3R2IA

Crystal structure of superantigen-like protein, exotoxin sacol0473 from staphylococcus aureus subsp. aureus col
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
194
structure length
192
Chain Sequence
b'RKYYINMLHQYYSEESFEPTNISVKSEDYYGSNVLNFKQRNKAFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSGFVSNPSLQVKKVDAKNGFSINELFFIQKEEVSLKELDFKIRKLLIEKYRLYKGTSDKGRIVINMKDEKKHEIDLSEKLSFERMFDVMDSKQIKNIEVNLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exotoxin 5
molecule tags Unknown function
source organism Staphylococcus aureus subsp. aureus col
publication title Crystal Structure of Superantigen-like Protein, Exotoxin SACOL0473 from Staphylococcus aureus subsp. aureus COL
rcsb
total genus 54
structure length 192
sequence length 194
ec nomenclature
pdb deposition date 2011-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3r2iA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3r2iA01
1PTOF 3BVMA 4RGTA 3GP7A 4BWGB 1DYQA 1TS3A 2WV6D 1LT6D 1V1OA 2XN9C 4DXFA 1LO5D 4RFBA 1FNUA 1B44D 1TY0A 1EU4A 1YN3A 1KLUD 1LTGD 2O2LD 1LTTD 1L0XB 1LTAD 1MD2D 1LTBD 1RCVD 3CHBD 4OHJA 3O13A 1FD7D 1I4GA 4RGNA 1LT3D 2G9HD 5FKAC 1ENFA 1PRTC 5ELEA 1KTKA 1PRTB 4K6LA 1D5ZC 1PYWD 3BZDB 4L6TB 3BVZA 4RGMA 1LLRD 2QILA 2SEBD 5ELCA 1G8ZD 4UDUC 1EFID 5ELDA 1RF2D 1PZKD 1ET9A 2AQ3B 3BYTB 1I4HA 1JWMD 1I4RA 1M4VA 1AW7A 4NZLB 3OWEB 1SEBD 3R8BA 1ESFA 1TY2A 1EEID 4RHRA 1FNVA 2RDGA 2Z8LA 5D3IB 1HQRD 3V05A 1V1PA 1CHQD 1CHPD 1BCPC 1BCPB 1HXYD 1AN8A 1D6EC 1EWCA 2CHBD 2IPKD 4C56C 5D3DA 1LTRD 2IJ0A 1JCKB 1PRTF 1LT4D 1D5MC 1FGBD 1RDPD 1CK1A 1SJHD 2QEJC 1PTOD 3DWQA 4O1NA 4DXGA 1LTSD 3TSSA 1PTOH 3MC0B 1PZID 1XXGA 2NTTA 1SE4A 1UUPA 2AQ1B 1I4XA 1PRTD 3W2DA 1GOZA 3URYA 5ELBA 1CQVA 1S5CD 3R2TA 1CT1D 1SE2A 1L0YB 1T5XD 3BYYB 2NTSA 3EFXD 1STEA 1XTCD 1TS2A 4TSSA 4ZYSA 5ELFA 2RDHA 3DWAA 1QILA 1PTOC 3SEBA 1PTOB 4RGOS 1V1PB 1HTLD 1I4QA 4RCOA 1FNWA 4RHSA 1S5ED 5FK9C 2J4XA 1I4PA 1BCPF 1BCPD 1PZJD 2R61A 1TS5A 1YN5A 4RH6A 1EEFD 1JQYD 1S5BD 1DJRD 1SXTA 1JR0D 2XRSD 2XNAC 2ICIA 1RD9D 3BVGA 1EU3A 3MFGA 1UNSA 3KLSX 3EA6A 1ET6A 1YN4A 1KLGD 2TSSA 4Z9CB 1S5FD 1JWSD 1SBBB 5TSSA 2XRQD 1SE3A 1SJED 1LTID 1JWUD 1BXTA 1LT5D 4L63B 1D5XC 1F77A 2AQ2B 1HA5A 3R2IA 1S5DD 3DWPA 1TS4A 1B1ZA 5I4DA
chains in the Genus database with same CATH superfamily
2C9WB 4JWSC 2WB1B 4N58A 1WWTA 3DOWA 3IFTA 2VUMG 3TEXA 4AJWA 1TWHH 3EFUA 4F1SA 4LF6Q 4PMBA 5IP7G 4XT3B 3S17H 2ZVOA 5CORA 2NVQB 1LM8B 5L37A 4J3OD 4WURA 4XXEA 1LTTD 3A7AB 3PUYA 4IM2A 2KT7A 2MPMA 1RLFA 5DM73 3W1SC 1FD7D 1WGYA 1J0GA 4JBJA 2EYMA 4A3EH 3AULA 1ENFA 1B3QA 2NVTB 3PRZA 2F0LA 4JI2L 1C9FA 2BWES 3NBIA 1PYWD 3A8JE 2PLPA 2L7RA 1WFQA 3SK6A 2CKZB 3UDIA 1E7VA 2D9UA 1E8ZA 4HKZE 4BA1I 4GLXA 2AQ3B 4NJCA 5HHDG 1IBXA 1M4VA 2W3RA 1HZ5A 1Q8IA 5I9PA 1FCCC 2D5DA 1XMQL 2Q8IB 2MH7A 1FNVA 2V4LA 5BN4A 1ZW7A 2UXBL 3ZXRA 4N8FA 4B3SQ 1AYFA 3E56A 2KDMA 4LNOA 3V96A 1O80A 2MP1A 2Z6KC 4DV5L 1NJIC 1UELA 2EMSA 4BBNC 2E8GA 2F0WA 1LFDA 1OXUA 2NCNA 3TN2A 3RUZA 4BVUC 2W9NA 2AL6A 2J0TD 3PREA 4KDIC 1VF7A 3AE9B 4LW1A 1D5MC 1SJHD 4F87A 3Q8BA 1H9RA 4P1CC 2UUAQ 3TEYA 4DQOC 2KENA 1WTHA 1NAPA 1FEHA 5JHAA 2EZVA 3RNBC 1WMHB 4HPPA 4WAFA 3IAM1 3SD5A 1GOZA 1GUSA 4F8CB 4LF8Q 1S5CD 1Q81C 3DBRI 1EY4A 5CC4A 4MM3B 4KLKA 3KJPA 1I7HA 1LM0A 2BS2B 3AMUA 1T5XD 1JRUA 1STEA 3Q6SA 4FHKA 3ZNID 2FUG1 4TKNA 3DVNV 2A19A 2FAZA 1C4CA 2N9PC 4ICUA 1PH6A 2RF4A 1H9MA 4KHVA 2BKRB 1I6VC 2FIFA 3T1YQ 1SYEA 3GTGB 1GO3E 3Q0AA 5HURA 1VQ5A 1NTGA 5EE0A 1WR1A 4W9LA 2NBUA 3KLRA 3Q69A 1EFWA 4X6AH 2EQSA 1Y8NB 4WQMA 3ZNZB 1T5EA 3OAWA 2JA6G 2M4NA 3D6CA 4ANXA 1YHBA 2R7FA 5IAAC 3IL8A 1C4AA 3RN5A 1KDCA 1BR9A 2XNAC 4R1JA 3BVGA 3Q22A 3S2AA 3WCQA 5FJ8G 2F0NA 4TQ0A 3SR1A 1WGRA 3GTLB 1WGHA 5M5YH 1Q0WB 3RNFC 3CIRB 3KLWA 1TWGB 4KKJA 5M3MB 4P2CB 3P63A 1S5FD 2EY1A 4E71A 5TSSA 1SFOH 4K7SA 1PDQA 4MGZE 3KF6B 3TZUA 1E8YA 3LGJA 3QAQA 1D7QA 2AMCB 4F7XA 1Y1VG 1FCLA 3TMPB 3K9OB 5IYBH 4JBWA 3KDFB 5LMNQ 3NOBA 3DWPA 5I4DA 3H0GB 1PLFA 4O42A 1N9WA 3OYYA 1VQAA 3NEMA 2JE6I 5EPJA 4IUMB 1IYUA 1LT6D 4CKCA 4XQNA 2JA7G 4M0WA 4RFBA 4KN4C 4M8MA 2I5HA 1TY0A 1DXMA 1EU4A 4IUNA 1GAQB 2DAFA 2Y0SG 1F0ZA 5LMNW 3QO2A 1GXDC 2MNAA 4A3MH 1L2FA 1DGJA 2Z0EB 3NXWA 2FCSA 3HHMA 2D0PA 1NMFA 3H0GH 2IO0B 2JPHA 4XC2A 3CW2C 3L08A 5FKAC 3RN9C 4MTKA 1CKNB 2UUBL 1K0SA 1KRHA 2VRRB 2B2YA 1PRTB 2ASQA 2D10A 4KSKC 1SNMA 4ZRIA 3L0OA 2AYOB 2M1MA 1KLVA 1CM9A 2TMPA 3HOZB 2E75C 1S4ZA 4PG3A 4LF9L 3GTKH 3BG3A 1DM0B 2OEOA 1I3QH 1ML0D 2O4XA 3AYHB 4JPBW 2WGSA 3DEPA 3M63B 3EN2A 2CH4A 1XLQA 3TEWA 2BTEA 4F88A 3AE7B 2E6XA 4XX5A 4HPLB 1PH3A 1PDXA 1X3QA 5IP4D 1EEID 3M85A 5EJWA 2Z8LA 4GNXB 5AZGA 2F3WA 4QAYA 3V05A 3AM9A 2E2JH 3STBD 3Q23A 1JJCB 1QZGA 3L17A 1L0VB 1A2UA 1QZHA 3I4NG 3PZ7A 2ZTCA 2CHBD 1S72A 1EWCA 3U7ZA 3EQLC 1HZBA 4JG2A 4A3MG 3LXFA 4HKQA 4KX6B 1KIXA 2IZVB 1Q10A 3EGRA 4CDDC 2ZTDA 2JRIB 3ONAB 5IKCM 1SNPA 3T53B 1WGKA 4L23A 3SDLC 1WXSA 2K5HA 1SDFA 2NVTH 2DZIA 1KABA 3NS1A 2B3GA 4MJSA 5IP7H 1IKLA 3RZDH 1HFNA 4L1BA 1RTOA 1FD6A 3CXCA 3PLUA 3TP7A 4IW0A 4I7AA 3J7AF 2KXJA 1ESRA 3NQTA 4W9JA 1O7ZA 3T8MA 3AE5B 5C3EG 1TS2A 3N1YC 4C7ZA 3MJWA 3Q8CA 4MH8A 1YHAA 1X9NA 3MA2B 3I3TB 2B63H 4XZ4A 1C9OA 3F2CA 3NRZA 5LLIA 2M9VA 4KMUC 4BY1B 3S1MB 2ZM6Q 4FXCA 4Q2JA 3E5SA 2A6HD 4U673 1EM7A 1Q90A 4BBRH 4GN3B 5AFWA 3ZJYC 2IGGA 4JI5Q 2EMTA 4Q5VA 5IWAQ 1JQYD 4LMQD 3ABVB 2RR9A 4OXPA 2LXJA 1BT0A 1JOKA 1C4QA 1XTDA 2XSCA 4HCPB 2HTHA 5AUKA 5FLXE 2SDFA 1SIJA 4DXAB 2HJ1A 5M5XB 2KOXA 3DBHI 2PNHA 1ICFB 1NENB 5M3FB 1CI3M 2GB1A 3P4SB 4JX1C 5BMIA 2BF8B 2VB3X 1ILQA 1XPUA 4RF0A 1MG4A 1HQMC 5D65A 3B08A 1GUGA 1VS0A 1WD1A 3PIPA 4FF1A 1WSPA 2CHXA 1E1TA 3WWVA 1JWAD 2F4IA 2KBNA 4IDIA 4B3RQ 3AEBB 1A6XA 2LGSA 3JSVA 3H6MA 1B1ZA 3OSOA 4X66Q 2HDEA 4QMGA 2OWOA 3I4MG 2INDC 2Z0DB 3HKSA 4FJYA 3FPUB 1ZEQX 4CJ2C 4RM8A 4UHVA 2LI5A 4L5SA 4BWGB 1QNUA 1QUQB 4N59A 5C0XI 3JAML 2NS5A 4K2LA 1FJGQ 3K81C 4YCWA 3W5OA 2Z59B 4GSWA 1KXLA 1X54A 2H1EA 2EDGA 1HE8A 1AZQA 4M01A 5GXGB 3VA5A 3NE5B 5KNCA 4BA2I 4OWTB 1RCVD 4HROA 1WXMA 3N30A 2JP1A 4WJPA 3SFDB 2CVRA 2JEBI 2B8FA 4DR1Q 1AWDA 1WZ3A 1MJDA 1JT8A 2WX1A 4HR7B 4LF8L 4A3DB 2GVBA 4A3CG 2IGHA 3ZYYX 3JYUA 3PHXB 2OTLA 2F0QA 2PNRC 3IAS1 1PZKD 4GKJL 3F2BA 1JWMD 1TWAB 1I4RA 2KACA 1DOMA 1PGXA 2R7ZB 3S2HB 4DR3L 4PV1C 1VQHA 3HOVG 2VH1A 3I73A 5D3IB 3H94A 1V1PA 4MM3A 5FLXc 2WXOA 1XLOA 3CSFA 2A6HC 4A3DH 2V3NA 2Y0SB 4C3IG 4XYQA 3IKJA 4MEMA 1JC7A 2XGTA 2BKFA 1LXDA 3L13A 3VHTC 4JBMA 4A3JG 3S2DH 5EPLA 1ZXHA 4FULA 4K3CA 4B3TL 1WJ4A 3V62A 4LK0M 3F2DA 2MO0A 5CV6A 2F3IA 1JROA 3N3KB 1EY9A 5DPWA 3E9SA 3FKIB 3SU8X 3UDFA 3ND8A 5T1GA 2N1VA 5EGTA 2J42A 2RCNA 3A4RA 1PZID 2D62A 4NXMQ 4FYDA 5I9OA 4H2AA 2UU9Q 3ERQA 2PW5A 5J3BA 1FMAD 3URYA 2L15A 1C8CA 2KFKB 3HOZH 1PFNA 3R2TA 1BUVT 2PKOA 3UDGA 2JA8H 3RI7C 3I4LA 1XNRQ 3CQZH 3L10B 1BNZA 3I8ZA 4DV6Q 4PS8A 2UXCQ 2HD3A 2F03A 2HT1A 1VRAB 3AECB 3EC8A 2JRHA 1SIFA 4A76A 3H15A 1HTLD 2ACZB 4IPGA 5JVH3 4ARIA 1Z7TA 3J81i 1X3GA 3AU7A 1N5WA 3IT6B 2C7HA 2YEPF 2RD0A 3WIMA 3U9SA 3H0GG 2KNBA 1YN5A 3IBEA 3HM6X 1EEFD 4AYBE 4XE0A 2BYTA 2KCNA 3L2PA 3J81E 1R4QB 2EYPA 3PRPB 2X6GA 1V81A 2INNE 1XJVA 2QIEB 3C1EA 4ABNA 3MFGA 1T0SC 2NPTA 4A93B 2PIAA 3PRMB 4KGSA 3IVFA 5CHVC 3WAMA 1MKHA 3A8KE 1R7SA 1STBA 2N8NA 2GI9A 1LTID 3U50C 1EIFA 1B9MA 4JCVE 1RRBA 2JSOA 2K6QA 2FINB 5A35A 3S1NB 1H9SA 2PW9A 3QK0A 5C4XH 2MP2A 4IUQA 1VQ4A 1PXUA 1VCIA 2B2WA 3I3CA 2AKWB 5IGFA 1WY8A 3Q8FA 4P74A 4DR4Q 3G48A 1FO4A 2LMCA 4GOPB 2P5ZX 4A75A 5CV7A 4DV4Q 1Q86C 1FJGL 1OFFA 4ULLA 2WU5B 5IP9H 1PTOF 4YY3L 2FNJB 3M3YB 1MFWA 4RGTA 1NNXA 1RIPA 2B2UA 2LXKA 3M7NA 1FFUA 4HDOA 1FNUA 2W55A 4P75A 1L5PA 5MPOA 1T9HA 4WJNA 2WXGA 3KF6A 1N32Q 4TV3A 3FEWX 4IM3A 4QQBX 1FPYA 1D1KA 1SB3C 4NNJB 3QB3A 1D1IA 5BMHA 3KYCD 1V49A 4DHJD 4DDID 1FYCA 3P1HA 1W2BA 1YD8U 5DM63 1V2YA 3DVGX 4NPNA 2IT1A 2SEBD 2CH4W 3PO2H 1E7PB 1G8ZD 3I90A 2ZPYA 1BQQT 5ELDA 2JQOA 4Y7NB 5IA7A 1ET9A 4APVA 1J19A 1FGUA 4CDCC 5FLMG 1SNDA 1HNWQ 1WM3A 2L05A 3KWLA 1Q7YC 2GRIA 2ZNVB 2OT2A 1M90C 2D2CC 3MEHA 5CV4A 4DV0L 4RHRA 2RDGA 1VQBA 3LJ3A 4UP9A 2HHHQ 3UF8A 4ANVA 4A3EB 5C3JB 1KNAA 1E8WA 2BYEA 3EJIA 2HCIA 1UBQA 4RMFA 2VW9A 2FCMA 2UU7A 4R9WA 2XK5A 3QWZB 2F4VL 3PO2B 4A9AA 3TREA 1LUZA 1B4OA 1CKNA 3S17B 1J7BA 4POFA 5GQOA 2Z0SA 2JA5H 1FM0D 2IJ0A 2IX3A 1YIJA 4DV2L 2IX1A 3P2BA 2E2HB 1PTOD 2D5GA 1O7YA 1OXVA 3S1RH 1KF6B 2GN5A 4NB3A 4G7HC 3S1QH 4MACA 1K83B 3KUPA 1NI2A 4W9FA 2OTJA 3W2DA 1HNXL 1V8CA 3Q3JA 4IG7B 3RT3B 3UE0A 5ELBA 1QZEA 3HEJA 3W5UB 4YL8A 3Q8DA 3TMEA 1VQIA 2ZXRA 4BXXG 2WU2B 4B9KA 1YEZA 1AE2A 2MHVA 1NSNS 3T13A 3EFXD 1EQQA 3UI2A 4FF2A 4MNOA 4IOAA 4B0MA 3J81j 3QARA 3VUYA 2NVXH 2L4NA 1SF0A 2V9HA 4M8AA 4KKIA 3BK1A 3FRPB 4KHPL 2A68C 3BY4B 2GBRA 1B9NA 1J7AA 3LYYA 4CO7A 1UD7A 4W9IA 2IX0A 4ACFA 2J4XA 4KZCA 2F0TA 3CCEA 2GBMA 3ZRCA 3AB5A 3X3NA 5DEHA 3BK2A 3NHHA 5EBDA 3H9DA 4K0KQ 1XMOL 2BA1A 2VZKB 5CHFA 3NVYA 4IUUA 3QX1A 2XRSD 2WWZA 3DLLA 2Y5PA 3AI5A 1WJNA 1SMXA 1ZXIA 4YCVA 3ZNGC 1OTRB 1SGHA 3ZVVA 2K22A 2K25A 1FRRA 4XT1B 3L4PA 5LHY1 5IWAL 2K5WA 2KHIA 1T0QC 2EYFA 2C35B 2V3PA 3LDZE 1DOYA 3A0JA 1TGZB 5C3XA 3QOJA 3VYSA 4A3JH 1BXTA 3C1FA 2O5JC 1HZ6A 2VZKD 4LJZC 3DBRB 3S2HH 3ZJVA 5IT9c 3CC7A 2LXAA 4DFAA 2QGQA 2WDVB 3GZNI 4IM0A 1SLJA 4A3DG 2I1KA 1Y8RC 1AZPA 4JI0L 3S14H 4V190 1F9SA 2QDBA 3K5MA 4IPCA 4FF3A 4JYAQ 4TKOB 1QB5D 3G6EA 3K58A 2M0AA 2JZ3B 4HRSA 3E3XA 1B44D 1I6HH 1WJ6A 4GDLA 1XPOA 3NUCA 2WXJA 1I3QB 4LJOB 3Q8EA 3ZNHB 1W6JA 1KLUD 3QJYA 3KWVA 4L5RC 4ZKBB 3V2TA 3J80L 2UXCL 3U9OA 2SNMA 4GIVA 3ZTDA 1TIID 3K8AA 2H89B 2VQEL 2HIVA 1P7FA 1DCZA 2JA7H 1SYDA 4KTAA 1YIWA 4DV3L 4YXDB 5JH5C 2G9DA 1MHWC 3FHWA 2BB6A 4DHZE 3SK5A 1S3OA 2EXDA 2DWQA 2V4DA 4RWSC 2VQFQ 1EFID 2X69A 2JEAI 2O5IC 4BY1G 4LDTD 1HTPA 4KJOA 2B76B 1ILPA 1XT9B 3CCMA 4A93G 5FO8B 1ZXTA 2WXIA 2WHIA 1YNJD 1X32A 3F8TA 3MXGA 3N6RA 4E3CA 2KN5A 1EYAA 2R7ZG 4DV7L 1V5TA 4ZRPA 1LACA 5ELOA 4ZOHC 4EE2A 5JZEB 2PI2A 2EKEC 3APFA 4YTNB 1XLNA 1J5EL 3S16H 4PZ6A 4LWCA 4BFRA 3MXNA 4POGA 3PLVA 3VVWB 3HOUG 4YWMA 4KIKA 3X0WA 1OO9B 4DBGA 1JRPA 3B0AA 2UUCL 2NVYH 5C5MA 1XNQQ 4WWMA 4ODGA 3ERSX 3GTLH 1CZGA 1XXGA 4GN5A 4WQOB 2K05A 5D7GA 1QOBA 1QOAA 4UY8C 2K3UA 1WYWB 1TBEA 4OVVA 2VY3A 2L1AA 1OEYJ 1RJTA 4DR4L 4REZA 1F2RI 4LF6L 3BZKA 3BYYB 3GTJH 2ASBA 1H9KA 3DHQA 2G4DB 1RYJA 2REXA 4BZAA 3TL5A 3HRDD 4KY7A 1OTCA 1WFYA 4P1BC 5CMDA 4RGOS 4A93H 1TKEA 4ZCKA 4GKKQ 2RMMA 1ROEA 3C46A 2E2IB 2XWBB 3TUOA 2JN4A 5FK9C 3VR8B 4M1UB 3K0XA 1BCPD 1CMXB 3OJ3A 3WA0A 1LGRA 3ZDTA 2DNCA 2WAQB 1E7UA 3A9KA 3EUB2 3WALA 4ZHOA 5IYDG 1K73C 2BE5C 2O6VB 4C1NI 5IP9G 1DJRD 1WTPA 4A3EG 4X62Q 1QJOA 1J8IA 1GC6A 1JQ4A 5IGBA 4KV2A 3VA7A 3H7SA 3CC2A 3RLNA 5ISRA 2Z4HA 3UI3A 1UF0A 3V6EB 3HK0A 1Q12A 3PGZA 2HIXA 2F0GA 4YWGG 1VZ6A 3IFWB 1ZUD2 2L1BA 2A5UA 4DK3C 5CX3A 1JOQA 2C5LC 4B95A 1D5XC 4JL9A 5C23A 2KFJA 5C3EB 3RNAC 5IIFA 4J6HA 1CFMA 1WVLA 5G5GA 4HVBA 2WXNA 1L1OC 1D2BA 3A8IE 4R4QA 3I5JC 2KJHB 4USAA 4JI7Q 1FVIA 2WV6D 3HOXH 1YQBA 3KYDD 4GDKA 4NQKE 2A68D 1IYJB 4WRDA 1STHA 2KWDA 5CHWA 1UE1A 1V5OA 2XEWA 1WJJA 3T56B 2N9EB 4C80A 2PE6B 4OGQC 1VQJA 2BPSA 1SYBA 1LTLA 4B08A 5KHQA 2WFWA 1FXIA 2XK5B 2M00A 1I4GA 4G11A 2UUAL 2MBHA 1E2WA 1K83H 4XYOA 2OOBB 1TWCH 3JVZX 2ENBA 4HWIB 3Q24A 3VQIA 3RZDB 2YTVA 4WJ3M 3R7RA 2X6LA 4RGMA 4X3SA 4HCSA 5ELNA 1E90A 1XCTL 2RGFA 3R3MA 4J15A 3M4QA 2F0OA 2DZJA 4WIPA 4A3KG 2EYJA 1YQ3B 2A6EC 2LGDA 5LXIB 2MX2A 5BR8L 1STNA 3CCJA 2NVXB 1FXAA 1S1QB 3ZQ4A 4IUTA 1TVXA 4LNQA 3PPAA 3RMKC 4I7ZC 2VZAA 5C4JH 1YJ1A 3PF4A 1HQRD 2HCCA 2OQKA 3JAMi 1GHJA 1ONLA 2DY8A 3QOLA 1N63A 1F2YA 5FR6A 4FP5D 3GTQH 1HNWL 1MI0A 1G6ZA 4NW2A 3L16A 2FBWB 2IDYA 3OW2A 1Q8KA 4C56C 1LTRD 1PMRA 4NXNQ 1EUVB 2WXHA 1PRTF 1N34Q 2JA6B 1MHHE 1RTNA 3KUCB 1N33L 4HJAA 1MG8A 3I2ZA 3CF5A 3RPFC 3GTPH 1SMYC 4C3IH 2Q5WD 4TQ1A 1L4ZB 4XWWA 2WXRA 5JAVA 1WYDA 1CQVA 4KD4A 3ULPA 1PH5A 3KVFB 2CR5A 2X38A 5C1ZA 3M4OB 3NENA 3ENEA 2IHFA 1OXTA 3TJPA 2F0VA 2JA6H 2MGSA 3UDXA 1UZXB 3PTFC 3CKIB 3A9JB 2K0PA 1VQCA 3ER0A 1UE7A 1KDAA 4EQOA 3J7ZC 1VD2A 4HJGE 4K1RB 5GADC 3JW0X 1P9DU 4O0AA 4GDKB 3VTVA 1E3PA 2L76A 4DK6C 4X64Q 1E24A 5CBEE 3IHPC 3A74A 2R61A 1TZ1A 3HOVB 5C44B 5A2QE 1GUOA 2AUJD 2K1FA 3AEGB 1S5BD 5KNDA 3B2FA 3CWIA 3P4RB 1YJWA 3DQVA 4HTHA 3T1HL 1G2SA 4EZLA 4XTCS 1EIYB 3F1ZA 5LMUQ 4YWLA 1E0ZA 5EE9A 1ET6A 4HK2A 4HN7A 2TSSA 4AS1A 2IL8A 4KD3A 3C2PA 4JI6Q 2W82A 5AZFA 3QA8A 4R8NA 1H95A 2F0SA 2OJRA 1RL2A 3NQIA 2A6ED 4RM9A 5GAHC 2K03A 4HIKA 2PYKA 3VH4B 5CV9A 2AQ2B 4A3BH 3NZ3A 1NE3A 2DUDA 3GTJB 5IOCA 3AEFB 1GJXA 4I6PA 1SYCA 3ITPA 1GNUA 4XYCA 4L2YA 2B2TA 3TS2A 4LFBQ 1QOHA 1SNQA 1X65A 3EIVA 1EIHA 5FLXL 1WTOA 1ISNA 1K50A 3K7UC 1X1MA 4WWPA 3ZGZA 4HJ7A 3PCOB 2KVMA 2WX0A 3QHTA 2I1JA 2L00B 1V1OA 2ON8A 1U4MA 2F0JA 3LNNA 4X66L 3GZNB 3J7YW 2YEPB 1AE3A 1YJIA 2LEKA 2KEDA 2QF7A 2L0FA 4P73A 2LFIA 2Y5CA 3I4NB 3PT2B 4A55A 4NAWA 4H0LC 1W6KA 2K75A 5J1ZA 2MHJA 1GB4A 1A70A 3PF5A 1M8AA 1BMLC 4IUVA 1EF1A 1EYDA 3GB1A 4M8NA 2WAQG 3HS0C 2EPBA 1FFVA 3BVZA 3D3RA 4CJ0B 3R3OA 2Y0SE 5C0XG 1WXVA 4C7YA 2PPBC 4UDUC 4OX9L 2NVQH 3U2SC 4MSMB 2ICEC 1RHPA 4HAEA 5JPNC 1JALA 2L12A 4DUZQ 5IYCG 1YZ6A 5G3LF 3PZDA 2LD9A 1TY2A 4ZQ3A 5I6WA 2DZMA 4BXXH 3T16A 3HVDA 2LJIA 3PSEB 3Q2AC 3T3NA 2KLGA 3BDOA 3WAOA 1CHQD 3KOJA 2OEDA 1BCPC 3QJZA 1Q1BA 3O65B 2KECA 4JOIC 4MTNA 1WI0A 3M3JA 2EJFC 2OXPA 2MCNB 1N8RC 2CU3A 2WLBA 1WX8A 1KJTA 1GG3A 3RD2A 1XF5L 2JVCA 4AUQC 3QIAA 1Q46A 2LS01 4G7ZC 2LRWA 4K2KA 1R4MB 2DLBA 2DYMA 2V1CC 1BBWA 3A54A 1LTSD 3CRKC 3GDEA 1IBKL 2L8JA 3UINB 1KM7A 4AOFA 5EKLA 3GE8C 1K8AC 1XX8A 2EY6A 5EAYA 1JW9D 1X56A 2JZPA 1I5FA 2PJHA 4HPMB 2D3AA 1WCMH 2BYFA 3I4OA 5HI1A 2M0XA 4A90A 5E1FA 2QKIC 2KQSA 4QIWE 3L3OC 2K52A 3IRBA 1PH7A 1F52A 1HEZE 1T6BX 1VR9A 2L3ZA 3U30A 3FKYA 2UU9L 2NZ1D 1HR0L 1QILA 3CAMA 4EX5A 1YNND 5JOBA 5KNBA 1VQ9A 4BY7G 4DAVA 1PTOB 4GNXA 4GZYC 1E8XA 1RM6C 4FN2A 1SMYD 1ASYA 1XNRL 5EDSA 3MXNB 1XWEA 3VRAB 3EBEA 2BA0A 3MHSD 4EGVA 1EWYC 4IQZA 4Q0FA 3W9CB 4LNFA 2NZHA 3S2DB 1HTOA 2KHWB 2BS3B 1BO0A 1MJCA 1IBML 2NN6G 2B63B 1XD3B 1ZKOA 2KQ4X 5IO9A 2B2TC 4IPHA 3VXWA 4HLEA 1WCMG 2WKCA 1P7EA 3C3LA 2C5CA 2JZZA 2KMCA 2F4VQ 1WE7A 3AXCA 4K8JA 2E3TA 2KWVB 1P1AA 4A3GH 3IG3A 4JGHB 1Y8PB 1AH9A 1HA6A 2IY1B 2BVCA 3ZUNA 2SNSA 2I38A 2BCOA 2ZM6L 4DR3Q 1S5DD 2A8VA 3AU5A 1B7YB 5IT9E 4P7IA 4XDDA 1A3VA 1JORA 3A1QA 1BVSA 4KI0A 3KYHC 1TT5B 2PE9A 1Y1WG 2DJGC 3B2GA 5D94A 1OEYA 3EROA 3GTQB 3NELA 4ZAIA 2RDBC 3K5OA 1G6PA 3DCGA 1DOLA 2PO4A 4B6WA 2F0MA 2R3ZA 4RMAA 5D14A 4JV5L 1R4NI 4B3TQ 2R93G 3I55A 2WACA 3BINA 3AN1A 1GB1A 3DWMA 4JI7L 2E74C 2N88A 3AE4B 1IZ6A 2G5DA 1N36L 2RVLA 2UUCQ 4IURA 2GBNA 2CWPA 3H3VC 4OW0A 2VH2A 2JA8G 2PQAA 4XQJA 2QA4A 5IGDA 4P6VF 2ZW0A 2Q8RE 2L0TA 3HOYB 1I4HA 2Q2IA 1GKHA 2EYLA 1UEAB 5EE1A 2LSSA 2RPQA 1P3QU 2ZEQA 3M95A 4OO1I 3FAHA 2NBFA 1GVPA 5LMUL 2KX3A 2YVCA 4IZ8A 1QVCA 2FFKB 3Q14C 3M3YH 2CHZA 2D3CA 2KKCA 1EYGA 4TUUA 2FMCA 3GTKB 1QVFA 3MTSA 2ZTEA 1K9MC 2O2VB 4DDGD 4LFAQ 4PQXA 1EY0A 4BKSD 1JE4A 3DBLB 4PZ8A 3OMGA 1RDPD 3ALBA 4JI3Q 2KO3A 4JC0A 4K8IA 4YIJA 4JI5L 3QG1A 4C3HH 5IYCH 2FIDA 1IGDA 2MBBB 1MI2A 3D4WA 1VMPA 1SFOB 3L54A 3FPPA 1K28A 2UYZB 3NVWA 3HVZA 3SGIA 3AEVA 2LHDA 5KYLA 2KVZA 1CT1D 3FC4A 1HJPA 1TTNA 3K80C 4HJ8A 4BOZB 4YTPB 3KF8B 1G2TA 1CSQA 2MP2B 4EOYA 1RWSA 3OHXC 1PYSB 1HNXQ 3PZ8A 2QCZA 3L9AX 2QEXA 3KUZA 2LMCB 1U4AA 4IWPA 4QL5A 4O2DA 4JE3B 1VZ7A 3ZDMC 1WZ0A 1FNWA 1S5ED 3DDCB 1PH4A 3AMZA 4W9EA 1CUKA 2ZJPA 3U58A 2YU9B 2KDEB 1Z47A 4CGYB 2F3VA 5K5PA 3K5NA 4DR5Q 3ML9A 4AJYB 4FA6A 4RH6A 3PMFA 2B2VC 2L55A 1L6UA 1HPCA 4YSZB 4A3MB 4NJ6A 3AE1B 2H4OA 3MXUA 2KWCA 5C4HA 4YHHQ 1OQRA 3APCA 2DAJA 5JEAG 3TBLD 5HKHA 2R92G 4A3BG 2K5NA 3FILA 1KLGD 2FJ2A 1GM5A 1EF5A 3PUVA 2N0SB 5T8IA 5FLMH 4XQQA 1ZKHA 1OQQA 4IUPA 4ZHPA 5CR3A 2PPHA 2N78A 2G1EA 3MC9A 4K7UA 3Q3FA 4BKTA 4LF4Q 4F7ZA 5BR8Q 1TS4A 1A63A 1I50B 3VR9B 1V6EA 2MJ8A 4RCNA 3W1GA 2BQQA 2LGXA 2AWTA 4Y52H 3DVGY 5AJ3Q 4DV1Q 1A3TA 2Z4IA 2KMMA 4GLSC 4WH4A 1CKMA 1TS3A 3NVVA 2DN8A 4WWNA 4DXFA 4ALPA 1WI5A 3BDLA 4DUYL 1NYRA 1VLBA 3PGEA 3Q8AA 5JXVA 3S15B 1N36Q 4JBKA 1YN3A 3WOEA 3PO2G 1LTGD 3OMCA 1AFPA 2XTIA 2L83A 3NY5A 5AEKB 1Q1EA 2G9HD 2RBMA 1TKYA 4FLHA 1N33Q 1KTKA 1NDDA 3E0EA 2DGYA 2D11A 2V0GA 2QCPX 2KCTA 5C4XG 3H8HA 1E1OA 2NYZD 2WXLA 4ZRJA 1H9SB 3D8GA 2LGYA 1A8VA 3RZOH 1KNEA 4YTMB 1GC7A 1NR4A 1VQKA 1BBUA 3HP3A 3KF8A 2LJ5A 4ANUA 3E6ZX 5IT9L 1TKGA 2ALYB 4FDBA 4L8JA 4X3KA 5M5WH 2BYVE 3CC4A 2F0FA 3S1RB 1JB3A 1IHZA 2JU6X 1HXYD 2W3SA 1UE6A 2IO2B 4QF4A 2GLSA 2K5VA 4NP5A 4K0KL 2CHWA 5BO4B 2I0QA 2ZJDA 2CQAA 3J7A5 5LL6X 1Q3LA 2EOTA 4G3XB 2JXMB 5J22A 1CK1A 3R7QA 1XMQQ 4JK1C 2GOWA 3T1YL 1G91A 3DWQA 5C4JB 4X3UA 3GQBA 4C3JB 4NJ7A 4DF7A 4YSXB 3AU4A 1HZ9A 3RFZB 3E0JA 2PQAB 3VTWA 4PS3A 1EZ6A 1UUPA 1Q1OA 3MJ5A 1Y8OB 3D6WA 5AUIA 3KQ4A 4FXKC 5H8YE 1VQNA 5BYQA 3JC66 2KK8A 2DZKA 5C44G 1MSGA 3G6JB 1O7IA 4HCEA 4TSSA 2B8GA 1QCBD 4DNIA 5ELFA 3CCRA 5E6JA 2PMZB 4S3SA 5JHBA 4A3KH 1T3QA 4JI0Q 2KTRB 3Q3OC 1IYFA 3K6OA 4P72A 4J8QA 4OZAA 1I4QA 2KLCA 3DBSA 4KJNA 4P71A 3TP5A 3STBC 2Q2HA 3GTMB 3J81c 2WS3B 1HRJA 1E10A 1SSNA 3VR4A 4IOCA 4KKTA 4R4OA 5IGCA 4HMJA 4OIJA 3LB8C 3VTUA 2GA4B 2A5HA 3U4ZA 1WH3A 3GE3C 2K9XA 3NS8A 3VRBB 4II3B 4MELA 1WYGA 4H13C 1VZ8A 2M56B 4W9KA 4OO1H 1STGA 3L7ZC 2I5MX 3LX0A 1RKNA 1XLPA 4AQ7A 3HG9A 1UAPA 2QW7A 2BBCA 2VQFL 4BBSH 2K8BA 4E74A 4FADA 2YLMA 4X65Q 3PQIA 1C78A 3N9YC 1Z2MA 2HDLA 1XPRA 4GOPC 1K51A 4HXDA 4ANWA 1N61A 1SYGA 3P1MA 1XMOQ 1C76A 4GS3A 2FCNA 3N52A 2R6GA 4PYZA 2MLBA 3GV3A 3NZUA 3HOUH 4JI2Q 4DR2Q 4FHJA 4B3RL 4LF7Q 4JI3L 3AE2B 2LKVA 4CKBA 3HOVH 3ZJTA 2ZPNA 1SNCA 1U0LA 3SHQA 2RKSA 1EUJA 3NUHB 3RUIB 1NVID 1EQTA 1BKBA 4KHZA 4L5TA 2DJFC 1WTXA 4CBVA 1AEXA 4WORA 2B2UC 4ARCA 4A3IG 2QILA 5IYBG 2HE7A 1H9JA 2WINB 4A3FH 4YT0B 3VAWA 5J18A 5EBCA 3G71A 4LUZA 2Y3AA 2AHOB 2FE8A 2WDQB 3OJ4B 1TT2A 1ZP0B 3X3MA 3GTOB 2BE5D 1M1KC 1CA5A 1L6VA 4PK1A 2LASA 5BMGA 3ZO5B 1E5WA 2NBVB 3DBLI 4X62L 4TVAB 4DKAC 3I56A 4BKSA 5KHOA 4JI6L 1KD1C 1B53A 3AEDB 4KHPQ 2CJOA 3DVNU 2N7JA 2HQEA 1V9PA 1M94A 1UGJA 1UWMA 2CQOA 2KOLA 2Z6BA 3CRLC 4YHHL 2GMIC 2IYDB 2MJEA 2QMTA 5E7NA 1T0RC 2O6VA 2UUBQ 4GN4B 1VCBA 3VYUA 1HCZA 4DNRB 4O1NA 3CCQA 4K5VA 2KUMA 3A7LA 2HDMA 1V1QA 3NTIA 1NMGA 3TCAA 4LF9Q 4A3FG 2NWGA 1F9RA 3RLFA 4BY1H 1ACCA 4DHJB 1EQVA 2JT4B 1P16A 4R3DA 2Z1CA 1IP9A 4ZDVA 1K0RA 4N9TA 3H6NA 5KYIA 4DR6Q 1SE2A 4GXBA 4A3BB 2J53A 2LGIA 5C3EH 1XTCD 1TQOA 2WB1G 5M3FG 3VDYA 1D3ZA 3CPFA 5E4XA 1VQMA 3I57A 2A69D 2WIIB 3MWYW 1EIGA 1EO6A 4S0RA 2B63G 1S40A 2F0IA 4ME3A 2KQ3A 2X8XX 3HIZA 4EQPA 2K28A 2QDFA 1WGDA 1D4BA 3MEFA 4JYAL 1TWFB 3I4NH 2Q2UA 3S24A 3Q3NC 1I35A 4KIKB 3RCZA 2AX5A 4US8A 3M4PA 4BY7B 3QR8A 1EZ8A 1GHKA 4IOIE 1ENAA 1BOSA 1I50H 4K7WA 4C3IB 5J39A 1HTQA 4CDFC 3EHVA 4K5WA 3SVMA 3I70A 2VUMH 1V86A 2L9HA 5IGEA 5JPMC 3ULJA 5K36H 1V9JA 1SAPA 3ICEA 1F77A 1ZDVA 1HR0W 3R2IA 3B1LX 4ID6A 2H5XA 5FO7B 1KC8C 5LNK1 4KVGB 1YITA 1MVKA 4LNNA 2INCC 2RA4A 1A2TA 1NY4A 3H91A 4KGRA 5G55A 1WJUA 3DEOA 1F2RC 2PZTA 2SAKA 4G7OC 4NY0A 2XN9C 4A3PA 1X3PA 2KCCA 3VFKA 2N9LA 2R7DA 3HM3A 3MHBA 3G4SA 2JA5B 3X23A 1HZCA 1GJZA 4K5XA 4NXNL 1L0XB 1HR0Q 4JI4L 3U52E 1E0BA 3R66C 2LY7A 4RGNA 1PFSA 1B9RA 1F9QA 5E3FA 5CV5A 3P42A 3PV1A 4KGTA 3UIOB 4DUYQ 5ELEA 1IYVA 2NZOA 1K8MA 4A3OA 3BZDB 4MSQB 4PT5A 4US9A 5ELCA 4V0BA 2YYZA 3D31A 4NXML 3I4MB 2K01A 2OQ0A 1L7YA 4CJ1B 2MBEA 3T4AC 4NZLB 5H1SE 3P20A 5KRUA 4DR7Q 1YNTE 3PIO3 1X3FA 1LABA 1YNJC 5CBAE 2N3SA 1ZDXA 3FKIH 1JMLA 2L5TA 4C3HB 1STYA 2BDOA 2WKDA 4UP7A 3HKZB 4RAUC 2LXCA 4GB9A 2K39A 3MTNB 4B9WA 1D6EC 3SDZA 4DAPA 1Y1WH 2J7QB 2D07B 4RF1A 5L95C 1PH1A 1Q82C 2R7ZH 1JCKB 3ONSA 1JJ2A 2KJXA 1NCVA 1EOVA 1FGBD 3NJTA 4OVUA 5D2MB 4CYEA 4H7BA 2R93H 1EY7A 3NPPA 3TSSA 2UXDQ 1PGAA 2CW0D 1TWGH 2K50A 3DUZA 1R4PB 4QJFA 3FILB 4QUFA 1QNKA 3SR6A 3SK8A 2AQ1B 1PRTD 4ZKCB 4HDQA 4W9DA 2I5LX 2YTXA 1EY5A 1STAA 4DR2L 1L0YB 5FJ8H 5LXHA 1KOTA 1J7CA 5KIXA 2RDFA 2ZXPA 3DWAA 4EQNA 2XBBC 4J1MA 2JF5A 3E9HA 1KHIA 1ICWA 4FXGC 2IWHA 2LVOA 4LFBL 4R4TA 3J9CA 4XIGS 5BYSA 1IL2A 1KAWA 1YNXA 1PV4A 1XO3A 3QIJA 4MIUA 2BDNA 1OXSC 3U4EG 5I2XA 1N34L 1QUQA 3U4VA 1JB7A 1BCPF 3FVQA 2MA9B 1JJGA 2F0UA 2PW7A 5HY6A 4OO1G 1A15A 1WIAA 1YQ4B 5C4XB 3VDZA 2M8SA 1JR0D 1QE6A 2QDLA 1R9TB 4BBSG 2VNUD 2KJ6A 2MJ3A 3BU2A 1FR3A 2WQYB 3CCLA 4P16A 3NG0A 1YN4A 2VL6A 3HOZG 1RODA 2E2IH 4G57A 4IFDJ 4Z9CB 4LDTB 1QQRA 1SROA 5C6AA 2ZJQA 5EE3A 2LFNA 5I6YA 1QOFA 1XCQL 4DAYB 4NMZA 2NBWB 4L63B 3PO0A 2O6VD 3T1HQ 1VQEA 2KC1A 4TRDA 1SNOA 2WXQA 5CGKA 3VR3A 5GROA 4NAMA 3EVQA 4GLVB 2D3GA 2B3AA 2DX5B 4FO2A 2MBQA 3WAPA 2A73B 2RHSB 2KCMA 4QGUA 3AEAB 2PMZE 1LO5D 3TBIB 3FMCA 3V60A 3HGBA 3MHZA 2JWUA 2V1YA 3G7LA 1PA6A 1C7YA 2PVGC 1NYQA 4XGAB 3B9JA 1GD7A 3KBGA 2JXXA 2I2YA 5GAEC 4OEMB 2CS4A 2XWJB 2BGFA 1LT3D 1GUAB 1IBKQ 5M5WB 1S3SG 4CDEC 4DV4L 1PH8A 4I6LB 2JA9A 4K6LA 2YTYA 2ZT9C 1ZYRC 3HOXB 1NI3A 2MJDA 4OZCA 4L6TB 4CQNA 2SOBA 2WXKA 2ONQA 3N1ZC 4DK0A 4R4IA 3BYTB 2KWUB 4UPAA 1TYGB 4A3IB 2R92B 2E2DC 2PCFB 1ESFA 2ZXOA 2KDIA 1QOGA 4F8MA 3DMUA 1KDBA 2OCEA 4MN3A 2NVUI 3PS6A 1G51A 2IBIB 5M9OA 2N1WA 1KRSA 2KTFA 3MC8A 3HOWB 3DWGC 1K8OA 3NK9A 1RFAA 2AWOA 1WE6A 1TWFH 3MFYA 5K36G 4OIKA 1VQLA 1IW7C 1PFBA 4KSLC 2MO1A 2A4ZA 3VR6A 3ZIMA 1TZOA 3D4DA 2NPTB 3DXJC 3T51B 1JMCA 5M3FH 4RG1A 1TWCB 1MJEA 4S17A 3PIOA 3S1MH 1E2ZA 1I4XA 5JVG3 2B2WC 4IFDI 1WM2A 2FHTA 1X3EA 1NEKB 2DYOA 1WOCA 3WANA 1U4PA 3RULA 2CU1A 2KHJA 4QUCA 3A5UA 3AFQA 4GN1A 1V8QA 3RZOB 2NTSA 4II2B 2BWFA 4LFCL 3A4SC 3SEBA 4URKA 3QC8B 4MDKE 4C3JH 4HMIA 4JV5Q 4JLCA 3IAYA 4K14A 4XWTA 3V3XA 1QWYA 3NTKA 1SE9A 4JVZA 3OIPA 1AARA 3TP6A 4B0EA 2M19A 2K6AA 1PZJD 4K81A 4X3TA 3M4OH 1HHVA 1A5RA 1IGCA 1X6OA 4GLAC 4YCUA 4E6IA 1C48A 1EOTA 3R93A 2RSNA 4A3JB 2BH2A 2AL3A 4GOCA 4X57B 3ZKJC 4FBJB 2RPVA 4RKLA 1PUTA 1VJKA 4WFN3 4YSYB 4CHKA 3FKIG 1F2ZA 2R93B 3EA6A 1E2VA 1HUMA 1LYLA 1MSHA 4MT5A 5F2DA 3I72A 4MZ9A 4FJVB 1JWSD 3V6CB 2B29A 1SE3A 4DV3Q 4A3GG 2DYBA 5FO9B 2LHEA 4HJKA 1JWUD 4IALA 3I4MH 1EWIA 3A5ZB 4IPDA 3HOYH 1F1HA 2JYOA 1L4DB 3FP9A 2KEEA 4C3JG 1YI2A 4ZLTF 3MVVA 3RD4A 1IBMQ 1PH9A 1PHJA 2WAQE 1KAAA 1V80A 2KA7A 2QSDA 3PO3H 3DHGC 4A4IA 2OF1A 4L5QA 1C77A 1MHXA 1X55A 3RYTA 1NUCA 1WX7A 3BVMA 3TDQA 2RQXA 2F0DA 1IBLL 2LUMA 4UP8A 3KK7A 1NBFC 4BS9A 2VB2X 3GD7A 4UAIA 2LVQA 4EZKA 4WJWA 5A2QL 4AQYQ 3HZXA 3A9KB 1YMHE 1D8LA 2K04A 4A3FB 1SRUA 2O2VA 3S9WA 3VYRA 1J9OA 1LV9A 2AUKA 1EL0A 2CJNA 1UWXA 4XDCA 3RNEC 1SE8A 3PO3B 1LTBD 2FMMA 1VMCA 1F2MA 5G3LD 3GO5A 4RKBA 1C4PA 2K5DA 4A6QA 5KGUA 2ZCBA 1P98A 3K9PB 1PRTC 1HH2P 2ID0A 3CP0A 2XVSA 2EJGC 3QWNA 3CCVA 3H7PA 3J80i 4A8XC 3IFDA 1UBIA 1RFKA 3TEHB 4B3MQ 3E9IA 1AW7A 3OWEB 1SEBD 4GOPA 5LMNL 1K8RB 2K8CA 4DR5L 5EQ0A 3A1QB 3ZRFA 5C0XH 2H88B 3APDA 3J80E 2K8HA 2KQ7A 5C2TB 2EYOA 3DM3A 4RA8A 1Y56A 4B9XA 2LVPA 2QC8A 1UH6A 4GKKL 4MGKE 4R8IA 4OL7A 2KAJA 1AN8A 4C3HG 3J80c 1H4RA 3HOUB 4IO9A 5EKIA 2RHQB 1TIFA 2HQLA 4JIOU 4C4VB 1U4RA 1DD2A 3K7AB 4LK1C 2KMAA 3D4RA 3B6YA 3M9BA 3AE6B 1EY6A 4TQUS 1KQSA 5IYDH 2JYEA 3IXSA 4ZK9B 1IBXB 3P4PB 1PFDA 1A3UA 3KW5B 4DHZB 3CCUA 2MWSB 1CSPA 2K4KA 2NTTA 2NUCA 3KUDB 2VXWA 1R4MI 2L52A 2JX5A 2F0PA 2WXFA 1YX5B 4ILWA 4U68A 4BBSB 2F0EA 3CD6A 1K52A 5HG2A 1K3BC 4M02A 1CQFA 3I63C 2KZRA 3U8ZA 2JQRB 2Z6KA 4HIDA 2KJRA 1TJEA 1HFGA 4DN4M 1B70B 2RDHA 4IFDH 4JQWC 1UGMA 1PTOC 3OIQA 2JA5G 2PTLA 5HFYA 3AE3B 2G4SA 5LL6S 2PZUA 3MXPA 3HOXG 1WTQA 1XNQL 4A3LG 1MPEA 1EYCA 3DBHB 4GU2A 4LNIA 4RHSA 1VDZA 2BB5A 5EPKA 1TKWB 1I4PA 2BT6A 2WYQA 4IN3A 4EVOA 1WR6E 3S1NH 3N1XC 4IJLA 2ZW1A 4HCNB 4AH6A 5DPRA 2EYHA 2R2OA 4JI1L 1N62A 3CSTA 4R4CA 3W3AA 1WTRA 1UNSA 1YJNA 1EQRA 2JJQA 3CMEA 1MBYA 2N7DA 4A20A 3ZTCA 4JI8Q 1SN8A 1EY8A 2Y5BB 2WDRB 1NR2A 2N49A 3OG5A 4TMAB 1QF6A 2ATWA 4AYBB 1E7ZA 3WDNA 1WGGA 2FCQA 1U9RA 3KLSA 1HA5A 1YJJA 1IKMA 1ZPSA 1F9PA 4LJPB 4LAAA 3C19A 4GKJQ 2JXTA 4WAAA 5IOIA 1C79A 3RNCC 3OOCA 1CZPA 1V97A 4D2KA 4JW0A 1W3SA 2J52A 3ZJUA 3W5VB 4DR6L 3HUIA 2N9KA 3NZSA 5NUCA 3NP8A 3PUXA 2EIFA 1ZOYB 2R92H 4HIMA 4M00A 4BY7H 4OHJA 3K5LA 3O13A 1Z5SB 3VUWA 2K5PA 4OVZA 5E6OA 2LWPA 4LF7L 1BDOA 3N32A 1HNZQ 4IC7B 4MH0E 2K32A 2A1AA 4FNFA 1D5ZC 4KY5A 1WX9A 3M62B 2KHSA 3AB9A 4DV7Q 3BJUA 1WCMB 1ZGUB 4HSVA 3PIP3 3TP8A 4H44C 4JWUC 3S15H 2MSED 3UGBB 3JAME 1N5XA 4G50A 1MIUA 4ZRKA 2BW2A 2WP8J 5GAGC 4EEWA 4NQLB 3OPOA 3R8BA 3JSVB 5AZHA 4ASWC 4AP4C 2F52A 1PFMA 1K8GA 3S14B 2PZWA 2G3QB 2GBJA 2C7MB 2F0KA 3S1QB 1UE5A 2EE1A 4NKLA 2KX0A 3EECA 4KDLB 5DCNA 4WJOA 1ENCA 3OW7A 4BOSC 4KN7C 4LLGM 2ZZPB 3HRZC 1L0WA 5JJZA 2K1BA 5E6NA 3N20C 5C3WA 4NDXA 1Z9FA 1TWAH 1WD0A 3SK4A 2IO3B 1GUTA 2A69C 5COYA 2HD5B 3NWSA 3I9V1 2MRPA 3CMMB 2LUEA 4FVMA 3ULLA 1C1YB 4IWQA 2CFMA 2C9OA 4A3KB 3PUZA 3DPDA 2F1MA 3U7DA 4EUTA 2KDBA 4ITKA 5M5XH 2HJ8A 1U5KA 4C1NK 1Y69U 2PI2E 1PH2A 5JJKA 4LTUA 3DM1A 4YWKA 1O78A 4HJ9A 3KBXA 5D6JB 2EVBA 3MP9A 4DR1L 2E5LQ 4JI4Q 2K33A 5L83A 5C5LA 3DHHC 3CF6E 2M17A 2G45B 3H3VH 1AP0A 1K53A 2INPE 3UIPB 4N9PA 4BBNF 4GGQA 4RCOA 1TXYA 2Q8TA 2IW3A 4AQYL 5BYRA 3HKZG 5M3MH 3SXHA 1DOKA 1QKZA 5M3MG 1YOVB 2PVOD 4KK7A 2CW0C 4LUVA 1N60A 3ECIA 5JJIA 4K3BA 3FDTA 4JI1Q 4DV1L 3DHIC 1DONA 1E6EB 4YY3Q 1JWBD 2N55A 4PS7A 3CMAA 3CU7A 2I46A 4FJZA 1I94Q 3VUXA 1Y1VB 4DWFA 1PVOA 4B3ML 5IN7A 1SXTA 4H02A 4JI8L 5FOBB 3A33B 4JPSA 2F0HA 2IGDA 1PGBA 3NSWA 4ZRQA 1SYFA 3BIID 1I42A 2EKIA 2OJWA 1E9MA 1II3A 2LRUA 1JOOA 1WMHA 3GS2A 3MZ5A 5DPSA 1YJ9A 2XRQD 5C0XJ 1SJED 3A9JA 4J6IA 1WRDB 2B2YC 1QVGA 4EQ5A 4G0NB 2ZVNA 4KZ0A 3C0RB 3KH0A 1MGSA 3ML8A 1ZYRD 2PQEA 4DAMA 2NB0A 4DA2A 3OTOL 4ME5A 3H09A 1KH0A 4GMVA 2KTRA 5JEAJ 4DUZL 1GUNA 1YNNC 2B2VA 4LUOA 2J0KA 2KVRA 3AFPA 2E2JB 3GP7A 4X64L 2K6DB 1DYQA 1B2TA 4DV6L 2EY2A 5DPTA 2HTME 3T9LA 1WTVA 2KDFB 3BS1A 4IWOA 3ZXVA 2L0CA 4BBRB 1VDVA 2MBOA 1OQYA 3J7AV 3NTHA 1EWHA 2O2LD 3OWFA 4A3IH 1YHQA 1L2NA 2EJMA 3A56A 1LTAD 5DNFA 1MD2D 2NVYB 1IBLQ 3CHBD 1DOIA 1WF9A 2MQJA 2R2QA 5T1IA 3NHEB 2PMVA 4BAXA 4MHEA 1R4NB 3SHLA 4AYBG 4X65L 3T3OA 2QJLA 2DBYA 3PSIA 2UXBQ 1O7LA 3HKZE 1YVCA 3LWUA 3SE0A 4HJ5A 4ZUJA 1WTWA 3CQZB 3OLMD 2ZCCA 2M2LA 4NPSA 3KDFA 4N8X1 5C4ZA 3D0FA 2YV5A 2JWZA 4DV2Q 4GDLB 1NBWA 1TU2B 5JEAH 4GNXC 4PNYA 1G6JA 3WOFA 2JYTA 4DK1A 5HGQA 5DAUA 1BCPB 3VH3B 1ZE3D 1Y14B 4I6NB 2V4IB 3L0WB 3M7GA 2YU9H 1FIQA 2DY7A 2C60A 1VQFA 1VF5C 3K57A 3CPWA 3CCSA 2CWAA 1VQ7A 2GBKA 1E22A 1OXXK 3F2UA 4QCLA 1LT4D 3H7PB 2QEJC 2EXZA 4OZBA 1B8AA 3GTOH 3NWTA 2E76C 2JK8A 1PTOH 1LQBA 3QQ8B 3MC0B 4IFDG 2QHOA 2NN6H 4OX9Q 1KL9A 1SE4A 2RCFA 2Q2TA 2D3BA 1CZWA 5BN5A 2C7NB 4A3LH 1N32L 3EFCA 2OHFA 2DNEA 4AWJA 4RNAA 3ND9A 3I7FA 4Y7NH 2N9XA 2LZ6A 4JOIA 1YX6B 2B39A 4ZYSA 4FXDA 3NVZA 3AEEB 3KJOA 5G5HA 1J6QA 2E5LL 1JE5A 3RN2A 2WDTB 4WWOA 1TWHB 1GUWA 1HUNA 4ZYNA 5GMVA 2DNFA 2KANA 4DAYA 1CA6A 4PZ7A 5J17A 3HOWH 1XEEA 1UWVA 3P75A 4FF4A 3M4YA 2VUMB 1G291 4A3GB 2KC2A 4CHTB 4DV0Q 3BZCA 2A74C 4KY6A 4MJSB 1L1OA 1VQ8A 1VQDA 2K7VA 3TIXA 2ICIA 2DHZA 1RD9D 4WJ4A 3ETRA 1GPXA 4DNTB 5CTRC 3KLSX 3AQQA 4DK5A 3Q3MC 1SSOA 1UEBA 3NBHB 2BOSA 2NR2A 3BDCA 1SBBB 2HUGA 2ZJRA 4DV5Q 3QCAA 3AV8A 5CV8A 1DOXA 5CYUA 5BN3A 2CKHB 4LF5Q 1ASZA 5KEEA 5J2RA 1FRDA 1WXQA 5E4WC 2J7ZA 4PMWA 4DR7L 4OONA 4DGZA 2IY5B 4IKGA 3PO3G 2MUYA 5EKKA 3J81L 2AEHA 1L1OB 3P7JA 3HOWG 3TRZA 5M5YB 1WRIA 2JA7B 2KN4A 3GTGH 4QIWB 2EY5A 3PV0A 3PVLA 4MGIE 4MGYE 3VR2A 3TEZA 5G2NA 2UXDL 3GTMH 2WXPA 3K0YA 1J8CA 4LNKA 3TS0A 1WXAA 4QY7A 4G4KA 4I65A 5I2YA 5E6PA 5C44H 1PYBA 3MAQA 4A3CH 4C2MH 4ZUIA 1QG7A 3Q6BA 2EELA 1CKOA 4LFCQ 5AJ3L 3PHWB 2XIWA 1IXRA 1KFYB 4PMCA 1QLBB 4W9GA 2N4FA 1U4LA 3SFEB 2WXMA 5IY0A 1QT9A 2KYWA 4AIMA 2L32A 3PUWA 1VQ6A 1P0RA 3AE8B 4W9HA 1H8CA 1LLRD 1I6HB 4ZRZA 2HHHL 1IW7D 2KFKA 3ZLZA 1RF2D 1OGWA 5JJLA 2D2QA 1IUEA 4C2MB 1HZAA 4K6DA 5IODA 1KRTA 3RZWC 3HFZB 3HOYG 3JAMc 4HIOA 2GVAA 4WJQA 3GTPB 3UQAA 2WP9B 1CHPD 4PYUA 2RSUA 3IT4B 2JY6A 4KKSA 1FXTB 1JICA 3TQYA 2CCZA 3VR5A 5IGGA 1I94L 1DZ1A 1CJEA 1F9JA 2IPKD 1N6ZA 4B3SL 1T0YA 2BS4B 3VYTA 2FUHB 5H92C 1RAXA 1Y1VH 2VS1A 5D3DA 1F2LA 3RMHA 1BUIC 3W1SA 2JUOA 1FL0A 4DPGA 2PEAA 2UWQA 2V3SA 3AH7A 3BWUD 1YBYA 1XQQA 3H3VI 2W54A 4DXGA 3K59A 2VQEQ 2N7EA 1V43A 1K3RA 1VQPA 4EZJA 4OWWB 3KFUA 1IPGA 5DLQE 3NBHA 1DGSA 3P4QB 2IY0B 3D32A 1Y1WB 3UE1A 2RSOA 2D0OA 3ZW3A 5TR5A 1C3TA 3OTOQ 4HEDA 2FXQA 2DENB 4HEA1 1BBXC 2JSVX 4IJHA 2K5QA 1P8LA 4CKEA 3UQBA 3RNGC 2MW5A 2IO1B 1VQGA 4EKUA 3H1UA 4QB4A 2MQHA 2WNMA 1V1PB 4W9CA 3A55A 3GV6A 4LF4L 2AWNA 2K14A 4BKGA 4DU9A 4N9F4 2WB1E 1VQOA 3V61A 2J0JA 4LFAL 4ICVA 2JA8B 3W1YA 2MEKA 2I07B 2L11A 4KKUA 4M0WB 3S16B 1TS5A 4C4VA 1A62A 3RNUA 3RR5A 3RLOA 3K7AH 1A0IA 1CTMA 4OWXB 4OELB 1EU3A 5FR3A 3TZDA 2E2HH 4XDXA 5IE8A 2KD0A 2NN6I 4LCDE 3LWEA 5HGTA 2Z9HA 4LF5L 1J5EQ 4BBRG 2ES2A 1BF4A 1Q5WB 3RZFA 1B3AA 4N6EB 1HNZL 1PQSA 3GOEA 4EFOA 3I91A 4HSPA 3C8YA 1Z6HA 1SR3A 2ZNVC 4NAWB 2J0MA 1LT5D 1IL8A 1TR5A 2BH8A 1B50A 3W1BA 1R9TH 4C00A 2MFIA 2NMQA 1XYIA 2IHEA 4KV6A 1C0AA
chains in the Genus database with same CATH topology
4JWSC 2WB1B 4N58A 1WWTA 3IFTA 3TEXA 4PMBA 4XT3B 5CORA 2NVQB 4J3OD 4WURA 4XXEA 1LTTD 3A7AB 3PUYA 2MPMA 5DM73 1FD7D 2EYMA 1ENFA 2NVTB 2F0LA 1C9FA 3NBIA 1PYWD 3A8JE 2PLPA 4HKZE 3SK6A 2D9UA 4BA1I 2AQ3B 4NJCA 5HHDG 1IBXA 1M4VA 2W3RA 1HZ5A 1Q8IA 5I9PA 1FCCC 2D5DA 2MH7A 2Q8IB 1FNVA 5BN4A 1AYFA 3E56A 2KDMA 3V96A 1O80A 2MP1A 2F0WA 1OXUA 3TN2A 3RUZA 2J0TD 1VF7A 3AE9B 1D5MC 1SJHD 4F87A 3Q8BA 1H9RA 3TEYA 4DQOC 1FEHA 1NAPA 2EZVA 4WAFA 3IAM1 1GOZA 1GUSA 1S5CD 1EY4A 5CC4A 4MM3B 2BS2B 1I7HA 3AMUA 1T5XD 1STEA 3Q6SA 2FUG1 1C4CA 4US8A 1H9MA 4KHVA 1I6VC 1SYEA 3GTGB 3Q0AA 5HURA 5EE0A 3KLRA 3Q69A 4WQMA 1Y8NB 1T5EA 3D6CA 3IL8A 1C4AA 1KDCA 1BR9A 2XNAC 3BVGA 3Q22A 3WCQA 2F0NA 4TQ0A 3SR1A 3GTLB 3CIRB 1TWGB 4KKJA 5M3MB 4P2CB 3P63A 1S5FD 2EY1A 5TSSA 1PDQA 3TZUA 4F7XA 1FCLA 4JBWA 3DWPA 5I4DA 3H0GB 1PLFA 4O42A 2JE6I 5EPJA 1IYUA 1LT6D 4CKCA 4XQNA 4M0WA 4RFBA 4KN4C 1TY0A 1DXMA 1EU4A 4IUNA 1GAQB 1F0ZA 3QO2A 1GXDC 1DGJA 3NXWA 5FKAC 1KRHA 2B2YA 1PRTB 1SNMA 3HOZB 1CM9A 2TMPA 2E75C 1S4ZA 1E7PB 1DM0B 2OEOA 3BG3A 1ML0D 2O4XA 3DEPA 2BTEA 1XLQA 3TEWA 4F88A 3AE7B 2E6XA 1PDXA 1X3QA 1EEID 3M85A 5EJWA 2Z8LA 2F3WA 3V05A 3AM9A 3Q23A 1L0VB 1A2UA 3PZ7A 2CHBD 3U7ZA 1EWCA 3EQLC 4HKQA 3LXFA 4KX6B 1Q10A 3EGRA 3ONAB 1SNPA 3T53B 1WGKA 4L23A 1SDFA 1KABA 3NS1A 1FD6A 4L1BA 1IKLA 1HFNA 1RTOA 3TP7A 3J7AF 1ESRA 3NQTA 1O7ZA 3AE5B 1TS2A 4C7ZA 3Q8CA 4MH8A 3MA2B 3NRZA 2M9VA 4KMUC 4BY1B 3S1MB 4FXCA 4Q2JA 3E5SA 2A6HD 4U673 1EM7A 1Q90A 5AFWA 2IGGA 4Q5VA 1JQYD 4LMQD 3ABVB 1JOKA 1C4QA 2XSCA 5AUKA 5FLXE 2SDFA 1SIJA 5M5XB 1NENB 5M3FB 1CI3M 2GB1A 3P4SB 4JX1C 5BMIA 2VB3X 1ILQA 4RF0A 1HQMC 5D65A 1GUGA 1WD1A 1WSPA 4FF1A 1JWAD 2F4IA 4IDIA 3AEBB 1A6XA 3H6MA 1B1ZA 3OSOA 2HDEA 4QMGA 3FPUB 1ZEQX 4CJ2C 4BWGB 1QNUA 4N59A 5C0XI 3JAML 4K2LA 2H1EA 2EDGA 5GXGB 1AZQA 3VA5A 3NE5B 5KNCA 4BA2I 4HROA 1RCVD 2JP1A 3SFDB 2CVRA 2JEBI 2B8FA 1AWDA 4HR7B 4A3DB 2IGHA 3ZYYX 2F0QA 2PNRC 3IAS1 1PZKD 1JWMD 1TWAB 1I4RA 2KACA 1DOMA 1PGXA 2R7ZB 3S2HB 4PV1C 3I73A 5D3IB 3H94A 1V1PA 2WXOA 1XLOA 2A6HC 2V3NA 2Y0SB 4C3IG 4XYQA 3IKJA 1JC7A 1ZXHA 5EPLA 4LK0M 5CV6A 1JROA 1EY9A 3E9SA 3FKIB 3ND8A 5T1GA 5EGTA 2J42A 1PZID 2D62A 4FYDA 5I9OA 4H2AA 3ERQA 2PW5A 1FMAD 3URYA 1C8CA 2PKOA 1PFNA 3R2TA 1BUVT 3I4LA 1BNZA 3I8ZA 2F03A 1VRAB 3AECB 1HTLD 2ACZB 5JVH3 4ARIA 1Z7TA 3AU7A 1N5WA 3IT6B 2YEPF 3U9SA 1YN5A 1EEFD 2BYTA 4XE0A 2KCNA 3J81E 1R4QB 2EYPA 2X6GA 2INNE 2QIEB 3C1EA 4ABNA 3MFGA 2PIAA 4KGSA 4A93B 3A8KE 1R7SA 1STBA 2GI9A 1LTID 1B9MA 2JSOA 2FINB 5A35A 3S1NB 1H9SA 2PW9A 4IUQA 1PXUA 1VCIA 2B2WA 3I3CA 5IGFA 1FO4A 2LMCA 5CV7A 1OFFA 4ULLA 2WU5B 1PTOF 3M3YB 4RGTA 2B2UA 3M7NA 1FFUA 1FNUA 2W55A 1L5PA 5MPOA 2WXGA 3FEWX 1D1KA 1SB3C 3QB3A 1D1IA 5BMHA 1FYCA 3P1HA 5DM63 2IT1A 2SEBD 1G8ZD 3I90A 1BQQT 5ELDA 4Y7NB 1ET9A 1SNDA 3KWLA 2GRIA 2OT2A 2D2CC 3MEHA 5CV4A 4RHRA 2RDGA 4A3EB 5C3JB 1KNAA 3EJIA 2HCIA 4R9WA 3PO2B 4A9AA 1B4OA 3S17B 1J7BA 1FM0D 2IJ0A 2IX3A 2IX1A 2E2HB 1PTOD 2D5GA 1O7YA 1OXVA 1KF6B 4G7HC 4MACA 1K83B 3KUPA 3W2DA 1V8CA 5ELBA 3HEJA 3W5UB 5JXVA 3TMEA 2ZXRA 2WU2B 3T13A 2MHVA 1NSNS 4B0MA 3EFXD 3UI2A 4FF2A 2L4NA 1SF0A 4M8AA 4KKIA 3BK1A 3FRPB 2A68C 1B9NA 1J7AA 3LYYA 2IX0A 2J4XA 2F0TA 3AB5A 3X3NA 5DEHA 3BK2A 3NHHA 5EBDA 2BA1A 2VZKB 3NVYA 4IUUA 2XRSD 2Y5PA 1ZXIA 2K22A 1FRRA 4XT1B 3L4PA 5LHY1 2K5WA 2V3PA 1DOYA 2EYFA 5C3XA 3QOJA 3VYSA 1BXTA 3C1FA 2O5JC 1HZ6A 2VZKD 4LJZC 3ZJVA 2WDVB 4DFAA 1AZPA 4V190 1F9SA 2QDBA 3K5MA 4FF3A 4TKOB 1QB5D 3K58A 2M0AA 4HRSA 1B44D 3NUCA 2WXJA 1I3QB 3Q8EA 1W6JA 1KLUD 3QJYA 3KWVA 4ZKBB 3V2TA 3J80L 3U9OA 2SNMA 1TIID 2H89B 1P7FA 1DCZA 1SYDA 4KTAA 4YXDB 2G9DA 2BB6A 3SK5A 2DWQA 2V4DA 4RWSC 1EFID 2X69A 2JEAI 2O5IC 1HTPA 4KJOA 2B76B 1ILPA 5FO8B 1ZXTA 2WXIA 1YNJD 1X32A 3MXGA 3N6RA 1EYAA 4ZRPA 1LACA 4EE2A 4ZOHC 4YTNB 1XLNA 3MXNA 1OO9B 1JRPA 5C5MA 4WWMA 4ODGA 1CZGA 1XXGA 2K05A 5D7GA 1QOBA 1QOAA 2K3UA 2L1AA 1RJTA 4REZA 1F2RI 3BYYB 1H9KA 3DHQA 1RYJA 3HRDD 4KY7A 5CMDA 4RGOS 2RMMA 1TKEA 1ROEA 3C46A 2E2IB 2XWBB 3TUOA 3VR8B 5FK9C 4M1UB 1BCPD 2DNCA 2WAQB 3EUB2 4ZHOA 2BE5C 4C1NI 1WTPA 1DJRD 1JQ4A 1J8IA 1QJOA 5IGBA 3VA7A 5ISRA 2Z4HA 3UI3A 1Q12A 2F0GA 4YWGG 1VZ6A 1ZUD2 2L1BA 1JOQA 1D5XC 5C3EB 5IIFA 4J6HA 1CFMA 1WVLA 5G5GA 2WXNA 1D2BA 3A8IE 4USAA 2WV6D 2A68D 4WRDA 2KWDA 1STHA 4C80A 3T56B 4OGQC 1SYBA 4B08A 1FXIA 2M00A 1I4GA 1E2WA 4XYOA 2ENBA 3Q24A 3VQIA 3RZDB 2X6LA 4RGMA 4X3SA 4HCSA 1XCTL 2F0OA 4WIPA 2EYJA 1YQ3B 2A6EC 2NVXB 1STNA 1FXAA 3ZQ4A 4IUTA 1TVXA 4I7ZC 1HQRD 2HCCA 1GHJA 1ONLA 2DY8A 3QOLA 1N63A 1F2YA 4FP5D 1MI0A 1G6ZA 4NW2A 2FBWB 2IDYA 4C56C 1LTRD 1PMRA 2WXHA 1PRTF 2JA6B 1MHHE 1RTNA 3RPFC 4XWWA 1SMYC 2Q5WD 4TQ1A 1L4ZB 2WXRA 5JAVA 1CQVA 4KD4A 2X38A 3M4OB 1OXTA 2F0VA 2MGSA 3CKIB 2K0PA 1KDAA 4EQOA 4HJGE 4GDKB 5CBEE 2R61A 3HOVB 5C44B 5A2QE 1GUOA 2AUJD 3AEGB 1S5BD 5KNDA 3B2FA 3CWIA 3P4RB 4HTHA 1G2SA 4XTCS 1E0ZA 5EE9A 1ET6A 4HN7A 2TSSA 4AS1A 2IL8A 4KD3A 3C2PA 2W82A 4R8NA 2F0SA 3NQIA 2A6ED 2K03A 2PYKA 5CV9A 2AQ2B 3NZ3A 3GTJB 5IOCA 3AEFB 1GJXA 1SYCA 3ITPA 4L2YA 2B2TA 1QOHA 1SNQA 1EIHA 5FLXL 1WTOA 3ZGZA 1K50A 2KVMA 1V1OA 2ON8A 1U4MA 2F0JA 3LNNA 3J7YW 2YEPB 1YJIA 2LEKA 2KEDA 2QF7A 2Y5CA 2LFIA 3I4NB 4A55A 4H0LC 1W6KA 5J1ZA 1GB4A 1A70A 1M8AA 1BMLC 4IUVA 1EYDA 3GB1A 1FFVA 3HS0C 2EPBA 3BVZA 3D3RA 4CJ0B 3R3OA 5C0XG 4C7YA 2PPBC 4UDUC 3U2SC 2ICEC 1RHPA 4HAEA 5JPNC 1JALA 2L12A 5G3LF 1TY2A 4ZQ3A 5I6WA 3T16A 3HVDA 2LJIA 3T3NA 3BDOA 1CHQD 2OEDA 1BCPC 1Q1BA 2KECA 2EJFC 2OXPA 2CU3A 2WLBA 1XF5L 3QIAA 2LS01 4G7ZC 4K2KA 2DLBA 2DYMA 3A54A 1LTSD 3CRKC 5EKLA 1XX8A 2EY6A 1JW9D 2JZPA 5HI1A 4A90A 5E1FA 2QKIC 3L3OC 1T6BX 1HEZE 1VR9A 2NZ1D 1QILA 5KNBA 1YNND 5JOBA 3Q8FA 4DAVA 1PTOB 4GZYC 1RM6C 1SMYD 1XWEA 3VRAB 2BA0A 4EGVA 1EWYC 4IQZA 4Q0FA 3W9CB 3S2DB 2BS3B 1BO0A 2NN6G 2B63B 2KQ4X 1ZKOA 2B2TC 2WKCA 1P7EA 3C3LA 2C5CA 4K8JA 2E3TA 1Y8PB 1HA6A 2SNSA 2I38A 2BCOA 1S5DD 5IT9E 4XDDA 1A3VA 1JORA 4KI0A 3B2GA 3EROA 3GTQB 4ZAIA 3K5OA 1DOLA 2PO4A 2F0MA 2R3ZA 5D14A 2WACA 3AN1A 1GB1A 3DWMA 2E74C 2N88A 3AE4B 2RVLA 4IURA 3H3VC 4OW0A 4XQJA 5IGDA 4P6VF 2ZW0A 2Q8RE 3HOYB 1I4HA 2EYLA 1UEAB 5EE1A 4OO1I 3FAHA 2NBFA 4IZ8A 2FFKB 2FMCA 3GTKB 3MTSA 4PQXA 1EY0A 1JE4A 3OMGA 1RDPD 4K8IA 4YIJA 3QG1A 1IGDA 1MI2A 3D4WA 1VMPA 1SFOB 3FPPA 3NVWA 3HVZA 2LHDA 5KYLA 1CT1D 3FC4A 4YTPB 1G2TA 1RWSA 3OHXC 3PZ8A 3L9AX 2LMCB 4JE3B 1VZ7A 1FNWA 1S5ED 3AMZA 2YU9B 3K5NA 5K5PA 1Z47A 2F3VA 4CGYB 4RH6A 3PMFA 2B2VC 2L55A 1L6UA 1HPCA 4YSZB 4A3MB 3AE1B 2H4OA 3MXUA 5C4HA 1OQRA 5JEAG 3FILA 1KLGD 2FJ2A 3PUVA 2N0SB 5T8IA 4XQQA 4ZHPA 1OQQA 4IUPA 5CR3A 2G1EA 1TS4A 1I50B 3VR9B 2MJ8A 4RCNA 1A3TA 2Z4IA 2KMMA 4GLSC 4WH4A 1TS3A 3NVVA 2DN8A 4DXFA 3BDLA 1NYRA 1VLBA 3Q8AA 3S15B 1YN3A 3WOEA 1LTGD 3OMCA 1AFPA 2L83A 1Q1EA 2G9HD 2RBMA 1TKYA 1KTKA 2V0GA 2QCPX 3H8HA 2NYZD 2WXLA 1H9SB 3D8GA 4YTMB 1KNEA 1NR4A 3KF8A 3HP3A 3E6ZX 5IT9L 1TKGA 4X3KA 4L8JA 2F0FA 3S1RB 1JB3A 1IHZA 2JU6X 1HXYD 2W3SA 4QF4A 4NP5A 2CQAA 5LL6X 1Q3LA 2EOTA 2JXMB 5J22A 1CK1A 4JK1C 1G91A 3DWQA 5C4JB 4X3UA 3GQBA 4C3JB 4DF7A 4YSXB 3RFZB 3E0JA 1UUPA 1EZ6A 3MJ5A 1Y8OB 3D6WA 5AUIA 3KQ4A 4FXKC 5H8YE 5BYQA 1MSGA 3G6JB 5E6JA 4HCEA 4TSSA 2B8GA 1QCBD 5ELFA 2PMZB 4S3SA 1T3QA 3K6OA 4J8QA 4OZAA 1I4QA 4KJNA 3TP5A 3GTMB 2WS3B 1HRJA 1E10A 1SSNA 3VR4A 4KKTA 5IGCA 4HMJA 4OIJA 3LB8C 2GA4B 2A5HA 3VRBB 2K9XA 1WYGA 4H13C 1VZ8A 2M56B 4OO1H 1STGA 3L7ZC 3LX0A 1RKNA 1XLPA 4AQ7A 3HG9A 1UAPA 2BBCA 1C78A 3N9YC 2HDLA 1K51A 1N61A 1SYGA 3P1MA 1C76A 3N52A 2R6GA 3GV3A 3AE2B 2LKVA 4CKBA 3ZJTA 1SNCA 2RKSA 3NUHB 1NVID 1EQTA 4KHZA 1WTXA 4CBVA 1AEXA 4WORA 2B2UC 4ARCA 2QILA 1H9JA 2WINB 4YT0B 5EBCA 2Y3AA 2FE8A 2WDQB 1TT2A 1ZP0B 3X3MA 3GTOB 2BE5D 1CA5A 1L6VA 5BMGA 3AEDB 1B53A 2CJOA 2N7JA 2HQEA 1UWMA 1UGJA 2QMTA 2KOLA 3CRLC 2MJEA 3VYUA 1HCZA 4DNRB 4O1NA 4K5VA 2KUMA 3A7LA 2HDMA 3NTIA 2NWGA 1F9RA 3RLFA 1ACCA 1EQVA 4R3DA 2Z1CA 4N9TA 5KYIA 1SE2A 4A3BB 2J53A 2LGIA 1XTCD 1TQOA 5E4XA 3I57A 2A69D 2WIIB 3MWYW 1EIGA 2F0IA 2KQ3A 4EQPA 2K28A 1TWFB 2AX5A 4BY7B 1EZ8A 1GHKA 4IOIE 1ENAA 1BOSA 4C3IB 5J39A 4K5WA 3SVMA 3I70A 2L9HA 5IGEA 5JPMC 5K36H 1SAPA 1F77A 1ZDVA 3R2IA 4ID6A 5FO7B 5LNK1 1MVKA 2RA4A 1A2TA 3H91A 4KGRA 3DEOA 1F2RC 2PZTA 2SAKA 4G7OC 2XN9C 1X3PA 2KCCA 2N9LA 3MHBA 2JA5B 4K5XA 1L0XB 3U52E 1E0BA 2LY7A 4RGNA 1B9RA 1F9QA 5E3FA 5CV5A 3P42A 4KGTA 5ELEA 1IYVA 1K8MA 3BZDB 4PT5A 4US9A 5ELCA 4V0BA 2YYZA 3D31A 3I4MB 2K01A 4CJ1B 3T4AC 4NZLB 3P20A 5KRUA 1YNTE 3PIO3 1LABA 1YNJC 5CBAE 1ZDXA 1JMLA 2L5TA 4C3HB 1STYA 2BDOA 2WKDA 3HKZB 4RAUC 4B9WA 1D6EC 3SDZA 4DAPA 4RF1A 1JCKB 2KJXA 1NCVA 1FGBD 4H7BA 1EY7A 3NPPA 3TSSA 1PGAA 2CW0D 3DUZA 1R4PB 3FILB 4QUFA 1QNKA 3SR6A 3SK8A 2AQ1B 1PRTD 4ZKCB 1EY5A 1STAA 1L0YB 1J7CA 5KIXA 2RDFA 2ZXPA 3DWAA 4EQNA 4J1MA 3J9CA 1ICWA 4FXGC 2IWHA 5BYSA 4XIGS 1XO3A 4MIUA 2BDNA 1OXSC 3U4EG 5I2XA 1BCPF 3FVQA 2F0UA 2PW7A 4OO1G 1A15A 1YQ4B 5C4XB 1JR0D 1QE6A 1R9TB 2VNUD 2MJ3A 1FR3A 2WQYB 4P16A 1YN4A 1RODA 4G57A 4IFDJ 4Z9CB 1QQRA 5C6AA 5EE3A 2LFNA 5I6YA 1QOFA 1XCQL 4NMZA 4L63B 3PO0A 4TRDA 1SNOA 2WXQA 5CGKA 3VR3A 4NAMA 3EVQA 4FO2A 2A73B 3AEAB 1LO5D 3TBIB 3FMCA 3HGBA 3MHZA 2JWUA 3G7LA 2PVGC 1NYQA 3B9JA 3KBGA 2I2YA 2XWJB 1LT3D 5M5WB 4K6LA 2ZT9C 1ZYRC 3HOXB 1NI3A 2MJDA 4OZCA 4L6TB 4CQNA 2SOBA 2WXKA 2ONQA 4DK0A 3BYTB 1TYGB 4A3IB 2R92B 2E2DC 2PCFB 1ESFA 2ZXOA 1QOGA 4F8MA 3DMUA 1KDBA 4MN3A 5M9OA 3HOWB 3DWGC 1K8OA 3NK9A 2AWOA 3MFYA 5K36G 4OIKA 1IW7C 1PFBA 3VR6A 1TZOA 3D4DA 3DXJC 3T51B 1TWCB 4IFDI 1E2ZA 1I4XA 5JVG3 2B2WC 2FHTA 2DYOA 1NEKB 1U4PA 4QUCA 1V8QA 3RZOB 2NTSA 3SEBA 4HMIA 3IAYA 4K14A 4XWTA 3V3XA 1QWYA 3NTKA 3OIPA 3TP6A 4B0EA 2M19A 2K6AA 1PZJD 4X3TA 1HHVA 1IGCA 4E6IA 4A3JB 1C48A 1EOTA 3R93A 2RSNA 2RPVA 4RKLA 1PUTA 1VJKA 4WFN3 4YSYB 1F2ZA 2R93B 3EA6A 1E2VA 1HUMA 1MSHA 4MT5A 5F2DA 3I72A 1JWSD 1SE3A 2LHEA 5FO9B 1JWUD 4IALA 1L4DB 2JYOA 2KEEA 4C3JG 4ZLTF 3MVVA 3RD4A 1KAAA 2QSDA 2KA7A 2OF1A 1C77A 1MHXA 1NUCA 3BVMA 3TDQA 2RQXA 2F0DA 2LUMA 3KK7A 4BS9A 2VB2X 3GD7A 4UAIA 4WJWA 5A2QL 3HZXA 1YMHE 2K04A 4A3FB 3S9WA 3VYRA 1J9OA 1LV9A 2AUKA 1EL0A 2CJNA 1UWXA 4XDCA 3PO3B 1LTBD 2FMMA 1VMCA 1F2MA 5G3LD 3GO5A 4RKBA 1C4PA 2K5DA 4A6QA 5KGUA 1PRTC 2ID0A 2XVSA 2EJGC 3QWNA 4A8XC 3IFDA 1RFKA 1AW7A 3OWEB 1SEBD 5EQ0A 5C0XH 2H88B 3J80E 5C2TB 2EYOA 4RA8A 1Y56A 4B9XA 4R8IA 4OL7A 2KAJA 1AN8A 4C3HG 3HOUB 5EKIA 1U4RA 1DD2A 3K7AB 4LK1C 3D4RA 3AE6B 1EY6A 4TQUS 2JYEA 3IXSA 4ZK9B 1IBXB 3P4PB 1PFDA 1A3UA 2NUCA 2NTTA 2VXWA 2L52A 2JX5A 2F0PA 2WXFA 4ILWA 4U68A 4BBSB 2F0EA 1K52A 5HG2A 1CQFA 2JQRB 1TJEA 1HFGA 4DN4M 2RDHA 4IFDH 1PTOC 3OIQA 2PTLA 5HFYA 3AE3B 5LL6S 2PZUA 3MXPA 1WTQA 1MPEA 1EYCA 4RHSA 1VDZA 2BB5A 5EPKA 1TKWB 1I4PA 2BT6A 4IN3A 4EVOA 2ZW1A 2EYHA 1N62A 3W3AA 1WTRA 1UNSA 1MBYA 1EY8A 2WDRB 1NR2A 4TMAB 1QF6A 4AYBB 3WDNA 1U9RA 3KLSA 1HA5A 1YJJA 1IKMA 1ZPSA 1F9PA 4LAAA 2JXTA 1C79A 3OOCA 1CZPA 1V97A 4D2KA 2J52A 3ZJUA 3W5VB 3HUIA 2N9KA 5NUCA 3NP8A 3PUXA 1ZOYB 4OHJA 3K5LA 3O13A 2K5PA 4OVZA 1BDOA 2K32A 4KY5A 4FNFA 1D5ZC 2KHSA 3AB9A 1WCMB 4HSVA 3PIP3 3TP8A 4H44C 4JWUC 3JAME 1N5XA 2BW2A 2WP8J 3OPOA 3R8BA 1PFMA 3S14B 2PZWA 2F0KA 3S1QB 2EE1A 4NKLA 1ENCA 3OW7A 4KN7C 4LLGM 3HRZC 5JJZA 2K1BA 5C3WA 4NDXA 1WD0A 3SK4A 1GUTA 2A69C 5COYA 3NWSA 3I9V1 4FVMA 2C9OA 4A3KB 3PUZA 2F1MA 4ITKA 4C1NK 1Y69U 4LTUA 3DM1A 1O78A 3KBXA 2EVBA 3MP9A 2K33A 5C5LA 1K53A 1AP0A 2INPE 4N9PA 4RCOA 2Q8TA 2IW3A 5BYRA 3SXHA 1DOKA 1QKZA 2PVOD 4KK7A 2CW0C 1N60A 3FDTA 1DONA 1E6EB 1JWBD 1D4BA 2N55A 3CU7A 2I46A 1Y1VB 1SXTA 5FOBB 4JPSA 2F0HA 2IGDA 1PGBA 3NSWA 4ZRQA 1SYFA 3BIID 2EKIA 1E9MA 1II3A 1JOOA 3GS2A 3MZ5A 2XRQD 5C0XJ 1SJED 2B2YC 1MGSA 1ZYRD 2PQEA 2NB0A 4DA2A 4ME5A 3H09A 1KH0A 5JEAJ 1GUNA 1YNNC 2B2VA 2E2JB 3GP7A 1DYQA 1B2TA 2EY2A 2HTME 1WTVA 3BS1A 2L0CA 4BBRB 1VDVA 3J7AV 3NTHA 1EWHA 2O2LD 3OWFA 2EJMA 3A56A 5DNFA 1LTAD 1MD2D 2NVYB 1DOIA 3CHBD 5T1IA 2PMVA 4MHEA 3SHLA 3T3OA 2QJLA 2DBYA 1O7LA 3LWUA 3SE0A 4ZUJA 1WTWA 3CQZB 2M2LA 5C4ZA 4GDLB 1TU2B 5JEAH 4PNYA 3WOFA 2JYTA 4DK1A 5DAUA 1BCPB 1ZE3D 2V4IB 3M7GA 1FIQA 2DY7A 1VF5C 3K57A 1OXXK 3F2UA 4QCLA 1LT4D 2QEJC 2EXZA 4OZBA 2E76C 3NWTA 1PTOH 3MC0B 4IFDG 2NN6H 1SE4A 1CZWA 5BN5A 2OHFA 2DNEA 4RNAA 3ND9A 4ZYSA 2B39A 4FXDA 3NVZA 3AEEB 5G5HA 1TWHB 1GUWA 1HUNA 4DAYA 1CA6A 1XEEA 3P75A 4FF4A 3M4YA 2VUMB 1G291 4A3GB 4CHTB 2A74C 4KY6A 2K7VA 2ICIA 1RD9D 1GPXA 3ETRA 4DNTB 3KLSX 1SSOA 2BOSA 3BDCA 1SBBB 2HUGA 3AV8A 5CV8A 1DOXA 5CYUA 5BN3A 5KEEA 1FRDA 1WXQA 5E4WC 2J7ZA 4PMWA 4DGZA 4IKGA 2MUYA 5EKKA 3J81L 3P7JA 5M5YB 1WRIA 2KN4A 2JA7B 4QIWB 2EY5A 3PV0A 3VR2A 3TEZA 2WXPA 3K0YA 4G4KA 4I65A 5I2YA 3MAQA 4ZUIA 1QG7A 2EELA 2XIWA 1KFYB 4PMCA 1QLBB 1U4LA 3SFEB 2WXMA 1QT9A 2L32A 3PUWA 3AE8B 1LLRD 1I6HB 4ZRZA 1IW7D 1RF2D 1IUEA 4C2MB 4K6DA 5IODA 3GTPB 2WP9B 1CHPD 3IT4B 4KKSA 1JICA 3VR5A