3R2IA

Crystal structure of superantigen-like protein, exotoxin sacol0473 from staphylococcus aureus subsp. aureus col
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
194
structure length
192
Chain Sequence
RKYYINMLHQYYSEESFEPTNISVKSEDYYGSNVLNFKQRNKAFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSGFVSNPSLQVKKVDAKNGFSINELFFIQKEEVSLKELDFKIRKLLIEKYRLYKGTSDKGRIVINMKDEKKHEIDLSEKLSFERMFDVMDSKQIKNIEVNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Superantigen-like Protein, Exotoxin SACOL0473 from Staphylococcus aureus subsp. aureus COL
rcsb
source organism Staphylococcus aureus subsp. aureus col
molecule tags Unknown function
molecule keywords Exotoxin 5
total genus 54
structure length 192
sequence length 194
ec nomenclature
pdb deposition date 2011-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3r2iA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3r2iA01
4DXGA 1CT1D 1YN5A 2G9HD 2O2LD 3R2IA 1CHQD 1JWSD 2SEBD 1D5MC 1PZID 1JWUD 1PRTC 2RDGA 1LTGD 3BZDB 1QILA 1ET6A 1PTOD 3R2TA 1BCPB 1SBBB 3TSSA 1D5ZC 3BYYB 2R61A 5ELEA 1BXTA 2TSSA 1BCPF 1LT4D 1BCPD 1SE3A 4O1NA 4BWGB 2XNAC 1KLGD 1TS5A 5D3DA 1I4XA 1EWCA 1SXTA 3DWAA 1MD2D 4L63B 1EEFD 1L0YB 3DWPA 1CHPD 1FNWA 1B1ZA 4OHJA 5FK9C 1ET9A 3SEBA 4ZYSA 1AN8A 1PTOB 5ELDA 1PRTF 1TY2A 1L0XB 1FNVA 3BVGA 1JQYD 1LTBD 1SJHD 4UDUC 4RGMA 1RF2D 4RGTA 3O13A 1YN3A 1D5XC 1LLRD 1LT3D 1LTTD 2XRSD 4C56C 1JR0D 1SJED 2AQ1B 1HXYD 2NTTA 1PZJD 4DXFA 2J4XA 3MC0B 1FD7D 1I4QA 3EFXD 1D6EC 1KLUD 3KLSX 1LTAD 1SE4A 1PYWD 1PZKD 2IJ0A 1F77A 1EU3A 1SEBD 1I4GA 1ESFA 1RDPD 1PRTB 2IPKD 1TY0A 1AW7A 1XTCD 2QILA 1I4PA 1S5FD 1GOZA 1TS2A 4RGOS 4RFBA 2ICIA 3R8BA 1LTID 3URYA 1HQRD 2NTSA 4RH6A 3W2DA 1UUPA 2AQ3B 2RDHA 1PTOF 1LTSD 5FKAC 1B44D 1S5CD 2WV6D 1EEID 1KTKA 2Z8LA 1S5DD 1BCPC 1CK1A 1XXGA 3BYTB 3CHBD 1I4HA 1TS3A 4RHSA 1LT5D 1LT6D 1S5ED 3MFGA 1ENFA 3GP7A 3BVMA 1RD9D 5D3IB 5ELBA 4K6LA 1V1OA 4Z9CB 4RGNA 3DWQA 4L6TB 1PTOC 1FGBD 1UNSA 1S5BD 1SE2A 1PRTD 1RCVD 1HTLD 5ELFA 1LTRD 3BVZA 1DJRD 2CHBD 1M4VA 2XRQD 3EA6A 5I4DA 1HA5A 1JWMD 1CQVA 5ELCA 1LO5D 1DYQA 1G8ZD 1EFID 1PTOH 1JCKB 2QEJC 4NZLB 1V1PB 4TSSA 1STEA 1T5XD 5TSSA 1EU4A 1FNUA 4RHRA 3V05A 4RCOA 1YN4A 3OWEB 1I4RA 1V1PA 2AQ2B 2XN9C 1TS4A
chains in the Genus database with same CATH superfamily
4DUYL 2R7ZB 4KKJA 4J15A 4A75A 4LFBL 2FNJB 5BMGA 5IYCH 1A8VA 1T3QA 3GTKH 1HR0Q 1VQ7A 3BZDB 3AB5A 2OOBB 4P2CB 2Y3AA 4PG3A 4R4TA 4FHKA 5HHDG 3NY5A 2BA1A 1XMOQ 2WDRB 2FJ2A 3WALA 1X3EA 1BXTA 4R9WA 2B2VA 5EDSA 2IGHA 4F88A 3KJPA 3E9IA 2JWZA 1WF9A 2NUCA 1JB3A 2RDFA 1Y1WG 1OXVA 1FXIA 2B3AA 1MD2D 4L63B 3TBIB 3OJ4B 3RUIB 2A6HC 5FK9C 3T1YL 5K5PA 1WJUA 4AOFA 5GXGB 1WFQA 1ZKHA 4JIOU 5FR6A 4GN5A 3Q8BA 1QVCA 2QGQA 3TMEA 2MBEA 1SYFA 1HTOA 2QIEB 5JZEB 4KVGB 2LGIA 4ZRZA 3RZDB 3KYDD 3CMMB 3MTSA 4WAAA 4KZ0A 3AEFB 2L0CA 2CR5A 4HIDA 1JRPA 4GKJL 4DV4L 3RZFA 2CWAA 1NUCA 3C46A 1GC6A 1SYDA 1SEBD 3J81j 3X3NA 1CUKA 1PH2A 3W1SA 2BVCA 4A3GG 3I4OA 4ME3A 4R8IA 4HMIA 4JI1Q 3SHLA 4H2AA 1NDDA 4E71A 4EQOA 2M1MA 1FVIA 2Z6BA 3CCLA 4A3KB 3HKZB 2A69C 3M7GA 2RDHA 4FP5D 3Q22A 2ZTCA 2C7NB 2JQRB 4ARCA 2RVLA 1EOTA 1S4ZA 4JWSC 3GTPH 5C4XB 3NOBA 2YU9H 1BDOA 1JALA 5CORA 5I9OA 1UZXB 2J52A 1N34L 5C5LA 3P4PB 2C7HA 4BA2I 1KFYB 1XF5L 4UY8C 1H9RA 1E8YA 4HSVA 2WHIA 1KC8C 3TEXA 1KAWA 3KF8A 1YBYA 4P71A 5H1SE 4GOPC 2IZVB 2J42A 2NVUI 5IYCG 3ERQA 4M8AA 4L6TB 3V62A 1R4PB 1UNSA 4QIWE 2VH1A 3NE5B 1PYBA 1QUQB 2FCQA 1A5RA 4HROA 2F0UA 3KBGA 4QB4A 2F4IA 2D5DA 1OQRA 3K5LA 1HH2P 1WMHA 2V9HA 1DOYA 1M4VA 2KANA 1IUEA 2LS01 3EA6A 2PYKA 3ER0A 2JA8H 2MHJA 1I50H 4ZRPA 3CC2A 2Z9HA 2DNEA 1EYDA 5JJKA 2RKSA 1EFID 4A3DH 1V5TA 5CX3A 4BFRA 3AH7A 4W9GA 3U52E 2Z6KC 4YWKA 1EY4A 2PJHA 2EYHA 4MGYE 5IP9H 3ZJUA 3MA2B 1STHA 2JSOA 2OXPA 3OWEB 1BKBA 1GPXA 1N5XA 3S2AA 3VH4B 4LUVA 3ERSX 3RZOH 4LF5L 3M4OB 1FFUA 2KQ3A 1CT1D 3N32A 3ETRA 4RAUC 1ZXTA 4OZBA 1EY0A 5KNCA 4EKUA 4IFDJ 3RNCC 5IO9A 1TXYA 4C3HH 2BTEA 3ZNGC 1X6OA 3PZ7A 4BBSB 4ZDVA 2E3TA 3UDIA 2CQOA 2BDOA 2HTHA 2F0DA 4ME5A 3RMKC 5ELEA 1D3ZA 4A3GB 4MHEA 2K04A 4XQJA 1LT4D 4KY5A 4DAYA 2KVMA 1FO4A 5ISRA 4DR1L 4A3KG 4BWGB 1GUSA 1R9TB 2N9XA 4IOIE 4XDDA 2F52A 5A35A 3GE3C 3ZDTA 2JU6X 4RCNA 1LV9A 4I65A 1TWCB 1WD1A 1V86A 4HJGE 4KV2A 4PT5A 4PYZA 4AJYB 4JI3L 1SIJA 1JJ2A 1WJ6A 2FIFA 2IW3A 3VH3B 1PVOA 1YJIA 2VL6A 3EJIA 2LWPA 3HP3A 4HPMB 4KKIA 1IPGA 4NJ7A 4KDLB 3F2UA 1JJCB 3PO0A 1RF2D 2KCMA 4RGTA 3WAPA 1LTTD 3BY4B 3Q23A 1I6HB 1Q1BA 1X3PA 1YQ4B 4LNIA 5C0XH 3QHTA 2LSSA 4KZCA 2LUEA 1SLJA 5JJZA 2AQ1B 1HZAA 1HXYD 1VQHA 1TGZB 2FCNA 2NBVB 4XDCA 3ZIMA 5D14A 1FD7D 2FINB 3RN9C 1JC7A 4DV2Q 1AP0A 4K8IA 3DCGA 1CZGA 4DV1Q 1E7PB 4TMAB 4WJOA 2MEKA 4CHTB 2IJ0A 1E1TA 2MX2A 1WCMB 1DGSA 3I70A 1KL9A 3G6JB 4JOIA 1BBWA 3KLRA 3MAQA 1NI2A 3GS2A 2X38A 3HOXG 4TV3A 3H7PA 4GSWA 2QEXA 2VRRB 4FA6A 3MHBA 5CHWA 2B39A 4KHPQ 5D2MB 3U7DA 4H44C 2A4ZA 3BINA 1TKWB 2OEOA 1SYEA 1AE3A 2E2IH 2KTFA 3KUDB 3ZQ4A 1JJGA 2I46A 4A3IH 4URKA 2F0FA 1EFWA 1S5DD 1V80A 1AE2A 2F0LA 3NPPA 4LFCL 2E5LQ 3PREA 3WIMA 4QL5A 4JI2Q 1DXMA 4C4VB 1B9NA 2NBFA 4OXPA 4A3MH 4JI4L 2DY8A 1ENFA 3GP7A 1RD9D 3H8HA 4JI0Q 4LUOA 2A19A 3OYYA 1WM3A 4JI0L 1YNND 4BY1G 3JSVB 2ZNVB 1OXSC 4IG7B 1FIQA 4V0BA 4BBSG 1YZ6A 2IGDA 3EECA 4GDKB 1PFBA 3DWGC 5M3MG 5HI1A 4BXXH 1MKHA 1GUAB 5HG2A 1WSPA 2D07B 4K3BA 4HN7A 3QJYA 1QZGA 2KQ7A 2L11A 1R4NI 1LTRD 1VQBA 3BVZA 3VR6A 2MWSB 4ITKA 4UPAA 5L83A 2XRQD 1VQJA 3T13A 3CU7A 1XTDA 3PHWB 1ILPA 1QJOA 3HOUH 1SF0A 1T0RC 4Y7NH 4LCDE 4RF1A 1LO5D 5E6OA 2HDLA 3S1NH 3DHGC 3W5UB 1F9JA 3RNUA 3KUZA 3ZNZB 5C3EG 4W9IA 2QMTA 4XX5A 4LF5Q 3MJ5A 3VR8B 3DBLB 2J53A 5FO9B 5IP7H 4LFAL 5BYSA 3V05A 2MCNB 2BYEA 5IY0A 2D2CC 4DV1L 1WTHA 3SVMA 3FVQA 4HAEA 2AL3A 1NSNS 4XT1B 1G2TA 2HQLA 4R8NA 3TJPA 5LMUQ 3Q2AC 3TN2A 1NCVA 1NR2A 2IX1A 2OQKA 4RMFA 4QF4A 1IBLQ 4JG2A 3K59A 1PV4A 1AYFA 4F1SA 1VDVA 1E8WA 4EQPA 5A2QL 1DONA 3HOWB 2CJOA 2EYOA 4GLVB 4G7HC 1LM8B 3EGRA 4CJ1B 3VDYA 4TRDA 2Z59B 3JSVA 2IBIB 3L10B 4CDDC 1F1HA 1A3TA 2DY7A 1HCZA 4ICVA 1RIPA 3GTLH 1KRSA 4NAMA 4D2KA 1WH3A 5G5HA 2B63H 3AU7A 4WAFA 1L0YB 3DWPA 3QR8A 2VNUD 1K8RB 4DR1Q 1WE6A 3NENA 1QKZA 2Q5WD 3Q3JA 2F3IA 1P3QU 4IM3A 2EE1A 4M02A 2LXCA 4UP8A 5LL6S 2UXBL 1EF1A 3V96A 2IY1B 4FJVB 1DGJA 1WJJA 2BPSA 2DAFA 4A9AA 1LT3D 3ZJYC 2BBCA 1Z5SB 1JOQA 1EIFA 1XMQL 2MRPA 3NZ3A 4XWWA 3AE1B 3IHPC 3QB3A 5E6PA 1JROA 4MELA 1Y1VG 3TZUA 1MBYA 4DDID 1WIAA 5BMHA 3OTOQ 1E1OA 4DV7Q 3UGBB 1WTVA 3K57A 5K36G 3PGEA 2X6GA 3P1MA 3WAMA 1B53A 4L5QA 5IT9L 1F52A 4KLKA 1TWFB 2Z0SA 2A69D 2YLMA 3CF5A 4MDKE 3D4RA 4CKEA 2LGYA 1J0GA 2EXDA 3SK4A 4RFBA 2HHHL 2NN6G 3RR5A 4Q5VA 4P72A 2ZCBA 1PDQA 2VB2X 1DZ1A 2BGFA 1NMFA 1OTRB 3EQLC 4II3B 5LMNL 2HDMA 2AQ3B 3PRZA 1V1QA 1SYBA 4F87A 1RRBA 3PZDA 1B44D 2ZJQA 4XT3B 4DR6L 2BE5C 2KVRA 3APDA 5C4JH 2RF4A 2PNHA 2B2VC 3ITPA 4A93B 3LDZE 3PO3G 4K7UA 3U8ZA 3HOXH 2DJFC 2V3PA 1XNQQ 2PZUA 3RUZA 2CH4W 2L32A 1PH8A 1LT6D 1Y69U 3Q8AA 3GTLB 3AXCA 2FCMA 2L1AA 4EFOA 1PXUA 1K3BC 3S15B 1WX9A 2GBNA 2K8BA 2D0PA 5IOIA 1FJGQ 2NZ1D 3KF6B 2BYTA 3T53B 1S72A 3ONAB 1SE2A 1SB3C 3RNEC 4K7WA 3W9CB 4ABNA 4A3CG 4DR4Q 4I7AA 1K53A 5KGUA 4KY6A 4LF4L 2N9PC 4LDTB 2KWDA 1JWMD 4P16A 1NJIC 2LVQA 1MFWA 3BDLA 1X56A 2YTXA 4Y7NB 4OONA 3AE5B 3GZNB 5FR3A 1B4OA 3K8AA 5C0XI 2ACZB 2YTVA 1BUVT 4WFN3 3AMZA 2K6DB 3HUIA 4DUYQ 1FL0A 4W9DA 5TSSA 3AE9B 1JRUA 4C3JG 2QF7A 4YWMA 1GUGA 1U4PA 4HDQA 3BDCA 5CYUA 1PUTA 4WRDA 2OCEA 2JE6I 3A33B 3GD7A 1KIXA 2UXDL 5IGDA 1JWUD 5FOBB 2GVAA 4A55A 4ZHOA 3IAS1 2KLCA 1Y56A 3KQ4A 4C3IH 3TP6A 3VUXA 5E6NA 4NDXA 3L3OC 4IFDG 3DBRI 4KN4C 2C9WB 4TQ0A 2XEWA 4YTMB 3CAMA 4AS1A 4ZRJA 2PEAA 5JH5C 3I3TB 3NTHA 2L1BA 4GDLB 1QVFA 1C4AA 3KF6A 2RCNA 1WY8A 3D4DA 3OSOA 1RL2A 3ALBA 3KK7A 4KGSA 2N7EA 4DAMA 1FNWA 4ACFA 2K7VA 2RD0A 4A3EH 1UE6A 3I90A 2MFIA 4A3IB 1XT9B 1PFDA 4G11A 2BS2B 3AFPA 2L55A 3CPFA 3SGIA 2L9HA 4X3SA 3HG9A 1NVID 3DQVA 3O13A 1UWXA 4A3DG 4R3DA 4XWTA 2WAQB 5M3MH 5M5YH 3VR2A 3WOEA 1RWSA 1VR9A 1YIJA 1PYSB 4OX9Q 1EQQA 2EDGA 1KLUD 2WXFA 2JP1A 2OWOA 4BOSC 1K50A 4I6LB 1PZKD 4IPHA 5BN3A 4XC2A 5ELOA 5IT9E 4JGHB 2KMCA 4M00A 3RNGC 1XX8A 1A70A 2K33A 1EIHA 4OZCA 2G4DB 4POFA 1EQTA 3J81L 4J8QA 2PW9A 2K0PA 2EY6A 3FILB 2ZVNA 1KOTA 3KWLA 1F2LA 1F9SA 2R92H 1RODA 3NG0A 3VTWA 4OVUA 3P1HA 4F8CB 2KCTA 3I5JC 1I7HA 3H1UA 2M2LA 1CA5A 1PH5A 1L4ZB 4EEWA 2KX0A 3KJOA 2V4IB 2MHVA 2WWZA 1VQGA 2KC2A 4XGAB 2NN6H 3K81C 3IFDA 2LZ6A 3B2GA 4FF4A 3C8YA 4G50A 5JEAG 5IGFA 2BE5D 4FVMA 1V8CA 2KKCA 2UUAL 2F0OA 3CKIB 2ZXRA 1JT8A 5DPTA 1EYAA 3VA5A 5C3XA 1FGBD 2N55A 2EKEC 3P2BA 2FBWB 1UGJA 4HCSA 2N3SA 1A62A 5EAYA 1KNAA 5C0XG 1PQSA 1VCIA 1EL0A 3CD6A 2F0EA 3J80E 1H9SB 4X3UA 1A3VA 5H92C 4A3JB 4XE0A 3DLLA 3TEYA 3NK9A 2Y0SB 2MPMA 2GI9A 4DPGA 1P7FA 1EIGA 4TKOB 3G6EA 1G8ZD 3S2DH 3PO3B 3IVFA 4LLGM 2UXCL 1Z2MA 1MHXA 3VYSA 3SR6A 3NWSA 2NVTB 1V8QA 4UAIA 3U9OA 5JPNC 3DBSA 1SSOA 1B9MA 1EU4A 2I5MX 5C44B 4DR6Q 1DOXA 3PSIA 3FP9A 4X64L 1LUZA 2EXZA 2UXDQ 3U30A 4FJYA 1YX6B 4JE3B 3M3YH 1WGRA 3CMEA 2E2HH 1FM0D 3AE3B 3HOYB 1P16A 4AQYL 1SNQA 2K8HA 2E2DC 3Q8EA 1WCMH 3W1YA 1HUMA 4IWPA 2B3GA 4MN3A 2VZKD 3HK0A 2FHTA 2M19A 1CZWA 1PFNA 4A3MG 1PH3A 3JAMc 1BBXC 1OXUA 4YCUA 1E2ZA 4W9KA 2FMCA 4DR5L 1G6ZA 1J9OA 3HIZA 3QARA 3K6OA 1X54A 1K3RA 3GO5A 3SFEB 5IP7G 4XQQA 4FBJB 3DPDA 1R4MB 1V49A 2B2WA 3TUOA 4FF1A 5E1FA 1H9SA 3AECB 3OHXC 4C00A 4W9EA 5C4JB 2EYMA 4ZYSA 5I2XA 1SYGA 4A3OA 1S3SG 1IBMQ 4US8A 2JA8G 2UUCL 1TWHB 3BWUD 3ND8A 4L1BA 3CMAA 3S1RH 4KIKA 2JEBI 3EN2A 3KUPA 4JL9A 1KDCA 3S15H 4GGQA 4AYBB 3T4AC 1SDFA 4KKSA 3CCUA 1ASZA 3N20C 3A8IE 3U4EG 1M1KC 3CQZH 3L7ZC 2BW2A 4M8MA 4TQUS 4K1RB 4DF7A 3I55A 1ICFB 1PFMA 4N8X1 3AE4B 3BJUA 3OG5A 2H89B 2ZT9C 3I91A 1YQBA 3KFUA 2V3NA 4GXBA 5LMNQ 2W3SA 1PRTB 5IYBG 2IPKD 1YHBA 2AUKA 2Y0SG 4ZQ3A 1Q82C 4ZCKA 2MSED 4JOIC 1VZ8A 5J17A 1BF4A 3H9DA 3R8BA 3NS8A 1I94L 1T0QC 5BYQA 3PIO3 4OVZA 4RH6A 3B2FA 5KIXA 5FJ8G 5C44G 1PGBA 2NPTB 3TRZA 5GADC 4W9FA 4NAWB 1E0BA 2F03A 4A4IA 3PZ8A 3NJTA 2FUHB 3J80c 2WB1E 2NCNA 1V9JA 5KHOA 4IZ8A 2PW7A 2K4KA 4OWXB 1OGWA 2KFJA 3I63C 4EUTA 2RGFA 4IURA 4NW2A 2PI2E 4Q2JA 3PF5A 4JCVE 4LJPB 5JOBA 4C3IG 4YY3Q 3NBHB 3U9SA 4C2MB 1EWYC 2I5HA 1V1OA 4Z9CB 5HKHA 3B6YA 3NELA 2B63B 3H0GB 2VUMB 4A3LH 1GJXA 4N58A 1PTOC 3MWYW 2BH2A 3I4NG 4G7OC 1E8XA 1U4AA 4A3CH 4OGQC 1XPUA 4N59A 2CKZB 2LGDA 4BOZB 2EYFA 2YVCA 2E2JB 1PH1A 2W82A 1MG4A 2M56B 4GLAC 4HTHA 2GVBA 2WNMA 2RA4A 2Q2HA 4DK1A 1DYQA 5IGGA 3MXNB 2INCC 2Z6KA 1GD7A 1IKLA 4ASWC 4MH8A 2F0PA 3A8KE 3OMCA 1CTMA 2WXHA 2MLBA 5C4ZA 3OLMD 2PLPA 1ZXIA 4RCOA 1NYQA 2K6QA 2OQ0A 2OJWA 1J8IA 3HVDA 1PH6A 1VQLA 4LTUA 2G5DA 1L6VA 1DOIA 2F3WA 1XYIA 4KHZA 1Y1WH 1NEKB 4N6EB 1Y8PB 2HHHQ 3NZUA 4R4CA 1PZID 1IGDA 2JA6G 1CKNB 1QNUA 1ZUD2 2KTRB 3PTFC 4R1JA 4PZ6A 1N62A 4P1BC 3TS2A 3MXGA 2ZM6L 3JC66 2C9OA 1SFOB 4QUFA 4YWGG 4CKCA 4AWJA 1N33Q 4HIOA 1VCBA 1E3PA 4XXEA 1K28A 1O78A 1TZOA 2I2YA 2WKCA 2R93G 4X65L 2LXJA 1EWCA 2IY0B 3QAQA 5E4WC 2BB5A 3Q24A 3IKJA 5C3EH 4NXNQ 2MBQA 3RPFC 3ZRCA 4C4VA 1CHPD 4X3TA 3CCRA 3DBHI 1WD0A 5ELDA 1MHHE 1JB7A 1STAA 2KVZA 1NI3A 4HCNB 3BVGA 3UE0A 3DMUA 1SROA 4HXDA 4JK1C 3GTOH 3AI5A 4KSKC 5FLMH 5EGTA 1BBUA 5IODA 5EKKA 2WX0A 1W6JA 5J39A 2N9KA 1BO0A 1SNMA 4JI5Q 2JVCA 2JA7G 3U4VA 5GAGC 1I4QA 3VUWA 3T8MA 4A3FH 1J7BA 3KLSX 2CS4A 3I8ZA 2VQEL 4RMAA 3K7AB 1EY7A 1CA6A 2WXOA 1CSQA 4K8JA 1F2RI 4MSMB 2J7ZA 2WB1B 1WGHA 2CVRA 3M4YA 2J0JA 3DBHB 4B3RL 1UWVA 1TTNA 2L0FA 2NWGA 3H15A 1IHZA 1C1YB 1HNXL 4M01A 1IKMA 1C77A 1J6QA 1T9HA 4B0MA 2JJQA 3URYA 2WDQB 3ZNHB 1ENAA 1H9KA 5HGQA 1PH9A 1VQMA 2CH4A 2D9UA 1UELA 1DOLA 2K28A 4X62L 1RYJA 2INNE 3UDFA 3GTGH 2JXTA 3ABVB 3DHHC 3Q8CA 4O42A 1LTSD 1SNDA 1P8LA 4G4KA 1ILQA 4F8MA 4PQXA 1SFOH 2EELA 2FFKB 2A5UA 4DK5A 3TREA 3M3YB 2L15A 4HIKA 3DVNV 3MJWA 1I94Q 4K2KA 2XTIA 2AUJD 2E2HB 1TVXA 4DUZL 5NUCA 2WXNA 3AE2B 3TEWA 3HOZB 4MJSB 2XWBB 3E56A 2WDVB 1YJJA 2K03A 2UUBQ 3ZXVA 3RFZB 2KT7A 2WXJA 1HA6A 1N32L 3QX1A 3HOXB 1WOCA 3ZW3A 3DM1A 4QY7A 1ZE3D 4JI8Q 4B95A 1WGKA 1GUNA 4KK7A 4IPGA 4ANUA 1TWAB 4UP7A 2CHBD 2Q8RE 4P7IA 3WCQA 4A3JH 3EIVA 1YJWA 3GTJB 3ML8A 1NY4A 4GU2A 5AFWA 5J3BA 3SK6A 2LHEA 1IBML 2K5WA 1T0YA 4DV3L 3CC4A 2ZPNA 3HRDD 4KJOA 1QLBB 3C1EA 1T5XD 5E7NA 4PYUA 3F1ZA 2UU9Q 4RHRA 1B3AA 5E3FA 4FYDA 1JE4A 1ZEQX 1WGGA 3HOUB 2SNMA 1TS4A 2MJ8A 3VHTC 4DV6Q 2IX0A 3A7LA 2SOBA 4W9JA 2O2LD 3ZJVA 4CDCC 2HD3A 3DVGX 4DU9A 1D5MC 3JAMi 2CKHB 2ZJDA 3A55A 4W9HA 4C3HG 1ET6A 4BY7G 3B1LX 1E22A 2ZZPB 3TSSA 2OF1A 2CU3A 1NE3A 2NVYB 5EBDA 2TSSA 4IFDI 1JE5A 4C7YA 1MG8A 5K36H 1K73C 3I4MB 4OVVA 1QVGA 1QCBD 2B76B 3GB1A 4XYOA 3D0FA 4DR7Q 3A9JB 3DWAA 5C4HA 2NZHA 2WU5B 3KDFB 3C19A 1YMHE 4X66L 1KRTA 1P0RA 1WRIA 4II2B 1ET9A 5CTRC 3FKIH 3D6CA 4JBJA 3OW7A 2N88A 4CDEC 4FN2A 2GOWA 3I56A 1B8AA 1LTBD 5IWAQ 4RGMA 4F7XA 2IHEA 3GTOB 4OL7A 1PA6A 3JAML 2DNCA 3A9KA 3E3XA 1GVPA 3NHHA 2WP9B 2DX5B 4KI0A 1PZJD 5G3LD 2PQEA 4OO1H 4DK6C 3P63A 3A9KB 4BKGA 1Q3LA 1MHWC 1B7YB 2JZPA 3A0JA 5IA7A 3BDOA 5AJ3L 5CBEE 3LGJA 3CCSA 3PIP3 2K5DA 5M3FB 2PNRC 2PZTA 2MO0A 1GC7A 4IKGA 3M4PA 4RGOS 1YJ1A 3SD5A 3V3XA 1A2TA 2ICIA 3IL8A 3PVLA 4JI1L 4TQ1A 2E75C 1FR3A 1LTID 4PNYA 3F2CA 1N36Q 3AEVA 2EKIA 2ATWA 3TDQA 4GMVA 3T51B 3CCMA 2LJ5A 3J81i 1WTWA 3CRLC 3LYYA 2R92G 2XSCA 1LABA 2DBYA 2I1KA 3R93A 3FRPB 3PIOA 3BYTB 4PMWA 1UGMA 1VF5C 2RBMA 1LGRA 2K5PA 2J0MA 1XLQA 1BVSA 3CCEA 2GBMA 2WXLA 3N1XC 4NP5A 4HWIB 3R7QA 1IYFA 4UP9A 3J7ZC 1NAPA 2WXMA 1C48A 4A93H 2WP8J 3HRZC 3VQIA 2VW9A 5M5WB 4LW1A 2K52A 4DNIA 2CW0D 4FXGC 2GBKA 4JPBW 3T1HL 2JWUA 3S17H 3DBLI 2CWPA 1PGAA 2WLBA 1YJ9A 2ASBA 2KHWB 2WQYB 4U673 1XCTL 2DZKA 1FMAD 5GQOA 4J3OD 2JN4A 2WKDA 4DHJB 3P42A 2UUCQ 2F0TA 3W1GA 4MTKA 4H13C 1SMYC 2WINB 1R4MI 2DAJA 2MBOA 3EFUA 1E5WA 4H7BA 2LRUA 2LY7A 4LAAA 4PZ8A 3GV3A 4BBRG 1CKMA 3E0EA 1TQOA 1GM5A 4NQKE 1WR6E 4QJFA 4N9PA 5M9OA 1P1AA 4RNAA 5J1ZA 3VVWB 1I4RA 2YV5A 4KX6B 3VR3A 3EFCA 1U4MA 2C60A 4B9WA 1W3SA 4B6WA 3AU5A 5J2RA 4L5TA 1HZ6A 4IWOA 3E6ZX 2SEBD 4JI6Q 2FIDA 4K14A 1IBKQ 3QK0A 5I6YA 1EY8A 2G45B 1PRTC 3K5MA 1YI2A 1QILA 2K01A 3NSWA 3R2TA 4LNFA 1SNOA 2IO1B 2A74C 2JRHA 1EUVB 2R61A 2EYJA 3NTKA 1K83B 4C1NI 5G2NA 1E90A 2N78A 1WXSA 2HIXA 1G2SA 1BCPD 4HJ7A 2O6VA 2N9EB 4J6IA 3HVZA 1KLGD 4B08A 2BYFA 1U5KA 5D3DA 1SXTA 4C3IB 2LGXA 1N61A 1K0SA 1GKHA 1T5EA 1VQ4A 2XIWA 1B1ZA 1K8MA 1XO3A 3KH0A 2PMZE 2F0IA 5LMNW 1ML0D 2KJHB 5IT9c 4MGIE 1PTOB 3C2PA 1QOFA 4A3GH 2UXCQ 4JBWA 2WGSA 1FRRA 4BY1B 3PO2H 2NBUA 2K5QA 5CV6A 2IO3B 2NB0A 3DWMA 1NTGA 3FMCA 1K52A 1YN3A 3PT2B 3B08A 3APFA 2DZIA 4A8XC 5EPKA 2N7DA 3T16A 5C4XH 3GTPB 3CC7A 1WE7A 2KDMA 1Q10A 1O7ZA 4DXFA 3HOWH 1KH0A 5EE3A 3PGZA 3RNAC 4IO9A 3I57A 1MJEA 1D6EC 4LF7L 1HZ5A 4RM9A 4CKBA 1SE4A 1V9PA 1B50A 3GZNI 4IM0A 3SK5A 5C3WA 3U7ZA 2C5CA 2QILA 1HR0L 1KQSA 1GJZA 1FD6A 3IAM1 4LFBQ 5CMDA 1X55A 4JW0A 5CV8A 5DM73 1VZ6A 5AZHA 2R7FA 2EIFA 3EC8A 3I72A 2N4FA 4X66Q 4KSLC 1HRJA 1C78A 5KYLA 1LACA 4TKNA 4DAPA 3H6NA 5C1ZA 4LK1C 2XVSA 1EEID 3K58A 3PLVA 5C0XJ 3KYHC 3IG3A 4NPNA 3A1QB 2BKRB 3VYUA 5KNBA 1KRHA 3I4LA 1JMCA 3X0WA 3OPOA 2A68D 4RA8A 1G91A 4DBGA 3BVMA 1FPYA 3HOVG 3Q14C 3ECIA 3N1YC 2GB1A 4ZUIA 4DQOC 1PDXA 3PUXA 1KABA 3FAHA 4V190 3ZLZA 1U4LA 4QIWB 2OHFA 2ZTDA 3HHMA 1PRTD 3IRBA 4MM3B 3CPWA 4REZA 4PZ7A 1VQNA 2JA7H 2L3ZA 5AUKA 3HZXA 4BBSH 2DLBA 3TS0A 5G3LF 5C5MA 1UBIA 1I3QH 2KO3A 5H8YE 1L1OB 1EQVA 4KIKB 4DV3Q 3NS1A 3RULA 2QEJC 3KF8B 2BDNA 4S3SA 1OEYA 4IUPA 4BKSA 3JAME 2E2JH 4ZK9B 4FO2A 1O7IA 4WQMA 3ZRFA 3AE6B 4IC7B 2JYTA 1SMYD 2XN9C 4L5RC 3CWIA 4ZRKA 3H91A 1SIFA 1C79A 2EYPA 2IHFA 1XPRA 4DXGA 1O7YA 1YN5A 2G9HD 4AYBG 1KNEA 5FJ8H 4GOPB 1PH4A 3I9V1 3MXPA 2JYOA 1QOHA 2NVTH 4YSXB 3FPUB 3E9HA 5EE9A 3AB9A 4MIUA 2GRIA 3L2PA 2A73B 1SMXA 3MXNA 3TP8A 1IBLL 1BCPB 4WORA 2AEHA 2JA5G 1A15A 5CC4A 2LEKA 2SAKA 3OJ3A 1CSPA 2Q8TA 3CCQA 3SXHA 4LJZC 2KX3A 3H3VI 3FDTA 1AEXA 2N49A 2Z0EB 1SGHA 1WTQA 2NBWB 3OWFA 4CBVA 2OJRA 1WI5A 1I4XA 1IW7D 2KDFB 4KGTA 3A4SC 3LJ3A 4X57B 1HZCA 3D3RA 3S9WA 2KECA 2JZZA 1C9FA 4UHVA 3L9AX 2B2TC 1V43A 3CCVA 1R7SA 2KYWA 2WAQG 2WX1A 4B9XA 2F0WA 1TIFA 2ID0A 2ICEC 1TJEA 2ZVOA 4DV5L 3Q3NC 1PH7A 4CO7A 2ZXPA 4EQ5A 3BIID 3M95A 4X6AH 2L00B 3HOUG 2XK5A 1TT2A 2E2IB 4LMQD 3I3CA 4YIJA 2IY5B 2AMCB 2W54A 3CXCA 3EFXD 3MHSD 4L2YA 3SR1A 1FJGL 1LTAD 2F1MA 3S1RB 3MP9A 4JI5L 4FF3A 1N63A 2J0KA 3ZYYX 1UEAB 1DD2A 5T1GA 2KOXA 3H6MA 1SR3A 1TY0A 2EJMA 4IN3A 1NNXA 4A3LG 1QZEA 5EPJA 2IO2B 3TBLD 3W5OA 5HURA 1F2RC 4FXDA 4BAXA 4JI4Q 3L54A 5EBCA 5JEAH 4BY7H 1B3QA 4YSYB 2BQQA 3W5VB 4BA1I 1TBEA 5IAAC 2JUOA 2NVQB 4GOCA 1ZW7A 3QOJA 1J5EQ 2K8CA 3W2DA 1Q86C 3G7LA 2K75A 2JA9A 3G71A 2Z0DB 5AZGA 2K50A 1PTOF 1TWFH 3TEZA 1A63A 1PGXA 4W9CA 4GZYC 1BCPC 1CKOA 2KTRA 4GB9A 3NBIA 3W1BA 4KTAA 4RHSA 4HDOA 4NJ6A 1VQFA 4DWFA 1N8RC 5CGKA 1QF6A 3DOWA 3EROA 3H7PB 3SFDB 2ZM6Q 3T3NA 1XLNA 4ZUJA 4A3FG 1XNRL 2PMVA 3NBHA 4X62Q 4FLHA 4FJZA 2MP1A 3W3AA 1RKNA 3GQBA 4DV4Q 5LHY1 1EOVA 1J7AA 3AE8B 1OXTA 3L17A 1JWBD 4A3BH 5FLMG 1DJRD 3AQQA 3C1FA 5CV9A 4DFAA 3Q8DA 3H7SA 2XWJB 2K9XA 4QAYA 3PMFA 2UU7A 3AEDB 5DAUA 4RKLA 4E6IA 3KYCD 1SAPA 3PV0A 2KWVB 2RSNA 2KDBA 3DXJC 4DHZE 1IBXA 3KUCB 2HQEA 1V1PB 2MJ3A 1C76A 2HJ1A 1HZBA 3L0OA 1TWCH 3WWVA 1IBXB 4ZLTF 4USAA 2KNBA 4GIVA 2H5XA 3ZUNA 1K0RA 2B63G 3TP7A 3GTQB 1I42A 4I6PA 4L8JA 1EYGA 4US9A 4OW0A 5C2TB 5LLIA 3KBXA 2LFIA 1LTGD 1XMOL 5LMUL 2KDIA 1NENB 1J19A 4X65Q 3IT4B 2ZJRA 1AH9A 1B70B 4P1CC 3U4ZA 2PCFB 2A68C 4B3ML 2ALYB 3Q3FA 3MHZA 2B2UA 3A56A 3BS1A 1XLOA 2HT1A 1N33L 4A20A 1KJTA 2LXAA 4GN4B 1H9JA 3RLNA 3DVNU 4H0LC 3ML9A 1FCCC 1Y1VB 3R3OA 3S1QB 1UE7A 5CV5A 1U0LA 3RCZA 3APCA 2RQXA 1VRAB 4DHJD 4XDXA 3SE0A 3N52A 1AN8A 4KMUC 4B3MQ 2VZKB 2PO4A 4MJSA 1SE8A 1FNVA 1Y14B 2FCSA 4NKLA 4LF4Q 3QIJA 1VQ6A 4FADA 4YCVA 2B8FA 2KOLA 4DR4L 1H8CA 2EYLA 3QWNA 2KQ4X 2QA4A 4GLSC 3WAOA 2YTYA 1WX8A 3FKIB 1UEBA 2NN6I 4W9LA 3CRKC 4NMZA 2LFNA 2Y0SE 1TKGA 1HTPA 1FFVA 1N6ZA 1EU3A 1EIYB 1W2BA 2M17A 4WWOA 1ZDXA 2CU1A 1OQQA 3SU8X 3PO2G 1IYVA 3WANA 1XEEA 1XTCD 4WJNA 1GUOA 3HGBA 1S5FD 4K5XA 2IX3A 3PO3H 3S2DB 2VQFL 2KJXA 4KGRA 4B3SL 1ESRA 2LJIA 3AFQA 1E0ZA 4ID6A 2BH8A 1VQCA 1QUQA 5C44H 4DR2L 3QWZB 2O2VA 1HR0W 1B9RA 1U9RA 3S2HH 4IPDA 4LF8Q 2KAJA 2V1CC 2DN8A 2D3BA 3HM6X 4ZKCB 4N9TA 1KTKA 2KEDA 4MZ9A 4EE2A 2QJLA 1QNKA 4EQNA 5IGBA 2N8NA 3H0GG 3HOYH 2V0GA 4J6HA 4PS3A 3EUB2 2KA7A 3U58A 3RZWC 1WTOA 4TVAB 2B2WC 2KEEA 4R4OA 3CSTA 2PQAA 5E4XA 1YD8U 1YX5B 3R7RA 4RGNA 5EKIA 3RNBC 2ONQA 4EZLA 1TWGH 3JYUA 4HJ8A 2PIAA 1Q1OA 1GHJA 3BK2A 2RHQB 2UYZB 1IXRA 2K5NA 4IUVA 2BT6A 3L4PA 3Q3OC 3QQ8B 1UE5A 4A3PA 4ZKBB 3MFYA 3V2TA 3AEAB 3NP8A 2Y5BB 3ZVVA 4I6NB 3DUZA 2JYEA 4POGA 5I4DA 4IOAA 4J1MA 2YU9B 5ELCA 2O4XA 2UXBQ 1P98A 3PIPA 2EJFC 1YNJD 1RTNA 4AIMA 2R7DA 2R3ZA 3JVZX 1GHKA 5JJLA 3GTKB 4TSSA 1STEA 3LB8C 1L1OC 3PQIA 4DNRB 3PUYA 2Y5CA 2D0OA 2MJEA 2EMTA 2MBBB 3DDCB 2Q2UA 3A5ZB 3P4SB 3AN1A 2VB3X 1P7EA 3E9SA 3DEPA 1KXLA 2E8GA 3K9OB 1VMPA 1GB1A 2PMZB 3R2IA 2VXWA 4K6DA 3LNNA 5IGCA 1YHQA 1H9MA 1N60A 4G57A 3VXWA 2EY1A 2RDGA 2JXMB 5EQ0A 5KEEA 3K7AH 1C4CA 1G6PA 1PTOD 1WTPA 2BWES 2WXQA 2UUAQ 2RR9A 1JQ4A 1Q12A 4DUZQ 4IUTA 3S1MB 1BR9A 5FO8B 2BB6A 2BYVE 4BKSD 3PUWA 1YITA 2DENB 1BCPF 4CGYB 3PS6A 1NBWA 1X3GA 3A8JE 4DR5Q 1ZGUB 2X8XX 1YVCA 2OEDA 2KHIA 1CFMA 4KJNA 4HIMA 1XNRQ 4ULLA 2L8JA 3WDNA 2D2QA 2DYOA 1L0WA 3MTNB 3TIXA 1C8CA 3KWVA 1CKNA 2HD5B 1KAAA 2GBJA 2R2OA 3KDFA 3S14H 1BT0A 2KJ6A 3Q69A 5AZFA 3UQAA 3MZ5A 4C3HB 3J7YW 1Y8NB 3TMPB 1DCZA 1SNPA 2EQSA 1LLRD 4DAYB 1HNWQ 2JA7B 1SE9A 2ES2A 1SRUA 1WYWB 3NVWA 3K0YA 1C4PA 4HVBA 2M0AA 2SDFA 1ENCA 3FILA 3Q3MC 4LJOB 1STBA 3OAWA 1DM0B 2I0QA 4N9F4 5DPSA 1A2UA 1XCQL 4N8FA 1K8AC 4MTNA 2KJRA 1D1IA 2L83A 4ZRQA 4LF9Q 3AV8A 1I4GA 3MC9A 3A7AB 3J7AV 1AW7A 3FEWX 1I4PA 3NRZA 3ENEA 3FHWA 4LDTD 4S0RA 1D2BA 3QIAA 3WOFA 1Q0WB 1VQOA 4LF7Q 4IM2A 1IP9A 2NTSA 2F0MA 5IGEA 4JYAL 3G48A 2HUGA 3QG1A 1WR1A 1L7YA 5I6WA 2RMMA 2WXKA 5FKAC 1S5CD 1SSNA 2ZTEA 1D4BA 5KYIA 1Y1WB 4BVUC 2B2UC 1CK1A 3GTQH 3R3MA 1BQQT 3CQZB 3QCAA 2PPBC 5JHBA 5M5XH 4BBRH 4K81A 3NVZA 2KXJA 5D3IB 3DHIC 4AP4C 3K0XA 4K6LA 3ICEA 1E24A 3PRMB 3N9YC 1TR5A 4K0KL 4DDGD 3STBD 3ULPA 1QB5D 3OIPA 4XYCA 4HKQA 1GB4A 4EX5A 3M7NA 2ZCCA 2M9VA 4Y52H 4A3DB 1ZKOA 4HRSA 3VAWA 4HJKA 2DNFA 1IYJB 5C23A 2W3RA 1I6VC 3RNFC 4IUQA 3MEFA 1X9NA 1C3TA 3ZJTA 1IZ6A 4C2MH 2F3VA 4YSZB 2V3SA 4CDFC 1GG3A 2EY2A 1HA5A 2FMMA 1XQQA 1EUJA 2KCCA 2PVOD 2L4NA 4DK3C 4DK0A 4A3EG 1ISNA 2DWQA 2ZNVC 3PLUA 4NXMQ 3BZKA 5BN4A 2HTME 4IQZA 2GBRA 2MO1A 3D6WA 1FNUA 3H94A 1Q81C 2HJ8A 2L5TA 1FXAA 4A3BG 2VUMH 3GOEA 3LWUA 1GXDC 3F2BA 4BXXG 1R4NB 2L52A 2QDBA 3UIPB 2ENBA 4IALA 4AUQC 3HKZG 1WXMA 1CHQD 1HPCA 1OO9B 4LK0M 1C4QA 1TWAH 3ULLA 2KQSA 2WDTB 4YTPB 4BZAA 5IKCM 3RMHA 2MA9B 1P9DU 5M5YB 4OEMB 2QW7A 3BYYB 2MGSA 1EO6A 3KLSA 1K9MC 3T1HQ 4ILWA 1WYDA 4CJ2C 5T8IA 2JA6H 4HMJA 1RJTA 5AUIA 4BBRB 1LXDA 4DHZB 2CQAA 1F0ZA 2I5LX 3M9BA 3Q6BA 3VR4A 2KACA 3C0RB 1STGA 1TU2B 1MJCA 4OO1G 1J8CA 3A1QA 2O6VB 4GOPA 3MEHA 2A5HA 1I5FA 2DJGC 1Q5WB 2K1FA 4NNJB 1YEZA 2QDLA 3H3VC 4MGZE 3T56B 1FRDA 1L0XB 3FKYA 5TR5A 3K80C 4UDUC 3VYTA 3MVVA 3RD2A 5DPWA 3PPAA 3ZKJC 1NMGA 1KDBA 2M00A 4IUUA 1NBFC 4FULA 4JLCA 1YNJC 3NQTA 1QOGA 2NYZD 2Q2IA 2NTTA 5JVH3 4JI6L 1X1MA 4WH4A 2NVYH 3VR9B 3D31A 3J80L 4Q0FA 2JEAI 3RT3B 2BOSA 3TCAA 4I7ZC 4JBMA 4BKTA 1JOOA 2GN5A 1M8AA 1V5OA 1MI2A 2MUYA 5FLXc 1L1OA 1IL8A 5JEAJ 1VQEA 4YHHL 2QHOA 5D94A 3RD4A 2L7RA 2X6LA 1D7QA 1GOZA 4EOYA 2EOTA 4TUUA 4LUZA 1J7CA 4JVZA 2K05A 1N34Q 4A3MB 3AEGB 1G291 1SNCA 3A4RA 1STYA 2PZWA 5CV7A 3BU2A 4KHVA 4YHHQ 1C7YA 2JA8B 3GTMB 1F2ZA 5JJIA 3HM3A 2ZW1A 3UI2A 4KN7C 3QA8A 1O80A 5G55A 2V1YA 3NEMA 1TIID 1UBQA 2JZ3B 4MNOA 3S1NB 5IWAL 1SN8A 4BY7B 3KVFB 2V4DA 5C6AA 1F2MA 4JC0A 2EJGC 4KV6A 2DGYA 5CV4A 3UQBA 2Q2TA 4YCWA 4EGVA 4WWPA 4WJPA 2Z4IA 3I4MG 4IOCA 4HK2A 3HFZB 1V97A 4EVOA 1EZ6A 1Q90A 1I6HH 1C0AA 2G1EA 2PKOA 3RZOB 1RLFA 4KY7A 1VF7A 4P73A 3AEEB 4WWNA 2MP2B 4QMGA 2NPTA 2F0VA 1VQKA 3C3LA 1LQBA 1LFDA 4C3JH 2KHSA 3ND9A 4YWLA 4ICUA 2F4VQ 2KCNA 4K0KQ 4OIKA 1CMXB 2N1WA 4BBNF 2A1AA 2W9NA 2F0KA 4XIGS 5CR3A 3QJZA 4ARIA 3T1YQ 1JMLA 3OTOL 2AYOB 4JWUC 2E74C 3BZCA 3L16A 4YL8A 2PVGC 5AJ3Q 2AQ2B 2HE7A 3J7AF 5I9PA 5J22A 2WXRA 4E3CA 4DR2Q 5IN7A 1VDZA 4AJWA 5M3FG 1WXAA 1CZPA 4RF0A 3M85A 1YHAA 1E7ZA 1JICA 2QDFA 3N30A 3SHQA 1N9WA 1HJPA 3S17B 3AULA 4LF6L 2INDC 1ZYRC 1HUNA 2NR2A 2QCZA 4LNNA 3RLOA 1RHPA 1LYLA 1SBBB 1X3FA 2AX5A 3N1ZC 5M3FH 2H4OA 1S1QB 2MNAA 2KFKB 3AE7B 4NPSA 4IWQA 4HCEA 4A3EB 5IYDH 2B2YC 2E5LL 4LFCQ 2JT4B 2ZPYA 3NXWA 2REXA 2XNAC 1OTCA 2YEPF 2MP2A 3I2ZA 2E6XA 5JAVA 3UI3A 4DR7L 2INPE 3TL5A 4KHPL 1E7VA 4A6QA 3RZDH 2B2TA 2JQOA 2DHZA 2N9LA 4IDIA 4MH0E 2VZAA 2LRWA 1PRTF 1NR4A 3X23A 2PW5A 4MEMA 4IJLA 2JPHA 2M8SA 3Q8FA 2FAZA 1RFAA 3H3VH 2CJNA 3G4SA 3B0AA 2D62A 2PE9A 4LFAQ 2J4XA 1K83H 2F0JA 4DV7L 2P5ZX 3Q0AA 4A3JG 1N36L 3VR5A 3GDEA 4GKKQ 4QUCA 1QT9A 3EBEA 4A76A 1M90C 2KN5A 3NZSA 1WJ4A 2ZXOA 2LD9A 4K7SA 5JHAA 1OXXK 4WJ4A 3OMGA 1XMQQ 3HOZH 1ZOYB 1TKYA 2KDEB 3EHVA 5MPOA 2UU9L 1KF6B 5GAEC 2EVBA 5LNK1 2C7MB 4GNXB 2NVXB 2QCPX 3HOVH 4WJQA 3NUCA 3KOJA 2QC8A 5A2QE 2K5VA 1R9TH 1XD3B 4PS7A 3LX0A 2EZVA 3AM9A 1HHVA 1TKEA 2OT2A 3OIQA 5HY6A 3MC8A 4DXAB 5L95C 1NYRA 3S1MH 4FXCA 1E9MA 5L37A 1KDAA 1F9QA 1N32Q 4A90A 1TS3A 4K5WA 1YJNA 1IW7C 2A6ED 4EZJA 3GTGB 3ZTCA 2M0XA 3HKSA 4JBKA 4OWWB 1ZP0B 1HQMC 3P7JA 3UDXA 2WYQA 1VJKA 2ZEQA 1AZQA 3Q6SA 4U68A 1JOKA 1Q8IA 1RCVD 1VQPA 2N0SB 1EF5A 1HE8A 4C3JB 2H88B 4AQ7A 2IWHA 3NQIA 3N6RA 1KLVA 1MSGA 5GAHC 4APVA 4DV0Q 3GV6A 4NB3A 1N5WA 3KW5B 3DEOA 4K3CA 3QO2A 4MACA 1VQAA 2K39A 2M4NA 1Z7TA 2CW0C 2RSUA 1PTOH 2BCOA 1HNXQ 2VY3A 4RG1A 1L6UA 4A3BB 3IFTA 4JI7L 2TMPA 4DV2L 4R4IA 4FXKC 1TYGB 4DV6L 3PUZA 3D32A 3J80i 1MVKA 4L23A 5HFYA 5DM63 4KDIC 4MM3A 5DPRA 1V1PA 3T3OA 4P74A 1FGUA 2D10A 4JYAQ 2F0HA 2FXQA 3TZDA 2VQEQ 2NVXH 2WXPA 5LL6X 2A6EC 2JA5B 1ZXHA 4B3SQ 2JY6A 3PSEB 4PV1C 2PTLA 3IBEA 4NY0A 3P4RB 5BR8L 4DNTB 4LF9L 1WI0A 1IYUA 5BO4B 2K14A 5IYBH 3VYRA 2DYBA 1XNQL 1E7UA 2B2YA 3HOZG 2E76C 1HEZE 3CSFA 1MIUA 3M4QA 3L08A 2NVQH 1DOKA 1ACCA 2JX5A 1ASYA 2QSDA 4NXNL 2DZMA 2Z1CA 1HNWL 4G7ZC 4ZYNA 1WMHB 4HSPA 3IAYA 1K8OA 3UIOB 2BF8B 4DV5Q 3VA7A 2KWCA 2WXGA 5EE1A 2X69A 3IXSA 4K5VA 1TY2A 1D8LA 3D4WA 4R4QA 2ZW0A 3NVVA 2PQAB 2KMMA 1JQYD 2K22A 2CHZA 3CW2C 3M62B 1E8ZA 2FUG1 4DV0L 3D8GA 5FO7B 1C9OA 4C56C 3CF6E 3RN5A 1SJED 1S40A 2O5IC 2B29A 2PI2A 3J7A5 1E2VA 3RLFA 1WTXA 4DAVA 2HIVA 4HJ9A 3A9JA 4FNFA 2Z4HA 3S24A 2LVOA 4A3KH 2KENA 4YT0B 1QQRA 1WM2A 3I7FA 4B3RQ 5AEKB 1RDPD 3PCOB 2R92B 3I4NB 3AU4A 3UINB 1LM0A 1WYGA 3H09A 1V81A 4ZOHC 3V6CB 4HLEA 2V4LA 1TS2A 1F9RA 2VQFQ 4FDBA 3CCJA 2XK5B 1FEHA 4OELB 1HQRD 3RN2A 1WX7A 2NS5A 4P6VF 2KN4A 4ODGA 4JI3Q 1VD2A 5D7GA 1KHIA 1IL2A 4KKUA 4GN3B 4LNKA 5KHQA 1RAXA 2GA4B 2RCFA 2WV6D 4QGUA 2R7ZG 2Z8LA 3NVYA 4HPLB 4WJWA 5IP9G 5EE0A 1BMLC 1H95A 3SDLC 1L2FA 4O2DA 1CM9A 4FF2A 1QOAA 4MSQB 4XYQA 2UUBL 1YNXA 1S5ED 3MFGA 3V6EB 4BBNC 4XQNA 1CI3M 4ALPA 4QCLA 2CHWA 2PE6B 3DWQA 4ANVA 5BYRA 5E6JA 4WJ3M 4YY3L 2MJDA 2IO0B 2R6GA 1LTLA 3E5SA 4XTCS 2KD0A 3DM3A 5ELNA 2JA6B 4WQOB 4GKKL 2ASQA 1Q1EA 1HFGA 5CBAE 1HTLD 1KD1C 1VS0A 3UDGA 4MT5A 1EY5A 4OWTB 1ZPSA 3TEHB 1YOVB 2EY5A 1Z6HA 1XWEA 1BUIC 5EKLA 1Y1VH 3S1QH 4CYEA 3M4OH 4RKBA 3DHQA 2W55A 3L0WB 4FHJA 5D6JB 4HEDA 3QC8B 2D3AA 4B3TQ 4JV5L 4NZLB 1RM6C 2G3QB 2XBBC 5KNDA 1TT5B 3O65B 4RWSC 4HJAA 3EVQA 1YN4A 2Y5PA 1G6JA 2K3UA 1MSHA 4QQBX 4OIJA 2PPHA 2DZJA 1YNNC 1EQRA 4EZKA 1Q7YC 2R93H 2K25A 2VS1A 1UWMA 3S16H 2O6VD 3VRAB 4DR3Q 4B0EA 5I2YA 1JW9D 1ZDVA 2LXKA 5BR8Q 1H4RA 1GO3E 3GTMH 2RPVA 4ANXA 1FYCA 4ZRIA 1VQIA 4IFDH 3GTJH 4DR3L 3P75A 2JRIB 4JI2L 3P4QB 3NTIA 5BMIA 1K8GA 4NQLB 1AZPA 1SE3A 1TWHH 2WB1G 3PRPB 2KWUB 4GDKA 1VQ8A 3BK1A 2L0TA 1TS5A 4C7ZA 1A3UA 1RTOA 2K1BA 3ULJA 4L5SA 4GNXC 1EEFD 1VQ5A 5C4XG 3S2HB 1YIWA 5GMVA 2WACA 2K32A 2O5JC 2EMSA 3SEBA 4JI7Q 5FLXL 2D3GA 1WTRA 4NJCA 2MQJA 3VDZA 2BKFA 2KLGA 5JPMC 1VQ9A 4PMCA 3TP5A 4A3FB 1SJHD 5KRUA 1PLFA 3FKIG 3UE1A 3GE8C 2AWNA 1JR0D 1I50B 5D65A 2LASA 3PV1A 3K7UC 1EWHA 1OFFA 2LHDA 1WGYA 2KHJA 4A93G 4HPPA 4GLXA 4XZ4A 2SNSA 4BY1H 3PO2B 4E74A 2RDBC 1A6XA 1PYWD 3I4MH 1YQ3B 1F77A 1D1KA 4X64Q 2IL8A 4AYBE 1W6KA 4O0AA 1E10A 3H0GH 3HOYG 1F2YA 3PHXB 5DCNA 4DGZA 3DVGY 5JVG3 2LUMA 3HEJA 3B9JA 2D11A 1HTQA 4GN1A 4M8NA 3J81E 3J9CA 3FC4A 5DNFA 1QZHA 1EYCA 4OZAA 3FPPA 4B9KA 3OOCA 3IT6B 1IGCA 2WU2B 4KD4A 4IUMB 2DUDA 2BWFA 2IGGA 2LMCA 1XXGA 3T9LA 3UF8A 1YNTE 3CHBD 3L13A 2D3CA 4DA2A 2JA5H 2L05A 1LT5D 3E0JA 5ELBA 4AH6A 5T1IA 3ZNID 1U4RA 1VQDA 3LXFA 4C80A 1VZ7A 1WJNA 2WAQE 1AWDA 3VFKA 1BOSA 1ZYRD 4P75A 2F0SA 2JK8A 5HGTA 2AL6A 1QG7A 3ZGZA 2O2VB 3K9PB 3M63B 2HDEA 3VUYA 4WURA 3HS0C 3M3JA 2MH7A 1ONLA 5ELFA 3ONSA 4HR7B 2JF5A 3A5UA 1JORA 1K51A 2Q8IB 2WXIA 4RM8A 5EPLA 2I07B 1GUWA 1V2YA 3IFWB 1E6EB 1UH6A 1CQVA 2HCCA 4K2LA 4AQYQ 4GS3A 2NMQA 2DYMA 2LVPA 4ANWA 1AFPA 1L4DB 2MW5A 3N3KB 3VTUA 3R66C 2A8VA 1CQFA 3VRBB 3W1SC 2RHSB 4A3IG 1MGSA 4C1NK 2IDYA 3I73A 1J5EL 1Z9FA 1WXVA 3CIRB 1I3QB 1TWGB 3STBC 1PHJA 3MXUA 3AMUA 3NHEB 4ZAIA 5COYA 2LGSA 2KBNA 2MQHA 3PUVA 2CFMA 2R93B 3NWTA 2XGTA 3SK8A 1JWSD 1XLPA 2YYZA 2WS3B 4KD3A 4S17A 3A54A 1Y8OB 2LMCB 1WCMG 1JWAD 1E2WA 3QOLA 4DN4M 1UD7A 1Y8RC 2C35B 1WZ0A 4MGKE 1II3A 4LF6Q 3BG3A 3K5OA 1EM7A 1D5ZC 1EZ8A 2KC1A 4H02A 4GDLA 3ZO5B 1V6EA 3U2SC 2KUMA 3HOVB 3OW2A 4HEA1 1EY9A 2VH2A 2A6HD 2K6AA 2L12A 2WFWA 3RI7C 4HKZE 2QKIC 4O1NA 2UWQA 2JXXA 1BNZA 2EPBA 1SYCA 1VLBA 2D5GA 5G5GA 3F2DA 1CJEA 4HJ5A 5IOCA 2I38A 1HNZL 1GAQB 4OHJA 5M3MB 2I1JA 2MBHA 4G0NB 1XPOA 3V60A 1RFKA 5GROA 5FLXE 1PFSA 4CQNA 5CHVC 1QE6A 4NXML 1ICWA 1G51A 5EJWA 4DKAC 5M5XB 1VMCA 3P20A 2BA0A 2R2QA 2KFKA 1D5XC 1OQYA 2XRSD 2KMAA 1MJDA 4PMBA 3J81c 2F4VL 4CHKA 4GKJQ 1X3QA 2B8GA 1MI0A 1X65A 4JX1C 5C3JB 3MC0B 3CP0A 1UF0A 3SDZA 1EWIA 1I35A 3U50C 4NAWA 1A0IA 2ZJPA 3X3MA 3KLWA 1MPEA 2BS4B 2GLSA 1Q46A 2AWOA 1WZ3A 5BN5A 1STNA 5IYDG 1ESFA 3TQYA 3I4NH 1KM7A 4JPSA 2LI5A 3NUHB 2AWTA 5DEHA 4WWMA 3V61A 1EY6A 4PK1A 1FXTB 4X3KA 3K5NA 2R7ZH 2ON8A 4YTNB 1HFNA 4LWCA 4IUNA 1Z47A 4JQWC 1L2NA 4OX9L 1M94A 1Q8KA 5IIFA 1O7LA 2K5HA 5DLQE 1HNZQ 1S3OA 2GMIC 1ROEA 2IYDB 1UUPA 1WRDB 5LXIB 4LF8L 2JSVX 2RSOA 3DBRB 1GNUA 4ZHPA 4M1UB 2L76A 5F2DA 3AYHB 2RPQA 1GUTA 1F9PA 3F8TA 1WVLA 5M5WH 2WIIB 2F0GA 1I4HA 3S16B 1PMRA 1T0SC 2YEPB 2AKWB 4HCPB 4M0WA 4WIPA 3ZDMC 5JXVA 2OTLA 1OEYJ 3JW0X 2F0NA 1UAPA 4KKTA 4GNXA 4OO1I 4LNOA 1QWYA 4M0WB 4CJ0B 3ZTDA 2AHOB 2IT1A 4IPCA 3HOWG 1L0VB 1R4QB 3ZXRA 3VTVA 4LNQA 2G9DA 5J18A 4JI8L 1XJVA 1S5BD 2BS3B 2G4SA 2J0TD 2VUMG 5LXHA 4BS9A 1B2TA 2C5LC 2NZOA 2LKVA 2CCZA 5IP4D 1WGDA 1DOMA 3AEBB 2FE8A 2OTJA 1WFYA 2F0QA 2CHXA 2J7QB 3A74A 2KK8A 2N1VA 3S14B 3WA0A 4B3TL 1JCKB 4JV5Q 1FCLA 1TZ1A 4F7ZA 5IE8A 1WXQA 2HCIA 3RYTA 2H1EA 1QOBA 4IJHA 1T6BX 1WWTA 4IW0A 4G3XB 4YXDB 1UE1A 1L5PA 1X32A 4PS8A 1AARA 5C3EB 3HKZE 1HZ9A 2KZRA 2N7JA 1IBKL 3PF4A 3LWEA 5CHFA
chains in the Genus database with same CATH topology
2R7ZB 4KKJA 5BMGA 1T3QA 3BZDB 3AB5A 4P2CB 5HHDG 2BA1A 2WDRB 2FJ2A 1BXTA 4R9WA 2B2VA 2IGHA 4F88A 2NUCA 1JB3A 2RDFA 1OXVA 1FXIA 1MD2D 4L63B 3TBIB 2A6HC 5FK9C 5K5PA 5GXGB 3Q8BA 3TMEA 1SYFA 2QIEB 2LGIA 4ZRZA 3RZDB 3MTSA 3AEFB 2L0CA 1JRPA 1NUCA 3C46A 1SYDA 1SEBD 3X3NA 3W1SA 4R8IA 4HMIA 3SHLA 4H2AA 4EQOA 4A3KB 3HKZB 2A69C 3M7GA 2RDHA 4FP5D 3Q22A 2JQRB 4ARCA 2RVLA 1EOTA 1S4ZA 4JWSC 5C4XB 1JALA 1BDOA 5CORA 5I9OA 2J52A 5C5LA 3P4PB 4BA2I 1KFYB 1XF5L 1H9RA 4HSVA 3TEXA 3KF8A 2J42A 3ERQA 4M8AA 4L6TB 1R4PB 1UNSA 3NE5B 4HROA 2F0UA 3KBGA 4QB4A 2F4IA 2D5DA 1OQRA 3K5LA 1DOYA 1M4VA 1IUEA 2LS01 3EA6A 2PYKA 4ZRPA 2DNEA 1EYDA 2RKSA 1EFID 3AH7A 3U52E 1EY4A 2EYHA 3ZJUA 3MA2B 1STHA 2JSOA 2OXPA 3OWEB 1GPXA 1N5XA 3M4OB 1FFUA 2KQ3A 1CT1D 3ETRA 4RAUC 1ZXTA 4OZBA 1EY0A 5KNCA 4IFDJ 2BTEA 3PZ7A 4BBSB 2E3TA 2BDOA 2F0DA 4ME5A 5ELEA 4A3GB 4MHEA 2K04A 4XQJA 1LT4D 4KY5A 4DAYA 2KVMA 1FO4A 5ISRA 1R9TB 4BWGB 1GUSA 4IOIE 4XDDA 5A35A 2JU6X 4RCNA 1LV9A 1WD1A 4I65A 1TWCB 4HJGE 4PT5A 1SIJA 2IW3A 1YJIA 3EJIA 3HP3A 4KKIA 3F2UA 3PO0A 1RF2D 4RGTA 1LTTD 3Q23A 1I6HB 1Q1BA 1X3PA 1YQ4B 5C0XH 5JJZA 2AQ1B 1HXYD 4XDCA 5D14A 1FD7D 2FINB 1JC7A 1AP0A 4K8IA 1CZGA 1E7PB 4TMAB 2MEKA 4CHTB 2IJ0A 1WCMB 3I70A 3G6JB 3KLRA 3MAQA 3GS2A 2X38A 3MHBA 2B39A 4H44C 1TKWB 2OEOA 1SYEA 3ZQ4A 2I46A 2F0FA 1S5DD 2F0LA 3NPPA 1DXMA 1B9NA 2NBFA 2DY8A 1ENFA 3GP7A 1RD9D 3H8HA 1YNND 1OXSC 1FIQA 4V0BA 2IGDA 4GDKB 1PFBA 3DWGC 5HI1A 5HG2A 1WSPA 4HN7A 3QJYA 2L11A 1LTRD 3BVZA 3VR6A 4ITKA 2XRQD 3T13A 3CU7A 1ILPA 1QJOA 1SF0A 4RF1A 3W5UB 1LO5D 2HDLA 2QMTA 3VR8B 3MJ5A 2J53A 5FO9B 5BYSA 3V05A 2D2CC 3SVMA 3FVQA 4HAEA 1NSNS 4XT1B 1G2TA 4R8NA 3TN2A 1NCVA 1NR2A 2IX1A 4QF4A 3K59A 1AYFA 1VDVA 4EQPA 5A2QL 1DONA 3HOWB 2CJOA 2EYOA 4G7HC 3EGRA 4CJ1B 4TRDA 1A3TA 2DY7A 1HCZA 4NAMA 4D2KA 5G5HA 3AU7A 1L0YB 3DWPA 4WAFA 2VNUD 1QKZA 2Q5WD 2EE1A 5LL6S 3V96A 1DGJA 4A9AA 1LT3D 3NZ3A 2BBCA 1JOQA 4XWWA 3AE1B 3QB3A 1JROA 3TZUA 1MBYA 5BMHA 1WTVA 3K57A 5K36G 2X6GA 3P1MA 1B53A 5IT9L 1TWFB 2A69D 3D4RA 4CKEA 3SK4A 4RFBA 2NN6G 4Q5VA 1PDQA 2VB2X 1DZ1A 3EQLC 2HDMA 2AQ3B 4F87A 1SYBA 1B44D 4XT3B 2BE5C 2B2VC 3ITPA 4A93B 2V3PA 2PZUA 3RUZA 2L32A 1LT6D 1Y69U 3Q8AA 3GTLB 2L1AA 1PXUA 3S15B 2NZ1D 2BYTA 3T53B 3ONAB 1SE2A 1SB3C 3W9CB 4ABNA 1K53A 5KGUA 4KY6A 2KWDA 1JWMD 4P16A 3BDLA 4Y7NB 5FR3A 3AE5B 1B4OA 5C0XI 2ACZB 1BUVT 4WFN3 3AMZA 3HUIA 5TSSA 3AE9B 4C3JG 2QF7A 1GUGA 1U4PA 3BDCA 5CYUA 1PUTA 4WRDA 2JE6I 3GD7A 5IGDA 1JWUD 5FOBB 4ZHOA 4A55A 3IAS1 1Y56A 3KQ4A 3TP6A 4NDXA 3L3OC 4IFDG 4KN4C 4TQ0A 4YTMB 4AS1A 3NTHA 2L1BA 4GDLB 1C4AA 3D4DA 3OSOA 3KK7A 4KGSA 1FNWA 2K7VA 4A3IB 3I90A 1PFDA 2BS2B 2L55A 2L9HA 4X3SA 3HG9A 1NVID 4C7YA 3O13A 1UWXA 4R3DA 4XWTA 2WAQB 3VR2A 3WOEA 1RWSA 1VR9A 2EDGA 1KLUD 2WXFA 2JP1A 1K50A 1PZKD 5BN3A 5IT9E 1XX8A 1A70A 2K33A 1EIHA 4OZCA 1EQTA 3J81L 4J8QA 2PW9A 2K0PA 2EY6A 3FILB 3KWLA 1F2LA 1F9SA 1RODA 3P1HA 1I7HA 2M2LA 1CA5A 1L4ZB 2V4IB 2MHVA 2NN6H 3IFDA 3B2GA 4FF4A 3C8YA 5JEAG 5IGFA 2BE5D 4FVMA 1V8CA 2F0OA 3CKIB 2ZXRA 1EYAA 3VA5A 5C3XA 1FGBD 2N55A 2FBWB 1UGJA 4HCSA 1KNAA 5C0XG 1VCIA 1EL0A 2F0EA 3J80E 1H9SB 4X3UA 1A3VA 5H92C 4A3JB 4XE0A 3TEYA 3NK9A 2Y0SB 2MPMA 2GI9A 1P7FA 1EIGA 4TKOB 4LLGM 1G8ZD 3PO3B 1MHXA 3VYSA 3SR6A 3NWSA 2NVTB 1V8QA 4UAIA 3U9OA 5JPNC 1SSOA 1B9MA 1EU4A 5C44B 1DOXA 2EXZA 4JE3B 1FM0D 3AE3B 3HOYB 1SNQA 3Q8EA 2E2DC 1HUMA 4MN3A 2VZKD 2FHTA 2M19A 1CZWA 1PFNA 1BBXC 1OXUA 1E2ZA 2FMCA 1G6ZA 1J9OA 3K6OA 3GO5A 3SFEB 4XQQA 2B2WA 3TUOA 4FF1A 5E1FA 1H9SA 3AECB 3OHXC 5C4JB 2EYMA 4ZYSA 5I2XA 1SYGA 4US8A 1TWHB 3BWUD 3ND8A 4L1BA 2JEBI 3KUPA 1KDCA 4AYBB 3T4AC 1SDFA 4KKSA 3U4EG 3A8IE 3L7ZC 2BW2A 4TQUS 4DF7A 1PFMA 3AE4B 2H89B 2ZT9C 3I91A 2V3NA 2W3SA 1PRTB 2IPKD 2AUKA 4ZQ3A 1VZ8A 1BF4A 3R8BA 5BYQA 3PIO3 4OVZA 4RH6A 3B2FA 5KIXA 1PGBA 4NAWB 1E0BA 2F03A 3PZ8A 4IZ8A 2PW7A 4IURA 4NW2A 4Q2JA 5JOBA 4C3IG 3U9SA 4C2MB 1EWYC 1V1OA 4Z9CB 2B63B 3H0GB 2VUMB 1GJXA 4N58A 1PTOC 3MWYW 4G7OC 4OGQC 4N59A 2EYFA 2E2JB 2W82A 2M56B 4HTHA 2WNMA 2RA4A 4DK1A 1DYQA 5IGGA 1IKLA 4MH8A 2F0PA 3A8KE 3OMCA 1CTMA 2WXHA 5C4ZA 2PLPA 1ZXIA 4RCOA 1NYQA 1J8IA 3HVDA 4LTUA 1L6VA 1NEKB 1DOIA 2F3WA 1XYIA 4KHZA 4N6EB 1Y8PB 1PZID 1IGDA 1QNUA 1ZUD2 1N62A 3MXGA 2C9OA 1SFOB 4QUFA 4YWGG 4CKCA 4XXEA 1TZOA 1O78A 2I2YA 2WKCA 1EWCA 5E4WC 2BB5A 3Q24A 3IKJA 3RPFC 1CHPD 4X3TA 1WD0A 5ELDA 1MHHE 1STAA 1NI3A 3BVGA 3DMUA 4JK1C 5EGTA 5IODA 5EKKA 1W6JA 5J39A 2N9KA 1BO0A 1SNMA 1I4QA 1J7BA 3KLSX 3I8ZA 3K7AB 1EY7A 1CA6A 2WXOA 4K8JA 1F2RI 2J7ZA 2WB1B 2CVRA 3M4YA 2NWGA 1IHZA 1IKMA 1C77A 4B0MA 3URYA 2WDQB 1ENAA 1H9KA 2D9UA 1DOLA 2K28A 3ABVB 1RYJA 2INNE 2JXTA 3Q8CA 1LTSD 4O42A 1SNDA 4G4KA 1ILQA 4F8MA 4PQXA 2EELA 2FFKB 3M3YB 4K2KA 2AUJD 2E2HB 1TVXA 5NUCA 2WXNA 3AE2B 3TEWA 3HOZB 2XWBB 3E56A 2WDVB 1YJJA 2K03A 3RFZB 2WXJA 1HA6A 3HOXB 3DM1A 1ZE3D 1WGKA 1GUNA 4KK7A 1TWAB 2CHBD 2Q8RE 3WCQA 3GTJB 5AFWA 3SK6A 2LHEA 2K5WA 3HRDD 4KJOA 1QLBB 3C1EA 1T5XD 4RHRA 1B3AA 5E3FA 4FYDA 1JE4A 1ZEQX 3HOUB 2SNMA 1TS4A 2MJ8A 2IX0A 3A7LA 2SOBA 2O2LD 3ZJVA 4DU9A 1D5MC 3A55A 4C3HG 1ET6A 3TSSA 2OF1A 2CU3A 2NVYB 5EBDA 2TSSA 4IFDI 5K36H 3I4MB 1QCBD 2B76B 3GB1A 4XYOA 3DWAA 5C4HA 2WU5B 1YMHE 1WRIA 1ET9A 3D6CA 3OW7A 2N88A 1LTBD 4RGMA 4F7XA 3GTOB 4OL7A 3JAML 2DNCA 3NHHA 2WP9B 4KI0A 1PZJD 5G3LD 2PQEA 4OO1H 3P63A 1Q3LA 2JZPA 3BDOA 5CBEE 3PIP3 2K5DA 5M3FB 2PNRC 2PZTA 4IKGA 3V3XA 2V0GA 4RGOS 1A2TA 2ICIA 3IL8A 4TQ1A 2E75C 1FR3A 1LTID 4PNYA 2EKIA 3TDQA 3T51B 1WTWA 3CRLC 3LYYA 2XSCA 1LABA 2DBYA 3R93A 3FRPB 3BYTB 4PMWA 1VF5C 2RBMA 2K5PA 1XLQA 2WXLA 4NP5A 1NAPA 2WXMA 1C48A 2WP8J 3HRZC 3VQIA 5M5WB 2CW0D 4FXGC 2JWUA 1PGAA 2WLBA 2WQYB 4U673 1XCTL 1FMAD 4J3OD 2WKDA 3P42A 2F0TA 4H13C 1SMYC 2WINB 4H7BA 2LY7A 4LAAA 3GV3A 1TQOA 5M9OA 4N9PA 4RNAA 5J1ZA 1I4RA 4KX6B 3VR3A 1U4MA 4B9WA 1HZ6A 3E6ZX 2SEBD 4K14A 5I6YA 1EY8A 1PRTC 3K5MA 1QILA 2K01A 3NSWA 3R2TA 1SNOA 2A74C 2R61A 2EYJA 3NTKA 1K83B 4C1NI 1G2SA 1BCPD 3HVZA 1KLGD 4B08A 5D3DA 4C3IB 1SXTA 1N61A 1T5EA 2XIWA 1B1ZA 1K8MA 1XO3A 2F0IA 1ML0D 1PTOB 3C2PA 1QOFA 4JBWA 1FRRA 4BY1B 2K5QA 5CV6A 2NB0A 3DWMA 3FMCA 1K52A 1YN3A 4A8XC 5EPKA 3T16A 3GTPB 2KDMA 1Q10A 1O7ZA 4DXFA 1KH0A 5EE3A 3I57A 1D6EC 1HZ5A 4CKBA 1SE4A 1B50A 3SK5A 5C3WA 3U7ZA 2C5CA 2QILA 1FD6A 3IAM1 5CMDA 5DM73 5CV8A 1VZ6A 3I72A 1HRJA 1C78A 5KYLA 1LACA 4DAPA 4LK1C 2XVSA 1EEID 3K58A 5C0XJ 3VYUA 5KNBA 1KRHA 3I4LA 3OPOA 2A68D 4RA8A 1G91A 3BVMA 2GB1A 4ZUIA 4DQOC 1PDXA 3PUXA 1KABA 3FAHA 4V190 1U4LA 4QIWB 2OHFA 1PRTD 4MM3B 4REZA 5AUKA 3HZXA 2DLBA 5G3LF 5C5MA 5H8YE 1EQVA 3NS1A 2QEJC 2BDNA 4S3SA 4IUPA 3JAME 4ZK9B 4FO2A 4WQMA 3AE6B 2JYTA 1SMYD 2XN9C 3CWIA 3H91A 1C79A 2EYPA 4DXGA 1O7YA 1YN5A 2G9HD 1KNEA 3I9V1 3MXPA 2JYOA 1QOHA 4YSXB 3FPUB 5EE9A 3AB9A 4MIUA 2GRIA 2A73B 3MXNA 3TP8A 1BCPB 4WORA 2SAKA 2LEKA 1A15A 5CC4A 2Q8TA 3SXHA 4LJZC 3FDTA 1AEXA 1WTQA 3OWFA 4CBVA 1I4XA 1IW7D 4KGTA 3D3RA 3S9WA 2KECA 1C9FA 3L9AX 2B2TC 1V43A 1R7SA 4B9XA 2F0WA 2ID0A 2ICEC 1TJEA 2ZXPA 3BIID 1TT2A 2E2IB 4LMQD 3I3CA 4YIJA 2W54A 3EFXD 4L2YA 3SR1A 1LTAD 2F1MA 3S1RB 3MP9A 4FF3A 1N63A 3ZYYX 1UEAB 1DD2A 5T1GA 2Y3AA 3H6MA 1TY0A 2EJMA 4IN3A 5EPJA 5HURA 1F2RC 4FXDA 4YSYB 5EBCA 5JEAH 3W5VB 4BA1I 2NVQB 3QOJA 3W2DA 3G7LA 1PTOF 3TEZA 1PGXA 4GZYC 1BCPC 3NBIA 4KTAA 4RHSA 5CGKA 1QF6A 3EROA 3SFDB 3T3NA 1XLNA 4ZUJA 2PMVA 3NBHA 2MP1A 3W3AA 1RKNA 3GQBA 1J7AA 5LHY1 3AE8B 1OXTA 1JWBD 1DJRD 3C1FA 5CV9A 4DFAA 2XWJB 2K9XA 3PMFA 3AEDB 5DAUA 4RKLA 4E6IA 1SAPA 3PV0A 2RSNA 3DXJC 1IBXA 2HQEA 1V1PB 2MJ3A 1C76A 1IBXB 4ZLTF 4USAA 3TP7A 3GTQB 4L8JA 4US9A 4OW0A 5C2TB 3KBXA 2LFIA 1LTGD 1NENB 3IT4B 2PCFB 2A68C 3MHZA 2B2UA 3A56A 3BS1A 1XLOA 1H9JA 4H0LC 1FCCC 1Y1VB 3R3OA 3S1QB 5CV5A 2RQXA 1VRAB 4XDXA 3SE0A 3N52A 1AN8A 4KMUC 2VZKB 2PO4A 1FNVA 4NKLA 2B8FA 2KOLA 2EYLA 3QWNA 2KQ4X 4GLSC 3FKIB 2NN6I 3CRKC 4NMZA 2LFNA 1TKGA 1HTPA 1FFVA 1EU3A 1ZDXA 1OQQA 1IYVA 1XEEA 1XTCD 1GUOA 3HGBA 1S5FD 4K5XA 2IX3A 3S2DB 4KGRA 2KJXA 1ESRA 2LJIA 1E0ZA 4ID6A 1B9RA 1U9RA 2KAJA 2DN8A 4ZKCB 4N9TA 1KTKA 2KEDA 4EE2A 2QJLA 1QNKA 4EQNA 5IGBA 4J6HA 3EUB2 2KA7A 1WTOA 2B2WC 2KEEA 5E4XA 4RGNA 5EKIA 2ONQA 2PIAA 1GHJA 3BK2A 4IUVA 3L4PA 2BT6A 4ZKBB 3MFYA 3V2TA 3AEAB 3NP8A 3DUZA 2JYEA 5I4DA 4J1MA 2YU9B 5ELCA 2O4XA 2EJFC 1YNJD 1RTNA 2R3ZA 1GHKA 3GTKB 4TSSA 1STEA 3LB8C 4DNRB 3PUYA 2Y5CA 2MJEA 3P4SB 3AN1A 2VB3X 1P7EA 3E9SA 3DEPA 1VMPA 1GB1A 2PMZB 3R2IA 5IGCA 2VXWA 3LNNA 4K6DA 2PVGC 1H9MA 1N60A 4G57A 2EY1A 2RDGA 2JXMB 5EQ0A 5KEEA 1C4CA 1PTOD 1WTPA 2WXQA 1JQ4A 1Q12A 4IUTA 3S1MB 1BR9A 5FO8B 2BB6A 3PUWA 1BCPF 4CGYB 3A8JE 2OEDA 1CFMA 4KJNA 4ULLA 3WDNA 2DYOA 1C8CA 3KWVA 1KAAA 3Q69A 3MZ5A 4C3HB 3J7YW 1Y8NB 1DCZA 1SNPA 1LLRD 2JA7B 3NVWA 3K0YA 1C4PA 2M0AA 2SDFA 1ENCA 3FILA 1STBA 1DM0B 1A2UA 1XCQL 4ZRQA 1D1IA 2L83A 3AV8A 1I4GA 3A7AB 3J7AV 1AW7A 3FEWX 1I4PA 3NRZA 1D2BA 3QIAA 3WOFA 2NTSA 2F0MA 5IGEA 2HUGA 3QG1A 5I6WA 2RMMA 2WXKA 5FKAC 1S5CD 1SSNA 1D4BA 5KYIA 1Y1WB 2B2UC 1CK1A 1BQQT 3CQZB 2PPBC 3NVZA 5D3IB 4K6LA 3N9YC 1TR5A 1QB5D 3OIPA 4HKQA 1GB4A 3M7NA 2M9VA 4A3DB 1ZKOA 4HRSA 2W3RA 1I6VC 4IUQA 3ZJTA 2F3VA 4YSZB 2EY2A 1HA5A 2FMMA 2KCCA 2PVOD 2L4NA 4DK0A 2DWQA 2HTME 5BN4A 4IQZA 3D6WA 1FNUA 3H94A 2L5TA 1FXAA 3LWUA 1GXDC 2L52A 2QDBA 2ENBA 4IALA 1CHQD 1HPCA 1OO9B 4LK0M 1C4QA 4YTPB 3RMHA 5M5YB 3BYYB 2MGSA 3KLSA 4ILWA 4CJ2C 5T8IA 4HMJA 1RJTA 5AUIA 4BBRB 1F0ZA 2CQAA 3VR4A 2KACA 1STGA 1TU2B 4OO1G 3MEHA 2A5HA 3H3VC 3T56B 1FRDA 1L0XB 4UDUC 3VYTA 3MVVA 1KDBA 2M00A 4IUUA 1YNJC 3NQTA 1QOGA 2NYZD 5JVH3 2NTTA 4WH4A 3VR9B 3D31A 3J80L 4Q0FA 2JEAI 2BOSA 4I7ZC 1JOOA 1M8AA 1MI2A 2MUYA 1IL8A 5JEAJ 3RD4A 2X6LA 1GOZA 2EOTA 1J7CA 2K05A 4A3MB 3AEGB 1G291 1SNCA 1STYA 2PZWA 5CV7A 3GTMB 4KHVA 2JA8B 1F2ZA 2ZW1A 3UI2A 4KN7C 1O80A 1TIID 3S1NB 5D7GA 4BY7B 2V4DA 5C6AA 1F2MA 5CV4A 2EJGC 4KV6A 4EGVA 2Z4IA 1V97A 4EVOA 1EZ6A 1Q90A 2G1EA 2PKOA 3RZOB 1VF7A 4KY7A 3AEEB 4QMGA 2F0VA 3C3LA 2KHSA 3ND9A 2KCNA 4OIKA 2F0KA 4XIGS 5CR3A 4ARIA 1JMLA 4JWUC 2E74C 2AQ2B 3J7AF 5J22A 5I9PA 2WXRA 1VDZA 1CZPA 4RF0A 3M85A 1JICA 3S17B 1ZYRC 1HUNA 1RHPA 1SBBB 2AX5A 2H4OA 3AE7B 4HCEA 4A3EB 2B2YC 3NXWA 2XNAC 2YEPF 2E6XA 5JAVA 3UI3A 2INPE 4A6QA 2B2TA 2N9LA 4IDIA 1PRTF 1NR4A 2PW5A 3Q8FA 2CJNA 2D62A 2J4XA 2F0JA 3Q0AA 3VR5A 4QUCA 1QT9A 2ZXOA 1OXXK 3OMGA 1ZOYB 5MPOA 1TKYA 1KF6B 2EVBA 5LNK1 2NVXB 2QCPX 3NUCA 5A2QE 3LX0A 2EZVA 3AM9A 1HHVA 1TKEA 2OT2A 3OIQA 1NYRA 4FXCA 1E9MA 1KDAA 1F9QA 4A90A 1TS3A 4K5WA 1IW7C 2A6ED 3GTGB 1ZP0B 1HQMC 3P7JA 1VJKA 1AZQA 3Q6SA 4U68A 1JOKA 1Q8IA 1RCVD 2N0SB 4C3JB 2H88B 2IWHA 3NQIA 3N6RA 1MSGA 3GV6A 1N5WA 3DEOA 3QO2A 4MACA 1Z7TA 2CW0C 1PTOH 2BCOA 1L6UA 4A3BB 3IFTA 2TMPA 1TYGB 4FXKC 3PUZA 4L23A 5HFYA 5DM63 1V1PA 3T3OA 2F0HA 3TZDA 2WXPA 5LL6X 2A6EC 2JA5B 1ZXHA 4PV1C 2PTLA 3P4RB 4DNTB 1IYUA 3VYRA 2B2YA 2E76C 1HEZE 1DOKA 1ACCA 2JX5A 2QSDA 2Z1CA 4G7ZC 4HSPA 3IAYA 1K8OA 3VA7A 2WXGA 5EE1A 2X69A 3IXSA 4K5VA 1TY2A 3D4WA 2ZW0A 3NVVA 2KMMA 1JQYD 2FUG1 3D8GA 5FO7B 4C56C 1SJED 2O5IC 1E2VA 3RLFA 1WTXA 4DAVA 4FNFA 2Z4HA 4YT0B 1QQRA 1RDPD 2R92B 3I4NB 1WYGA 4ZOHC 3H09A 1TS2A 1F9RA 1FEHA 1HQRD 4P6VF 2KN4A 4ODGA 4KKUA 2GA4B 2WV6D 3NVYA 2Z8LA 4WJWA 5EE0A 1BMLC 4FF2A 1CM9A 1QOAA 4XYQA 1S5ED 3MFGA 4XQNA 1CI3M 4QCLA 3DWQA 5BYRA 5E6JA 2MJDA 2R6GA 3E5SA 4XTCS 2JA6B 5CBAE 1Q1EA 1HFGA 1HTLD 4MT5A 1EY5A 1ZPSA 2EY5A 1Z6HA 1XWEA 1BUIC 5EKLA 4RKBA 3DHQA 2W55A 4HEDA 4NZLB 1RM6C 5KNDA 4RWSC 3EVQA 1YN4A 2Y5PA 2K3UA 1MSHA 4OIJA 1YNNC 1UWMA 3VRAB 4B0EA 5I2YA 1JW9D 1ZDVA 2RPVA 1FYCA 4IFDH 3P75A 3P4QB 5BMIA 3NTIA 1AZPA 1SE3A 3BK1A 1TS5A 4C7ZA 1A3UA 1RTOA 2K1BA 1EEFD 3S2HB 2WACA 2K32A 2O5JC 3SEBA 5FLXL 4NJCA 1WTRA 5JPMC 4PMCA 3TP5A 4A3FB 1SJHD 5KRUA 1PLFA 2AWNA 1JR0D 1I50B 5D65A 1EWHA 1OFFA 2LHDA 2SNSA 3PO2B 1A6XA 1PYWD 1YQ3B 1F77A 1D1KA 2IL8A 1W6KA 1E10A 1F2YA 4DGZA 5JVG3 2LUMA 3HEJA 3B9JA 3J81E 3J9CA 3FC4A 5DNFA 1EYCA 4OZAA 3FPPA 3OOCA 3IT6B 1IGCA 2WU2B 4KD4A 2LMCA 2IGGA 1XXGA 1YNTE 3CHBD 4DA2A 1LT5D 3E0JA 5ELBA 5T1IA 1U4RA 3LXFA 4C80A 1VZ7A 1AWDA 1BOSA 1ZYRD 2F0SA 5HGTA 3ZGZA 1QG7A 2HDEA 4WURA 3HS0C 2MH7A 1ONLA 5ELFA 4HR7B 1JORA 1K51A 2Q8IB 2WXIA 5EPLA 2I07B 1GUWA 1E6EB 1CQVA 2HCCA 4K2LA 2NMQA 2DYMA 1AFPA 1L4DB 1CQFA 3VRBB 1MGSA 4C1NK 2IDYA 3I73A 3CIRB 1I3QB 1TWGB 3MXUA 3AMUA 4ZAIA 5COYA 3PUVA 1XLPA 2R93B 3NWTA 3SK8A 1JWSD 2WS3B 2YYZA 4KD3A 3A54A 1Y8OB 2LMCB 1JWAD 2K22A 1E2WA 3QOLA 4DN4M 1II3A 3BG3A 3K5OA 1EM7A 1D5ZC 1EZ8A 3U2SC 2KUMA 3HOVB 4HEA1 1EY9A 2A6HD 2K6AA 2L12A 4AQ7A 4HKZE 2QKIC 4O1NA 1BNZA 2EPBA 1SYCA 1VLBA 2D5GA 5G5GA 1CJEA 5IOCA 2I38A 1GAQB 4OHJA 5M3MB 1RFKA 5FLXE 4CQNA 1QE6A 1ICWA 5EJWA 5M5XB 1VMCA 3P20A 2BA0A 1D5XC 2XRSD 4PMBA 1X3QA 2B8GA 1MI0A 4JX1C 5C3JB 3MC0B 3SDZA 3X3MA 1MPEA 2BS4B 2AWOA 5BN5A 1STNA 1ESFA 4JPSA 3NUHB 5DEHA 4WWMA <