3R27A

Crystal structure of the first rrm domain of heterogeneous nuclear ribonucleoprotein l (hnrnp l)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
b'KTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heterogeneous nuclear ribonucleoprotein L
publication title Crystal structure of the first RRM domain of heterogeneous nuclear ribonucleoprotein L (HnRNP L)
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 19
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3r27A01
2EK6A 2FHOB 5ITHA 3VAHA 1UW4A 2D9PA 1UAWA 1U1OA 2RT3A 2L41A 2KM8C 1NO8A 3P49B 1WF0A 2ADBA 2DGWA 4QQBA 3V4MA 3VAJA 2OSQA 1R8PA 5DM6Q 2QEXS 1FJ7A 2CQ2A 2OJ3A 1OO0B 5LXYA 2CPEA 4F26A 2MZSA 1S79A 2HGNA 3ULHA 3MURP 2YH1A 1VQ5S 3I56S 2BOPA 1U6BA 3RW6A 3UE2A 1PO6A 1VQNS 3U1LA 2MQOA 2MQQA 3R1LA 5D78A 2RRAA 3D2WA 5D77A 2RS2A 1M90T 2E5IA 2D3OR 1U1KA 3G71S 3P6YC 1WI8A 5IFMA 2MYFA 3G9CA 3CC7S 5DM7Q 2HZCA 2CQDA 1ZH5A 3HI9A 1M5PC 2J0QD 2GHPA 3NMRA 4BS2A 2VOPA 2LMIA 1WEZA 2MGZA 2DB1A 1YITS 2RQ4A 3CD6S 1DZ5A 2I38A 2CJKA 2CPDA 2DNGA 5GMKa 3I55S 1HD0A 3U1MA 1VQMS 1ZZFA 3CCJS 5CYJA 3IRWP 4QU7A 4V19X 2LYVA 2DGUA 3G96A 2MKIA 1SJQA 2DNLA 2MZ1A 3SDEA 2VONA 2G1DA 3CCLS 2AD9A 2DNNA 3CMAS 2M9KA 3S6EA 2DGVA 2LEBA 4QPTA 1U1PA 1B7FA 2KHCA 4PR6A 3BO3A 1H6KX 1RK8A 2KI2A 2U2FA 2XB2D 2MMYA 2KFYA 2DITA 4TU8A 4FXWA 5DDRC 1W2BR 4QU6A 1WG5A 3EX7B 1VBXA 2CQIA 3SDEB 3CUNA 1YJWS 2MQLA 2YTCA 2CQPA 2DNOA 3LQVA 4ED5A 2LEAA 1P27B 2CPIA 2M70A 2DHGA 1O0PA 2CQGA 3MD3A 3VAGA 3G6ES 2DNHA 2M4MA 2UP1A 3MUVP 1VBYA 4OZ1A 2JVRA 1X4DA 2G0CA 4TU7A 1M5OC 3CCVS 4YOEA 1K9MT 2OSRA 3CMES 2MSSA 2KM8B 1U1LA 1F9FA 1DHMA 3SMZA 1WF1A 3CCMS 5BJRA 5MLCV 1WG4A 3TP2A 3S8SA 3EGNA 3Q2TC 1L3KA 1HL6A 3P3DA 2KYXA 3CPWR 1VC0A 1URNA 2M8DB 3NS6A 2RRBA 2NZ4A 1JJHA 1X4HA 5HL7Q 2VOOA 2E5GA 2MY8A 5GAGU 4WFAQ 1SJRA 3DLLQ 2N82B 1SXLA 2KU7A 1SJFA 1OWXA 4WKRA 2FC8A 5H1SV 1VQ7S 1WHVA 3B4DA 3S01A 3VALA 1WHYA 1BY9A 1JJ4A 3L3CA 2DHXA 1YHQS 1FJEB 2DNKA 4U67Q 2PEHA 1WHWA 2M2BA 2KG1A 4Z2XA 4WCEQ 4TLQA 1FXLA 1U2FA 2JVOA 3UCUP 3MOJB 2HVZA 2DHSA 4IOCQ 4TU9A 2MJUA 2LA6A 4F25A 3K0JA 4LJMA 2MKJA 2E44A 4UY8T 4LIRA 1DRZA 5IQQA 4C0OC 3J7YU 2DNQA 2DH9A 3VF0B 5EN1A 2MSTA 2LA4A 2DGOA 4LMZA 2XNQA 1ZZNA 2MZRA 2ZJRQ 2LXUA 1M5VC 5GAHU 1VQLS 3IWNC 1X0FA 5JVGQ 1WWHA 3TYTA 2B0GA 1D9AA 2Q79A 3R27A 2E5JA 3BO2A 2CQ4A 1UP1A 1FJCA 2MXYA 2LECA 2ZJPQ 1AUDA 2RQCA 5FJ4A 5IM0A 2PE8A 2J76E 2MGZB 2KXFA 3G4SS 3R1HA 2F3JA 2LQ5A 1WTBA 2YH0A 2F9JA 1WG1A 1S72S 1KQSR 4WFNQ 5CXTA 4Y0FA 4ZKAA 2J0SD 5LSLA 1YTYA 2QA4S 3NNCA 2D9OA 2CPJA 2FY1A 1SJ3P 2MKSA 1VC5A 3NS5A 2KH9A 3JB9k 2JWNA 1FNXH 1Q81T 2CPHA 1OIAA 4F02A 1DBDA 1KD1T 2HGLA 1YJNS 2N7CA 2ADCA 2DGTA 1A9NB 3N9UC 2CQCA 1RKJA 1Q7YT 1N88A 2MKHA 1PGZA 2K8GA 5HO4A 2RUGA 5LSOA 1X4FA 2JRSA 3US5A 4WF9Q 5DDQC 3BO4A 2CPZA 1UFWA 3SXLA 2DK2A 2MPUA 4W90B 2VODA 3J7ZT 2DH7A 2K3KA 2KRRA 4EGLA 2MZTA 1H2UX 4WIIA 2MKKA 1JMTA 1X5PA 2QFJA 4IUFA 3S7RA 1FHTA 2MQNA 3LPYA 1K73T 3MD1A 1Q82T 1YJ9S 1HA1A 4Y00A 1WHXA 4YB1P 3THPA 3CCES 2CPFA 2AYMA 2RU3A 3CXCR 5JVHQ 3VAKA 4CH1A 4RU2A 1QM9A 3UWTA 2DIVA 1WI6A 3VAMA 1VQPS 3PIPQ 1A7GE 1X4AA 2U1AA 3UCGA 1X4GA 4CQ1A 3VAFA 1P1TA 4W92B 1VQ6S 2JX2A 1KOHA 2DHAA 3OW2R 4J5OA 2O3DA 1U1RA 2DISA 2M0GB 1H2VZ 1HD1A 1U1MA 1VQ9S 1QVFR 2GO9A 1YWXA 2EVZA 3MDFA 2DH8A 3P5TL 1KC8T 3CC4S 3H2VE 1N8RT 2KRBA 4C7QA 2DNMA 2FC9A 3HHNB 1WF2A 3UCZP 3NNHA 2YKAA 2RVJA 2MHNA 4IO9Q 2MKCA 3Q2SC 3ZZZA 3THTA 4IOAQ 2DGXA 1VC6A 1VQKS 2KT5A 5LJ3Y 1G2EA 1SJ4P 1N52B 1NU4A 2SXLA 2J8AA 4CIOA 4FXVA 2MQMA 2MJNA 2ZJQQ 2CQHA 4PKDB 1WEYA 1M5KC 2BZ2A 2DGQA 2F9DA 2XS2A 5LJ5Y 2MY7A 1VBZA 3BS9A 3H2UB 2EK1A 3CF5Q 3PIOQ 1FT8A 1CVJA 2HYIB 1YI2S 3G8TA 1VQ4S 1K8AT 3G8SA 1U1QA 2WBRA 2M88A 4OZ0A 3UD3P 5GAEU 3CCRS 2XS5A 1X5OA 2OTJS 1X4CA 2LXIA 1N54B 1NJIT 1Q86T 1IQTA 1OPIA 1KOOA 2HGMA 3CTRA 2KXHA 4PRFA 4C4WA 1U1NA 2LCWA 2M8HA 3CC2S 1VQOS 3BEGB 2N3OA 3CCQS 4YUDA 3DXBA 2DNRA 3MUTP 4P6QA 2NLWA 2OTLS 2KN4A 2N3LA 2XSFA 3TO8A 1M1KT 2AYBA 2E5HA 2KVIA 2KXNB 5IM0B 1WEXA 2KG0A 3MUMP 2CQ3A 3NNAA 2DNPA 1D8ZA 2DIUA 1X5SA 2M7SA 1QVGR 1H2TZ 2CQ1A 2DNZA 2L08A 2MZQA 5DETA 2MQPA 1JJ2R 2AYEA 1U6FA 1XN9A 2RS8A 2M52A 2CPYA 3MI7X 3VAIA 4CH0S 4A8XA 2MZJA 1WELA 1X4BA 2V94A 3RW7A 2X1BA 2DGSA 4M5DB 2LKZA 2FPHX 3UD4P 3FEXB 2CQBA 4ERDA 5DDPC 3FEYB 5CA5A 2DO0A 5LXRA 2X1GA 1YIJS 5GVQA 2MB0B 2OIHA 2DNYA 1X4EA 2XNRA 3EGZA 2RNEA 2ERRA 2CPXA 5DDOC 2I2YA 2YWKA 2X1AA 4WFBQ 4UQTA 1FO1A 2DO4A 3ZZYA 2XS7A 5GADU 1VQ8S 1R8HA 3B4MA 2AYGA 2L9WA 3CCUS 2X1FA 2G4BA 1X5TA 3MXHP 3CCSS 3CULA 2A3JA 2CQ0A
chains in the Genus database with same CATH superfamily
3I4PA 4X64F 5DS7A 3PW5A 2A10A 1UAWA 2UUBJ 4WJBA 3ZC4A 1WF0A 4DL0C 2OSQA 4O3RA 1QE1B 3A8EA 3BYRA 1SJ1A 5L46A 3ZZOA 4DU7A 2MHEA 4V19J 3CJSA 1T9TA 3GPAA 3R1LA 5D78A 3BYPA 1SV5A 2YNGB 5J2QA 2IM1A 5IT0A 3PDNA 4Q2MA 3HLUA 2BE2B 4DOZA 2QL7B 2WB1D 1R8CA 1UVMA 1KWMA 4JI1F 5CD4A 3TJAA 3V6DA 2JC1A 2PMZD 2YNIA 3OSPA 2XYHB 5AE3A 2ZBCA 4IG0B 5F8MA 3DRRA 1VQSA 1IBLF 2YBVA 4EYHB 4I1TA 1UW9A 3RB6A 1TV6B 3EPIA 4ZVSB 4RW8A 2KYZA 1XIQA 3M6XA 1JIHA 4GC7A 3T1YJ 1FD8A 3MD3A 2VQEF 1WJ9A 1LWFB 1L5UA 3LAKA 3IAM9 2NXEA 4DMZA 3A3NB 2KM8B 2IJNA 4NLTA 3Q2TC 1SQEA 3DU5A 4DFJA 4I0WA 3GV8B 1TMMA 3VVTA 5HMZA 5EWEA 4WFAQ 3EZ5A 3R7NB 3FFIA 4C48A 4ZITA 4DSKA 4OZ2A 3PHEA 2CVIA 4FN5A 3TQ1A 4P7VA 5IWAJ 4LSLB 2JNJA 1TK5A 1RAJA 4HHUA 1IR1A 4B9MA 2LA6A 3UFCX 4P73A 3CO9A 4F3QA 4EEYA 4N56A 4KKOB 4LF5F 4P2FA 4L3NA 1VISA 3W7BA 2DH9A 1RISA 3QRRA 4J9RA 1BQNA 1LKZA 2B4OA 4R5PA 4HDGA 2GIFA 2ZOMA 4RO0A 1TELA 1UVNA 5HMXA 4EBCA 4LF6J 4PPDA 2GAGC 3Q8RB 5F8IA 4X4SA 3O2IA 1NPKA 4CT8A 4ZIVA 3N5FA 4B3RF 2LQ5A 1WTBA 4GKKF 4PWDB 5DG7A 5BR8F 3M8SA 2GQCA 2C3YA 1R0AA 1RTIA 1KD1T 1FK9B 1LK7A 2FVRA 3N6LA 3O5TB 1ZAVA 4G3IA 4WF9Q 1S6UA 5D4NA 3KDOA 2KZZA 4FYVB 3C46A 4Y3CA 5A2QY 1QLNA 1S77D 3BF4A 4ZIWA 4OLPA 1KLMB 4DV7F 2C22A 3K7RA 3ZNJ1 2DIVA 1VQPS 2B3TB 3N28A 4IR9A 3OL7A 2K2PA 1SC3B 2XMMA 5BYQA 2ZKUA 4FDFA 4J5OA 4ZP8A 1HW8A 5KG7A 2V8VA 3HCXA 1HWKA 1ROFA 3ZTSA 4U6PA 2BJEA 3O6QA 5A8RA 5KTQA 1RXOB 4URGA 4CLPA 3O8WA 1HMVB 4CP5A 2CQHA 1JNRB 2FLLA 5HROB 4DV2J 4MJKA 4I4BA 1U1QA 3NGKA 3LH2S 1ZETA 1TVRB 3EWGA 3GCXP 1WD6A 2EKNA 1XNQJ 2DHHA 4QYRA 4LF7J 5I3UB 1T05A 2W1BA 4F04B 1K0TA 2EFVA 1DLOB 4BBYA 4OYMA 1LFWA 2XGQA 2ZHAA 1KONA 1XTZA 1TTHB 2L08A 4IDKA 2MQPA 4NA1A 5F3ZA 3OLAA 2AYEA 2HW3A 5KFCA 2HNDA 2H5JB 3RW7A 5KFEA 1B70B 5A0YA 4M5DB 2XI3A 5LMNJ 2DCLA 2ZH6A 1S4EA 2PT0A 3PZPA 2QE5A 1FKOA 3W63A 4I2PA 3MR3A 3D1HA 3CJKA 3T5LA 4NMXA 5GADU 2CRLA 4TQSA 4ZLPA 2VHGA 4Q0BB 3ZZUA 2GCFA 3AHPA 2NS1B 5ITHA 2RH3A 4M5IA 2HNYA 4YMEA 2ZKTA 3ILJA 3RAMA 1RWPB 2YX1A 2K1RB 3VAJA 1R8PA 1EQ0A 1OYDA 3CD7A 3GFZA 3MMCA 3DI6B 2MZSA 2NYIA 2R8IA 1GMWD 1I51B 3S1TA 1D3WA 2J8SA 4LVOP 1NKEA 4JI8F 4R8UB 4EI2A 2VFVA 3IBFB 1FJGJ 3A1YG 2OPRB 4DR5J 3CD6S 3U1MA 1JLBB 4R25A 4UTGA 2XULA 4HT7A 1GXUA 1U09A 3N01A 4M1KA 4RUAA 2M9KA 2PA8D 1WC0A 1QY7A 2IRYA 3U1NA 1N32F 2YXLA 2NZCA 2V4JA 3HSDA 3ENVA 2CQIA 3M2RA 2HAFA 2ZM6J 2LEAA 2CPIA 2AEMA 3RRHA 1HBNB 3QZ7A 2XWYA 4DV4J 2GQQA 7FD1A 1J5OB 1Q4RA 2YWWA 1T03A 2ATLA 2BRLA 4TYBA 4WE1A 1HARA 1KQFB 2JEFA 4P72A 3R8YA 4OI2A 4IH7A 1QUVA 3RBDA 1H74A 1FJEB 4Y2AA 2DNKA 1WHWA 1Q7LB 2IJFA 4USWA 4UY85 1NSKL 3SSSA 2J7UA 2UXDJ 4UOHA 1VIXA 5E0OA 2FZCB 1UEUA 4KY3A 2J0XA 3RR7A 2FVPA 1KVKA 2MLYA 3R5CA 5KFMA 4ILLA 3DU6A 3HX9A 1X0FA 1TR0A 4CO5A 3BO2A 4DR1F 1FJCA 2DPJA 1UTAA 5KFGA 4DUYJ 3DM2B 1WG1A 2CXEA 2F8MA 1TAQA 3AQPA 5ETRA 3JTPA 2UU9J 3IFEA 2BJ3A 3EXCX 1S57A 2JWNA 1JLEB 1JLFA 2LDYA 4NZ0A 5LL6d 1YJNS 2ADCA 1VIOA 4JI5J 2Y1LB 3UI3A 4F36A 3GYXB 3J7ZT 1FEEA 2W7AA 3ZZTA 4HT5A 2BQ3A 2QRRA 1NPPA 3W2WA 1T95A 4DR7F 2B4PA 2AYMA 3GE9A 4J91A 3H4BA 1WI6A 1HWUA 4BWJA 1A7GE 4X4UA 3GJRB 5F9LA 1HKAA 3CSKA 1GEHA 2YKMA 1UWAA 2JX2A 3OW2R 2RILA 2M0GB 1WNEA 3SIPB 4O23A 1OY8A 3VCDA 2OEKA 5D0GA 4USVA 3UCZP 5K5MA 2VU5A 3THTA 2IYGA 4W4MA 3MHYA 1LNQA 1RAIB 5GAHI 3G6VA 3ILOA 3R5BA 3SYZA 2JJ4D 4ATNA 1ZM4A 3JSMA 1LW0B 3R7BB 2F4VJ 1CVJA 2OP5A 1K8AT 4NLPA 4H4OB 2WBRA 2M88A 5E3PA 4UZBA 3F56A 3CCRS 2B8QA 4NXNF 3AFGA 1OPIA 1HLWA 2KXHA 4ZVEA 2LEPA 3WQPA 5CYMA 5DJBA 2BXJA 4ENOA 5IC6B 1WC1A 3VWSA 1PILA 4DPTA 3G82B 5DETA 3MWBA 1MU2A 2BJ9A 4DV6J 2MZJA 3WZ0A 2PIIA 1RWUA 1CJKA 3MEGA 3PFOA 2CYYA 3VV2B 4LT6A 3ZXWA 1RT6B 5GMDA 2OIHA 2GIRA 4ZA1A 2I2YA 2JL9A 3BH7B 4YFUA 4P9SA 1G4CA 4BC9A 1A0OB 3VGUA 1FF2A 1R7IA 5F0UA 2O67A 4K2XA 4KSEB 3JQJA 3QT8A 1KVIA 2EK6A 1FFGB 2B5JA 4CNYA 2W01A 3M32B 3F0NA 1U1OA 5D8HB 3PW7A 1IKVB 1EJ7L 1N34F 4MK8A 5DM6Q 3PW4A 2CQ2A 2GHWA 3KHGA 1N33F 3DGVA 1S79A 1VQ5S 2B7CB 2NQPA 3J7AN 3ILIA 2RS2A 1M90T 2E5IA 5HBMA 4DDFA 1RACB 2V8DA 1RHRB 3P6YC 3R5DA 2HFZA 2XO6A 1FVSA 2CPDA 3NAIA 1NDCA 5J1NA 1BQMB 2DGUA 4U7CA 1U26A 1XMOF 2YWFA 2DNNA 4B3TF 3PV8A 4X64J 1N0VC 5AXMA 4OYAA 1S0OA 3MM9A 1WG5A 5C24A 2GMJA 2MQLA 2RQMA 4ED5A 1L3SA 4N5SA 4EO8A 4HYKA 5D0EA 3D1OA 1KHVA 2HAIA 2HFOA 1K9MT 4DR6F 5DLFA 4ZVOB 2HSEB 1EHWA 4M5JA 2HIQA 2LP4A 4F4YA 1XQIA 1RTZA 4G1IA 1L3KA 2DR6A 5DGAA 4XO0A 3D9BA 1VC0A 3NS6A 3AB4B 5KG6A 3HSGA 1S48A 5GAGU 3QQCD 2JOQA 3AA8A 2FYXA 5CHCB 4JI1J 3R5JB 5IT9Y 4C9DA 4USJC 2AZ1A 5A8KA 3KG0A 2YNHB 1W7WA 4DCJB 4EK2A 2DHSA 1HNVA 1CJVB 2MJUA 3MAAA 4F25A 1IBLJ 3FQLA 1RI7A 4ZJQA 1FRHA 4LIRA 1YZ7A 5KG2A 3RJMB 4XAKA 5K9FA 3M1VA 3KLIA 3KLHA 2V50A 4LMZA 2ZJRQ 2VQEJ 4N41A 1CQNA 4PUOA 2HBQB 2OGUA 2DEJA 2RDDA 4I56A 3UR3C 2BW7A 2YX7A 2ZH5A 4YDDB 1RDRA 2CJXB 1BQXA 4U8VA 5L9NA 3QT5A 5DG9A 3DGPB 1OMSA 4J9SA 4ZKAA 2UVUA 2AJFE 2HWHA 1UPMB 2LU1A 3ZNUA 2PO4A 4NLSA 2DR5A 3ZTOA 4KH1B 1Q81T 3UW1A 3DMJB 4F02A 4KRWA 2K06A 5DRKA 2KTQA 1KR4A 4ED8A 5AJ3F 3Q24A 4V1Ak 1YJVA 4LBIA 5J2MA 3MMBA 3I5AA 2RUGA 2XSJA 1RAFB 4LF5J 1ZA2B 4N77A 2DH7A 4Z7CA 3KXDA 4EGLA 4RU9A 4BWMA 3PRBA 5D4LA 3NS7B 4FS1A 2ZH7A 4Y00A 3OFFA 5D6GA 3C8YA 3Q23A 2EBEA 4NI2A 2QLBB 3I5BA 1S9EA 5J2NB 1TFWA 3OHAA 4B3RJ 1KOHA 2DISA 3C66A 1CULB 1B64A 2DH8A 4C8OA 4GKKJ 5J2PB 2D7SA 1HNZF 1EETA 2MKCA 3WDOA 5BR8J 4M5HA 5KOWA 2KT5A 2AP6A 3RAQA 1SJ4P 2HURA 3ETOA 3DLKA 2VKRA 1F5BA 4JP8A 2IC3B 3EE3A 4ZN1A 2J9DA 3ZTPA 3CJ5A 1WDTA 1LWEA 4ITSA 3DDKA 1RZMA 4IG3A 4NCGB 1YQHA 1VRUA 3OFHA 1RWVB 4MIWA 3HZGA 2APOA 2BVZA 3CGIA 4CO4A 4ANCA 1SUQB 4A48A 4C4WA 4DV7J 3HD1A 2M8HA 3CC2S 3D0GE 3SV3A 2KN4A 3ZO7A 3VR1A 4KO0A 3IGVA 2KXNB 4DX8H 1XR7A 3D5MA 4HI2A 1N6QA 4FYDA 2MKYA 1F9EB 1DTQB 1KKHA 3VAIA 2R8HA 3HFZB 1V5VA 2CJ9A 3AH6A 3Q22A 5H9FJ 4OHVA 4ZVHA 4ERDA 4MK9A 4X65F 4H54A 1D9DA 3AD7C 3K8VA 3GR0A 4WPAA 3H42A 2DO4A 4KH0B 2OPPB 2L9WA 2I5JB 2R2TA 4DV3F 2GAHC 3IWXA 2C2ZB 3W9IA 3OTDA 3PR5B 1SKUB 2AIRB 3TW0A 4L72B 4HTIA 1QUPA 5CABA 3TZYA 1KFDA 2YNGA 3C15B 1QAJA 3O1LA 1R3NA 1GNKA 4F26A 4TVAB 1T9YA 4F67A 4NCBA 1BGXT 3V81B 1TU0B 1S9GB 3G71S 5IFMA 1NDLA 2CQDA 1IKYB 5BXIA 1RTDA 3HI9A 2J0QD 4GO5X 4EU0A 5F8GA 2VOPA 4ED0A 2BJ8A 4DPUA 1IR2A 4NE9C 4LIWA 5A76A 3QJLA 1BWVA 5HLFA 3PNIA 3C14A 1Y3KA 1U1PA 2AU0A 1NKCA 1LWCB 4RW6A 2XB2D 2G1HA 2MMYA 3MFIA 2FJDB 4PXCA 3TEGA 2HMIB 4FBTA 2WW4A 3UVJB 2JFKA 1P27B 2VPWB 1JLCB 1O0PA 5J1EA 2ZDPA 5EX3A 3CMES 1RAHB 5MLCV 4JI8J 3S8SA 3AA9A 1HL6A 3PR4A 1X4HA 4IFYA 3OL9A 3R2CJ 1FERA 2PI5A 1FRXA 2OPQB 3AQOA 5FIIA 3S01A 1RHKB 3W2VA 2V0NA 3PCOB 2PEHA 4ILMA 1C1BA 4Z2XA 3AJDA 2QLWA 4LR7A 3NY0A 4IQXA 4IOCQ 4ECUA 4ECRA 4UF4A 3FEZA 4H4MB 2EFQA 6FD1A 4UUWA 3Q8VA 5EN1A 4XK8C 2D74B 2V69A 1EZZB 4IRKA 2RF2B 2GIQA 3Q89A 1AFJA 2GS8A 1XR5A 3TJ9A 1X8DA 4JOUA 3NBPA 4PQAA 1D9AA 4PEOA 4M94A 4CO1A 4ED7A 1QDUB 1DARA 4OI4A 3RBXA 3LUYA 2IDEA 2UUAF 1R6YA 1FK9A 3R1HA 2ZH1A 2F3JA 3DOKB 1S72S 1OSCA 3B8HA 1XMQF 3MCSA 3PKMA 5DZ6A 1A6LA 2UVWA 4MFBA 2Z30B 1R8BA 3LALA 1RTJA 3W65A 4WWSA 5K20B 1A9NB 3N9UC 1RT7B 5ETLA 2XGPA 1PGZA 3PW0A 1KLMA 2H48B 2C3UA 3OXLA 3GTYX 1X0PA 2VODA 2CKWA 1YRTA 4OJ3A 5CZXA 2VDIA 3OHBA 4LQ9A 2N4DA 2MQNA 4ZHRB 3M30B 2RU3A 3DOLA 1FRKA 3PM9A 1Q8BA 1X4AA 3MPUB 2WBMA 3CJ0A 4K8RA 5KAKA 2EVZA 5D3GA 4C7QA 4F0HA 4RBTA 5HATA 1EB0A 4RLEA 3PFEA 3BKTA 1NPRA 4L73A 3Q8UA 4CIOA 2VG6A 1K44A 5HN0A 5LJ5Y 3NOGA 1FE4A 5IV3A 4OZ0A 1U4BA 5GAEU 1S6PA 1KOOA 2P5VA 4DR7J 2IA6A 2LDIA 2PD1A 3CCQS 4IFVA 2X3DA 1NH7A 3HVWA 3OT9A 2BANB 2JEJA 1JK9B 2MDAA 1JKHB 1S1VA 2J6TA 4OYIA 3BDEA 1QVGR 1NZAA 1W25A 4PPZA 1PAEX 2G2YA 4ER8A 1TKTB 4CH0S 1FDNA 3W64A 1JLQB 3BDPA 5EX0A 2KFZA 1GFWB 5IQ6A 2JHEA 2DO0A 2OLWA 3R9LA 3C16A 2KHDA 3ENQA 3HZEA 4ETXA 4WFBQ 3W5YA 5KFLA 1NLKL 3C19A 4RJVA 4B3SF 3LAMA 3CCUS 1HBOB 3RTVA 4NXNJ 2C28A 1C1CA 2OPSB 3GB0A 1X7VA 3L95X 4ZVRB 4ID5B 3NGRA 1N5YA 2IAJA 4NA3A 3PYGA 2YKNB 1NO8A 3D4JA 3P49B 2UXBF 2EI5A 3V4MA 4R8UA 2V8HA 2RE1A 4D3HA 2UV8G 2BA9A 2CPEA 1VCTA 3M6WA 2L48A 1WTFA 3IRXB 3Q0AA 3D6HB 2D3OR 4YB7A 2GVZB 2PA3A 1ACMB 2PMWA 1VK3A 1WEZA 3MM5A 5GMKa 4WFYA 1B0TA 3KK2A 4MMOA 2YKOA 3MECA 2YNFA 4B17A 2DNLA 3M2UB 2HK2A 3CCLS 2W2NP 1REVB 1Z2ZA 1H6KX 3NCQA 4ECQA 4RNHA 1WOOA 2W9BA 1KBRA 2DITA 5DDRC 3K5OA 2DR8A 2C3MA 4DZDA 1RHJB 2EBGA 1N34J 3D66A 2FIUA 2E5LF 1S59A 1GH8A 5LMUF 4DG1A 1N33J 2X3GA 1YRXA 3ISZA 1AZSB 1NEEA 5CYQB 1XC9A 1M5OC 5C25B 4AUKA 4YR0A 2GW8A 2MSSA 1ZAWA 1Y0HA 3FCWA 4ZP6A 4GVBB 4WXOA 1P8GA 3KNGA 3TA1A 6FDRA 2KKHA 5H1SV 5B09A 2LQBA 4LFCF 3GJSB 4OYOA 1D9FA 3C6UA 4HACB 2M2BA 1XMOJ 4WCEQ 2IVFB 4B3TJ 5G0RA 4B02A 2CIMA 2GO8A 2AGPA 2H3EB 4HVZA 2XCAA 1V3SA 3GV5B 1T7PA 4PQUA 1FWKA 5L1KA 5E2QA 4E2FB 1GQEA 3BH6B 3Q86A 2RDJA 3K59A 1MWQA 4CLKA 1ZA1B 1XK8A 1OY6A 1OPZA 2VASA 3OFGA 4DR6J 4NZ7A 1KN6A 3L7PA 4CNZA 3R27A 5C42A 3MEDB 1HYSB 1EX8A 5FDLB 1KQSR 2WW8A 2Q3PA 4DL3A 1CC7A 1E6VA 2J0SD 2XI2A 1YTYA 4ZPVR 1M1GA 2Y3YA 2XLIA 2FHKA 4CM2A 5E41A 4BCAA 4LSNB 2DGTA 1NK5A 1BD6A 2H9ZA 1S12A 4FBUA 2N7YA 4DR2F 2F63A 3GV7B 2JRSA 3US5A 5K14A 2UVRA 3U27A 5K8PA 1H38A 2DK2A 1UEKA 2C2RA 2FLPA 3BQ0A 2BKNA 3R6LB 4MKYA 1FHTA 4DXLA 1YJ9S 5K8NA 4NA2A 2QFIA 2DRAA 1IKXB 3CCTA 2V2VA 3M8QB 2WCXA 4C8MA 4HHHA 1X4GA 2XMKA 2QC3A 2NXNA 3SZ2A 4OI6A 5B0GA 4WBFA 5KG1A 4YB6A 1H2VZ 1U0HB 1QVFR 3CMQA 1KC8T 1GK8A 1LQ9A 5L1LA 3HHNB 3J81U 2QGFB 1FFWB 3RU0A 1RT1B 1VQKS 4B3OB 1NU4A 4ETZA 3MCNA 2KJVA 3N4WA 3FDSA 2NPFA 2NREA 5L38A 1H3DA 1UPPA 3UDVA 4QR0A 4G1QB 3MM6B 3JQKA 1IWGA 3M05A 3N79A 3OTEA 1P9YA 1GXLA 2RUSA 4PRFA 3MCMA 3PJWA 4C3MA 3WC0A 3X3UA 1J5EJ 3OD2A 4DX5A 4YUDA 2NLWA 1RCXB 2N3LA 5KFYA 2X51A 3W61A 4QWAA 4NEZA 3F41A 2ZH8A 2DNPA 3CDWA 5DQGA 1D8ZA 4J9KA 2DIUA 2DNZA 2JDJA 3OL6A 3D68A 1V9OA 1HNZJ 2C2DA 4DS5A 5IV4A 1B0PA 2FPHX 4NLWA 5H9EK 2AJQA 4AE5A 5LXRA 1RCOB 4RW9B 3LP0B 2ERRA 1MLAA 1VK8A 2MEWA 2YWKA 2NR0A 2FHJD 1FO1A 2AJ2A 3NKYA 4FYWB 1VLYA 4LF8F 2NXJA 4KGKA 3BV8A 2BDPA 2PN6A 3J80U 3CULA 1F5AA 1S1UB 1TL3A 1CS4B 2XY7A 3IS9B 3PEHA 1VLOA 2RHQB 5HP1A 3OPKA 4AYBD 2Y1IA 1F9HA 2GMLA 3KLFB 1OO0B 2FD2A 2YQ3A 4I6AA 5I4MA 1RSCA 1GMUA 2J7WA 4WYLA 3FSIA 3M8PB 4P52A 4MK7A 4E0DA 1C0TA 1C4AA 2RRAA 5D77A 1WC6A 1BQMA 3HHEA 3UDEA 1CJUA 2Z2ZA 3FBCA 1SI9A 3DLEA 2DB1A 1DZ5A 4X65J 2XEXA 1HNXF 2H4WB 1IM4A 1NBEB 2AMCB 5KFIA 2MKIA 3PKYA 3PJXA 2WRMA 4DL2A 1RP5A 4DV3J 2L3MA 3ONQA 2KHCA 3DCAA 3SCKE 1L3UA 3BGRA 3ZZRA 2LFVA 1UFKA 2W2OP 4LSZB 4TU8A 4OI0A 4Q8FA 2D69A 4FXWA 5KFHA 1DTTB 1RB0A 2BR0A 2VJVA 2NYHA 3SDEB 1R27B 3CUNA 3K57A 4HEA9 4LQ3A 3LWMA 4RWWA 4USMA 3UNYA 3DOMA 3RYLA 1KTVA 5KFFA 3G6ES 2M4MA 2HHPA 4NLQA 3CCVS 4O4GB 3IBWA 2EG1A 5I3PA 1U47A 4A46A 2PI4A 5L9XA 4ZVUB 4MAKA 2BOAA 1Y4ZB 3TUIC 1URNA 2ZE2A 4ZJLA 5I3QA 4DX7A 3DLLQ 1WHVA 1CJTA 1S10A 1JJ4A 1YHQS 1SCJB 2GHVC 4Y28C 2J9EA 3QNWB 1VS3A 3K89A 3JAMY 3MPDA 3K0JA 4LJMA 2ASLA 1F1BB 1AUSL 5HVFA 1YG0A 4AXIA 1NK8A 1KFSA 3JQMA 5EUHA 1M0SA 3G8QA 4YP3A 4PXBA 4KAIA 2Q79A 1IN0A 3RB4A 1HI0P 2RB7A 2AT1B 2CZ4A 4OI3A 5DQHA 1VRTA 2RQCA 2PE8A 2W8LA 4P75A 4UZCA 1DFDA 1LFPA 2OFGX 2K3IA 4Y0FA 3W9JA 2CUYA 3QLHB 1B0VA 1FNXH 2XYPB 2R8KA 4DQSA 1Y10A 2E7WA 4K4UA 2DCUB 3NP5A 2QJ3A 2VFTA 2JLGA 2R4FA 4A8WA 1LEOA 3HHLA 3CIMA 4IUFA 5ETVA 2F40A 1S6QA 3CCES 2VICA 3EZUA 1YK9A 4U7UK 3W9HA 1RT5B 5RUBA 5T7LA 4Y65A 3RBEA 1HWJA 4C8NA 2UUAJ 1IKWB 2HPUA 1RT2A 1XMQJ 4IO9Q 3M2VB 3ZZZA 4F4ZA 4RUBA 3MR2A 2E9RX 1YX2A 1FESA 5D15A 3SCIE 3HHLC 2DRDA 3LF0A 3KG1A 3DRXA 2HIYA 3IC1A 1PJ6A 3DLGA 3TAMA 2QYCA 5HMWA 1M5KC 4I2QB 4ANEA 3BB5A 5KT4A 3CT9A 1EP4B 4X4TA 2EFNA 4A8YA 2OKQA 2Z2LA 1V6HA 3KOAA 5A2QU 4QWEA 2GJIA 3HKZD 3TOQA 2BMBA 3MM8A 3D0HE 3HKWA 4FPIA 5HQ8A 4Q43A 1S99A 1WEXA 4XDDA 3KUHA 2Q6BA 3DRSA 3OJSA 2RIJA 4JV1A 3GIMA 4NASA 4FVCA 5C5JA 4KPYA 2CPYA 1Z4UA 3BPDA 2V94A 2HS3A 3H20A 1F60B 1JB0C 4ZCIA 4DV0F 3FEYB 3JTNA 3K5MA 1HQUB 1YIJS 3UDLA 1TKZA 2AWZA 1GX5A 2FHMA 4JV0A 4X62F 2D3UA 1CC8A 4X4PA 3QRQA 5E3CA 4O4RA 3WIUA 2VKZG 1GMVA 2P6SA 4NLYA 1T3OA 2KDOA 2CA9A 4LRBA 2VC1A 2FHOB 2V63A 3BGLA 4KGVB 3JTOA 2H1YA 3DLBA 5DO2A 4QQBA 4DZ6A 3HFKA 4ZPBA 5ETKA 2HK3A 4FF1A 3NGTA 3ZFVA 4YDXA 3PX6A 1TQLA 1MSWD 2HGNA 3PXGa 2L9DA 3RW6A 2KVQE 1NSPA 4UOCA 1T0TV 4QOTA 3KFWX 4DV1F 3C2PA 3IG1B 3G9CA 3HF5A 5DM7Q 1IVZA 3UN5A 1FKPB 1ZOTA 2E9TA 2MGZA 5AT1B 3EUNA 2ZH2A 1I5OB 4DJBA 1SJQA 4B3SJ 1RWMB 4FNHA 1TL7A 4PR6A 2KT2A 4L75A 2BJDA 2HNZA 1BXNA 2C2OB 2UXBJ 1KEKA 3WX4A 4ED6A 5KFDA 1NH8A 2JC0A 3FCHA 2VG5A 2CQGA 2Q66A 1MROB 4HHJA 2UP1A 9RUBA 4CRJA 1X4DA 2G0CA 3DRPB 1RLDA 2ACYA 3TX8A 1R8AA 2WTFA 1DHMA 1FE0A 2BACA 3DNCA 3CCMS 3OXGA 3EGNA 4PXDA 2VUGA 4ED2A 2FVQA 1T11A 4CZCA 4AQYJ 5B0BA 1SXLA 1RU2A 2KU7A 2B9WA 1YGYA 1RHUB 1YBAA 2WOMB 1NUEA 1SB6A 4U67Q 3OR2B 4LF4F 3ICLA 2HHSA 2W2MP 1U2FA 2FZKB 3PO5A 1CSJA 1I6JA 5L1IA 3LP1A 4DN9A 3PYEA 3CNQP 4A8OA 4NLRA 5IQQA 2ZUGA 3M4XA 5HQMA 2PC6A 2E5LJ 4EYIB 4IO1A 1Q16B 5LMUJ 2XNQA 1PCAA 1S97A 3W8PA 3HJFA 4RBUA 1SV5B 4F8RA 2FLOA 4X4VA 2LECA 1Q8KA 2A6MA 3W5XA 2PEBA 2DYAA 4CM0A 5IM0A 2XLKA 3KDNA 4DSEA 2KXFA 3FCVA 4RW4B 2AGQA 2CPJA 4F7VA 4LFCJ 3V6DB 4PXEA 4ELTA 4NLVA 2YNIB 1N48A 3ET6B 1UJ6A 2P2CB 3H8YA 1H72C 1ZS6A 1SIWB 2CQCA 3H7HB 1GTEA 1GT8A 3DRRB 4ZP7A 7FDRA 2MPUA 1FVQA 5KFOA 3W62A 4RW8B 3B6BA 2MKKA 4QR2A 1JMTA 1UVKA 1V3RA 1WC5A 3HVTA 2HVDA 3LPYA 2QIFA 1HA1A 2W24A 2HHWA 1C4CA 1QAIA 2Z56B 3DLHA 3PIPQ 3G2XA 4F0KA 3G86A 1LV5A 2ASYA 1B99A 2FTRA 3GP9A 4LF9F 4GC6A 2CVEA 4ES2A 1UVIA 5KFAA 4IOAQ 2IVMA 1YJ7A 1N5QA 2SXLA 4Y2KA 1WKLA 2B9YA 5KFKA 2BZ2A 3MM7A 4OHZA 5T14A 4DR2J 4ANDA 3CF5Q 1FX4A 4PCQA 1VQ4S 3CJ8A 2UUTA 2R7RA 4OYBA 2BANA 1BQNB 4OX8A 1JQGA 1L3TA 5H9FK 3P45B 5HJXA 1ZYQA 2WB4A 4J37A 2AYBA 1KQGB 3MFHA 1IR0A 1EKRA 4OJ1A 4URQU 5KT2A 3GFHA 1RT4A 4B9UA 3AOCA 4IRCA 1PYSB 1G6BA 2OEMA 3NLCA 1R0AB 1ZM9A 5LOQA 1RTIB 2BKPA 3TWZA 1S1XA 4J90A 4RX6A 2HVIA 2DXDA 2ZWOA 3AOAA 2QA2A 1MMDA 5GVQA 5CCMA 1X4EA 2LLZA 3EGZA 3T5JA 4URSA 2C1EB 2X1AA 3BSAA 3W66A 4KV8A 3A8IA 2V8GA 1S7IA 1RYRA 1VBKA 1RHMB 3NCRA 4CT9A 3C6TA 3E8OA 1S76D 4HI1A 4DUZF 1DURA 5A8RB 2MQOA 2AQ4A 4OHWA 3BR8A 2EXUA 4RUHA 4XIUA 3QPIA 4JI3J 1NNDA 2Z2MA 3DYAA 1M5PC 4TY9A 3LGHA 2CG4A 2OUGA 2RQ4A 4M95A 1U0SA 3OR1A 4FYYB 3M6UA 1VQMS 3IRWP 5E3AA 3G96A 2ROEA 4ES1A 4LF8J 2A2DA 2MZ1A 3CEDA 2AD9A 5SZTA 3CMAS 4ZJOA 3JSYA 3MTJA 2DRBA 1RWKB 4I64A 3BO3A 2AW0A 1RA7A 2U2FA 5CYQA 4FF4A 1T05B 1TL4A 1C0UA 2CZVC 4U95A 1KNZA 1SC1B 2R7TA 1KS2A 3LQVA 2D41A 2G9OA 4F4XA 4IDKB 3MUVP 2HNDB 3TX0A 4NPOA 3TQEA 4J9PA 4DLGA 3VVUA 3SMZA 1ULRA 2ALYB 2HLTA 1Z1ZA 1N5TA 3CDUA 3R97A 3H5XA 4M5MA 2VA2A 3QZ8A 2M8DB 1QAXA 2O01C 4FKYA 2MY8A 5KOXA 1FKOB 1G3OA 3HHKA 1DQAA 4I2PB 1HNXJ 2YWHA 2CNNB 3CJKB 4O44B 4C8LA 4X66F 2DHXA 3IN5A 1RAAB 1SIZA 2KB2A 3CDEA 3TEHB 4ALZA 2JVOA 3UCUP 1PBUA 4M8LA 2HNYB 4PG5A 2HHHF 5KFTA 1SKRA 5A8WA 1AW0A 3MMCB 2ZVSA 1IBCB 4OZ3A 1QSLA 1SQFA 3RBZA 2YKPA 4DX6A 3IWNC 2WZ1A 2GVDA 4MKVA 4QR1A 3TYTA 1CLFA 1PG5B 2XMAA 3M8RA 3W8GA 3L7UA 1IXKA 4HH0A 4M5NA 2M5YA 2I0XA 2FY8A 5LSLA 2HRYA 4WP9A 3NS5A 3TVKA 3BR9A 2GJ2A 5C2GA 2F65A 2EFPA 1N88A 2MKHA 3J7Z5 3SBMA 5IT9U 1KVJA 2OHDA 2R3VA 2V4JB 3SXLA 1HBUA 2J6UA 3M2RB 3M8QA 3I4HX 2KZMA 5EHHA 2B9EA 4WIIA 4DLEA 1HPZA 2QFJA 2FVSA 5CAAA 4ZOSA 3B54A 3AD8C 2ATCB 1Q82T 1WHXA 2XBPA 1SKWA 1B7YB 2ZVIA 4RW7A 3IO1A 4Y34A 3FMWA 4JI2F 4CQ1A 3VAFA 1WACA 1T03B 4I7FA 4X4QA 4A8QA 1U1RA 2C42A 4WE1B 2BV3A 3AJ2A 2GO9A 3BSOA 2V4QA 4JI0F 5F8LA 2Q1LA 5H9EJ 1MMLA 2Y1JA 5LJ3Y 4Y2IA 2ZFHA 3RUBL 1SC6A 4DF4A 1JXEA 5FD1A 1ZPWX 1Q5YA 5F8JA 1VR6A 3C3LA 4EBEA 3MMAA 4CLUA 4RR5A 2WSEC 1AT1B 5BYRA 2A18A 2QN6B 2LXIA 1REGX 4TN2A 4WKYA 1Q53A 3CTRA 1RU1A 5JUMA 1HWLA 3BEGB 1OSDA 4FS2A 1HHQA 3V6HA 3HK2A 3V4IA 4C3LA 1RAOA 5EGYA 1PYTA 2KO1A 4DR4F 3IR6B 1X5SA 2CQ1A 2MZQA 1KTQA 4LFBF 2HQGA 4F4KA 1V5IB 4CWBA 1S0MA 1WUUA 1WELA 2ZEJA 1VDHA 1JLFB 1FTCA 3GILA 3UD4P 4DQPA 3I32A 5A6PA 5DDPC 4CLSA 2V2KA 4CCHA 1RTHA 4UOFA 5C2CA 3TVYA 1TL1A 1TKXA 4UQTA 2CFXA 2JEGA 1APSA 1KDNA 1VQ8S 4YN3B 1E6YA 2AYGA 4AD6A 5CH7B 3RGIA 4C8KA 3W2WB 1DJ0A 4LRCA 4KTQA 2E7XA 3VAHA 1M5HA 1FXDA 2P9GA 1K1QA 2G0IA 2L41A 2DGWA 3Q8SB 3CJRA 2IMWP 2QEXS 2YKMB 2Z0GA 3SCJE 4CTAA 2AHOB 3TA2A 1S4FA 5T41A 1VQNS 2XO7A 4OZLA 4YS2A 4N8NA 2OD4A 1U1KA 4CH7A 5KT3A 3KLGA 4O0NA 1H0HB 4LRFA 3OUYA 4DV0J 2IRUA 3JSBA 1HQ2A 2ZOFA 3HT3A 1S0VA 4C8ZA 4USKA 3SDEA 2VONA 4USIA 2H5IB 4K50A 5KFWA 3JYTA 3P4UB 2A1BA 4QWCA 4EBDA 3Q8YA 3T3FA 2YPZA 1JLGA 1UWBA 2DTJA 3IA0A 4D3GA 5CYMB 4MT1A 4F0MA 3OV7A 2XG8A 1ICEB 1S1TA 4B9TA 1YJWS 3FJ2A 3DHWC 4RPFA 1MU2B 3BQ1A 4YOEA 3QIPA 1CJKB 1WF1A 3OJUA 1WG4A 3MEGB 2P9EA 3SV4A 4DV1J 3KK3A 4KHPF 3OBIA 2VOOA 2N82B 4NLXA 1NK9A 2ZNZA 3BQ2A 1RT3B 3EVMA 4P10A 2A6OA 4O3SA 1F3VA 3H4DA 1JLAA 3QJPA 2B6AA 1FWLA 2VPYB 2B5JB 1YBUA 2CNLB 5F8HA 3D7SB 3RAXA 4G65A 4C0OC 3GMGA 3I96A 2HQCA 3A13A 2MSTA 2V6AA 2V2ZA 2XLJA 4K2JA 2V5HG 2WONA 3FRZA 2HVHA 1M5VC 1YBTA 2VIHA 3B82A 1FI4A 4JYAF 1TFYA 1HI1A 4LRDA 4TQRA 5HBMB 2E5JA 4EO6A 2XMWA 5CCLA 4Y2CA 1PC4A 2B9XA 5FJ4A 1MW7A 3G4SS 2W8KA 6AT1B 2F9JA 3NNCA 3ISNC 3KK1A 2EC2A 4KB7A 3EPGA 3GONA 4YY3F 1UZHA 3PJ9A 1O6XA 3O44A 2WSCC 2B56A 4OI1A 2HGLA 1AFIA 3H2LA 8ATCB 5I42A 1HQEA 4E98A 2RD5C 3LPEA 2LVWA 4A4JA 3MM9B 3DRYA 5C24B 3SQGA 4ZCKA 3FC9A 4I67A 2OI2A 2VBXA 1X5PA 4U96A 1ELOA 1GAOA 4DUYF 2YWGA 4C11A 1IKWA 3IR5B 2WVEA 2DR7A 1QM9A 4X4NA 4A8MP 3LTOA 1NHVA 1AYEA 3BBBA 1WKKA 5L1JA 3QRPA 3H2VE 4LBHA 4CLWA 3QSIA 5JJBA 2QYGA 2YQ1A 2VDHA 1YLXA 3E01A 5A8KB 1EP4A 3MEEA 4O3NA 3CB4A 2MQMA 1LW2A 2R7SA 1WEYA 4X4RA 4ZDNA 3MAAB 2XMVA 2XS2A 4K7QA 2O5DA 3H2UB 2C2NA 3G8TA 3G8SA 4J9VA 3M1VB 3KLIB 4DI6A 3KLHB 3BSCA 2XS5A 1Q0NA 1N54B 2RRNA 1FDBA 4PUOB 4YQWA 1VQOS 4JV5J 4P6QA 4WU2A 1H7XA 2KL8A 3LP2A 2XSFA 3V2UC 4GRSA 4FPRA 1UMJA 2KVIA 4QJVA 2HHXA 3HJVA 1H2TZ 3GU0A 1HQUA 3BGUA 4LF9J 2VFUA 3ADAC 3GSIA 4ES3A 4A8XA 4ICLA 5LSRA 2DGSA 1YKWA 4N47A 1IBKF 5KT7A 4TY8A 4KJIA 4G1PA 5J2MB 1H7WA 2X1GA 3A3OB 3MMBB 1OS5A 5DDOC 2XSJB 2GJFA 5G4DA 3GJQB 3OVSA 1R43A 3TJ8A 2HRUA 2QA4G 2VJUA 4ZS6A 1YJRA 2QLFB 3LANA 1K1SA 4NI2B 3VGVA 1S9EB 3GYNA 1PSDA 1XWLA 3EMTA 1OYEA 4K4SA 2Y9HA 2ZD1A 4F2SA 5AE1A 5B0EA 1YJTA 2H4YB 1U6BA 2VL1A 4Z7YA 1MN9A 1EETB 2MQQA 2GGPA 1WI8A 3DLKB 2HHUA 3GZ7A 2EW9A 2JLEA 1LWEB 3T1HF 2I8EA 4IG3B 4NXMF 1HD0A 1C2PA 4OQJA 4QU7A 4V19X 2DJWA 3M6VA 1VRUB 2VG7A 3I0SA 2RKIA 4L6V3 3DLJA 3TRGA 1IJEB 4N76A 4F3OA 3FBBA 4ECXA 2CG8A 2IFXA 4K4WA 4QU6A 1VBXA 4FF2A 5IZHA 4KO0B 1RADB 2LXFA 4QIWD 4HLBA 5B0FA 1QSYA 1Y00A 2XY5A 1N6QB 2GA7A 2AF6A 4OX9F 3VAGA 1NJWA 4DUZJ 3SI8A 1HWIA 3O3LA 2W4DA 3SFUA 4USUA 1RGVA 3TAQA 4KHRA 2EC0A 4PYAA 2DT9A 4DPXA 4MH8A 2RRBA 4EMDA 1NDKA 2FC8A 1RA6A 1VQ7S 2CJAA 1HNIA 3VALA 5DLGA 3I0RB 4ZVTB 3N6MA 4KHMA 4Q5VA 5C7PA 2R8GA 5THWA 5HK4A 4OYZA 2IA0A 3PACA 1K47A 2HHTA 2VH7A 4ZVQB 2HVEA 4X84A 2NSCA 3ELHA 3FBEA 4ZPWR 4BLGA 2FJXA 3W3SA 3NGUA 3W1YC 5JVGQ 3KTQA 4RW4A 1WWHA 2R2SA 1TUWA 3NEKA 2B0GA 3KJVA 1HFEL 4IRDA 2ZJPQ 1I94F 1TL5A 1RTDB 5F9NA 1YJUA 2ZBRA 2V9WA 4NOHA 3ET6A 1X9SA 1JXVA 2W9CA 5KFZA 4JB8B 1M1HA 1TAUA 5B7WA 4K0KF 2WAQD 4KFBA 2FY1A 3SEOA 4MYUA 4X66J 1N5SA 5HLFB 3R5AA 4WK1A 2XMUA 3C14B 2G0JA 3KLEB 1Q7YT 3LA0A 4RW6B 1ZM3A 1HNWF 4A8SA 2HHHJ 1CG2A 2K3KA 3FZ2A 1JJCB 3EGWB 4MKBA 5J1EB 1K0VA 1Q78A 5KFBA 2OFHX 3ITHA 7AT1B 5IT4A 3I6PA 4UT4A 2CPFA 3FVYA 5KG0A 5FLXY 4LFAF 2IM0A 4FP9A 1Q8LA 1SH2A 1F0XA 2E1RA 5M2UA 1QE1A 3MEKA 2KT3A 2ROGA 2ZBPA 4RKUC 4M5GA 4IFYB 1U1MA 2HG4A 4HKQA 3UN2A 2RVJA 4HTJA 4ECYA 1NSQA 3W2VB 4A8FA 1VC6A 1C1BB 2JFDA 3VQTA 3EVOA 3GFXA 2ZC3A 2R7XA 2BE2A 2EEYA 1U6ZA 3BS9A 4K4YA 4NRUA 3M8ZA 2HYIB 4O3OA 2FJAB 1R6VA 1S0NA 3QATA 3ETMA 4UOGA 2IMOA 3G87A 4IG0A 5SUHA 4GKJF 4ZLNA 3NBPB 2JSXA 4QIEA 3MUTP 4JI2J 1TV6A 3TO8A 1M1KT 2XC9A 4FZVA 3ISND 3CIZA 1LWFA 2HLUA 4JI0J 2B8PA 1RWWB 2OEJA 4X4OA 1SL2A 3NAHA 4YHHF 4MFBB 1RTJB 3DKDA 2CQBA 5ETNA 3W5ZA 3BKFA 2R7OA 4ED4A 5GADI 2VZ9A 1T9WA 4TXSA 1DQ9A 4AFFA 2BRKA 3R7SB 4KC5A 3MGJA 4NX9A 3GR1A 2NUUG 4QZVB 3TR5A 3T6JA 1R8HA 2E9ZA 2G13A 4DCPB 2G4BA 4LSLA 2DKOB 3MXHP 4ZPTR 3CCSS 1BC6A 2E29A 2HFNA 3BBFA 3DOLB 5A6WA 2D9PA 2BQUA 1ZAXA 5CQGA 4OMFG 2KM8C 4KKOA 1D09B 2CDQA 2ADBA 3MZIA 1FJ7A 1BUXA 4YB5A 1RKIA 1NK6A 4DR4J 4LFBJ 5D3GB 4OX6A 4PG6A 4WTYA 5KT5A 1T8EA 1N32J 3HHDA 5L8RC 5DG8A 2XMTA 2MYFA 3T5KA 2VG6B 1ZH5A 3NL0A 4HR2A 2HBRB 2LMIA 3K5PA 4OYPA 3EVWA 2KFNA 4PWDA 3DHXA 3H5YA 5CYJA 3EDRB 3FRYA 4DN0A 1EAYC 2CJBA 3I9V9 1TK8A 2IBKA 4OZ5A 5IS2A 3OVAA 1S6PB 2I9SA 3MOZA 1W26A 3PRVA 1RK8A 4F3MA 1UA1A 2KFYA 1FX2A 4IFVB 1U2RA 3RRKA 3MPWA 2YTCA 4DS4A 1SH0A 1S1VB 2VFRA 1U8WA 2DHGA 3PTWA 2JVRA 2BW2A 1FKAF 1EQMA 4O44A 3NWGA 2IRXA 4OZNA 3KJNB 1X9WA 2YWEA 3H59A 3C16B 1VFJA 4KGZB 2AJ1A 2H65B 4W98A 4AL5A 2J6SA 5KFQA 3B4DA 4BDPA 5KFVA 3BN7A 1ZPVA 3HDSA 4DR1J 3PX4A 4ZPCA 3TARA 1C1CB 3AY0A 3LO3A 2XCPA 1HMVA 3P5BP 4NYPA 2DXFA 4TU9A 1N5YB 3OXFA 1VI7A 2IAJB 2WVFA 5HROA 4WYWA 1UKUA 2LQ8A 3V5RA 3R2DJ 3M7VA 5CD4H 3VHQA 3VF0B 1TVRA 4CLFA 2EFGA 3IM8A 1GX6A 1ZZNA 5HJYA 3BBCA 2BM1A 5AXNA 5I3UA 1SKSA 4DSIA 1Z2LA 1DLOA 3L7OA 3PW2A 4LF1A 4KHPJ 2J76E 2MLXA 2COLA 3MM5B 2UVVA 1WSRA 3KK2B 4IR1A 3MECB 2YNFB 1VC5A 3HO1A 2A2CA 2FUG9 4ZVGA 4M5DA 2CPHA 3A8JA 4RUCA 4B3MF 3H5UA 1VRQC 2K8GA 5HO4A 2W9BB 5DDQC 4CO0A 1M5SA 2KRRA 4RBVA 3JAMU 1OY9A 4B9NA 4Q0BA 4DG1B 1K73T 5DZ7A 3CXCR 5JVHQ 2B4VA 1O8BA 3ZTRA 4JYAJ 2B43A 3LW5C 2ZZMA 4USTA 5F8NA 4ECSA 2K1RA 4W92B 2YKQA 3QWUA 1XERA 5JMNA 1LXNA 3MDFA 2W7OA 3DI6A 2KRBA 3QAUA 4IQMA 2MHNA 3IAS9 4DQIA 2DGXA 3AXKA 3C6UB 3D3BJ 4YY3J 2O66A 3CD5A 1G2EA 2AJ4A 2MJNA 2BE7D 5G0RB 2OPRA 2ZUAA 4PKDB 2DGQA 2J9DE 2H51B 3J81j 3H98A 1JLBA 4PQUB 1TUVA 1NHUA 4PWUA 1NB7A 1N4LA 1HW9A 1KHWA 3CJ4A 2WVDA 2OTJS 1FA0A 2R7WA 3JS9A 2VB6A 4H4KA 4AT1B 4AXJA 5C42B 2DPIA 3KLVA 2W4PA 4CYUB 3H0PA 2KG0A 2CQ3A 4BC7A 2M7SA 2QA1A 2VQFF 1E6VB 1RWNB 3NCPA 1HBNA 1FWPA 3BZQA 4O3QA 1NM2A 1UCNA 1J5OA 3T19A 2LKZA 2XYGB 2CJYB 4Z37A 3OLBA 2VF3A 4H4KC 5K14B 3X1LB 1RWXB 3D6MB 2A3JA 3RG6A 3HM9A 4JI6F 3GYGA 1UW4A 2DY9A 3I31A 1NK0A 4EWTA 2VPZB 2UUCF 4ZLJA 4P2XA 3K8WA 2EG2A 4QWBA 1P1LA 2HWTA 3ENWA 3MURP 1PC5A 2HHQA 3UE2A 5ETPA 9ATCB 2W9AA 3KHHA 2WVCA 2GZOA 1UVLA 5KFJA 1SPBP 2VC0A 3HP6A 3UN3A 4DU8A 3CW2C 1IBKJ 3CC7S 3BKUA 2GHPA 1PKUA 1WKJA 3DM2A 4OV1A 2CDRB 1NHKL 2HRTA 1JLEA 4Y6IA 2G1DA 3ILLA 3FQKA 4QPTA 2QMWA 3E51A 1KSPA 3AAWB 3ZZ0A 2ZNYA 3F73A 1BWEA 1BHNA 1XJWB 3EX7B 2NXCA 3PEJA 2DNOA 4PYDA 3Q8PB 2FJEB 3IGNA 2XWXA 2GNKA 2OMLA 4KPCA 2Z57B 4NRTA 2HWIA 4OZ1A 4C8YA 2ZBIA 3CWJA 5D4PA 4TU7A 1RT3A 3L9ZA 3NXZA 1UJ5A 5GAGI 2XHWA 4LR8A 3OVBA 3T1HJ 4QWDA 5GMEA 1JXLA 2V8PA 4NXMJ 4GVLA 4WKRA 1VMBA 4EUVA 1ITPA 2XZTB 3CJ2A 1FNMA 4CDIA 1UJ4A 2UV8A 3HPOA 1FXLA 3MOJB 1TL3B 1ZBTA 4EZ6A 4AL7A 1VQYA 1NZ8A 1LW0A 5HP1B 4UY8T 2ZOGA 4KT0C 1U25A 4H4OA 2Y0BB 2UZAA 4IH6A 4OFZA 5KFSA 2LA4A 5AJ3J 4OX9J 4LUBA 1QTNB 3IM9A 3OQ2A 5D4OA 2RU9A 1PBAA 3GLJA 1C0TB 3CE8A 3HT0A 3CCWA 3EJMA 2R2RA 1IWAA 3BJYA 3CDBA 4KGMA 2QT7A 2AGOA 1CJUB 3DFEA 1KP6A 2IDLA 3DLEB 3VQSA 1D1UA 3G82A 2YH0A 2LQJA 2I1RA 3UO0A 2F4FA 1T02A 2QA4S 1YSJA 1FRLA 4WU3A 2QL9B 1F2GA 2G2ZA 2BJ7A 4C98A 2FVCA 5F0WA 5D0HA 4DPYA 1RKJA 3MCOA 1RT6A 3HMJG 3BGRB 1R89A 5ETQA 2MZTA 4DFMA 3SFGA 5KG5A 3HULA 2CAJA 3DOMB 4YB1P 4CH1A 3M32A 3T6BA 3VAMA 1B4SA 3IWLA 3UCGA 1IKVA 1H98A 1I94J 1P1TA 2DHAA 1NXIA 2ZE2B 1IM6A 2FGCA 4RNOA 2DNMA 1WF2A 4K0KJ 1CJTB 1TZ0A 3Q2SC 3GG1A 1SBRA 4B9LA 3AODA 3GQCA 3M8YA 2F9DA 1XEZA 1HNWJ 1VBZA 4IKAA 2EK1A 2VPXB 1NDPA 3PIOQ 4E8UA 5E33A 2WSFC 2Z2YB 1VGYA 2NUHA 1WC4A 4OV6A 3GIIA 2HZAA 3TUPA 2LCWA 2Q6CA 1UEVA 2XY6A 1NCLA 4IOBA 2ZBQA 4LFAJ 4WZQA 1SC4B 3EDQB 2ZH4A 1VRTB 2AJ0A 3VZHA 3NNAA 2LU2A 3NMAA 5K8OA 1QSSA 1U6FA 3PYFA 4DV5F 3MI7X 3GSDA 2FZGB 4J9UE 4DL6A 4DPWA 2ZZTA 3QO9B 1U8SA 2ZH9A 1SH3A 3FEXB 2X7IA 3BGOP 4CO3A 2BQRA 4WFZA 3GIJA 4P7TA 3NGSA 1VHFA 2DNYA 4WP3A 1J5EF 1X9MA 1HIYA 1S5ZA 2BJ1A 4DR3F 5E3QA 1Y9OA 1HBMB 3HHLB 2ACMA 2RAQA 2X1FA 2YNHA 3K5LA 3U7JA 2QO3A 1S6QB 2CADA 3BPSP 1CJVA 4GKJJ 5ADZA 2HS4A 2Y0SD 2ZWPA 4ECVA 2RSQA 2VA3A 1H73A 3VGSA 5T7LB 2QLXA 2OJ3A 3P96A 1VJWA 1F5CA 1T9VA 3ULHA 2YH1A 4FVMA 1OQ6A 1RT2B 1D0EA 3D2WA 2BEFA 1UZDA 4YHHJ 2HZCA 1RBOB 3PHTA 3QYYA 4ZPAA 3PY8A 3DLGB 3TAMB 4I69A 1RBAA 4F4AA 5D0RA 1N36F 1VJQA 3DGPA 1MN7A 4U7UD 1ZZFA 1HR0F 1TMJA 4WTOB 2ASDA 2MTLA 3NRBA 2Q43A 5M2PA 3DMJA 3Q8QB 3S6EA 2DGVA 2LEBA 4L3KA 5KFXA 1B7FA 4ZCMA 1FCAA 1IJFB 3IMQJ 2IM2A 5M2RA 3H5SA 5E7OB 1XR6A 3MM8B 4NL5A 2GX8A 2M70A 3K58A 3DRSB 3K17A 5HI7A 5E3RA 4K4TA 1VBYA 1Q1KA 3TVZA 4DFPA 4MTPA 2IJRA 2OSRA 2R2UA 5HMYA 2K7JA 4NLOA 3DC2A 2HQIA 1U1LA 3PYDA 5J2NA 3QWPA 2PMHA 2BM0A 4J9MA 1RBLA 3I0RA 3ENAA 3P3DA 1CQMA 4L74A 1CULA 5JXSA 5HL7Q 1TKZB 1SJRA 4OZJA 5J2PA 1FNOA 1NJXA 1SJFA 1W2IA 1OWXA 3SQOP 2DY1A 1WHYA 1BY9A 4RNNA 4B9VA 2C3OA 3PO4A 4KE5A 3HFVA 2KG1A 2IC3A 3KJFB 4J7CA 2E44A 3FNNA 4NCAA 3UR0A 1DRZA 5AXKA 2P8IA 3J7YU 3QSYB 4NCGA 3KHRA 1CEZA 2C2EA 3KNAA 2QLJB 4MIBA 3OTOF 2FJVA 4DEZA 1SUQA 4QCLA 2HQDA 4J9OA 4JBCA 4OIXA 5HAOA 3QAEA 2L9NA 5HVHA 1AUDA 3MR5A 5B08A 2MGZB 1F6TA 1D8YA 4XPCA 1N5VA 3KLEA 4M63A 4WFNQ 3IBCB 1DTQA 1B3TA 2D9OA 2KH9A 3JB9k 1EKSA 3TA0A 3UDCA 4GO7X 3CVKA 1TL7B 1PIEA 3HSJA 3MPYA 3D54A 1WOPA 2HNZB 3AJ1A 4DFKA 3EGVA 3A12A 1H2UX 2OPPA 2VG5B 2DBBA 2I5JA 4F50A 4K5RA 2E1CA 5U47A 3UWTA 4OJHA 3I5CA 4WZMA 2GC8A 2GMHA 4RWXA 3UNGC 1XNRF 4ZVFA 3C15A 1J27A 2QTWA 3NGDA 3TAPA 4JI4F 3D28A 1YWXA 3P5TL 4NLGA 3NNHA 4WK3A 2YKAA 3V81A 1S9GA 2F1FA 2R8JA 1Y11A 2QX0A 4R0EA 4F4WA 4P2SA 1N52B 2C3PA 2V34A 1IKYA 4J9NA 4B3MJ 1URRA 2M3DA 1OQ3A 3LP1B 2MY7A 5GAEI 4G6VB 4QYZK 2IHR1 1G1XA 2FQQB 3RZAA 4JI7F 1MWYA 2B51A 1X5OA 2FHJA 1Y5IB 1LWCA 4C0BA 1ZM2A 3KUEA 2C2KB 1LXJA 2F8HA 1NMEB 1S6OA 3CCZA 3K2YA 2N3OA 4PG7A 2R7QA 1RYSA 2HMIA 1FTRA 1FDAA 3UVJA 5IM0B 4QIFA 2P9CA 1JNZB 2FJBB 3KWMA 1JLCA 3QFWA 1R0BG 3QGIA 5IC4B 3I87A 2ZITA 2QSFA 2M52A 4UW2A 3FSYA 1S1WB 4PAAA 1SQGA 4PWWA 1UETA 3GFYA 2XNRA 4DQRA 2OPQA 3POTB 3QJJA 2HHVA 2RMLA 4B9SA 3B4MA 1NRKA 1Y3JA 4IYQA 4C97A 3HVTB 3MF5A 4RNFA 3ZTQA 3VZIA 2FGOA 2V9KA 2WK4A 2ALZA 3WIVA 5J1PA 3EXYA 2UXCF 4H4MA 2FJWA 2R9LA 3TI0A 5L39A 2RF2A 2VQFJ 2BOPA 2NPIA 1NJZA 4ED1A 1FRMA 2HKEA 5F3TA 2CNKB 3LOUA 4R0JA 1G7CB 1U48A 2QMUB 2EFOA 3NMRA 2DXEA 3DOKA 3MM7B 4QW8A 3TZZA 2A0FB 2V2QA 3CCJS 3AB2B 2HBZB 2DVIA 4YEAA 4MKAA 2E1MC 2KJWA 5J2QB 4ZLLA 2WHOA 3M9MB 1RT7A 4JI6J 1XBWA 1TK0A 3R3TA 2OMOA 3QT6A 4OHXA 3FBFA 3WX8A 2UUCJ 4FF3A 2CQPA 5KG3A 1WC3A 4ZHRA 1RT4B 2ZC4A 1TUGB 3M30A 3L4BC 1Q95G 2BUNA 3OTCA 4P74A 1S1XB 1Y5NB 1JJHA 5ETSA 4DQQA 2JH3A 4NMLA 5ETOA 3UPFA 1Y5LB 4X2BA 1BMQB 1RAGB 4KV8B 1JWWA 2AKWB 3FFIB 3IR7B 2Z8QA 4GMKA 2MKJA 3I9ZA 5E5NA 3C6TB 4WP8A 4NWBA 2BE9B 1T3NA 1V3ZA 2AV5A 4DUTA 2IPOB 1VQLS 4AQYF 3OSNA 3HXMA 4KIAA 3FKBA 2E66A 2CQ4A 1UP1A 2K7KA 2OD6A 1RWOB 3DYAB 4OL8A 4R5PB 2HBYB 3I82A 1JKHA 3IXQA 1RHQB 4KYZA 4P71A 2AZ3A 2ZHOA 5CXTA 3OR1B 1MWZA 4RZRA 1TKTA 3ZZPA 2GFFA 2BABA 1JLQA 1SJ3P 1EARA 3KMQA 3PX0A 1UFLA 3T41A 3VGTA 1FRJA 2XHCA 2N7CA 4WXWA 2VV5A 1GTHA 2HFSA 3UD5A 3OL8A 1C0UB 1IQZA 4ELUA 2VD3A 1T94A 1HBOA 3A8KA 3MD1A 2OPSA 2P6TA 3KMSA 2JZ5A 4ID5A 4DBQA 2H5EA 4LBPA 4RU2A 3HSZA 2YKNA 2ZZNA 1IBMF 4CLYA 1VQ6S 5KFUA 2O3DA 2CZ9A 2BBEA 4B08A 1VQ9S 3CJTA 1TKDA 1VHIA 3H90A 3SSRA 2ILYA 3IRXA 3KHLA 4DCOB 1P9QC 3J7A1 4DSFA 3MR7A 3V6KA 2GVZA 2J8AA 4FXVA 2ZJQQ 3HD2A 3QGGA 2ROPA 3HHLD 1RABB 1AB8A 4OYWA 4PG4A 1IUJA 3T9NA 1UA0A 3AD9C 5A8WB 5DGBA 2VBYA 2HFUA 2AEFA 3FSXA 3M2UA 4CYUA 1X4CA 1REVA 1MNEA 2MLZA 2CNOB 3DDIA 2GVDB 2UUBF 3DXBA 3AOBA 2OTLS 2J9CA 3QIDA 3NG8A 4BHQA 1Y7PA 2IY5B 2PGCA 2IYIA 3MUMP 1JJ2R 2LQ9A 5EWGA 1AZSA 1XN9A 4NEYA 5C25A 4NYOA 1X4BA 2HQFA 4ECTA 1X31C 3MAQA 4Q44A 3N5BA 1O51A 4GVBA 3KYLA 3D3CJ 4M5KA 4UUXA 3M9OB 2RNEA 4L76A 1HBUB 1WORA 3B78A 1PYOB 5A0YB 1FXRA 2PSZA 4HACA 1HPZB 4MYTA 3HVAA 3QMQA 4TKTA 1LOUA 2H54B 2CQ0A 2RQKA 5LT5A 4RW7B 2XTJP 3W60A 4I7FB 2YX4A 2FB0A 3MAHA 8RUCA 3D1QA 3T1YF 3D0IE 5LXYA 1Q8IA 2G2OA 4NYZA 3KJQB 1PO6A 4DV5J 4CLLA 1RAEB 3D6FB 3MEDA 2OAUA 1HYSA 5FDLA 4BS2A 3RB3A 3MMAB 2CJKA 4XDCA 3I55S 3NWRA 2OELA 4DR3J 2BKOA 4QIVA 4O0IA 1P6TA 4OLOA 2RHSB 4LSNA 4ZVPB 5IWAF 4K4ZA 4ZN3A 4ILRA 4Q8EA 1SVDA 2KI2A 2ZDOA 2NSBA 2XQCA 1U7LA 1BLUA 1W2BR 3TZWA 4UQGA 3SSQA 3V4IB 2JEIA 4K59A 2WVBA 4JI3F 5MAOA 3TUZC 2DNHA 3PRDA 2OO4A 3GIKA 2Z58B 4LF6F 1IKXA 3WC2A 4HL9A 3TP2A 1NJYA 5F41A 2PDAA 3CPWR 2KYXA 2O1PA 4N7TA 1RTHB 2NZ4A 2CJQA 1U0HA 2R7UA 1N36J 1SL0A 1TL1B 1TKXB 1HR0J 4USHA 1SL1A 1RT1A 4Y2MA 1E6YB 3L3CA 4ECZA 2AX0A 2QSWA 2C2MB 2HQ3A 4B3OA 4ZPDA 4FYXB 2HVZA 2ZHBA 2ZH3A 4ZMMA 1I3OB 1S7HA 3QT7A 4G1QA 3M8WA 3MM6A 1PJ7A 4HDHA 5AE2A 4CTAB 1NSAA 3NOCA 4PG8A 2LXUA 3THVA 3EYZA 2ABYA 3R5GA 1FFSB 1O5JA 1WDDA 1VYAA 2MXYA 3KLGB 1YZ6A 3PVXA 3OUYB 1FDDA 3LGMA 3CJQA 2R42A 2J5AA 3T5HA 5K8MA 2ASJA 4ED3A 2Y8WA 4K4VA 4Q45A 2PFDA 1LK5A 3JYTB 3G6YA 2VBZA 4U9RA 2R7VA 1Q79A 1JLGB 1XMBA 3IP0A 4RW9A 1UWBB 3LP0A 3BO4A 4DV2F 1S1TB 4FXDA 2GQ2A 3N0VA 5HANA 2NCKL 2EWHA 2HFVA 2YY3A 3AXMA 1F3FA 1XNQF 3OTOJ 3E3XA 3QGPA 4WIQA 3THPA 1S1UA 2DEIA 1CS4A 2XZDB 3QIPB 3IS9A 2MQ8A 4LF7F 4AL6A 4OYXA 4I6WA 4XPEA 2U1AA 4K4XA 3KK3B 5B0DA 3PG9A 4TLRA 3KLFA 1YRUA 1QD1A 1AA1B 1N0UA 3J7YI 3CC4S 1HI8A 1N8RT 2HZVA 2BYCA 3M8PA 3Q83A 3BN4A 5KG4A 1KQKA 3AT1B 2B7BB 2POKA 2E7VA 1JX4A 3DN9A 5LMNF 3CO0P 5CZVA 4A8KA 1JLAB 1R31A 2V68A 4U8YA 3GG0A 2B6AB 3T1AA 3L09A 3HVRA 3KUGA 1X60A 4RL1A 1FT8A 4I6YA 3MR6A 1U45A 5KFPA 1WOSA 2Z4PA 3BREA 2D3O1 1FD2A 4C6AA 2J7KA 4JUZA 2WONB 1Q86T 4YR3A 4MIAA 3TUJC 2QG9B 4DSJA 3JSMB 2HEKA 1EIYB 4X62J 3G6XA 3BSNA 1DTTA 3QGHA 8AT1B 3QO9A 1GXTA 1XNRJ 4Q2LA 4TNOA 1NB2A 2E5HA 3K5NA 5EDWA 4DSLA 4CI0B 4JI4J 5FLXU 4J9QA 3FZBA 3MTKA 4LREA 3KK1B 4O4GA 1RQ0A 2IVYA 3T9ZA 1ZTTA 1MG7A 3CD0A 1HBMA 5HSPA 2NXUA 1FJGF 2N4CA 5B0AA 1QAYA 4DR5F 5CA5A 2W2PP 5I42B 2MB0B 4OX7A 2FLNA 1HQEB 2CPXA 2VBWA 3KKFA 3SQGB 3ZZYA 2XS7A 4JI7J 3LGNA 3R6GB 3LWLA 2B4UA 1RLCL 1DQ8A 3DDNA 4IH5A 1X5TA 5EWFA 2YPYA 1VOMA 4C11B 2XZWA 2D3ZA 1MMNA 2D1CA 4J9LA 3DXSX 2IBOA 2RT3A 2Y8YA 4O3PA 4CLZA 3H40A 2ZM6F 1RE1B 4C0HA 3H25A 3OTBA 3I56S 2YVSA 3FK4A 3U1LA 1KLNA 4XTTA 4DV4F 3E01B 3A3PB 2FDNA 2Y1RI 3MEEB 3E2EA 5KFRA 4CO2A 1LW2B 2F8EX 1YITS 2W2QP 2I38A 2CWKA 2DNGA 5HQLA 4FNIA 3GIRA 2LYVA 3SCLE 3QLHA 4ZK7M 4TYAA 1NKBA 4A47A 2DR9A 4QW9A 2UXDF 2E1AA 2V67A 4KGXB 1I1GA 3LP2B 5IOLA 2UXCJ 3D67A 4QBUA 4LF4J 4ZCLA 1U24A 3FUYA 3GCWP 4DL7A 4KQZA 3EICA 4S0MA 1LWXA 4ICLB 1F9FA 1RT5A 3OFEA 5BJRA 4PABA 4TY8B 3TANA 3RB0A 2IM3A 2E5GA 1NK4A 1YDLA 1T9XA 2UU9F 4PZVA 4LR9A 1QJHA 3M2VA 3MMJA 1F2HA 1U49A 4YR2A 1AXQA 5ETTA 5DQIA 3A4TA 4QIGA 4C2MA 1RUSA 4TLQA 3CJ3A 1L3VA 5KT6A 4EZ9A 2F5GA 1U2CA 4JI5F 3U02A 3GWCA 2UUWA 2YQ0A 4I2QA 4FKXA 4C3KA 3TNVA 2PFFB 1AROP 1TP7A 2VFSA 2V4RA 2DNQA 5ETMA 3JXOA 1DAXA 1PAUB 1UL3A 4DL5A 4JV2A 2ZD1B 2DGOA 1HNVB 2W25A 2MZRA 3CDAA 4Q7AA 5GAHU 3V6JA 3BGFA 2GGPB 1WSVA 1DY3A 2IIHA 2GV1A 4EFAC 3J81Y 3FGVA 4ZP9A 1QTMA 1OJ4A 3WBZA 4CLTA 2CWXA 3M9NB 2QL5B 2QZ8A 2RDIA 2MKSA 2VG7B 3I0SB 2RKIB 1U02A 1OIAA 4DL4A 1DBDA 4QYZJ 1KRPA 4ID8A 4KR0B 5LSOA 1X4FA 2JLFA 4QPXA 2F4VF 2CPZA 1UFWA 4W90B 1GMWA 3P8BB 2QMXA 3S7RA 4OHYA 4LRAA 3QBCA 3QFHA 1PJ5A 3RR8A 4M5LA 4DWIA 2XM3A 3VAKA 4LVNP 3EM1A 1R0CB 1T9UA 3WHIA 4P2MA 2QV6A 5HVGA 4KBIA 1YVFA 4ECWA 1HD1A 2FC9A 1FRIA 1S49A 4DV6F 1RJJA 3MPVA 4I68A 1HNIB 2BX6A 1UVJA 2AX1A 3GJTB 3F44A 3IG1A 1FKPA 4K5SA 3J80Y 3EZOA 2RJZA 1ZTWA 2HS0A 3N6NA 1YI2S 4DHVA 1BE4A 3UD3P 4F2RA 1NJIT 4NLUA 5AXLA 1IQTA 3VTIA 2HGMA 1N56A 2J0WA 2EPIA 4DPOA 1U1NA 4HH1A 2W7PA 1FEHA 2AEJA 2OH2A 1HHTP 4ELVA 3KJVB 2DNRA 2E1PA 2ILZA 4LF2A 4NZ6A 1IBMJ 5B0CA 1S1WA 3FMBA 2EKYA 2W9CB 1MROA 3RRGA 2F7VA 2RS8A 3KG4A 4WFXA 4KFBB 3DRPA 3POTA 3JSRA 1CPZA 2I6WA 2X1BA 1NK7A 2W4CA 4N8OA 1S9FA 3BM7A 5LM7E 1Q5VA 1J2VA 4RNMA 4OJGA 2DD8S 3D6TB 5BYSA 4JV5F 5KFNA 2WOMA 3UQSA 1NAQA 3TZXA 3OR2A 5IXUA 1HHSA 4NLDA 4DF8A 1CBKA 2XMJA 3ITHB
chains in the Genus database with same CATH topology
3I4PA 4ID5B 4X64F 1N5YA 4KTQA 2E7XA 3VAHA 5DS7A 2IAJA 1M5HA 4NA3A 2YKNB 3PW5A 1FXDA 2A10A 2HS4A 5ADZA 2P9GA 1UAWA 1K1QA 2Y0SD 4ECVA 2RSQA 2L41A 2VA3A 1NO8A 4WJBA 3P49B 2UXBF 3ZC4A 1WF0A 5T7LB 2DGWA 2EI5A 3V4MA 3Q8SB 4DL0C 2IMWP 2OSQA 2QEXS 4O3RA 2YKMB 2V8HA 1QE1B 2QLXA 4R8UA 3A8EA 2OJ3A 2RE1A 3P96A 1SJ1A 2Z0GA 3SCJE 4D3HA 1VJWA 1F5CA 3ZZOA 2UV8G 2BA9A 2CPEA 4CTAA 3M6WA 2MHEA 3TA2A 3ULHA 1S4FA 2YH1A 2L48A 4FVMA 4V19J 1OQ6A 5T41A 1RT2B 1WTFA 3IRXB 2XO7A 1D0EA 1VQNS 3Q0AA 4OZLA 5D78A 3R1LA 3D2WA 4N8NA 1SV5A 2OD4A 2YNGB 2D3OR 4YB7A 1U1KA 2PA3A 4CH7A 5KT3A 3KLGA 2HZCA 1H0HB 3OUYA 5J2QA 1VK3A 3QYYA 4ZPAA 2IM1A 5IT0A 3PDNA 3PY8A 3DLGB 3TAMB 4I69A 1WEZA 3MM5A 4Q2MA 1N36F 3HLUA 2BE2B 4DOZA 2IRUA 2WB1D 3DGPA 5GMKa 1R8CA 3JSBA 1UVMA 4WFYA 1B0TA 1ZZFA 1HR0F 3KK2A 4MMOA 2YKOA 3MECA 4JI1F 2ASDA 2YNFA 3V6DA 4B17A 2ZOFA 3NRBA 2DNLA 2JC1A 3HT3A 1S0VA 4C8ZA 3SDEA 2VONA 3M2UB 4USIA 2PMZD 4K50A 2YNIA 5KFWA 2Q43A 3CCLS 5M2PA 3JYTA 3DMJA 3OSPA 5AE3A 3Q8QB 2A1BA 1REVB 2DGVA 3S6EA 2ZBCA 2LEBA 1B7FA 5KFXA 4QWCA 4IG0B 1Z2ZA 4ZCMA 1FCAA 1H6KX 3NCQA 5F8MA 4EBDA 1IJFB 3T3FA 4ECQA 1JLGA 3DRRA 2IM2A 4RNHA 2W9BA 1VQSA 1IBLF 1UWBA 5M2RA 2DTJA 2DITA 3IA0A 4D3GA 5CYMB 5DDRC 3K5OA 3OV7A 2XG8A 2DR8A 2C3MA 1S1TA 4B9TA 4EYHB 4I1TA 3RB6A 1TV6B 1YJWS 3EPIA 3FJ2A 3H5SA 2EBGA 5E7OB 1XR6A 3MM8B 4NL5A 2FIUA 4RW8A 2KYZA 2GX8A 2E5LF 3DHWC 1GH8A 3M6XA 1JIHA 4GC7A 2M70A 3K58A 5LMUF 3DRSB 1FD8A 5HI7A 3MD3A 5E3RA 4DG1A 2VQEF 4K4TA 2X3GA 1YRXA 1MU2B 3ISZA 1LWFB 1VBYA 1Q1KA 3TVZA 4DFPA 4MTPA 3BQ1A 1L5UA 1NEEA 5CYQB 1XC9A 1M5OC 4YOEA 3LAKA 2OSRA 3IAM9 5C25B 5HMYA 2R2UA 2K7JA 4AUKA 3QIPA 4DMZA 4YR0A 4NLOA 3DC2A 2HQIA 2GW8A 2MSSA 2KM8B 1U1LA 5J2NA 1ZAWA 3QWPA 2PMHA 1WF1A 1Y0HA 3OJUA 2BM0A 4ZP6A 4J9MA 1WG4A 3MEGB 2P9EA 3SV4A 2IJNA 3I0RA 4NLTA 3Q2TC 1SQEA 3KK3A 4WXOA 4KHPF 3DU5A 4DFJA 4I0WA 3P3DA 3GV8B 1CQMA 1P8GA 3OBIA 5JXSA 5HL7Q 2VOOA 1TKZB 3KNGA 3TA1A 5HMZA 5EWEA 4WFAQ 3EZ5A 1SJRA 6FDRA 3FFIA 4OZJA 2N82B 4NLXA 5J2PA 1FNOA 1NJXA 1SJFA 1W2IA 1OWXA 2KKHA 2ZNZA 3BQ2A 5H1SV 1NK9A 4DSKA 1RT3B 3PHEA 5B09A 2LQBA 4LFCF 2CVIA 1WHYA 1BY9A 1D9FA 4O3SA 3C6UA 4FN5A 4RNNA 4B9VA 2C3OA 3PO4A 4KE5A 3TQ1A 2M2BA 2KG1A 3H4DA 4P7VA 4LSLB 4WCEQ 2IC3A 1JLAA 2IVFB 3QJPA 2B6AA 1RAJA 1TK5A 5G0RA 4B02A 4B9MA 2CIMA 2VPYB 2B5JB 2GO8A 2LA6A 2AGPA 3UFCX 4HVZA 5F8HA 2XCAA 1V3SA 3GV5B 2E44A 3FNNA 3CO9A 1T7PA 4F3QA 4PQUA 4EEYA 4N56A 3RAXA 4NCAA 4KKOB 3UR0A 1DRZA 4LF5F 5L1KA 5E2QA 5AXKA 4C0OC 3J7YU 4L3NA 4NCGA 3GMGA 3W7BA 2DH9A 3KHRA 1RISA 1GQEA 3I96A 1CEZA 2C2EA 2RDJA 4J9RA 1BQNA 2MSTA 3K59A 3KNAA 1LKZA 2B4OA 4MIBA 4R5PA 2XLJA 2V5HG 4HDGA 2WONA 2ZOMA 3OTOF 3FRZA 2FJVA 4DEZA 1M5VC 2HVHA 1UVNA 1SUQA 1XK8A 4QCLA 1OPZA 2VASA 3OFGA 5HMXA 3B82A 4JBCA 4J9OA 4EBCA 4JYAF 4PPDA 4NZ7A 1HI1A 1TFYA 1KN6A 4TQRA 3L7PA 4OIXA 3QAEA 3Q8RB 2L9NA 4CNZA 3R27A 5C42A 5HBMB 5F8IA 4X4SA 2E5JA 3O2IA 4EO6A 2XMWA 5CCLA 3MEDB 4CT8A 4Y2CA 1HYSB 1PC4A 3N5FA 1AUDA 3MR5A 4B3RF 2B9XA 5FJ4A 5FDLB 5B08A 1MW7A 2MGZB 3G4SS 2LQ5A 2W8KA 1WTBA 4XPCA 1N5VA 2F9JA 3KLEA 1D8YA 1KQSR 2WW8A 4M63A 4WFNQ 4GKKF 4PWDB 2Q3PA 4DL3A 1CC7A 1DTQA 1E6VA 5DG7A 2J0SD 2XI2A 1YTYA 4ZPVR 3NNCA 3ISNC 5BR8F 3KK1A 2D9OA 2XLIA 4KB7A 3EPGA 2FHKA 3M8SA 2GQCA 2C3YA 4YY3F 2KH9A 5E41A 3JB9k 3TA0A 3UDCA 1R0AA 4BCAA 3O44A 4GO7X 2WSCC 2B56A 4LSNB 1RTIA 1KD1T 1FK9B 3CVKA 4OI1A 2HGLA 1AFIA 2DGTA 1LK7A 1NK5A 2FVRA 3N6LA 3H2LA 1BD6A 3MPYA 3D54A 2H9ZA 4FBUA 5I42A 2N7YA 4DR2F 3GV7B 2HNZB 1HQEA 4E98A 3O5TB 1ZAVA 4G3IA 2JRSA 2RD5C 3AJ1A 5K14A 3U27A 3US5A 2LVWA 4DFKA 4A4JA 1S6UA 4WF9Q 5D4NA 3MM9B 2KZZA 5K8PA 3DRYA 5C24B 3SQGA 4ZCKA 1H38A 2DK2A 4I67A 3C46A 4Y3CA 2C2RA 1H2UX 2OPPA 2FLPA 5A2QY 2VG5B 2DBBA 3BQ0A 1QLNA 1S77D 2I5JA 2VBXA 4F50A 1X5PA 4K5RA 1ELOA 3BF4A 2E1CA 4MKYA 1FHTA 1GAOA 4DUYF 4OLPA 1YJ9S 2YWGA 4C11A 1IKWA 1KLMB 5K8NA 4DV7F 2C22A 5U47A 3IR5B 3K7RA 4NA2A 1QM9A 3UWTA 2DR7A 4A8MP 4X4NA 2DRAA 2DIVA 1IKXB 4OJHA 3CCTA 1NHVA 2B3TB 1VQPS 3I5CA 3M8QB 4WZMA 2WCXA 2GC8A 2GMHA 4C8MA 3N28A 4RWXA 3UNGC 4IR9A 1X4GA 2K2PA 3OL7A 1XNRF 2XMKA 2XMMA 4ZVFA 5BYQA 2ZKUA 3SZ2A 4OI6A 4J5OA 5B0GA 4ZP8A 5L1JA 5KG1A 3NGDA 1HW8A 3TAPA 4YB6A 4JI4F 1H2VZ 1QVFR 5KG7A 3D28A 1YWXA 2V8VA 3P5TL 1KC8T 1HWKA 1LQ9A 1ROFA 3H2VE 5L1LA 4NLGA 3HHNB 4U6PA 4WK3A 3NNHA 2BJEA 5JJBA 3O6QA 2YKAA 5A8RA 3RU0A 5KTQA 3V81A 1S9GA 2F1FA 1RT1B 2R8JA 3E01A 1VQKS 4R0EA 5A8KB 4F4WA 4P2SA 4B3OB 1N52B 1EP4A 1NU4A 2C3PA 3MEEA 4ETZA 4O3NA 3N4WA 2KJVA 1IKYA 3CB4A 3FDSA 4J9NA 2NPFA 2MQMA 2NREA 1LW2A 3O8WA 1HMVB 5L38A 2R7SA 2CQHA 1WEYA 4X4RA 4ZDNA 1URRA 1JNRB 1H3DA 1OQ3A 2M3DA 2XMVA 3LP1B 2MY7A 2FLLA 2XS2A 5GAEI 5HROB 2O5DA 3H2UB 4G6VB 4QR0A 2IHR1 1G1XA 4MJKA 4G1QB 3G8TA 3G8SA 3MM6B 4I4BA 1U1QA 3RZAA 3NGKA 3M1VB 4JI7F 3LH2S 1MWYA 3KLIB 1ZETA 2B51A 3KLHB 3BSCA 3M05A