3R2IA

Crystal structure of superantigen-like protein, exotoxin sacol0473 from staphylococcus aureus subsp. aureus col
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
194
structure length
192
Chain Sequence
RKYYINMLHQYYSEESFEPTNISVKSEDYYGSNVLNFKQRNKAFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSGFVSNPSLQVKKVDAKNGFSINELFFIQKEEVSLKELDFKIRKLLIEKYRLYKGTSDKGRIVINMKDEKKHEIDLSEKLSFERMFDVMDSKQIKNIEVNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exotoxin 5
publication title Crystal Structure of Superantigen-like Protein, Exotoxin SACOL0473 from Staphylococcus aureus subsp. aureus COL
rcsb
source organism Staphylococcus aureus subsp. aureus col
molecule tags Unknown function
total genus 54
structure length 192
sequence length 194
ec nomenclature
pdb deposition date 2011-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3r2iA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3r2iA01
1XTCD 3BZDB 1DJRD 1RDPD 1B1ZA 4UDUC 2IJ0A 4L63B 1LTBD 4OHJA 2XRSD 5ELFA 5FK9C 4TSSA 5D3IB 1LTGD 3BVMA 1CQVA 1SE3A 2J4XA 1RCVD 1HXYD 3R2TA 1SEBD 1LT5D 2AQ3B 1CHPD 2R61A 4RHSA 3DWPA 1I4QA 1PZKD 1SE4A 1QILA 1V1PB 2WV6D 1PTOF 2TSSA 4RGTA 4Z9CB 1RF2D 1LLRD 5ELCA 1RD9D 1EWCA 5I4DA 2O2LD 2QEJC 1AW7A 1TY0A 1PZJD 1BCPD 1I4HA 3DWQA 1JR0D 1KLGD 1T5XD 2AQ2B 1JWSD 1YN3A 1BXTA 1EEID 2NTTA 4NZLB 2RDGA 4RFBA 1MD2D 2XNAC 1TS4A 1UNSA 2Z8LA 1D5ZC 1S5FD 1I4PA 1G8ZD 5D3DA 1LTRD 4DXFA 1FNUA 1B44D 2XRQD 1LT4D 1PRTB 1PTOB 1TY2A 4RGNA 1YN5A 1TS5A 1GOZA 2IPKD 1EEFD 1TS3A 1PZID 1I4GA 4RH6A 3GP7A 1PRTF 3DWAA 1BCPC 1SJED 1CK1A 1DYQA 3BYYB 1KTKA 1EU4A 1S5DD 1LTAD 1JWMD 1FNVA 2RDHA 3TSSA 2NTSA 1ET9A 1M4VA 1LTTD 1HTLD 1I4RA 1HQRD 1LT6D 1AN8A 2G9HD 1HA5A 2QILA 1JQYD 4K6LA 1FGBD 3OWEB 2CHBD 2XN9C 4L6TB 4O1NA 4ZYSA 3MC0B 1UUPA 3W2DA 1JWUD 5TSSA 3V05A 1L0YB 1V1OA 1FNWA 1LTSD 1SXTA 1LO5D 1D6EC 5ELBA 1BCPF 1L0XB 1D5XC 1PTOD 1S5ED 4RGOS 1V1PA 1PYWD 1D5MC 4RGMA 1F77A 2SEBD 1CHQD 1LT3D 1S5BD 3MFGA 3O13A 3BVZA 3R8BA 1LTID 1I4XA 1S5CD 1SJHD 5ELDA 4DXGA 1CT1D 3R2IA 3SEBA 1ESFA 1ET6A 1XXGA 4RHRA 1SE2A 1ENFA 1YN4A 1PTOH 1EFID 4C56C 1FD7D 1TS2A 1JCKB 3BYTB 4RCOA 1SBBB 3CHBD 1PRTC 1PTOC 1BCPB 2ICIA 3URYA 3BVGA 1STEA 1EU3A 4BWGB 3KLSX 3EA6A 5FKAC 5ELEA 1PRTD 3EFXD 1KLUD 2AQ1B
chains in the Genus database with same CATH superfamily
1X1MA 2DNCA 1KC8C 4LNQA 5E6JA 1KRTA 4HIMA 3GTPB 1H9RA 3RD4A 2K04A 4DXAB 4HPPA 2WXGA 3KH0A 1NCVA 4GLSC 2IZVB 2IHFA 3WIMA 1VQFA 1H9SB 3F8TA 4HIDA 1D3ZA 3BVMA 2LXJA 3P75A 4DR2L 1IL2A 1WJ6A 2OQ0A 5E7NA 3UI3A 3ZRFA 2K5WA 4ASWC 2M17A 1X3GA 4NY0A 3PUWA 2NVUI 2NUCA 4EE2A 3ZVVA 3KUPA 2INDC 1PH3A 1HFNA 2KDBA 1N36Q 4RGTA 3H6MA 4LCDE 1IBLL 3IAS1 3SK8A 5G5HA 2KJXA 2UUBL 4DUZL 4C3JH 2O2LD 4DV7L 2B39A 2OWOA 1PYSB 4CHKA 3ZTDA 1KLGD 4DV4Q 2NPTB 5EE0A 1WTPA 3PUYA 1NYQA 1BXTA 1QNKA 2PCFB 4XQQA 2QA4A 4FNFA 4MIUA 1JE4A 3AE7B 4O0AA 1O78A 4NJCA 5LHY1 5IAAC 4JI1L 4K3BA 1LTLA 2WDVB 3KUCB 3WA0A 4JI0Q 4HVBA 5CORA 4FN2A 4E3CA 4A3IH 2DN8A 1K52A 2NVQH 4BY1G 4XYCA 4JI8L 4MTNA 3PZ7A 1TU2B 2MEKA 5G2NA 1LFDA 4DR7Q 4FULA 4X6AH 4YT0B 3NTIA 4DUYL 2B2WC 5IE8A 1Z7TA 2DUDA 5EKKA 5CGKA 2IDYA 2KFJA 2MW5A 1WCMG 4LNFA 3ZQ4A 1KDAA 4IZ8A 5T8IA 2R7ZB 2JWZA 2WB1E 2B2WA 3JC66 4CJ2C 2N78A 2Y0SE 3DOWA 1OXUA 3Q14C 4W9LA 1U9RA 4YWGG 1YNJC 1X9NA 3OG5A 3A9KA 1YNTE 1FNVA 3FPPA 4X65Q 3CQZH 2YTYA 2JA8H 1CZPA 2G9HD 4ZUIA 1YQ3B 3AXCA 4IOAA 3GB1A 3OLMD 3V61A 2LHDA 3OIPA 2KC2A 2WB1G 4F8MA 1MG8A 3ZUNA 2Y0SG 4ZYSA 2WGSA 4OONA 1PDQA 1QUQA 2M00A 3PIOA 1Q81C 3DHHC 3IXSA 2C5LC 4FP5D 5JJLA 1CSQA 2EY2A 1VQKA 2MBOA 2BW2A 2A69D 5C4JB 2N9KA 1EOVA 3FC4A 4G50A 1L2NA 4ODGA 5C3XA 4IUTA 1QT9A 2HUGA 4HJKA 4C3IH 4RKLA 2VB3X 5BR8L 3MJ5A 2QF7A 5IOIA 4LF6Q 3GTQH 1HHVA 2ZXOA 3TRZA 2RSNA 4BBSH 1WXAA 1LT3D 1RTNA 4DR6Q 1DGSA 3JYUA 1FMAD 2Q5WD 2KQSA 1I4XA 2E2DC 5C2TB 3L08A 1PA6A 2CJNA 1J19A 4HIKA 1Y1VB 4C3HH 1K83H 3BDOA 4A3JG 1SSNA 3DWMA 3UDFA 4M8NA 1Y8NB 4JE3B 1V97A 4MNOA 1LYLA 2EYMA 2KD0A 2UXDQ 3CF6E 3N20C 4RMFA 4PK1A 3CHBD 3M4PA 4ZRPA 4JBMA 4GB9A 4A3LH 2YU9B 4KKJA 1BF4A 4H7BA 5COYA 5CV8A 1HUNA 1MFWA 4YTMB 1BBUA 1ILQA 2KMCA 3APFA 1K8MA 1KNAA 3W5UB 3T16A 2CH4W 2MLBA 2WX0A 3H8HA 3KF8A 1AARA 2M8SA 1CQFA 3HOXH 1P1AA 4ANUA 2QSDA 2W9NA 2WQYB 3VR8B 1NI3A 2DX5B 3UIOB 2K6QA 1M8AA 1X56A 4RG1A 2LXCA 1GG3A 3H7PA 3I3CA 3PTFC 4HAEA 1XPUA 5EJWA 4HJ8A 3RNUA 1I6HH 2UU7A 2D10A 4H02A 1YI2A 4A3BB 3IBEA 3OJ3A 2NZOA 4RHSA 4PS3A 1SE4A 4FJZA 4G0NB 1RAXA 4A3MH 1HNXL 4IQZA 3A1QB 5F2DA 4YSZB 2Q2HA 1D1IA 2CCZA 2AMCB 4HIOA 4KX6B 2FMCA 1W2BA 5CBAE 4JI4L 2F3VA 2DY7A 1F9QA 1TWCH 5C3EG 4B3TQ 3GV6A 1NDDA 5M3MG 2L4NA 5K5PA 4RFBA 1VMPA 1TS4A 3WDNA 4KHPQ 3Q8CA 4BBRH 1I50B 4MELA 3EIVA 1VF7A 2HCCA 3BJUA 2Q8TA 1C4AA 3PGEA 2LEKA 5GADC 1EUJA 1B44D 2MSED 3S14H 2R93G 3AI5A 4XYQA 2IYDB 1TS5A 1WJUA 3K0XA 5CR3A 5KHQA 4A3GG 3AQQA 1UF0A 4F7ZA 4HJAA 3ND8A 1SJED 1GUSA 1KTKA 5CHVC 2MCNB 5LXHA 2ZXPA 2CQAA 5L95C 2I46A 1P7FA 4CKBA 1A62A 4IALA 1ET9A 4GN3B 2L52A 4WH4A 1F9RA 3CC4A 2UUBQ 1HZ9A 4DUZQ 2WIIB 4DV7Q 4GZYC 4A3IG 1I5FA 2CKZB 1L0WA 2MJ3A 4C2MB 4NJ6A 2NWGA 2LVQA 3KDFA 4OIKA 3PSEB 4JPBW 4B0MA 4E74A 2N9LA 2GBRA 3UIPB 4LWCA 1IYVA 3W2DA 2R92H 4HRSA 1K8RB 4HLEA 3RYTA 1PGXA 3V05A 4JI1Q 1XCTL 3LDZE 4B95A 1KABA 2WXNA 3AE4B 4IUQA 1A3VA 1BCPF 5FO8B 1WX7A 2F0IA 2JEBI 3TREA 2PI2A 2JQOA 4QMGA 5AUIA 2RA4A 1RM6C 4DV3Q 1F77A 2ZZPB 2Y5PA 2AYOB 4AQYQ 4GKKQ 4A3CH 4LTUA 2EIFA 3R8BA 1RRBA 1EY6A 3K9OB 2K1BA 2P5ZX 3J7YW 3GTOB 3VR4A 1VQ9A 1EOTA 2CU1A 4RHRA 2UXCQ 1VCBA 1K28A 3CAMA 4A3FH 1EYGA 2KOXA 1B3QA 2B2TC 3KLWA 2ZPYA 4A3KG 4A3JB 4N9TA 2C5CA 4JI7L 1JE5A 1PRTC 4C3IG 4DFAA 3I63C 3QWZB 2A73B 3BVGA 3A9KB 4ANWA 1C79A 4WJPA 2IX3A 2B2TA 3X23A 3H0GB 3K5OA 2RCFA 5C4ZA 1MHHE 1Y8PB 5H1SE 3GTKB 1SB3C 4FHJA 3RR5A 2BB6A 4WQMA 1XTCD 5IGCA 1TWGH 3TMPB 2E2HB 1ZDXA 1DJRD 1FM0D 4R8IA 4MH0E 1H8CA 4KKSA 1LTBD 4C3HG 3K6OA 2D11A 4TSSA 4OL7A 4WWMA 2JA6B 1FGUA 2NVXB 3MHSD 1O80A 2ZCCA 2QMTA 2CH4A 4LDTD 4IO9A 2KFKB 3VRBB 5JPNC 4C7ZA 5FR6A 2E76C 1WGHA 3T3NA 2KCTA 1B4OA 2L15A 4YWMA 1B2TA 3QWNA 2WNMA 2B8FA 1GC6A 1VQMA 2UWQA 5ELCA 5IGEA 1E7ZA 5ISRA 4G7ZC 2KCMA 4TMAB 3FVQA 3PZDA 2J53A 3HOXG 1YIJA 2NVYB 3J80c 2EY1A 4R4TA 4AYBE 4DK1A 1VQNA 1JW9D 2A5UA 2QIEB 4PS7A 1JWSD 4OWWB 1YITA 1EYDA 1YJIA 3EN2A 1SMYC 4JGHB 2WXKA 1KLVA 1F52A 1WR1A 2A6HC 5G3LD 1YQBA 5M5XH 4ZHPA 4URKA 2MO0A 4XWTA 2QW7A 1VQ8A 4AYBG 4A3MG 3P4PB 3RN2A 3S1MH 4WIPA 3Q3JA 1WGRA 1FR3A 3VAWA 2YEPB 2JN4A 5LNK1 1HCZA 3A4RA 2A74C 2VH1A 3KF8B 3DWAA 2LVOA 1HR0W 1VQOA 1CK1A 1Z5SB 4C3JB 4IWOA 4W9GA 2F0LA 2GBKA 3IAYA 3MC8A 4WJ4A 3H7PB 4JCVE 5E3FA 4M01A 2EMTA 3SHQA 1QOAA 1FCLA 1HNXQ 2NTSA 3T1HL 2INPE 5C23A 2FFKB 3LWEA 3I4LA 1K3BC 3PRMB 1AN8A 5MPOA 1P16A 4R4IA 2JK8A 4OGQC 1JQYD 4K6LA 1WGKA 2LFIA 3IRBA 3TQYA 2CHBD 2RBMA 2K14A 4O42A 4A3IB 1LABA 2NVQB 4ICUA 3U58A 4HR7B 5E1FA 4X3SA 1CA5A 1OQQA 2V3PA 1V1OA 2BH8A 3QA8A 4LF4L 1HZCA 1D5XC 1TZ1A 3S2HH 2WFWA 2A8VA 2WS3B 4II3B 4ANXA 5DM63 1PYWD 5KHOA 1MKHA 2VRRB 4OELB 3U2SC 1IKMA 1CKOA 3U30A 4R1JA 5C3JB 2SDFA 3CQZB 3QIAA 2JA8B 3W1YA 3V3XA 2JYEA 2L1BA 1GUTA 4DWFA 2J0TD 5JEAJ 2R92G 2HJ8A 3MXNA 4CBVA 2BGFA 2K52A 3MXGA 4DKAC 1ROEA 2JZZA 3D6WA 3D4WA 2UXBL 4KMUC 1MHWC 3J81c 3C0RB 3F2BA 2Z59B 4KV6A 2ZEQA 2FINB 2UUCL 1A3TA 2L8JA 4KY7A 5AFWA 3M4OH 1BMLC 2D2CC 4C3IB 4A3CG 1UD7A 2OXPA 2CW0C 4OVVA 3GTQB 3QHTA 3K80C 3KDFB 3UDGA 2EYHA 1RDPD 2EQSA 4BBSB 2IJ0A 1M1KC 2LUEA 4ILWA 3CKIB 5JVH3 5FK9C 1V8QA 1CSPA 4XIGS 3A9JA 3W1SC 4C4VA 3ZJTA 4G7HC 2LRWA 2L12A 4NMZA 4C3HB 4IUMB 1K83B 3L4PA 3HOUG 4B0EA 4BOZB 3W1SA 2FCNA 3RFZB 1J6QA 4RM9A 1B9NA 3PLVA 3Q69A 3RNGC 4JV5L 2R61A 5TR5A 4RAUC 3AB9A 4WAFA 2IO3B 2A68D 4C7YA 2JE6I 1U5KA 2NB0A 5JJZA 2D9UA 4IJLA 3FPUB 2WXMA 3BDLA 2JA5G 5IT9L 1RTOA 2EE1A 5H92C 1E22A 4X57B 3HOZG 1VQDA 4A3EG 1Z9FA 1EEID 1Q1EA 5CMDA 5DLQE 4IOCA 4W9FA 3PO3H 4DR1L 3CWIA 2UUAL 1XPOA 4JI6L 4XGAB 2K25A 1CKNA 4X3UA 1CTMA 1PQSA 2D5GA 3I4MG 4GMVA 5IP4D 3TEXA 3AEVA 4LNKA 1C9FA 1PRTB 1GUNA 5ELNA 1I6HB 2F52A 3AECB 4AQ7A 2ACZB 3AYHB 3DM3A 1E8XA 3OJ4B 4XZ4A 5G55A 1PZID 4X64L 4A3MB 1JWBD 4US9A 1U0LA 1BCPC 1TWAH 2OTJA 4ZRKA 3CMEA 2BWES 4KSKC 1IBML 1ZXIA 2DNFA 1NYRA 4YHHQ 2KMMA 1TWCB 2BWFA 1WR6E 3IG3A 3FP9A 3M63B 3E9SA 2LFNA 4WWNA 1HA5A 3HS0C 4YY3Q 2OCEA 3J7A5 4ZCKA 4BBRB 2N9PC 3HHMA 4GDLB 2XWJB 3DQVA 3NHEB 2A1AA 4IUUA 3VDYA 1SLJA 3S14B 3C8YA 1WZ3A 1EQRA 3V96A 2BB5A 5IO9A 1EIHA 2M19A 3A74A 2JJQA 2F0TA 5DM73 5IYBH 2NVTH 1TKYA 1SXTA 3OW7A 2HIXA 4RA8A 2N8NA 5J3BA 4W9KA 2HD5B 3O65B 4O2DA 3MFGA 1QZGA 2GOWA 3F2CA 1ZYRC 1FVIA 2KVMA 4MGYE 4DXGA 4MH8A 3BZCA 1XXGA 2OJRA 1SE2A 2QEXA 2A4ZA 5IP9H 5D2MB 4B9KA 2DNEA 3Q6BA 2RCNA 4C1NK 3H7SA 2F0KA 3D4RA 2MX2A 4J6IA 3RULA 1JCKB 2ZJDA 2F0UA 2R92B 2PW5A 3H9DA 5M3FH 3EECA 1NVID 3EQLC 2JA7H 2LI5A 2AWTA 3VXWA 4IFDG 3ZNHB 4II2B 5IP7G 1RLFA 1TT2A 4G11A 4NQKE 5C0XJ 1JOKA 4JI2L 3CRLC 1WE6A 1XO3A 3R2TA 3ZDMC 1RKNA 2EJMA 2WINB 1M94A 1B1ZA 3I4NG 1SYDA 1VDZA 4R4QA 2KLCA 2PNRC 5LLIA 2K5QA 2ON8A 2KHSA 4DK6C 1IXRA 2LRUA 3WAPA 1PFDA 1SMYD 3NK9A 3M3JA 3J80L 4A3FB 1STAA 4I6NB 4K7UA 1PFSA 2A6HD 3WANA 3VUWA 3DXJC 1LT5D 3PVLA 1E3PA 2Q2UA 3DWPA 3S15H 1DOYA 4APVA 4L5SA 1JOQA 3SR6A 1N6ZA 3VA5A 1EF5A 4DV4L 1N5XA 2DYOA 1LLRD 1RJTA 4KIKA 4POFA 5E6PA 2VXWA 1AW7A 1TY0A 1WTHA 2IX0A 5DCNA 2KT7A 1TWGB 3MXNB 4JI0L 4KN7C 2KOLA 2OEDA 1FCCC 1KHIA 4NZLB 1IHZA 3HK0A 3S1QB 2RDGA 2XWBB 5FLXE 1CZWA 1AFPA 1HPCA 1G2SA 2JP1A 2Z4HA 4PYUA 2DGYA 1SIFA 1VQIA 2G45B 4OZAA 2F0HA 3KLRA 2PVOD 2KWVB 4ZRZA 3VHTC 1VQCA 2JZ3B 1V9JA 4JQWC 5KYIA 4XXEA 1J7BA 2DYBA 3AMZA 2EKEC 3SGIA 2B2YC 4BY1H 1A15A 2NBVB 3BK2A 1IZ6A 2F3WA 3A9JB 4C4VB 2XIWA 1C4CA 3KFUA 2YEPF 4NPNA 1II3A 1YHAA 2KEDA 2B2YA 4JV5Q 1WCMH 2QDLA 3QO2A 1E0BA 4IPHA 4LAAA 4K0KQ 3SR1A 4QCLA 3H6NA 1PH5A 1WJNA 3VYRA 2ONQA 2Z0SA 4FJYA 2VB2X 2ZM6Q 5KNBA 4Y52H 2KTRA 3KBGA 3ENEA 3KQ4A 3BU2A 4K14A 3Q22A 2C7MB 2FCMA 4ZHOA 1MJCA 1JMLA 3S1MB 1V5OA 4LF6L 3KYDD 2G4SA 2UUAQ 4JI6Q 1WJ4A 3NELA 4DR6L 2H4OA 1JRUA 5JHAA 3Q8EA 4EX5A 2VZKB 4MACA 4G4KA 3ML9A 1V1PA 4N9F4 4OIJA 1CKNB 3KBXA 1P3QU 2SEBD 3J81L 1MPEA 4HMIA 2J42A 3B1LX 5EPKA 4X64Q 1A5RA 4IPDA 2CW0D 3WWVA 1WXMA 1OO9B 1SJHD 2V3NA 4ARIA 3OWFA 2DAJA 2PW9A 1DOIA 1IBMQ 4N8X1 1PTOH 4L2YA 4HJ7A 2F4IA 5FO9B 1HA6A 2EPBA 1TXYA 1TS2A 5C5LA 2BS4B 3NE5B 4MGKE 2AEHA 4NNJB 3ZRCA 1NAPA 1E7PB 4L1BA 3TP6A 4CHTB 3RCZA 1BCPB 3WOFA 2YVCA 1WI5A 4XTCS 4HWIB 3HKZE 3K8AA 5GAGC 3K5LA 2WLBA 3IVFA 1SSOA 5A2QL 1LACA 2IHEA 2I0QA 3S2HB 1FXTB 2JUOA 1VF5C 2F0FA 3AEFB 3FKYA 3SU8X 2XBBC 3TBIB 3MTNB 2E8GA 1JB7A 1D2BA 4FXCA 4OHJA 1A2UA 1UE7A 1AYFA 1EZ6A 2REXA 1H9KA 5ELFA 1NMFA 3A1QA 3BINA 4H2AA 4GKJL 1CMXB 3ALBA 4DHZB 4EQNA 2XEWA 1KDCA 3HKZG 4LF8L 2KDIA 4BBNF 4A76A 4X66L 4ME5A 3CCLA 4JL9A 4X62Q 1V5TA 2KKCA 4QF4A 2YLMA 1UWMA 1SEBD 2V0GA 3NTHA 2DZIA 2HDMA 2N1WA 1I4QA 2AUKA 1Z6HA 3LB8C 3E5SA 2JRIB 3N3KB 4F8CB 2JSOA 3MEFA 4QIWE 4B3TL 2EYJA 3WAOA 3CRKC 1STBA 1WRIA 3JSVA 4DHJB 2WDTB 3M4OB 4OZBA 3TJPA 1QCBD 4DV0L 5KYLA 2MJ8A 1E8WA 1TWFB 3ZYYX 3DUZA 1DGJA 1BCPD 1JR0D 2SNSA 4NB3A 4NQLB 1XT9B 3VDZA 1L2FA 1T9HA 5CV5A 1AP0A 2OJWA 1F9JA 4DAPA 3M9BA 4GN4B 4OX9Q 5D65A 4JI2Q 5C3EH 2AL3A 4UPAA 5CV7A 3SHLA 2O6VD 1G8ZD 5M3MH 3BDCA 2D3AA 3GE8C 4REZA 2XRQD 1TY2A 3JAMc 3CF5A 1HZAA 1BNZA 2Z0DB 2JU6X 4HPLB 1LV9A 3H1UA 2N88A 1EIGA 1EFWA 4UP9A 3BG3A 3Q3MC 1PRTF 2R93H 3QARA 2AWNA 2KZRA 1FJGQ 1C4PA 1K9MC 3F2UA 4KD3A 2N1VA 4A3GH 1WFYA 5GAEC 4BZAA 1IBXA 3UI2A 3CXCA 1OGWA 1WM2A 5IOCA 1EQTA 2XTIA 2CWAA 3TP7A 1SNPA 1XMOL 1KAWA 4JBWA 1LTTD 2UU9L 1H9JA 1HTLD 3PIP3 4JC0A 1ZGUB 3PO3B 1Z47A 4A3DG 4GLXA 5KNDA 2RKSA 3OWEB 3AE6B 3I8ZA 2G3QB 3HRDD 1XTDA 4NKLA 3PO2H 1RFKA 4KIKB 2EYPA 2TMPA 4DGZA 4L5QA 2J0KA 3PPAA 4Q5VA 4PQXA 4PYZA 3TEWA 4DV3L 2PMVA 2WDQB 3M4YA 2Q2IA 4AQYL 4GKKL 3PIO3 2I1JA 1TWAB 4DDGD 1P0RA 4RGOS 3TL5A 1ICFB 3PIPA 1T0RC 4HCEA 2N49A 2UXCL 1KRHA 1J9OA 2B29A 2NZHA 3AFQA 3RN5A 1T6BX 2FUHB 2W54A 3AEAB 3G7LA 3AV8A 1VLBA 4JYAL 2X69A 3S2DH 4EOYA 3ZJYC 2IT1A 4EZJA 4E6IA 3P1MA 3M3YH 3HOWG 4KV2A 2A6EC 2ENBA 4TRDA 1QVGA 4PT5A 3TMEA 2MQJA 2N7DA 4QY7A 3PSIA 3KJPA 5BO4B 2Z9HA 2CU3A 4BKGA 2WXOA 4B3RQ 5GMVA 4WJWA 5IN7A 1B53A 1FRDA 2NVTB 2KFKA 4K1RB 2QDFA 2DJGC 4M02A 1T0SC 3EA6A 2BDNA 4A3KH 4B3SQ 4DAVA 4WJ3M 1KOTA 1RFAA 1V9PA 5EAYA 3K0YA 2K7VA 2KTRB 3EFCA 1HNWL 1G91A 3HGBA 4ANVA 2XRSD 1ICWA 3B08A 1MI0A 4DU9A 1WFQA 3N30A 1DXMA 2QKIC 4DNTB 1WM3A 3GTMH 4BKSD 1MJDA 4GNXC 1KD1C 1SE3A 3AE1B 3G48A 3I90A 3I55A 2W82A 4MGIE 3HKZB 3ONSA 4WRDA 3VUXA 4GNXA 5DPSA 5M3FB 1V1PB 3R7QA 2JA7B 3N9YC 1PHJA 1CFMA 1RD9D 5I9PA 5I4DA 4K5VA 2QEJC 4EKUA 3A5ZB 1WD1A 3I57A 2K0PA 2HQEA 3OMGA 3ERQA 2D2QA 2KJ6A 3IL8A 2BCOA 4QB4A 2AQ2B 1J8IA 3HZXA 4LW1A 3GE3C 2E3TA 4A3PA 1BDOA 4K3CA 4Q0FA 2K33A 1CZGA 3JW0X 2KA7A 4CKCA 1IYJB 1E5WA 3DEOA 1IGCA 1YD8U 5AZGA 4A55A 4TKOB 4S17A 4QIWB 3SE0A 3OAWA 4ID6A 2IGHA 4GKJQ 3VFKA 4IUPA 3S15B 1I42A 2JRHA 4LF8Q 1XEEA 2N7JA 1EZ8A 2NS5A 1SYBA 4X66Q 1HH2P 1SYFA 5IKCM 2LASA 3N32A 2EDGA 5EBDA 3ULPA 3IHPC 2EYFA 3N1ZC 2DHZA 3NS1A 4B3MQ 1V1QA 3RLOA 1EWYC 5EKLA 5E4XA 1TT5B 2OQKA 4PG3A 4NAWB 1IYFA 1UE1A 3UE0A 1WZ0A 3VTVA 1DOLA 3ZNID 1ENAA 2OF1A 3ONAB 3NZ3A 2X6GA 1LT6D 1QZHA 1E7UA 4DV0Q 3IKJA 2ZNVC 3NVVA 5DPWA 5J22A 2QJLA 3RLFA 4O1NA 3JSVB 1MIUA 3MC0B 3RPFC 1WJJA 2GA4B 1N9WA 4KI0A 4ULLA 4DAYB 5ELOA 1GHKA 2I07B 5L83A 2PVGC 3HM6X 5GXGB 4R4OA 3IFWB 1AZQA 2L76A 2W3SA 5E6NA 5EPLA 2CHZA 1AEXA 4BY1B 5K36G 2K6DB 5JOBA 5LL6X 1JJGA 1D5MC 1OXVA 1WCMB 4NDXA 2HJ1A 2ALYB 1RODA 3O13A 2BF8B 1VD2A 4W9IA 2N0SB 3NRZA 3TS0A 4CGYB 5KEEA 3V62A 3PO2G 3AU7A 1YX5B 5D14A 4BBNC 2KBNA 1CKMA 2F3IA 5EQ0A 2ZJRA 4IKGA 1D4BA 3P4SB 2BQQA 2ZW0A 2VQEL 4ACFA 4FF4A 4ZQ3A 4POGA 4C56C 1X32A 2RMMA 1XMOQ 3B2GA 4A8XC 1PV4A 2BTEA 4H0LC 2UU9Q 2Z0EB 1IBXB 2ZXRA 1EYAA 4S3SA 2WB1B 5LMUQ 1VDVA 2Y0SB 3NHHA 3URYA 2R2OA 3PHWB 2W55A 5D6JB 4AJYB 3M7GA 1ZXTA 4DR4L 4K81A 1W6JA 1GC7A 1F9SA 2K32A 4MEMA 1HE8A 3AE2B 3RNEC 4CQNA 2N7EA 3BZKA 3DBLI 1VZ8A 4ITKA 2VQFL 1GJXA 3VQIA 3J80i 3CCEA 4LF9L 4PMWA 1B70B 2L05A 1JWAD 3VR9B 2X6LA 4B9WA 4HPMB 2DBYA 1OEYA 1NI2A 4JYAQ 2NYZD 3HOYG 1MSGA 3TSSA 1PZKD 2WV6D 4BS9A 2YTXA 3HOUH 2TSSA 4Z9CB 4KLKA 4IURA 3S16B 1FFVA 1MHXA 2L0FA 3ZO5B 2MA9B 3A56A 3L17A 4A90A 2CQOA 3JAML 3DM1A 2N9XA 1HNZL 2BKFA 2VW9A 3AB5A 4EGVA 1E1OA 3PGZA 1HRJA 4EUTA 4HN7A 1CJEA 2JA5H 2NN6H 5FR3A 3T9LA 2C7NB 2K8CA 2HTHA 1MD2D 4FYDA 1EM7A 1GAQB 1ZP0B 4FXKC 1C76A 3HOZH 2KWDA 1VQEA 5KGUA 1A3UA 4PV1C 4A3EH 3FILA 4FLHA 2K9XA 2K1FA 1HNWQ 2L55A 2K39A 2KK8A 3AULA 4PZ8A 1TYGB 4OZCA 5FO7B 4YHHL 1H9MA 3I4MH 2KVZA 1XYIA 1A6XA 2JZPA 3FKIH 4GDLA 4L5RC 3U4ZA 3MEHA 1DOMA 4YY3L 4G57A 2FUG1 4DNIA 2GB1A 2RDHA 4IPCA 1BOSA 2K8HA 2YTVA 2FCQA 1M4VA 2R3ZA 4I7ZC 3P63A 3KWLA 5T1GA 1IPGA 4GNXB 1YNJD 2IY5B 2RPVA 5C3EB 4OWTB 1KM7A 5IYCH 1LGRA 4ARCA 5M3MB 2LXAA 4C1NI 1VZ7A 2B8GA 4AIMA 1WGDA 2LS01 1N32L 2J0MA 4A3OA 1I35A 1GM5A 5CV4A 3X0WA 3NZSA 3W5OA 2O2VA 1E2VA 4KGSA 4KD4A 1WTRA 5C44H 1WX8A 2R93B 1LO5D 1EIYB 4JI3L 1EQQA 2V1YA 2PLPA 3A8JE 2KX0A 4V190 1X54A 2LGYA 4A3GB 1EUVB 1CM9A 4IWQA 1HZ5A 2MJEA 1FXAA 1UH6A 2LD9A 1Q8IA 4DPGA 4QGUA 3I70A 1A70A 5CV6A 3STBC 2EJFC 3P7JA 5EKIA 2M56B 4HTHA 3L0WB 4HSPA 3PRPB 2KDEB 3TUOA 1C78A 1FD6A 3OOCA 4S0RA 3AU5A 3PO2B 2INNE 4CDEC 1KXLA 3ULJA 1F2YA 1NR2A 1V43A 5IT9E 1CA6A 1ZXHA 2GBMA 4C00A 4XC2A 5JZEB 1BQQT 4FF3A 3IT6B 5IGDA 1XMQL 1O7IA 3DBHI 3KK7A 3DBLB 1VQPA 3R3MA 3VYTA 1SE8A 4FXDA 1C77A 3KYCD 3MTSA 5BMIA 4YSXB 4NXNL 2LHEA 4IFDH 3QAQA 1PLFA 5IGBA 2EELA 5IP7H 2LJ5A 1QQRA 4A4IA 2Y5CA 2ZNVB 3MAQA 3S2DB 3PS6A 1FYCA 4JBKA 3M3YB 1F1HA 2CJOA 2SNMA 2NBUA 2ZPNA 2BDOA 3I4NH 1UAPA 1HXYD 4LF7L 2LGXA 2JXTA 3R66C 1E0ZA 1GO3E 2AQ3B 2WU5B 1CHPD 3RMKC 4OEMB 4XDXA 4KHZA 5I2XA 2K8BA 1HFGA 3U7ZA 3U8ZA 2K05A 1XX8A 1EF1A 4I7AA 2VQEQ 3RNAC 4A20A 4A3KB 1QKZA 4PMCA 4FXGC 1KH0A 1JJCB 5CTRC 3TS2A 1KNEA 1Q12A 2G5DA 2M2LA 1IP9A 3ND9A 1SNDA 3CPWA 2BYEA 1XLNA 4N59A 4ZRQA 3DVNV 1S4ZA 4FVMA 4DR4Q 5BMHA 5BN5A 5KRUA 1BO0A 2EY6A 3RZFA 3NY5A 3WALA 3NP8A 3BK1A 3NVYA 3PUVA 3Q8AA 3GTMB 4UY8C 3L2PA 2VQFQ 2FE8A 4ZYNA 1Q46A 2HHHL 2BYFA 1WYGA 1Y69U 2R2QA 3Q24A 1TWHH 4LF9Q 3QCAA 4MGZE 1QE6A 1IBKL 2OT2A 4PZ6A 1JRPA 3DHQA 3T4AC 2B63G 3HRZC 2VZAA 1GNUA 2NCNA 4GN1A 3A7AB 4K0KL 3DVGY 2CHWA 2F4VL 1WXSA 1EU4A 3CU7A 4K5WA 5J1ZA 4XYOA 4K7SA 4KVGB 3NUCA 4LMQD 2LMCA 2NN6G 3RNFC 4JK1C 3HUIA 2BYVE 2ZM6L 5FLXc 4OO1H 2KNBA 2LGSA 4KGRA 2ZW1A 4IW0A 3OW2A 1WVLA 1X3FA 4KJNA 3HOXB 2WWZA 4HJ5A 1S3OA 3LYYA 4J6HA 1D7QA 3MFYA 3ZDTA 3S17H 1E9MA 5JEAG 2BH2A 1HNZQ 2WX1A 5IGFA 4LJOB 2NN6I 4XQJA 1WRDB 1SYEA 1VQJA 4QL5A 3FKIG 1GUGA 2PQAB 3T13A 1EO6A 4Y7NH 3MVVA 2C60A 2B2VA 4FO2A 1LTSD 4JW0A 3B0AA 4AYBB 2H89B 4KGTA 1L0XB 1Q90A 3ZW3A 1AE3A 2JT4B 2O4XA 4P71A 4BAXA 1VQBA 3VR5A 2PZWA 3UQAA 1O7ZA 1FL0A 1QNUA 2K03A 2K50A 4B08A 1Y8RC 3FILB 3J80E 3HOVG 1JICA 1UE6A 1XF5L 2QHOA 3T1YQ 3K9PB 3NVZA 3QIJA 5IYCG 3T51B 5HGQA 1ESFA 2F1MA 2H88B 2JVCA 3L54A 1PVOA 2L9HA 2LSSA 2ZTDA 3EBEA 1SFOH 1X3PA 2IBIB 4DR3L 2KDFB 4IOIE 1FD7D 4YTNB 1BUIC 5C44G 3DBHB 1ZKOA 3BYTB 2IWHA 3J7AF 3AN1A 4OWXB 2H5XA 1S3SG 2KMAA 1WSPA 5DPTA 4ZRIA 3VR6A 3MHBA 2LY7A 2PMZE 3P42A 1PRTD 1NJIC 2F0DA 3CCMA 1N32Q 3A8KE 2BBCA 2KXJA 3DBRI 4HCSA 1TKEA 3PO0A 3IT4B 5BYRA 1E90A 4X62L 3OYYA 4JI3Q 2XGTA 1A8VA 2W3RA 5HHDG 1E8YA 3V6CB 1UE5A 1NR4A 2DY8A 3DBSA 1MJEA 5C1ZA 2O2VB 3X3MA 2Q8IB 2F0GA 2GBNA 3DPDA 4AUQC 1TR5A 3OTOQ 5E4WC 2HTME 1UBQA 1PFBA 2HIVA 4KY6A 3ZJVA 1PTOF 4XDCA 4TUUA 3L3OC 1K0RA 1T3QA 3RI7C 4DV2L 3TP8A 3SVMA 3R7RA 5LMNL 3WAMA 3I56A 1QWYA 2K75A 3NJTA 4OX9L 3A0JA 2VH2A 4H13C 1IYUA 2RHSB 4RCNA 3TCAA 4YXDB 3J9CA 1STHA 1XMQQ 2NTTA 3AM9A 4P1CC 2B2UC 3EGRA 3CMMB 3SFEB 4LFBL 4IFDI 3UQBA 4KHVA 4NXNQ 4DQOC 4AWJA 2BA1A 1PYBA 2B2UA 5D3DA 2AHOB 5LL6S 5I9OA 1FJGL 2HD3A 3ZXVA 2D3BA 5EE9A 4OVZA 1PFNA 3D4DA 2OTLA 1S72A 1EEFD 2JPHA 3HOUB 1R4NI 2BKRB 3J81E 3U50C 4MSMB 1C7YA 3RNBC 4BY7G 1VQ5A 4LF7Q 1WGGA 4D2KA 2MWSB 1SGHA 3I4OA 2DZMA 4KK7A 2VNUD 5DPRA 4IM0A 1K8GA 1SIJA 1MVKA 5M5WH 2JA5B 1F0ZA 1UEAB 3GV3A 2QILA 2EOTA 5J18A 2KENA 1E24A 1GPXA 3L7ZC 3G6EA 1F9PA 1JMCA 3HOZB 1G2TA 1E10A 4A3EB 2HE7A 3ZLZA 2CVRA 5G5GA 1SYCA 2EVBA 5A2QE 3BIID 4A3DH 2NZ1D 3IAM1 2I5MX 1J7CA 4HMJA 4J15A 1EWHA 1G6PA 3I4MB 4UP8A 1WI0A 2K22A 1X6OA 3FKIB 2KHJA 2VS1A 2HHHQ 4BA1I 2GBJA 5DAUA 3CIRB 4OO1G 4JWUC 1YBYA 3KYHC 2XK5B 4MDKE 3SDLC 5C0XG 3S1NH 1VQAA 2KUMA 1QOHA 2KEEA 5L37A 1IBKQ 4N8FA 4NAMA 5JXVA 1S5BD 4LFAL 3EFUA 4A93H 4EZLA 3M4QA 2J7QB 5ELDA 2F4VQ 4WURA 1ASZA 3ZKJC 4CDCC 1HR0L 2RF4A 4A9AA 1VQ4A 1FIQA 4LNNA 3SK4A 4B3RL 5AJ3Q 3A54A 2F0QA 2MPMA 1EYCA 3I7FA 2AKWB 1QVCA 1EY7A 2OHFA 3DCGA 2RVLA 2R6GA 3EVQA 5KNCA 5M5XB 2EXDA 4FF1A 3H3VH 2CS4A 2K4KA 4B3SL 2JXMB 1I3QH 5I6WA 4DK0A 3HOWH 2M0AA 3W5VB 2LMCB 1NBFC 1UWXA 1OXSC 2IO0B 2B3GA 3DBRB 1EU3A 4P72A 2FIFA 2KANA 1TJEA 2IX1A 5AUKA 1NUCA 4CKEA 1WMHA 2X8XX 3BZDB 3U4EG 4A75A 3N52A 4L63B 2F0NA 2MBQA 1LUZA 1VRAB 3IFDA 1U4AA 3S2AA 2L11A 4LK1C 5C5MA 3Q0AA 3OPOA 4EQOA 1XNRL 1HZBA 1Y56A 2IO2B 4J3OD 5H8YE 1B9RA 3FEWX 4LJPB 2K01A 4CO7A 2IW3A 3MXUA 5FLMG 4YWLA 4R8NA 4HXDA 3C1FA 4P1BC 1ZEQX 3I3TB 3M85A 2PMZB 2K5DA 3NQIA 1R7SA 2N9EB 1G6ZA 1WTWA 4EZKA 4YCUA 1BKBA 2QDBA 2R7ZG 1N8RC 1HZ6A 2B3AA 1QILA 1ZE3D 3JAMi 4LFCL 3E0EA 2KJRA 1QB5D 4C80A 3VH3B 4DR3Q 2YV5A 2XVSA 3ICEA 3W1BA 3DWQA 1SN8A 1T5XD 4GOCA 3GD7A 1XNQL 1QZEA 2PPHA 2MH7A 2K6AA 1ZPSA 4DR5Q 1B3AA 1QF6A 2XNAC 2VZKD 4V0BA 4JI5Q 1UNSA 4X3KA 4DV5Q 2Y3AA 1NE3A 3I4NB 2VUMH 2BA0A 3SK6A 3ZGZA 2VY3A 4I65A 5D94A 1LTRD 1R4NB 5EDSA 3ZIMA 4NAWA 3K57A 1EIFA 5FLXL 2UYZB 4ZRJA 4UAIA 4UP7A 2WP9B 3W1GA 4B3ML 4MTKA 4P2CB 4QAYA 1N61A 4XDDA 1BUVT 4PMBA 4MM3A 1I4GA 3H0GH 3RNCC 4ABNA 4LNIA 1OQYA 5DNFA 3DHGC 1PH9A 4KDLB 2RDFA 2WYQA 1K50A 4GDKA 4DAYA 1ASYA 2K28A 1DONA 4P7IA 1ML0D 1Y1VG 1R4MI 1ENCA 3I73A 2M4NA 5CBEE 3OIQA 4DV2Q 2L00B 2JY6A 4M00A 5LMNQ 3VYSA 1TKGA 4YL8A 4CJ0B 1X3QA 3FAHA 2E5LQ 2XN9C 5I2YA 3BS1A 1K8OA 3APCA 2MP2A 4M8MA 1WTOA 1UUPA 1EY0A 2ES2A 2PZTA 1Q5WB 4QUFA 4GSWA 4ZLTF 3H3VC 4LFBQ 1GD7A 2G1EA 4WWOA 1XQQA 1DCZA 1H4RA 1XD3B 4QJFA 5CX3A 2E75C 5IWAL 2IL8A 3CCVA 4DDID 3EJIA 4AP4C 2LUMA 2MGSA 2C9WB 4DA2A 3L10B 2AWOA 3GTJH 1YHQA 1FXIA 2E6XA 1K53A 5K36H 1YJWA 1FEHA 4GXBA 4DHJD 3A55A 2JXXA 2FIDA 3T53B 2ZJQA 4A3BG 3D31A 2FNJB 2GVBA 1STYA 5LMUL 3S17B 3GTGH 2MNAA 1ZYRD 2I1KA 3J81j 1L4ZB 2HDLA 5FOBB 4USAA 5KIXA 3NS8A 1VQ6A 4ZKCB 5A35A 4RM8A 1SBBB 1PTOC 2BE5C 3PMFA 4Y7NB 1L0VB 2K5PA 1STEA 4CDDC 1B9MA 4NW2A 3MA2B 3A8IE 2E2IH 4HKZE 4YTPB 5FKAC 2F0MA 4JVZA 1FO4A 4ZKBB 3ZNGC 3U7DA 2XSCA 1SAPA 4A93G 3RMHA 2RR9A 2EYLA 4UDUC 4R3DA 4EFOA 1SMXA 5CC4A 2ASQA 1ESRA 4HSVA 2KC1A 5D3IB 2F0OA 3AFPA 3AH7A 2EMSA 4HROA 1LTGD 2KQ7A 4DBGA 5BN3A 1SFOB 4LK0M 2PO4A 4LFAQ 2I2YA 2J52A 3MHZA 1NSNS 1JQ4A 2HQLA 5IGGA 3SFDB 2ATWA 3NWTA 2BVCA 5TSSA 2LGIA 1HR0Q 2ZTEA 1N33Q 3A33B 2PZUA 3ULLA 5HFYA 2IO1B 3M95A 3H3VI 3HVZA 2GI9A 2IGGA 3J7AV 2PPBC 3HOYH 3WCQA 3RUIB 2WXFA 1T0YA 2RSOA 4DAMA 1UELA 1I4HA 5GQOA 1Y14B 1VS0A 2K3UA 2PJHA 2Y5BB 2KJHB 3SD5A 1MBYA 4I6PA 2Z6KC 4IUNA 4HKQA 4IM3A 1R9TH 1BBWA 3Q3FA 1N60A 2Z6KA 2Z8LA 3Q3OC 1D5ZC 4LJZC 4YCWA 3QOJA 4DXFA 1HTOA 2DWQA 1EY8A 4XT3B 4FHKA 2PEAA 2F0EA 4RGNA 3TP5A 4HCNB 1XNRQ 1E7VA 2IPKD 4KKTA 1WMHB 4JPSA 1L4DB 1IGDA 1UGJA 1PFMA 4RH6A 3D8GA 1K73C 4DN4M 3BYYB 1R4MB 4ZOHC 1R4PB 2QCZA 2J7ZA 3CSFA 1QLBB 3K5NA 3MJWA 1PGAA 1YEZA 1UWVA 4LFCQ 2VUMG 3C3LA 3K7AH 4HK2A 2Z4IA 4BFRA 1I6VC 1H95A 5BN4A 3CCRA 1GXDC 2NBFA 4YWKA 3BY4B 4KKIA 3UDXA 3P1HA 4L6TB 2F0SA 1XNQQ 2ID0A 2E2JH 3H0GG 3NBHA 3ZNZB 2DZKA 1GHJA 2CR5A 1HQMC 2MHVA 5M9OA 1UGMA 3OMCA 2L83A 3PRZA 3VRAB 1P8LA 1Z2MA 1B8AA 1UZXB 3VUYA 1A63A 1WXQA 2N3SA 2MJDA 3RN9C 3T8MA 5JPMC 1WYWB 1NEKB 2RPQA 1B7YB 4P73A 4IN3A 1WWTA 2JA6G 2WXQA 3S1RH 3AE5B 3WOEA 3HVDA 4LUVA 3VVWB 2ZVNA 5HY6A 1WXVA 2EXZA 3RZDH 4F87A 2OOBB 5M5WB 3SEBA 2ASBA 4AH6A 1DOKA 2V4DA 2HDEA 4MM3B 5IA7A 1VMCA 4K6DA 2JQRB 5J2RA 1SNMA 1YN4A 5CHWA 3KVFB 5EE1A 3I91A 2D07B 1JC7A 4A3DB 1JT8A 4YCVA 4N9PA 1WF9A 2YYZA 3K59A 1WY8A 3JAME 4GDKB 1Q82C 4IDIA 4K5XA 2ICIA 1V86A 1YJNA 1QVFA 5EPJA 3ABVB 4E71A 1STNA 2KQ3A 3KLSX 4RWSC 1YJ9A 3GO5A 3KWVA 1N34Q 3GS2A 1AWDA 2WU2B 1TIID 1KJTA 3S1NB 4OW0A 3E9IA 4N58A 5C4XH 4N6EB 3CD6A 2D3CA 2MP2B 1ILPA 3LX0A 4EVOA 3PUZA 4A93B 4IWPA 2DJFC 4RNAA 1W3SA 2K5NA 2BOSA 5IWAQ 3Q23A 2ZJPA 1IUEA 3NVWA 1MG4A 3UE1A 4FBJB 1Q8KA 2CFMA 1YQ4B 1QG7A 2J4XA 5IT9c 1V8CA 3HIZA 3P4QB 4B6WA 2A68C 3SDZA 3B6YA 3NXWA 1GUWA 1L5PA 2D0PA 1I3QB 2C35B 3HOWB 4C3JG 2M9VA 3G71A 4P16A 4DR2Q 3K81C 4GLVB 2CKHB 2AX5A 1YNXA 3QC8B 3CP0A 2WXHA 1BR9A 4EQPA 3CPFA 4UHVA 1OTCA 3QJZA 1HJPA 4PNYA 2NR2A 1HEZE 4JX1C 1IBLQ 4W9HA 1WD0A 2DYMA 2L5TA 2OEOA 1YN3A 5AZHA 4BA2I 3NEMA 3PHXB 1M90C 1OXTA 3GDEA 3PUXA 1LM8B 4DK5A 4EEWA 5T1IA 1Q1BA 3KLSA 1AZPA 1JJ2A 1TGZB 1YJ1A 3EC8A 2RDBC 1VR9A 1XLPA 1STGA 4CDFC 1E2WA 1PTOB 4U673 2KN5A 3QR8A 5D7GA 1YNNC 1GOZA 4QQBX 3K5MA 4JIOU 2L0TA 1JORA 2QGQA 4G3XB 1L1OC 1LM0A 2GLSA 3AEEB 3VTUA 3C19A 3KF6A 2RD0A 1YZ6A 4MSQB 4XWWA 4OVUA 1DYQA 3CCSA 1OEYJ 2MO1A 1X3EA 1QJOA 4JI8Q 1L1OA 1KRSA 3CCJA 2JA8G 2WXLA 4TV3A 4LDTB 4DUYQ 2KECA 4W9CA 2B63H 2PQAA 4WQOB 1JOOA 1QOBA 2PE9A 2F0WA 1F2ZA 1X65A 3GTLH 1WE7A 1SR3A 1V2YA 1ZDVA 2SAKA 5JHBA 1NENB 2V4IB 3N1YC 2SOBA 4KJOA 1NNXA 3D6CA 3DMUA 3QB3A 3ECIA 2IY0B 5LMNW 1FGBD 2MUYA 1V6EA 2VUMB 1E2ZA 3IFTA 4DV6L 2DENB 2PIAA 4WORA 4L8JA 1VCIA 4HJGE 1JWUD 3PF5A 1PH2A 5JEAH 4IPGA 4RKBA 2EKIA 3I2ZA 1FNWA 3DVGX 4K2LA 4BBSG 3ZJUA 1NMGA 2PI2E 1OXXK 1PTOD 2BE5D 3T1YL 3M62B 1VJKA 3NSWA 2ICEC 3T3OA 3EHVA 4LLGM 2K5VA 1WGYA 3Q6SA 4FDBA 4NPSA 4RGMA 4RF0A 2FCSA 1QUQB 2MRPA 2A5HA 4BXXH 1PGBA 3S1QH 3BVZA 1OTRB 4HDQA 3DEPA 3L0OA 1S5CD 1X55A 4JBJA 3U4VA 5BR8Q 1WX9A 3BWUD 3R2IA 1J5EL 4XE0A 3AEBB 3W3AA 3RD2A 5EGTA 1W6KA 3PV1A 1RL2A 4ICVA 1ENFA 3C1EA 3HOVH 5C4HA 3L16A 3AU4A 4A3LG 1EFID 3B9JA 3Q3NC 1GJZA 3AMUA 5E6OA 4J8QA 5C6AA 1RHPA 1FFUA 1BBXC 1L7YA 2A6ED 2NMQA 4F7XA 3QQ8B 2EJGC 4BWGB 3UINB 3FMCA 4KDIC 3J81i 2GVAA 3CSTA 1KFYB 4YSYB 1G51A 4M0WA 3GOEA 4IG7B 1L6UA 3RZOH 1PH6A 1GVPA 2BS2B 1J8CA 3RUZA 1E1TA 2PKOA 3GTJB 4BKTA 2KHIA 3U9OA 3V2TA 3OTOL 3APDA 3NBHB 3X3NA 2J0JA 4IUVA 3PZ8A 1KAAA 1EY4A 1Q7YC 3A7LA 4P6VF 1YMHE 2N4FA 1F2LA 2GRIA 3GTGB 1XCQL 3V60A 1G6JA 2V1CC 3L13A 4Q2JA 3NPPA 1LXDA 1WOCA 4K7WA 4MHEA 4R4CA 1RF2D 4HDOA 3W9CB 1TQOA 1TIFA 1UBIA 1SF0A 2FAZA 3DWGC 2E2IB 1ISNA 1C3TA 1IKLA 1PXUA 5FJ8H 2D62A 3Q8DA 5C4XG 1QOGA 2LJIA 4K8JA 5HGTA 1PH4A 3LWUA 4BBRG 1U4PA 3CC2A 3L9AX 1K0SA 2CHXA 4W9EA 1ZW7A 3E0JA 1P9DU 4CJ1B 1C1YB 3TEHB 3E9HA 2WHIA 2ZTCA 1EL0A 3D32A 3KUDB 1MI2A 4JI4Q 3TN2A 2KDMA 1EWIA 3AEDB 3VA7A 2WP8J 2K5HA 1S5FD 1I4PA 2F0VA 1DD2A 1FNUA 2L1AA 2MBHA 3LXFA 4GU2A 2MBBB 2LWPA 2PE6B 2R7DA 2B76B 4JLCA 2WXPA 4WJQA 4GOPC 2L32A 1Y8OB 1U4MA 5C3WA 1A2TA 1V49A 3AE8B 4TQUS 2KQ4X 1Y1WH 4GOPA 3HOYB 4FADA 3FRPB 4LF5L 1KF6B 1T0QC 4GIVA 3B2FA 3F1ZA 3DLLA 4JOIC 5GAHC 4BY7H 4F1SA 5M5YH 1WTQA 1R9TB 3TDQA 3DHIC 3N1XC 4JOIA 1Q0WB 3NG0A 2E74C 2WKCA 2XK5A 3KOJA 2PTLA 3P2BA 2FXQA 3VR2A 2GN5A 1PMRA 4ZAIA 5IYDH 2F0PA 3ER0A 4WAAA 1RIPA 4AOFA 2PQEA 2LXKA 3D0FA 2KWCA 5CHFA 4US8A 4DV1L 4ALPA 1L0YB 5AZFA 1GB4A 4F88A 1D6EC 2INCC 4DNRB 4NXML 1TWFH 4GGQA 2LGDA 2QCPX 2MP1A 2GMIC 1XWEA 1ZKHA 4EQ5A 4WJOA 2I5HA 5AJ3L 4NJ7A 2MQHA 5BYSA 3GTPH 4ZUJA 1R4QB 1SNQA 1LQBA 1F2MA 1LTID 1SNOA 1SDFA 3H91A 3OHXC 3K7AB 4MZ9A 5C0XH 4A3FG 1PH1A 3HM3A 3FDTA 1V80A 1NY4A 4KTAA 2ZT9C 2O5IC 2AL6A 1WH3A 4IC7B 5CV9A 1CUKA 5JJKA 3TZDA 3EUB2 3KF6B 1OFFA 2Q2TA 1IW7C 2DAFA 2B2VC 1C9OA 3HEJA 3LNNA 2E2JB 1RWSA 2KN4A 1TVXA 4XT1B 1DZ1A 1L1OB 4DF7A 1AE2A 1C48A 2KTFA 1V81A 4IM2A 2F0JA 4ZDVA 2A19A 3A4SC 1YVCA 4DK3C 4P74A 1DM0B 4FJVB 4DV6Q 4AS1A 1YHBA 4WFN3 4BXXG 1D8LA 3EFXD 3K58A 1VQ7A 4JI7Q 2M0XA 3MXPA 2AQ1B 1WTVA 3S1RB 1RYJA 2KACA 2WKDA 1KDBA 3QOLA 3JVZX 4GLAC 3RZDB 1T5EA 2BS3B 2JYTA 3HFZB 2JX5A 1B50A 3PT2B 2RSUA 1P98A 3VH4B 1TBEA 1ZOYB 3TBLD 3ZXRA 4MN3A 1HUMA 1NTGA 2RHQB 5FLMH 2C9OA 1J5EQ 4PS8A 3PLUA 2MHJA 4GN5A 5JAVA 3QK0A 5IY0A 1UEBA 4IFDJ 1FRRA 2CWPA 2N55A 4NP5A 1YNND 1VZ6A 2R7ZH 3PV0A 4TKNA 4DR5L 1SRUA 2PYKA 2LZ6A 4JI5L 2JA9A 4DV5L 1YOVB 3CCQA 2DLBA 2QC8A 3MWYW 4MJSA 1Q86C 5C4XB 1JALA 3VTWA 2JYOA 4R9WA 3KW5B 1GKHA 1C0AA 3P4RB 3LJ3A 2O6VA 2HT1A 1BVSA 3NOBA 4WWPA 1SYGA 3TEYA 1MGSA 1S40A 1TTNA 5HG2A 4M0WB 4CYEA 1DOXA 2WXJA 5FJ8G 2FMMA 5C4JH 4KKUA 4KN4C 4X3TA 1S1QB 2L7RA 2RGFA 4BVUC 2KYWA 4P75A 3GZNI 3Q2AC 4RMAA 2F03A 4LUOA 1LTAD 1HTPA 1I94L 4W9JA 4U68A 5IIFA 2D5DA 3I72A 3V6EB 2E5LL 1SROA 1YX6B 3G4SA 4WJNA 3AE9B 2WAQE 4M8AA 1Y1VH 4I6LB 2AUJD 2MBEA 3H15A 1K51A 5CYUA 1WIAA 2HCIA 1EQVA 2BT6A 3T1HQ 4HCPB 3K7UC 4DHZE 2ZVOA 2BYTA 1YJJA 3E3XA 1XLQA 1H9SA 1Y1WG 3ITPA 2WAQG 2YU9H 3I5JC 1ZUD2 1WTXA 1EY9A 1E6EB 1N63A 1S5ED 1O7YA 4TQ1A 1PUTA 1IL8A 1VQHA 2WXIA 4L5TA 2L0CA 1K3RA 3VR3A 2B63B 3EROA 3U52E 1CHQD 2V3SA 2M1MA 1I7HA 3GTLB 4LF4Q 5G3LF 1SNCA 3ERSX 1KIXA 3HG9A 3HP3A 2KLGA 1L6VA 1CT1D 1EY5A 5IYDG 1E8ZA 1Q10A 3SK5A 2JSVX 1ET6A 1N36L 4LF5Q 2WDRB 2FJ2A 2NPTA 5HURA 5LXIB 4TVAB 2Z1CA 3CMAA 3STBD 3DVNU 2A69C 2R7FA 5NUCA 4GOPB 4A3BH 4RCOA 4B9XA 3PQIA 1MSHA 1Q3LA 3H09A 2FBWB 1A0IA 1KL9A 4LNOA 4KZCA 2WXRA 1U4LA 4TQ0A 2KO3A 4J1MA 1F2RC 1TKWB 2UXBQ 2KWUB 3KUZA 3I9V1 5EBCA 3R3OA 1KLUD 4KY5A 4RF1A 2EZVA 4DV1Q 3U9SA 1JB3A 2UUCQ 4FA6A 3QG1A 4M1UB 2WACA 4QUCA 3QX1A 4ZK9B 4NXMQ 1VQGA 4GS3A 4DR7L 1XPRA 4L23A 3NZUA 4BKSA 1I50H 3C2PA 1PH7A 1N33L 3MZ5A 1CQVA 4OO1I 3HOVB 4HJ9A 1RCVD 2EYOA 5C0XI 1ACCA 4JWSC 5GROA 1Q1OA 1J0GA 3ETRA 3P20A 3RZWC 1OQRA 2KVRA 1G291 4H44C 4X65L 5C44B 1EWCA 1N5WA 4KZ0A 5AEKB 4XQNA 3NUHB 4BOSC 5I6YA 1PZJD 1PH8A 3PO3G 3RZOB 2RQXA 2I38A 3ZTCA 1HTQA 5DEHA 2KX3A 2KCNA 3NWSA 3GQBA 1GB1A 1N62A 3NBIA 3UF8A 3CC7A 1GUOA 4C2MH 3NENA 2I5LX 3E6ZX 1J7AA 2D0OA 1U4RA 2V4LA 3HKSA 4IJHA 1C8CA 3G6JB 5J39A 1LT4D 3RT3B 5J17A 1VQLA 1YN5A 3MC9A 3T56B 2JF5A 4DR1Q 1C4QA 2EY5A 2G4DB 3QJYA 5IODA 3GZNB 1TS3A 3CW2C 3GP7A 2D3GA 3FHWA 2MFIA 4YIJA 3SXHA 3A5UA 3PREA 5JH5C 2PNHA 3H94A 1S5DD 4FF2A 2JWUA 2LKVA 3J7ZC 1F2RI 3TIXA 4A6QA 3AEGB 5BYQA 1JROA 3RLNA 2JEAI 4G7OC 1SE9A 2ZCBA 4KSLC 1JWMD 3S9WA 3VYUA 1NBWA 3GTOH 1I4RA 1HQRD 2UXDL 2KCCA 1O7LA 3CCUA 1PDXA 2IGDA 5IYBG 3AE3B 5JVG3 1XJVA 4LUZA 2G9DA 1FPYA 3D3RA 4PZ7A 2Q8RE 4A3JH 2KHWB 1XLOA 3S16H 1CI3M 4AJWA 2Z6BA 1D1KA 2LVPA 1IW7D 4JG2A 3Q8FA 4MJSB 3Q8BA 4MT5A 5ELBA 3OSOA 2BPSA 3PF4A 3F2DA 2V9HA 2X38A 1Y1WB 3GTKH 3M7NA 1TZOA 2WAQB 5EE3A 3LGJA 2E2HH 2O6VB 2DZJA 3TEZA 2C7HA 4HEA1 2PW7A 4BY7B 5IP9G 1QOFA 5M5YB 4ME3A 3KJOA 1AH9A 2FHTA 5HKHA 2NVXH 1KQSA 1WYDA 3S24A 2JA6H 1YIWA 4K2KA 3NTKA 3PCOB 5M3FG 1I94Q 3DDCB 3E56A 3ML8A 2JA7G 4HEDA 4XX5A 1BT0A 4OXPA 1N34L 2IY1B 2KAJA 4W9DA 2H1EA 1TWHB 3NQTA 2VL6A 5JJIA 2L3ZA 3C46A 1P7EA 3R93A 3TZUA 1ONLA 1GUAB 2NBWB 3MP9A 4K8IA 3N6RA 5HI1A 5ELEA 2O5JC 5BMGA 4KHPL 3UDIA 3UGBB 2NVYH 1K8AC
chains in the Genus database with same CATH topology
2DNCA 5E6JA 3GTPB 1H9RA 3RD4A 2K04A 2WXGA 1NCVA 4GLSC 1H9SB 3BVMA 3P75A 3UI3A 2K5WA 3PUWA 4EE2A 2NUCA 3KUPA 1HFNA 4RGTA 3H6MA 3IAS1 3SK8A 5G5HA 2KJXA 2O2LD 2B39A 1KLGD 5EE0A 1WTPA 3PUYA 1NYQA 1BXTA 1QNKA 2PCFB 4XQQA 4FNFA 4MIUA 1JE4A 3AE7B 1O78A 4NJCA 5LHY1 2WDVB 5CORA 2DN8A 1K52A 3PZ7A 1TU2B 2MEKA 4YT0B 3NTIA 2B2WC 2IDYA 1Z7TA 5EKKA 5CGKA 3ZQ4A 1KDAA 4IZ8A 5T8IA 2R7ZB 2B2WA 4CJ2C 1OXUA 4YWGG 1U9RA 1YNJC 1YNTE 1FNVA 3FPPA 1CZPA 2G9HD 4ZUIA 1YQ3B 3GB1A 2LHDA 3OIPA 4F8MA 4ZYSA 1PDQA 2M00A 3IXSA 4FP5D 2EY2A 2BW2A 2A69D 5C4JB 2N9KA 3FC4A 4ODGA 5C3XA 4IUTA 1QT9A 2HUGA 3MJ5A 4RKLA 2VB3X 2QF7A 1HHVA 2ZXOA 2RSNA 1LT3D 1RTNA 1FMAD 2Q5WD 1I4XA 2E2DC 5C2TB 2CJNA 1Y1VB 3BDOA 1SSNA 3DWMA 1Y8NB 4JE3B 1V97A 2EYMA 3CHBD 4ZRPA 4KKJA 2YU9B 1BF4A 4H7BA 5COYA 5CV8A 1HUNA 4YTMB 1ILQA 1K8MA 1KNAA 3W5UB 3T16A 3H8HA 3KF8A 1CQFA 2QSDA 2WQYB 3VR8B 1NI3A 1M8AA 3I3CA 4HAEA 5EJWA 4A3BB 4RHSA 1SE4A 4IQZA 5F2DA 4YSZB 1D1IA 4KX6B 2FMCA 5CBAE 2F3VA 2DY7A 1F9QA 3GV6A 2L4NA 5K5PA 4RFBA 1VMPA 1TS4A 3WDNA 3Q8CA 1I50B 1VF7A 2HCCA 2Q8TA 1C4AA 2LEKA 1B44D 4XYQA 1TS5A 5CR3A 3ND8A 1SJED 1GUSA 1KTKA 2ZXPA 2CQAA 2I46A 1P7FA 4CKBA 4IALA 1ET9A 2L52A 4WH4A 1F9RA 4GZYC 2WIIB 2MJ3A 4C2MB 2NWGA 4OIKA 4B0MA 2N9LA 1IYVA 3W2DA 4HRSA 1PGXA 3V05A 1XCTL 1KABA 2WXNA 3AE4B 4IUQA 1A3VA 1BCPF 5FO8B 2F0IA 2JEBI 4QMGA 5AUIA 2RA4A 1RM6C 1F77A 2Y5PA 4LTUA 3R8BA 1EY6A 2K1BA 3J7YW 3GTOB 3VR4A 1EOTA 4RHRA 2B2TC 4A3JB 4N9TA 2C5CA 1PRTC 4C3IG 4DFAA 2A73B 3BVGA 1C79A 2IX3A 2B2TA 3H0GB 3K5OA 5C4ZA 1MHHE 1Y8PB 3GTKB 1SB3C 4WQMA 2BB6A 1XTCD 5IGCA 2E2HB 1ZDXA 1DJRD 1FM0D 4R8IA 4KKSA 1LTBD 4C3HG 3K6OA 4TSSA 4OL7A 4WWMA 2JA6B 2NVXB 1O80A 2QMTA 3VRBB 5JPNC 4C7ZA 2E76C 3T3NA 1B4OA 1B2TA 3QWNA 2WNMA 2B8FA 5ELCA 5IGEA 5ISRA 4G7ZC 4TMAB 3FVQA 2J53A 2NVYB 2EY1A 1JW9D 4DK1A 2QIEB 1JWSD 1EYDA 1YJIA 1SMYC 2WXKA 2A6HC 5G3LD 4ZHPA 4XWTA 3P4PB 4WIPA 1FR3A 2YEPB 5LNK1 1HCZA 2A74C 3DWAA 1CK1A 4C3JB 2F0LA 3IAYA 5E3FA 1FCLA 1QOAA 2NTSA 2INPE 2FFKB 3LWEA 3I4LA 5MPOA 1AN8A 4OGQC 1JQYD 4K6LA 1WGKA 2LFIA 2CHBD 2RBMA 4O42A 4A3IB 1LABA 2NVQB 4HR7B 5E1FA 4X3SA 1CA5A 1OQQA 2V3PA 1V1OA 1D5XC 2WS3B 5DM63 1PYWD 3U2SC 1IKMA 5C3JB 2SDFA 3CQZB 3QIAA 2JA8B 3V3XA 2JYEA 2L1BA 1GUTA 2J0TD 5JEAJ 3MXNA 4CBVA 3MXGA 1ROEA 3D6WA 3D4WA 4KMUC 4KV6A 2FINB 1A3TA 4KY7A 5AFWA 1BMLC 2D2CC 4C3IB 2OXPA 2CW0C 3GTQB 4BBSB 2EYHA 1RDPD 2IJ0A 4ILWA 3CKIB 5JVH3 5FK9C 1V8QA 4XIGS 3ZJTA 4G7HC 2L12A 4NMZA 4C3HB 1K83B 3L4PA 4B0EA 3W1SA 1B9NA 3Q69A 2R61A 4RAUC 3AB9A 4WAFA 2A68D 4C7YA 2JE6I 2NB0A 5JJZA 2D9UA 3FPUB 2WXMA 3BDLA 5IT9L 1RTOA 2EE1A 5H92C 5CMDA 1EEID 1Q1EA 3CWIA 4X3UA 1CTMA 2D5GA 3TEXA 1C9FA 1PRTB 1GUNA 1I6HB 4AQ7A 3AECB 2ACZB 1PZID 4A3MB 1JWBD 4US9A 1BCPC 1ZXIA 1NYRA 2KMMA 1TWCB 3E9SA 2LFNA 1HA5A 3HS0C 4BBRB 4GDLB 2XWJB 4IUUA 3S14B 3C8YA 3V96A 2BB5A 1EIHA 2M19A 5DM73 2F0TA 1TKYA 1SXTA 3OW7A 4RA8A 3MFGA 1ZYRC 2KVMA 4DXGA 4MH8A 1XXGA 1SE2A 2DNEA 4C1NK 2F0KA 3D4RA 1JCKB 2F0UA 2R92B 2PW5A 1NVID 3EQLC 4IFDG 1TT2A 5C0XJ 1JOKA 1XO3A 3CRLC 3R2TA 1RKNA 2EJMA 2WINB 1B1ZA 1SYDA 1VDZA 2PNRC 2K5QA 2ON8A 2KHSA 1PFDA 1SMYD 3NK9A 3J80L 4A3FB 1STAA 2A6HD 3DXJC 1LT5D 3DWPA 1DOYA 1JOQA 3SR6A 3VA5A 1N5XA 2DYOA 1LLRD 1RJTA 2VXWA 1AW7A 1TY0A 2IX0A 1TWGB 4KN7C 2KOLA 2OEDA 1FCCC 4NZLB 1IHZA 3S1QB 2RDGA 2XWBB 5FLXE 1CZWA 1AFPA 1HPCA 1G2SA 2JP1A 2Z4HA 4OZAA 2F0HA 3KLRA 2PVOD 4ZRZA 5KYIA 4XXEA 1J7BA 3AMZA 2B2YC 1A15A 3BK2A 2F3WA 2XIWA 1C4CA 2YEPF 1II3A 2KEDA 2B2YA 3QO2A 1E0BA 4LAAA 3SR1A 4QCLA 3VYRA 2ONQA 2VB2X 5KNBA 3KBGA 3KQ4A 4K14A 3Q22A 4ZHOA 1JMLA 3S1MB 2H4OA 3Q8EA 2VZKB 4MACA 4G4KA 1V1PA 4OIJA 3KBXA 2J42A 2SEBD 3J81L 1MPEA 4HMIA 5EPKA 2CW0D 1OO9B 1SJHD 2V3NA 4ARIA 3OWFA 2PW9A 1DOIA 1PTOH 4L2YA 2F4IA 5FO9B 1HA6A 2EPBA 1TS2A 5C5LA 2BS4B 3NE5B 1NAPA 1E7PB 4L1BA 3TP6A 4CHTB 1BCPB 3WOFA 4XTCS 2WLBA 3K5LA 1SSOA 5A2QL 1LACA 3AEFB 3S2HB 1VF5C 2F0FA 3TBIB 1D2BA 4FXCA 4OHJA 1A2UA 1AYFA 1EZ6A 1H9KA 5ELFA 4H2AA 4EQNA 1KDCA 4ME5A 4QF4A 1UWMA 1SEBD 2V0GA 3NTHA 2HDMA 1I4QA 2AUKA 1Z6HA 3LB8C 3E5SA 2JSOA 2EYJA 3CRKC 1STBA 1WRIA 3M4OB 4OZBA 1QCBD 5KYLA 2MJ8A 1TWFB 3ZYYX 3DUZA 1DGJA 1BCPD 1JR0D 2SNSA 5CV5A 1AP0A 4DAPA 5D65A 3SHLA 5CV7A 1G8ZD 3BDCA 4REZA 2XRQD 1TY2A 1BNZA 2JU6X 1LV9A 2N88A 1EIGA 3BG3A 1PRTF 2AWNA 1C4PA 3F2UA 4KD3A 1IBXA 3UI2A 5IOCA 1EQTA 3TP7A 1SNPA 4JBWA 1LTTD 1H9JA 1HTLD 3PIP3 3PO3B 1Z47A 5KNDA 2RKSA 3OWEB 3AE6B 3I8ZA 3HRDD 4NKLA 1RFKA 2EYPA 2TMPA 4DGZA 4Q5VA 4PQXA 3TEWA 2PMVA 2WDQB 3M4YA 3PIO3 1TWAB 4RGOS 4HCEA 1KRHA 1T6BX 2W54A 1J9OA 3AEAB 3G7LA 3AV8A 1VLBA 2X69A 2IT1A 4E6IA 3P1MA 2A6EC 2ENBA 4TRDA 4PT5A 3TMEA 2CU3A 2WXOA 4WJWA 1B53A 1FRDA 2NVTB 3EA6A 2BDNA 4DAVA 3K0YA 2K7VA 1G91A 3HGBA 2XRSD 1ICWA 1MI0A 4DU9A 1DXMA 2QKIC 4DNTB 1SE3A 3AE1B 3I90A 2W82A 3HKZB 4WRDA 5M3FB 1V1PB 2JA7B 3N9YC 1CFMA 1RD9D 5I9PA 5I4DA 4K5VA 2QEJC 1WD1A 3I57A 2K0PA 2HQEA 3ERQA 3OMGA 3IL8A 2BCOA 4QB4A 2AQ2B 1J8IA 3HZXA 2E3TA 1BDOA 4Q0FA 2K33A 1CZGA 2KA7A 4CKCA 3DEOA 1IGCA 4A55A 4TKOB 4QIWB 3SE0A 4ID6A 2IGHA 4IUPA 3S15B 2N7JA 1XEEA 1EZ8A 1SYBA 1SYFA 2EDGA 5EBDA 3NS1A 2EYFA 1EWYC 5EKLA 5E4XA 4NAWB 1DOLA 1ENAA 2OF1A 3ONAB 3NZ3A 2X6GA 1LT6D 3IKJA 3NVVA 5J22A 2QJLA 3RLFA 4O1NA 3MC0B 3RPFC 2GA4B 4KI0A 4ULLA 1GHKA 2I07B 2PVGC 5GXGB 1AZQA 2W3SA 5EPLA 1AEXA 4BY1B 5K36G 5JOBA 5LL6X 1D5MC 1OXVA 1WCMB 4NDXA 1RODA 3O13A 2N0SB 3NRZA 4CGYB 5KEEA 3AU7A 5D14A 5EQ0A 4IKGA 1D4BA 3P4SB 2ZW0A 4FF4A 4ZQ3A 2RMMA 4C56C 1X32A 3B2GA 4A8XC 2BTEA 4H0LC 1IBXB 2ZXRA 1EYAA 4S3SA 2WB1B 1VDVA 2Y0SB 3NHHA 3URYA 2W55A 3M7GA 1ZXTA 1W6JA 1F9SA 2K32A 3AE2B 4CQNA 1VZ8A 4ITKA 1GJXA 3VQIA 4PMWA 1JWAD 3VR9B 2X6LA 4B9WA 2DBYA 2NYZD 1MSGA 3TSSA 1PZKD 2WV6D 4BS9A 2TSSA 4Z9CB 3S16B 4IURA 1FFVA 1MHXA 3A56A 4A90A 3JAML 3DM1A 3AB5A 4EGVA 1HRJA 4HN7A 1CJEA 2NN6H 5FR3A 1MD2D 4FYDA 1EM7A 1GAQB 1ZP0B 4FXKC 1C76A 2KWDA 5KGUA 1A3UA 4PV1C 3FILA 2K9XA 2L55A 1TYGB 4OZCA 5FO7B 1H9MA 1XYIA 1A6XA 2JZPA 3MEHA 1DOMA 4G57A 2FUG1 2GB1A 2RDHA 1BOSA 1M4VA 2R3ZA 4I7ZC 3P63A 3KWLA 5T1GA 1YNJD 2RPVA 5C3EB 4ARCA 5M3MB 4C1NI 1VZ7A 2B8GA 2LS01 5CV4A 1E2VA 4KGSA 4KD4A 1WTRA 2R93B 1LO5D 2PLPA 3A8JE 4V190 4A3GB 1CM9A 1HZ5A 2MJEA 1FXAA 1Q8IA 3I70A 1A70A 5CV6A 2EJFC 3P7JA 5EKIA 2M56B 4HTHA 3TUOA 4HSPA 1C78A 1FD6A 3OOCA 3PO2B 2INNE 1F2YA 1NR2A 1V43A 5IT9E 1CA6A 1ZXHA 1BQQT 4FF3A 3IT6B 5IGDA 3KK7A 3VYTA 4FXDA 1C77A 5BMIA 3MTSA 4YSXB 2LHEA 4IFDH 1PLFA 5IGBA 2EELA 1QQRA 2Y5CA 3MAQA 3S2DB 1FYCA 2CJOA 3M3YB 2SNMA 2BDOA 1UAPA 1HXYD 2JXTA 1E0ZA 2AQ3B 2WU5B 1CHPD 4XDXA 4KHZA 5I2XA 1HFGA 3U7ZA 2K05A 1XX8A 4A3KB 1QKZA 4PMCA 4FXGC 1KH0A 1KNEA 1Q12A 2M2LA 3ND9A 1SNDA 4ZRQA 1XLNA 4N59A 1S4ZA 4FVMA 5BMHA 5BN5A 5KRUA 1BO0A 2EY6A 3NP8A 3BK1A 3NVYA 3PUVA 3Q8AA 3GTMB 2FE8A 1WYGA 1Y69U 3Q24A 1QE6A 2OT2A 1JRPA 3DHQA 3T4AC 3HRZC 3A7AB 1EU4A 3CU7A 4K5WA 5J1ZA 4XYOA 3NUCA 4LMQD 2LMCA 2NN6G 4JK1C 3HUIA 4OO1H 4KGRA 2ZW1A 1WVLA 3HOXB 4KJNA 3LYYA 4J6HA 3MFYA 1E9MA 5JEAG 5IGFA 2NN6I 4XQJA 1SYEA 3T13A 1GUGA 3MVVA 2B2VA 4FO2A 1LTSD 4AYBB 2H89B 4KGTA 1L0XB 1Q90A 2O4XA 3VR5A 2PZWA 1O7ZA 3FILB 1QNUA 2K03A 4B08A 3J80E 1JICA 1XF5L 3NVZA 3T51B 1ESFA 2F1MA 2H88B 2L9HA 4IOIE 1X3PA 4YTNB 1FD7D 1BUIC 1ZKOA 3BYTB 2IWHA 3J7AF 3AN1A 1WSPA 3VR6A 3MHBA 2LY7A 3P42A 1PRTD 2F0DA 3A8KE 2BBCA 4HCSA 1TKEA 3PO0A 3IT4B 5BYRA 2W3RA 5HHDG 1NR4A 2DY8A 3X3MA 2Q8IB 2F0GA 1TR5A 5E4WC 2HTME 1PFBA 4KY6A 3ZJVA 1PTOF 4XDCA 3L3OC 1T3QA 3TP8A 3SVMA 1QWYA 4H13C 1IYUA 4RCNA 4YXDB 3J9CA 1STHA 2NTTA 3AM9A 2B2UC 3EGRA 3SFEB 4IFDI 4KHVA 2BA1A 2B2UA 5D3DA 5LL6S 5I9OA 5EE9A 4OVZA 1PFNA 3D4DA 1EEFD 3HOUB 3J81E 4D2KA 4KK7A 2VNUD 1SIJA 1MVKA 2JA5B 1F0ZA 1UEAB 2QILA 2EOTA 3GV3A 1GPXA 3L7ZC 1F9PA 3HOZB 1G2TA 1E10A 4A3EB 2CVRA 5G5GA 1SYCA 2EVBA 5A2QE 3BIID 2NZ1D 3IAM1 1J7CA 4HMJA 1EWHA 3I4MB 2K22A 3FKIB 4JWUC 4BA1I 5DAUA 3CIRB 4OO1G 5C0XG 2KUMA 1QOHA 2KEEA 4NAMA 5JXVA 1S5BD 5ELDA 4WURA 4A9AA 1FIQA 3SK4A 3A54A 2F0QA 2MPMA 1EYCA 2OHFA 1EY7A 2RVLA 2R6GA 3EVQA 5KNCA 5M5XB 4FF1A 2JXMB 5I6WA 4DK0A 3W5VB 2M0AA 2LMCB 1UWXA 1OXSC 1EU3A 1TJEA 2IX1A 5AUKA 1NUCA 4CKEA 3BZDB 3U4EG 3N52A 4L63B 2F0NA 1VRAB 3IFDA 2L11A 4LK1C 5C5MA 3Q0AA 3OPOA 4EQOA 1Y56A 4J3OD 1B9RA 5H8YE 3FEWX 2K01A 2IW3A 3MXUA 4R8NA 3C1FA 1ZEQX 3M85A 2PMZB 2K5DA 3NQIA 1R7SA 1G6ZA 1WTWA 2QDBA 1HZ6A 1QILA 1ZE3D 1QB5D 4C80A 2XVSA 3DWQA 1T5XD 3GD7A 2MH7A 2K6AA 1ZPSA 1B3AA 1QF6A 2XNAC 2VZKD 4V0BA 2Y3AA 1UNSA 4X3KA 3I4NB 2BA0A 3SK6A 3ZGZA 4I65A 1LTRD 3K57A 5FLXL 4UAIA 2WP9B 4P2CB 1N61A 4XDDA 1BUVT 4PMBA 1I4GA 4ABNA 5DNFA 2RDFA 1K50A 4DAYA 1DONA 2K28A 1ML0D 1ENCA 3I73A 5CBEE 3OIQA 3VYSA 1TKGA 4CJ0B 1X3QA 3FAHA 2XN9C 5I2YA 3BS1A 1K8OA 1WTOA 1UUPA 1EY0A 2PZTA 4QUFA 4ZLTF 3H3VC 2G1EA 1DCZA 2E75C 2IL8A 3EJIA 2LUMA 2MGSA 4DA2A 2AWOA 1FXIA 2E6XA 1K53A 5K36H 1FEHA 3A55A 3T53B 3D31A 1STYA 3S17B 1ZYRD 1L4ZB 2HDLA 5FOBB 4USAA 5KIXA 4ZKCB 5A35A 1SBBB 1PTOC 2BE5C 3PMFA 4Y7NB 1L0VB 2K5PA 1STEA 1B9MA 4NW2A 3MA2B 3A8IE 4HKZE 4YTPB 5FKAC 2F0MA 1FO4A 4ZKBB 2XSCA 1SAPA 3RMHA 2EYLA 4UDUC 4R3DA 5CC4A 1ESRA 4HSVA 5D3IB 2F0OA 3AH7A 4HROA 1LTGD 5BN3A 1SFOB 4LK0M 2PO4A 2I2YA 2J52A 3MHZA 1NSNS 1JQ4A 5IGGA 3SFDB 3NWTA 5TSSA 2LGIA 2PZUA 5HFYA 3HVZA 2GI9A 2IGGA 3J7AV 2PPBC 3WCQA 2WXFA 2RSOA 1I4HA 2K3UA 1MBYA 4IUNA 4HKQA 1N60A 2Z8LA 1D5ZC 4LJZC 3QOJA 4DXFA 2DWQA 1EY8A 4XT3B 2F0EA 4RGNA 3TP5A 2IPKD 4KKTA 4JPSA 1L4DB 1IGDA 1UGJA 1PFMA 4RH6A 3D8GA 4DN4M 3BYYB 4ZOHC 1R4PB 2J7ZA 1QLBB 3K5NA 1PGAA 3C3LA 2Z4IA 1I6VC 5BN4A 1GXDC 2NBFA 4KKIA 3P1HA 4L6TB 2F0SA 2ID0A 3NBHA 1GHJA 1HQMC 2MHVA 5M9OA 3OMCA 2L83A 3VRAB 1WXQA 2MJDA 5JPMC 1NEKB 4IN3A 1WWTA 2WXQA 3AE5B 3WOEA 3HVDA 2EXZA 4F87A 5M5WB 3SEBA 1DOKA 2V4DA 2HDEA 4MM3B 1VMCA 4K6DA 2JQRB 1SNMA 1YN4A 5EE1A 3I91A 1JC7A 4A3DB 4GDKB 4DQOC 4N9PA 4IDIA 2YYZA 3K59A 3JAME 4K5XA 2ICIA 5EPJA 3ABVB 1STNA 2KQ3A 3KLSX 4RWSC 3GO5A 3KWVA 3GS2A 1AWDA 2WU2B 1TIID 3S1NB 4OW0A 4N58A 4N6EB 1ILPA 3LX0A 4EVOA 3PUZA 4A93B 4RNAA 2BOSA 3Q23A 1IUEA 3NVWA 1YQ4B 1QG7A 2J4XA 1V8CA 3P4QB 2A68C 3SDZA 3NXWA 1GUWA 1L5PA 1I3QB 3HOWB 4C3JG 2M9VA 4P16A 2AX5A 2WXHA 1BR9A 4EQPA 4PNYA 1HEZE 4JX1C 1WD0A 2DYMA 2L5TA 2OEOA 1YN3A 4BA2I 1OXTA 3PUXA 5T1IA 1Q1BA 3KLSA 1AZPA 1VR9A 1XLPA 1STGA 1E2WA 1PTOB 4U673 5D7GA 1YNNC 1GOZA 3K5MA 1JORA 3AEEB 4XWWA 1DYQA 2WXLA 1QJOA 2KECA 1JOOA 1QOBA 2F0WA 1F2ZA 1ZDVA 2SAKA 1NENB 2V4IB 2SOBA 4KJOA 3D6CA 3DMUA 3QB3A 1FGBD 2MUYA 2VUMB 1E2ZA 3IFTA 2PIAA 4WORA 4L8JA 1VCIA 4HJGE 1JWUD 2EKIA 3RFZB 5JEAH 4RKBA 1FNWA 4K2LA 3ZJUA 1OXXK 1PTOD 2BE5D 1VJKA 3NSWA 2ICEC 3T3OA 4LLGM 3Q6SA 4RGMA 4RF0A 4HEA1 2A5HA 1PGBA 3BVZA 3DEPA 1S5CD 3BWUD 4XE0A 3R2IA 3AEBB 3W3AA 5EGTA 1W6KA 1ENFA 3C1EA 5C4HA 1EFID 3B9JA 3AMUA 4J8QA 5C6AA 1RHPA 1FFUA 1BBXC 2A6ED 2NMQA 4F7XA 2EJGC 4BWGB 3FMCA 1KFYB 4YSYB 4M0WA 1L6UA 2BS2B 3RUZA 2PKOA 3GTJB 3U9OA 3V2TA 3X3NA 4IUVA 3PZ8A 1KAAA 1EY4A 3A7LA 4P6VF 1YMHE 1F2LA 2GRIA 3GTGB 1XCQL 4Q2JA 3NPPA 4MHEA 1RF2D 3W9CB 1TQOA 1SF0A 3DWGC 2E2IB 1IKLA 1PXUA 2D62A 1QOGA 2LJIA 4K8JA 5HGTA 3LWUA 1U4PA 3L9AX 3E0JA 4CJ1B 1EL0A 1MI2A 3TN2A 2KDMA 3AEDB 3VA7A 2WP8J 1S5FD 1I4PA 2F0VA 1DD2A 1FNUA 2L1AA 3LXFA 2B76B 2WXPA 2L32A 1Y8OB 1U4MA 5C3WA 1A2TA 3AE8B 4TQUS 2KQ4X 3HOYB 3FRPB 1KF6B 3B2FA 1WTQA 1R9TB 3TDQA 2E74C 2WKCA 2PTLA 3VR2A 1PMRA 4ZAIA 2F0PA 2PQEA 4US8A 1L0YB 1GB4A 4F88A 1D6EC 4DNRB 2QCPX 2MP1A 1XWEA 5BYSA 4ZUJA 1R4QB 1SNQA 1F2MA 1LTID 1SNOA 1SDFA 3H91A 3OHXC 3K7AB 5C0XH 3FDTA 4KTAA 2O5IC 2ZT9C 5CV9A 3EUB2 3TZDA 1OFFA 1IW7C 2B2VC 3HEJA 3LNNA 2E2JB 1RWSA 2KN4A 1TVXA 4XT1B 1DZ1A 4DF7A 1C48A 2F0JA 1DM0B 4AS1A 4WFN3 3EFXD 3K58A 3MXPA 2AQ1B 1WTVA 3S1RB 1RYJA 2KACA 2WKDA 1KDBA 3QOLA 3RZDB 1T5EA 2BS3B 2JYTA 2JX5A 1B50A 1ZOYB 4MN3A 1HUMA 2C9OA 5JAVA 4IFDJ 1FRRA 2N55A 4NP5A 1YNND 1VZ6A 3PV0A 2PYKA 2DLBA 3MWYW 5C4XB 1JALA 2JYOA 4R9WA 3P4RB 1SYGA 3TEYA 1MGSA 5HG2A 1DOXA 2WXJA 2FMMA 4KKUA 4KN4C 4X3TA 2F03A 1LTAD 1HTPA 4U68A 5IIFA 2D5DA 3I72A 3AE9B 4M8AA 2AUJD 1K51A 5CYUA 2HCIA 1EQVA 2BT6A 2BYTA 1YJJA 1XLQA 1H9SA 3ITPA 1ZUD2 1WTXA 1EY9A 1E6EB 1N63A 1S5ED 1O7YA 4TQ1A 1PUTA 1IL8A 2WXIA 2L0CA 3VR3A 2B63B 3EROA 3U52E 1CHQD 1I7HA 3GTLB 5G3LF 1SNCA 3HG9A 3HP3A 1L6VA 1CT1D 1EY5A 2JSVX 1Q10A 3SK5A 1ET6A 2WDRB 2FJ2A 5HURA 2Z1CA 2A69C 5NUCA 4RCOA 4B9XA 1MSHA 1Q3LA 3H09A 2FBWB 2WXRA 1U4LA 4TQ0A 4J1MA 1F2RC 1TKWB 3I9V1 5EBCA 3R3OA 1KLUD 4KY5A 4RF1A 2EZVA 3U9SA 1JB3A 3QG1A 4M1UB 2WACA 4QUCA 4ZK9B 4L23A 3C2PA 3MZ5A 1CQVA 4OO1I 3HOVB 1RCVD 2EYOA 5C0XI 1ACCA 4JWSC 3ETRA 3P20A 1OQRA 1G291 4H44C 5C44B 1EWCA 1N5WA 4XQNA 3NUHB 5I6YA 1PZJD 3RZOB 2I38A 2RQXA 5DEHA 2KCNA 3NWSA 3GQBA 1GB1A 1N62A 3NBIA 1GUOA 3E6ZX 1J7AA 1U4RA 1C8CA 3G6JB 5J39A 1LT4D 1YN5A 3T56B 1C4QA 2EY5A 3QJYA 5IODA 1TS3A 3GP7A 4YIJA 3SXHA 3H94A 1S5DD