3R2OA

1.95 a resolution structure of as-isolated ftna from pseudomonas aeruginosa (ph 6.0)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
154
structure length
154
Chain Sequence
MQGHPEVIDYLNTLLTGELAARDQYFIHSRMYEDWGFSKLYERLNHEMEEETQHADALLRRILLLEGTPRMRPDDIHPGTTVPEMLEADLKLERHVRAALAKGIALCEQHKDFVSRDILKAQLADTEEDHAYWLEQQLGLIARMGLENYLQSQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterioferritin
publication title Two distinct ferritin-like molecules in Pseudomonas aeruginosa: the product of the bfrA gene is a bacterial ferritin (FtnA) and not a bacterioferritin (Bfr).
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Metal binding protein
total genus 74
structure length 154
sequence length 154
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2011-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3r2oA00
3Q4QA 1O9RA 3F38A 1NF6A 2IU2A 2XGWA 3F33A 1JI4A 5IX6A 1RCEA 1LKOA 4ISMA 4Y08A 5D8XA 1BG7A 3IS7A 3KA4A 5LG2A 3R2HA 4CVTA 1ZS3A 1B71A 1J30A 1QYBA 3BT5A 4XKUA 2FZFA 3UOIA 3ES3A 1Z4AA 3PW1A 5GU2X 3AF9X 3F32A 2GYDA 2ZA8A 4TOHA 5D8SA 5I4JA 1LKPA 1O9IA 2JD70 4TW3A 2Z6MA 1BFRA 4U3GA 5JACA 3AJOA 5FFBA 2ITBA 1NFVA 3R2MA 2OH3A 4PG0A 3H7GA 5ERJA 2V2SA 4RC6A 1VEIA 2VXIA 4CY9A 3BVEA 2V2MA 1R03A 4CMYV 2FG4A 2XJNA 3PWQA 2FKZA 4TO9A 5HJFA 1TKOA 3PVTB 4RC5B 4LPJA 4AM4A 2Z5PA 1TK6A 1VLGA 2WLAA 5LS9A 5GN8A 2OC5A 2C6RA 2CHIA 4CVSA 3UOFA 4REUA 4MN9A 2D5KA 3E6SA 3UNOA 5GU0X 1MFRA 4TOFA 4II4A 3PWQC 3SHXA 4DASA 2QQYA 4CYBA 5FFDA 3KWOA 5JKLG 2ZG7X 4TOBA 2VZBA 4EVCA 4ZMCA 3A9QA 3PVYA 5GU1X 2V2NA 3Q4RA 1EUMA 1YUZA 5D8QA 4ZTTA 2QF9A 3R2RA 3EZUA 2GYQA 4LQJA 5JKMG 4CVRA 5J93A 2FFXJ 1VEQA 5J9VA 3F36A 3PVRB 3KXUA 4AM2A 1IERA 4TOAA 1JKUA 3O7RA 4RC8A 2FHAA 1JGCA 1QGHA 3ISFA 5ERKA 1H96A 2FJCA 4ZKXA 4ZJKA 3AJQA 1RCDA 2C2FA 4M32A 3SIDA 1DATA 4ETRA 2C2JA 4ZKWA 1RCIA 3QVDA 3SH6A 3QHBA 4ZKHA 2CN6A 2ZG8X 3WVVA 5D8OA 1MOJA 3AJPA 4P18A 4DYUA 4KVRA 3WVUA 1JKVA 4R42A 2Z5RA 5HQOA 3RBCA 1RCGA 1DVBA 4M33A 1NF4A 5D8RA 3HL1A 4LYUA 4DYXA 2V2OA 4LPMA 5C6FA 2G4HA 3FVBA 1L8IA 2HR5A 1VELA 5FFCA 5HJHA 4CMYA 5GOUA 4MY7A 4ITTA 3PW1B 1JYBA 3PVTA 4ZLWA 4MJYA 4QUWA 4DZ0A 4DYYA 3QZ3A 5CMQA 1OTKA 1YV1A 2V2IA 3E1OA 3AF7X 3F37A 2JD80 1LB3A 2BK6A 2FL0A 4ISPA 3AF8X 3RD0A 3ERZA 4PGIA 1L8HA 3PZAA 1JTSA 3SE1A 3E2CA 1FHAA 4DYZA 4EVEA 4RC6B 3VNXA 3EZ0A 5E2DA 5LG8A 2YJJA 1RYTA 1TJOA 1Z6OA 3PWFA 2YW7A 4IWJA 2BW1A 2CF7A 4RC7B 5K52A 3FI6A 4ZL6A 3HIUA 5AXSA 4TODA 5FFAA 5GN8B 1DPSA 3F35A 2CLBA 5D8PA 1AEWA 4YKHA 5J8SA 5GU3X 1JREA 3E1NA 1N1QA 2ZA6A 4LQVA 2V15A 5E1UA 4CYAA 4II4B 2V2JA 1S3QA 4EVDA 3R2SA 1UMNA 4KVQA 1KRQA 3IQ1A 3RGDA 5CZUA 3OGHA 3NP0X 2WTLA 5FFEA 2V2RA 3PVYB 3AK8A 2UX1A 1LKMA 4MKUA 1BCFA 2ZURX 3QB9A 5J8WA 4ERUA 3BVFA 1F33A 1UVHA 2CEIA 1SOFA 3BVIA 1Z6OM 4KVSA 4PGKA 4IWKA 3O7SA 2V2PA 2HTNA 3MPSA 4Z3BA 3WNWA 2GS4A 1VJXA 3AK9A 3F34A 4CVPA 1XZ3A 2PYBA 3R2OA 5LBHA 4LQHA 1F30A 1JIGA 1HRSA 3IS8A 2CHPA 2IY4A 1RCCA 4A25A 5K53A 1XZ1A 5CMRA 2FG8A 2BJYA 4LYXA 3BVKA 4M34A 2VXXA 2XJMA 5FEJA 3BVLA 1ZUJA 4EVBA 1GWGA 2RBDA 3BKNA 3R2LA 3KA6A 3U90A 1IESA 4RC5A 2XKQA 4LPNA 4M35A 2F7NA 1NNQA 4PG1A 4TOGA 3ISEA 2YJKA 1TKPA 3T9JA 2CLUA 2JD60 1SQ3A 3KA8A 4ITWA 3QHCA 3FSEA 3E1MA 2V2LA 2CN7A 4XKTA 5JKLA 4TOEA 2CIHA 3EGMA 4IXKA 3E1QA 4OYNA 4RC7A 2X170 2XJOA 1S2ZA 3QD8A 3NP2X 3RAVA 4LQNA 1JI5A 3Q4NA 3Q4OA 3TA8A 4DE6A 2Z5QA 2ZG9X 3R2KA 4ZL5A 5JKMA 2WLUA 2C2UA 3E1PA 3KX9A 3A68A 4XKSA 4E6KA 3E6RA 3PVRA 2BKCA 3F39A 2C41A 4MUDA 3NOZX 4XGSA 3PW8A 2ZA7A 2YW6A 3GHQA 3KA9A 3WVWA 2IB0A 3GVYA 3E1JA 1S30A 3RE7A 3OJ5A 2W0OA 3GE4A 2Y3QA 4TOCA 1YUXA 5D8YA 4ML5A 3E1LA 3PW8C 4DI0A 2Z90A 4Z5SA 3KA3A 4AM5A
chains in the Genus database with same CATH superfamily
3Q4QA 3C1ZA 1O9RA 3F38A 1NF6A 2IU2A 2XGWA 3F33A 2V8TA 1JI4A 5IX6A 1RCEA 1LKOA 4ISMA 4Y08A 5D8XA 3C21A 1BG7A 3IS7A 3KA4A 5LG2A 3R2HA 4CVTA 1ZS3A 1B71A 1J30A 1QYBA 3BT5A 4XKUA 2FZFA 3UOIA 3ES3A 1Z4AA 3PW1A 5GU2X 3AF9X 3F32A 3LKDA 2GYDA 3DBYA 3JZ9A 4W4LB 2ZA8A 3L0MA 4TOHA 5D8SA 5I4JA 1LKPA 1O9IA 2JD70 4YXMA 4TW3A 2Z6MA 1BFRA 4U3GA 5JACA 3AJOA 5FFBA 2ITBA 1NFVA 3R2MA 2OH3A 4PG0A 3H7GA 5ERJA 2V2SA 4RC6A 1VEIA 2VXIA 4CY9A 3BVEA 2V2MA 1R03A 4CMYV 2FG4A 2XJNA 3PWQA 2FKZA 4TO9A 5HJFA 1TKOA 3PVTB 4RC5B 4LPJA 4AM4A 2Z5PA 1TK6A 1VLGA 2WLAA 5LS9A 5GN8A 2OC5A 2C6RA 2CHIA 4CVSA 3UOFA 4REUA 4MN9A 2D5KA 3E6SA 3UNOA 5GU0X 1MFRA 4TOFA 4II4A 3PWQC 3SHXA 4W4KB 4DASA 2QQYA 4CYBA 5FFDA 3KWOA 5JKLG 2ZG7X 4TOBA 2VZBA 4E40A 4EVCA 4ZMCA 3A9QA 3PVYA 2AR0A 5GU1X 3GGZA 2V2NA 3Q4RA 1EUMA 1YUZA 3C23A 5D8QA 4ZTTA 2QF9A 3R2RA 3EZUA 2GYQA 4LQJA 5JKMG 4CVRA 5J93A 2FFXJ 1VEQA 5J9VA 3F36A 3PVRB 3KXUA 4AM2A 1IERA 4TOAA 1JKUA 3O7RA 4RC8A 2FHAA 1JGCA 1QGHA 3ISFA 5ERKA 1H96A 2FJCA 4ZKXA 4ZJKA 3AJQA 1RCDA 2C2FA 4M32A 3GGYA 3SIDA 3D19A 1DATA 4ETRA 2C2JA 4ZKWA 1RCIA 3QVDA 3SH6A 3QHBA 4ZKHA 2CN6A 2ZG8X 3WVVA 5D8OA 1MOJA 3AJPA 4P18A 3M6JA 4DYUA 4KVRA 3WVUA 1JKVA 4R42A 2Z5RA 5HQOA 3RBCA 1RCGA 1DVBA 4M33A 1NF4A 5D8RA 3HL1A 4LYUA 4DYXA 2V2OA 4LPMA 5C6FA 2G4HA 3FVBA 1L8IA 2HR5A 3KDQA 1VELA 5FFCA 5HJHA 4CMYA 5GOUA 4MY7A 4ITTA 3PW1B 1JYBA 3PVTA 4ZLWA 4MJYA 3FRRA 3VV9A 3JZAB 4QUWA 4DZ0A 3UFBA 4DYYA 3QZ3A 5CMQA 1OTKA 1YV1A 2V2IA 3E1OA 3AF7X 3F37A 2JD80 1LB3A 2BK6A 2FL0A 4ISPA 3AF8X 3RD0A 3ERZA 4PGIA 1L8HA 3PZAA 1JTSA 3SE1A 3E2CA 1FHAA 4DYZA 4EVEA 4RC6B 3VNXA 3EZ0A 5E2DA 5LG8A 2YJJA 1RYTA 1TJOA 1Z6OA 3KHKA 3PWFA 2YW7A 4IWJA 2BW1A 2CF7A 4RC7B 5K52A 3FI6A 4ZL6A 3HIUA 3V3KB 5JDOB 5AXSA 4TODA 5FFAA 5GN8B 1DPSA 3F35A 2CLBA 5D8PA 1AEWA 4YKHA 5J8SA 5GU3X 4YXJA 1JREA 3E1NA 1N1QA 2ZA6A 4LQVA 2V15A 5E1UA 4CYAA 4II4B 2V2JA 1S3QA 4EVDA 3R2SA 1UMNA 4KVQA 1KRQA 3IQ1A 3RGDA 5CZUA 3OGHA 3NP0X 4WJG4 2WTLA 5FFEA 2V2RA 3PVYB 3AK8A 2UX1A 1LKMA 4MKUA 1BCFA 2ZURX 3QB9A 5J8WA 4ERUA 3BVFA 1F33A 1UVHA 2CEIA 1SOFA 3BVIA 4X0JA 1Z6OM 2CWLA 4KVSA 4PGKA 4IWKA 3O7SA 4MXPA 2V2PA 2HTNA 3MPSA 4Z3BA 4YVZA 3WNWA 2GS4A 1VJXA 3AK9A 3F34A 4CVPA 1XZ3A 2PYBA 3R2OA 5LBHA 4LQHA 1F30A 3VVAA 1JIGA 1HRSA 3IS8A 2CHPA 2IY4A 1RCCA 2Y44A 4A25A 5K53A 1XZ1A 5CMRA 2G38B 2FG8A 2BJYA 4LYXA 3BVKA 4M34A 3FRSA 2VXXA 2XJMA 5FEJA 3BVLA 1ZUJA 4EVBA 1GWGA 2RBDA 3BKNA 3R2LA 3KA6A 3U90A 3W54A 1IESA 4RC5A 2XKQA 4LPNA 4M35A 2F7NA 1NNQA 4PG1A 4TOGA 3ISEA 2YJKA 1TKPA 3T9JA 2CLUA 2JD60 1SQ3A 3KA8A 4ITWA 3QHCA 3FSEA 3E1MA 2V2LA 2CN7A 4XKTA 5JKLA 4TOEA 2CIHA 3EGMA 4IXKA 3E1QA 4OYNA 3N6OA 4RC7A 2X170 2XJOA 1S2ZA 3QD8A 2OKCA 3NP2X 5JDOA 4KXRB 3RAVA 4LQNA 1JI5A 3Q4NA 2WWXB 3Q4OA 3TA8A 4DE6A 2Z5QA 2ZG9X 3R2KA 4ZL5A 5JKMA 2WLUA 2C2UA 3E1PA 3KX9A 5HU6D 3A68A 4XKSA 4E6KA 3E6RA 3PVRA 2BKCA 3F39A 2C41A 4MUDA 3NOZX 4XGSA 3PW8A 2ZA7A 2YW6A 3GHQA 3KA9A 2V8UA 3WVWA 2IB0A 3GVYA 3E1JA 1S30A 3RE7A 3OJ5A 2W0OA 3GE4A 2MGYA 2N02A 2Y3QA 3C1YA 4TOCA 1YUXA 5D8YA 4ML5A 3E1LA 3PW8C 4DI0A 2Z90A 4Z5SA 3KA3A 4AM5A
chains in the Genus database with same CATH topology
3Q4QA 3C1ZA 1O9RA 3F38A 1NF6A 2IU2A 2XGWA 3F33A 2V8TA 1JI4A 5IX6A 1RCEA 1LKOA 4ISMA 4Y08A 5D8XA 3C21A 1BG7A 3IS7A 3KA4A 5LG2A 3R2HA 4CVTA 1ZS3A 1B71A 1J30A 1QYBA 3BT5A 4XKUA 2FZFA 3UOIA 3ES3A 1Z4AA 3PW1A 5GU2X 3AF9X 3F32A 3LKDA 2GYDA 3DBYA 3JZ9A 4W4LB 2ZA8A 3L0MA 4TOHA 5D8SA 5I4JA 1LKPA 1O9IA 2JD70 4YXMA 4TW3A 2Z6MA 1BFRA 4U3GA 5JACA 3AJOA 5FFBA 2ITBA 1NFVA 3R2MA 2OH3A 4PG0A 3H7GA 5ERJA 2V2SA 4RC6A 1VEIA 2VXIA 4CY9A 3BVEA 2V2MA 1R03A 4CMYV 2FG4A 2XJNA 3PWQA 2FKZA 4TO9A 5HJFA 1TKOA 3PVTB 4RC5B 4LPJA 4AM4A 2Z5PA 1TK6A 1VLGA 2WLAA 5LS9A 5GN8A 2OC5A 2C6RA 2CHIA 4CVSA 3UOFA 4REUA 4MN9A 2D5KA 3E6SA 3UNOA 5GU0X 1MFRA 4TOFA 4II4A 3PWQC 3SHXA 4W4KB 4DASA 2QQYA 4CYBA 5FFDA 3KWOA 5JKLG 2ZG7X 4TOBA 2VZBA 4E40A 4EVCA 4ZMCA 3A9QA 3PVYA 2AR0A 5GU1X 3GGZA 2V2NA 3Q4RA 1EUMA 1YUZA 3C23A 5D8QA 4ZTTA 2QF9A 3R2RA 3EZUA 2GYQA 4LQJA 5JKMG 4CVRA 5J93A 2FFXJ 1VEQA 5J9VA 3F36A 3PVRB 3KXUA 4AM2A 1IERA 4TOAA 1JKUA 3O7RA 4RC8A 2FHAA 1JGCA 1QGHA 3ISFA 5ERKA 1H96A 2FJCA 4ZKXA 4ZJKA 3AJQA 1RCDA 2C2FA 4M32A 3GGYA 3SIDA 3D19A 1DATA 4ETRA 2C2JA 4ZKWA 1RCIA 3QVDA 3SH6A 3QHBA 4ZKHA 2CN6A 2ZG8X 3WVVA 5D8OA 1MOJA 3AJPA 4P18A 3M6JA 4DYUA 4KVRA 3WVUA 1JKVA 4R42A 2Z5RA 5HQOA 3RBCA 1RCGA 1DVBA 4M33A 1NF4A 5D8RA 3HL1A 4LYUA 4DYXA 2V2OA 4LPMA 5C6FA 2G4HA 3FVBA 1L8IA 2HR5A 3KDQA 1VELA 5FFCA 5HJHA 4CMYA 5GOUA 4MY7A 4ITTA 3PW1B 1JYBA 3PVTA 4ZLWA 4MJYA 3FRRA 3VV9A 3JZAB 4QUWA 4DZ0A 3UFBA 4DYYA 3QZ3A 5CMQA 1OTKA 1YV1A 2V2IA 3E1OA 3AF7X 3F37A 2JD80 1LB3A 2BK6A 2FL0A 4ISPA 3AF8X 3RD0A 3ERZA 4PGIA 1L8HA 3PZAA 1JTSA 3SE1A 3E2CA 1FHAA 4DYZA 4EVEA 4RC6B 3VNXA 3EZ0A 5E2DA 5LG8A 2YJJA 1RYTA 1TJOA 1Z6OA 3KHKA 3PWFA 2YW7A 4IWJA 2BW1A 2CF7A 4RC7B 5K52A 3FI6A 4ZL6A 3HIUA 3V3KB 5JDOB 5AXSA 4TODA 5FFAA 5GN8B 1DPSA 3F35A 2CLBA 5D8PA 1AEWA 4YKHA 5J8SA 5GU3X 4YXJA 1JREA 3E1NA 1N1QA 2ZA6A 4LQVA 2V15A 5E1UA 4CYAA 4II4B 2V2JA 1S3QA 4EVDA 3R2SA 1UMNA 4KVQA 1KRQA 3IQ1A 3RGDA 5CZUA 3OGHA 3NP0X 4WJG4 2WTLA 5FFEA 2V2RA 3PVYB 3AK8A 2UX1A 1LKMA 4MKUA 1BCFA 2ZURX 3QB9A 5J8WA 4ERUA 3BVFA 1F33A 1UVHA 2CEIA 1SOFA 3BVIA 4X0JA 1Z6OM 2CWLA 4KVSA 4PGKA 4IWKA 3O7SA 4MXPA 2V2PA 2HTNA 3MPSA 4Z3BA 4YVZA 3WNWA 2GS4A 1VJXA 3AK9A 3F34A 4CVPA 1XZ3A 2PYBA 3R2OA 5LBHA 4LQHA 1F30A 3VVAA 1JIGA 1HRSA 3IS8A 2CHPA 2IY4A 1RCCA 2Y44A 4A25A 5K53A 1XZ1A 5CMRA 2G38B 2FG8A 2BJYA 4LYXA 3BVKA 4M34A 3FRSA 2VXXA 2XJMA 5FEJA 3BVLA 1ZUJA 4EVBA 1GWGA 2RBDA 3BKNA 3R2LA 3KA6A 3U90A 3W54A 1IESA 4RC5A 2XKQA 4LPNA 4M35A 2F7NA 1NNQA 4PG1A 4TOGA 3ISEA 2YJKA 1TKPA 3T9JA 2CLUA 2JD60 1SQ3A 3KA8A 4ITWA 3QHCA 3FSEA 3E1MA 2V2LA 2CN7A 4XKTA 5JKLA 4TOEA 2CIHA 3EGMA 4IXKA 3E1QA 4OYNA 3N6OA 4RC7A 2X170 2XJOA 1S2ZA 3QD8A 2OKCA 3NP2X 5JDOA 4KXRB 3RAVA 4LQNA 1JI5A 3Q4NA 2WWXB 3Q4OA 3TA8A 4DE6A 2Z5QA 2ZG9X 3R2KA 4ZL5A 5JKMA 2WLUA 2C2UA 3E1PA 3KX9A 5HU6D 3A68A 4XKSA 4E6KA 3E6RA 3PVRA 2BKCA 3F39A 2C41A 4MUDA 3NOZX 4XGSA 3PW8A 2ZA7A 2YW6A 3GHQA 3KA9A 2V8UA 3WVWA 2IB0A 3GVYA 3E1JA 1S30A 3RE7A 3OJ5A 2W0OA 3GE4A 2MGYA 2N02A 2Y3QA 3C1YA 4TOCA 1YUXA 5D8YA 4ML5A 3E1LA 3PW8C 4DI0A 2Z90A 4Z5SA 3KA3A 4AM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q4Q A;  1O9R A;  3F38 A;  1NF6 A;  2IU2 A;  2XGW A;  3F33 A;  1JI4 A;  5IX6 A;  1RCE A;  1LKO A;  4ISM A;  4Y08 A;  5D8X A;  1BG7 A;  3IS7 A;  3KA4 A;  5LG2 A;  3R2H A;  4CVT A;  1ZS3 A;  1B71 A;  1J30 A;  1QYB A;  3BT5 A;  4XKU A;  2FZF A;  3UOI A;  3ES3 A;  1Z4A A;  3PW1 A;  5GU2 X;  3AF9 X;  3F32 A;  2GYD A;  2ZA8 A;  4TOH A;  5D8S A;  5I4J A;  1LKP A;  1O9I A;  2JD7 0;  4TW3 A;  2Z6M A;  1BFR A;  4U3G A;  5JAC A;  3AJO A;  5FFB A;  2ITB A;  1NFV A;  3R2M A;  2OH3 A;  4PG0 A;  3H7G A;  5ERJ A;  2V2S A;  4RC6 A;  1VEI A;  2VXI A;  4CY9 A;  3BVE A;  2V2M A;  1R03 A;  4CMY V;  2FG4 A;  2XJN A;  3PWQ A;  2FKZ A;  4TO9 A;  5HJF A;  1TKO A;  3PVT B;  4RC5 B;  4LPJ A;  4AM4 A;  2Z5P A;  1TK6 A;  1VLG A;  2WLA A;  5LS9 A;  5GN8 A;  2OC5 A;  2C6R A;  2CHI A;  4CVS A;  3UOF A;  4REU A;  4MN9 A;  2D5K A;  3E6S A;  3UNO A;  5GU0 X;  1MFR A;  4TOF A;  4II4 A;  3PWQ C;  3SHX A;  4DAS A;  2QQY A;  4CYB A;  5FFD A;  3KWO A;  5JKL G;  2ZG7 X;  4TOB A;  2VZB A;  4EVC A;  4ZMC A;  3A9Q A;  3PVY A;  5GU1 X;  2V2N A;  3Q4R A;  1EUM A;  1YUZ A;  5D8Q A;  4ZTT A;  2QF9 A;  3R2R A;  3EZU A;  2GYQ A;  4LQJ A;  5JKM G;  4CVR A;  5J93 A;  2FFX J;  1VEQ A;  5J9V A;  3F36 A;  3PVR B;  3KXU A;  4AM2 A;  1IER A;  4TOA A;  1JKU A;  3O7R A;  4RC8 A;  2FHA A;  1JGC A;  1QGH A;  3ISF A;  5ERK A;  1H96 A;  2FJC A;  4ZKX A;  4ZJK A;  3AJQ A;  1RCD A;  2C2F A;  4M32 A;  3SID A;  1DAT A;  4ETR A;  2C2J A;  4ZKW A;  1RCI A;  3QVD A;  3SH6 A;  3QHB A;  4ZKH A;  2CN6 A;  2ZG8 X;  3WVV A;  5D8O A;  1MOJ A;  3AJP A;  4P18 A;  4DYU A;  4KVR A;  3WVU A;  1JKV A;  4R42 A;  2Z5R A;  5HQO A;  3RBC A;  1RCG A;  1DVB A;  4M33 A;  1NF4 A;  5D8R A;  3HL1 A;  4LYU A;  4DYX A;  2V2O A;  4LPM A;  5C6F A;  2G4H A;  3FVB A;  1L8I A;  2HR5 A;  1VEL A;  5FFC A;  5HJH A;  4CMY A;  5GOU A;  4MY7 A;  4ITT A;  3PW1 B;  1JYB A;  3PVT A;  4ZLW A;  4MJY A;  4QUW A;  4DZ0 A;  4DYY A;  3QZ3 A;  5CMQ A;  1OTK A;  1YV1 A;  2V2I A;  3E1O A;  3AF7 X;  3F37 A;  2JD8 0;  1LB3 A;  2BK6 A;  2FL0 A;  4ISP A;  3AF8 X;  3RD0 A;  3ERZ A;  4PGI A;  1L8H A;  3PZA A;  1JTS A;  3SE1 A;  3E2C A;  1FHA A;  4DYZ A;  4EVE A;  4RC6 B;  3VNX A;  3EZ0 A;  5E2D A;  5LG8 A;  2YJJ A;  1RYT A;  1TJO A;  1Z6O A;  3PWF A;  2YW7 A;  4IWJ A;  2BW1 A;  2CF7 A;  4RC7 B;  5K52 A;  3FI6 A;  4ZL6 A;  3HIU A;  5AXS A;  4TOD A;  5FFA A;  5GN8 B;  1DPS A;  3F35 A;  2CLB A;  5D8P A;  1AEW A;  4YKH A;  5J8S A;  5GU3 X;  1JRE A;  3E1N A;  1N1Q A;  2ZA6 A;  4LQV A;  2V15 A;  5E1U A;  4CYA A;  4II4 B;  2V2J A;  1S3Q A;  4EVD A;  3R2S A;  1UMN A;  4KVQ A;  1KRQ A;  3IQ1 A;  3RGD A;  5CZU A;  3OGH A;  3NP0 X;  2WTL A;  5FFE A;  2V2R A;  3PVY B;  3AK8 A;  2UX1 A;  1LKM A;  4MKU A;  1BCF A;  2ZUR X;  3QB9 A;  5J8W A;  4ERU A;  3BVF A;  1F33 A;  1UVH A;  2CEI A;  1SOF A;  3BVI A;  1Z6O M;  4KVS A;  4PGK A;  4IWK A;  3O7S A;  2V2P A;  2HTN A;  3MPS A;  4Z3B A;  3WNW A;  2GS4 A;  1VJX A;  3AK9 A;  3F34 A;  4CVP A;  1XZ3 A;  2PYB A;  3R2O A;  5LBH A;  4LQH A;  1F30 A;  1JIG A;  1HRS A;  3IS8 A;  2CHP A;  2IY4 A;  1RCC A;  4A25 A;  5K53 A;  1XZ1 A;  5CMR A;  2FG8 A;  2BJY A;  4LYX A;  3BVK A;  4M34 A;  2VXX A;  2XJM A;  5FEJ A;  3BVL A;  1ZUJ A;  4EVB A;  1GWG A;  2RBD A;  3BKN A;  3R2L A;  3KA6 A;  3U90 A;  1IES A;  4RC5 A;  2XKQ A;  4LPN A;  4M35 A;  2F7N A;  1NNQ A;  4PG1 A;  4TOG A;  3ISE A;  2YJK A;  1TKP A;  3T9J A;  2CLU A;  2JD6 0;  1SQ3 A;  3KA8 A;  4ITW A;  3QHC A;  3FSE A;  3E1M A;  2V2L A;  2CN7 A;  4XKT A;  5JKL A;  4TOE A;  2CIH A;  3EGM A;  4IXK A;  3E1Q A;  4OYN A;  4RC7 A;  2X17 0;  2XJO A;  1S2Z A;  3QD8 A;  3NP2 X;  3RAV A;  4LQN A;  1JI5 A;  3Q4N A;  3Q4O A;  3TA8 A;  4DE6 A;  2Z5Q A;  2ZG9 X;  3R2K A;  4ZL5 A;  5JKM A;  2WLU A;  2C2U A;  3E1P A;  3KX9 A;  3A68 A;  4XKS A;  4E6K A;  3E6R A;  3PVR A;  2BKC A;  3F39 A;  2C41 A;  4MUD A;  3NOZ X;  4XGS A;  3PW8 A;  2ZA7 A;  2YW6 A;  3GHQ A;  3KA9 A;  3WVW A;  2IB0 A;  3GVY A;  3E1J A;  1S30 A;  3RE7 A;  3OJ5 A;  2W0O A;  3GE4 A;  2Y3Q A;  4TOC A;  1YUX A;  5D8Y A;  4ML5 A;  3E1L A;  3PW8 C;  4DI0 A;  2Z90 A;  4Z5S A;  3KA3 A;  4AM5 A; 
#chains in the Genus database with same CATH topology
 3Q4Q A;  3C1Z A;  1O9R A;  3F38 A;  1NF6 A;  2IU2 A;  2XGW A;  3F33 A;  2V8T A;  1JI4 A;  5IX6 A;  1RCE A;  1LKO A;  4ISM A;  4Y08 A;  5D8X A;  3C21 A;  1BG7 A;  3IS7 A;  3KA4 A;  5LG2 A;  3R2H A;  4CVT A;  1ZS3 A;  1B71 A;  1J30 A;  1QYB A;  3BT5 A;  4XKU A;  2FZF A;  3UOI A;  3ES3 A;  1Z4A A;  3PW1 A;  5GU2 X;  3AF9 X;  3F32 A;  3LKD A;  2GYD A;  3DBY A;  3JZ9 A;  4W4L B;  2ZA8 A;  3L0M A;  4TOH A;  5D8S A;  5I4J A;  1LKP A;  1O9I A;  2JD7 0;  4YXM A;  4TW3 A;  2Z6M A;  1BFR A;  4U3G A;  5JAC A;  3AJO A;  5FFB A;  2ITB A;  1NFV A;  3R2M A;  2OH3 A;  4PG0 A;  3H7G A;  5ERJ A;  2V2S A;  4RC6 A;  1VEI A;  2VXI A;  4CY9 A;  3BVE A;  2V2M A;  1R03 A;  4CMY V;  2FG4 A;  2XJN A;  3PWQ A;  2FKZ A;  4TO9 A;  5HJF A;  1TKO A;  3PVT B;  4RC5 B;  4LPJ A;  4AM4 A;  2Z5P A;  1TK6 A;  1VLG A;  2WLA A;  5LS9 A;  5GN8 A;  2OC5 A;  2C6R A;  2CHI A;  4CVS A;  3UOF A;  4REU A;  4MN9 A;  2D5K A;  3E6S A;  3UNO A;  5GU0 X;  1MFR A;  4TOF A;  4II4 A;  3PWQ C;  3SHX A;  4W4K B;  4DAS A;  2QQY A;  4CYB A;  5FFD A;  3KWO A;  5JKL G;  2ZG7 X;  4TOB A;  2VZB A;  4E40 A;  4EVC A;  4ZMC A;  3A9Q A;  3PVY A;  2AR0 A;  5GU1 X;  3GGZ A;  2V2N A;  3Q4R A;  1EUM A;  1YUZ A;  3C23 A;  5D8Q A;  4ZTT A;  2QF9 A;  3R2R A;  3EZU A;  2GYQ A;  4LQJ A;  5JKM G;  4CVR A;  5J93 A;  2FFX J;  1VEQ A;  5J9V A;  3F36 A;  3PVR B;  3KXU A;  4AM2 A;  1IER A;  4TOA A;  1JKU A;  3O7R A;  4RC8 A;  2FHA A;  1JGC A;  1QGH A;  3ISF A;  5ERK A;  1H96 A;  2FJC A;  4ZKX A;  4ZJK A;  3AJQ A;  1RCD A;  2C2F A;  4M32 A;  3GGY A;  3SID A;  3D19 A;  1DAT A;  4ETR A;  2C2J A;  4ZKW A;  1RCI A;  3QVD A;  3SH6 A;  3QHB A;  4ZKH A;  2CN6 A;  2ZG8 X;  3WVV A;  5D8O A;  1MOJ A;  3AJP A;  4P18 A;  3M6J A;  4DYU A;  4KVR A;  3WVU A;  1JKV A;  4R42 A;  2Z5R A;  5HQO A;  3RBC A;  1RCG A;  1DVB A;  4M33 A;  1NF4 A;  5D8R A;  3HL1 A;  4LYU A;  4DYX A;  2V2O A;  4LPM A;  5C6F A;  2G4H A;  3FVB A;  1L8I A;  2HR5 A;  3KDQ A;  1VEL A;  5FFC A;  5HJH A;  4CMY A;  5GOU A;  4MY7 A;  4ITT A;  3PW1 B;  1JYB A;  3PVT A;  4ZLW A;  4MJY A;  3FRR A;  3VV9 A;  3JZA B;  4QUW A;  4DZ0 A;  3UFB A;  4DYY A;  3QZ3 A;  5CMQ A;  1OTK A;  1YV1 A;  2V2I A;  3E1O A;  3AF7 X;  3F37 A;  2JD8 0;  1LB3 A;  2BK6 A;  2FL0 A;  4ISP A;  3AF8 X;  3RD0 A;  3ERZ A;  4PGI A;  1L8H A;  3PZA A;  1JTS A;  3SE1 A;  3E2C A;  1FHA A;  4DYZ A;  4EVE A;  4RC6 B;  3VNX A;  3EZ0 A;  5E2D A;  5LG8 A;  2YJJ A;  1RYT A;  1TJO A;  1Z6O A;  3KHK A;  3PWF A;  2YW7 A;  4IWJ A;  2BW1 A;  2CF7 A;  4RC7 B;  5K52 A;  3FI6 A;  4ZL6 A;  3HIU A;  3V3K B;  5JDO B;  5AXS A;  4TOD A;  5FFA A;  5GN8 B;  1DPS A;  3F35 A;  2CLB A;  5D8P A;  1AEW A;  4YKH A;  5J8S A;  5GU3 X;  4YXJ A;  1JRE A;  3E1N A;  1N1Q A;  2ZA6 A;  4LQV A;  2V15 A;  5E1U A;  4CYA A;  4II4 B;  2V2J A;  1S3Q A;  4EVD A;  3R2S A;  1UMN A;  4KVQ A;  1KRQ A;  3IQ1 A;  3RGD A;  5CZU A;  3OGH A;  3NP0 X;  4WJG 4;  2WTL A;  5FFE A;  2V2R A;  3PVY B;  3AK8 A;  2UX1 A;  1LKM A;  4MKU A;  1BCF A;  2ZUR X;  3QB9 A;  5J8W A;  4ERU A;  3BVF A;  1F33 A;  1UVH A;  2CEI A;  1SOF A;  3BVI A;  4X0J A;  1Z6O M;  2CWL A;  4KVS A;  4PGK A;  4IWK A;  3O7S A;  4MXP A;  2V2P A;  2HTN A;  3MPS A;  4Z3B A;  4YVZ A;  3WNW A;  2GS4 A;  1VJX A;  3AK9 A;  3F34 A;  4CVP A;  1XZ3 A;  2PYB A;  3R2O A;  5LBH A;  4LQH A;  1F30 A;  3VVA A;  1JIG A;  1HRS A;  3IS8 A;  2CHP A;  2IY4 A;  1RCC A;  2Y44 A;  4A25 A;  5K53 A;  1XZ1 A;  5CMR A;  2G38 B;  2FG8 A;  2BJY A;  4LYX A;  3BVK A;  4M34 A;  3FRS A;  2VXX A;  2XJM A;  5FEJ A;  3BVL A;  1ZUJ A;  4EVB A;  1GWG A;  2RBD A;  3BKN A;  3R2L A;  3KA6 A;  3U90 A;  3W54 A;  1IES A;  4RC5 A;  2XKQ A;  4LPN A;  4M35 A;  2F7N A;  1NNQ A;  4PG1 A;  4TOG A;  3ISE A;  2YJK A;  1TKP A;  3T9J A;  2CLU A;  2JD6 0;  1SQ3 A;  3KA8 A;  4ITW A;  3QHC A;  3FSE A;  3E1M A;  2V2L A;  2CN7 A;  4XKT A;  5JKL A;  4TOE A;  2CIH A;  3EGM A;  4IXK A;  3E1Q A;  4OYN A;  3N6O A;  4RC7 A;  2X17 0;  2XJO A;  1S2Z A;  3QD8 A;  2OKC A;  3NP2 X;  5JDO A;  4KXR B;  3RAV A;  4LQN A;  1JI5 A;  3Q4N A;  2WWX B;  3Q4O A;  3TA8 A;  4DE6 A;  2Z5Q A;  2ZG9 X;  3R2K A;  4ZL5 A;  5JKM A;  2WLU A;  2C2U A;  3E1P A;  3KX9 A;  5HU6 D;  3A68 A;  4XKS A;  4E6K A;  3E6R A;  3PVR A;  2BKC A;  3F39 A;  2C41 A;  4MUD A;  3NOZ X;  4XGS A;  3PW8 A;  2ZA7 A;  2YW6 A;  3GHQ A;  3KA9 A;  2V8U A;  3WVW A;  2IB0 A;  3GVY A;  3E1J A;  1S30 A;  3RE7 A;  3OJ5 A;  2W0O A;  3GE4 A;  2MGY A;  2N02 A;  2Y3Q A;  3C1Y A;  4TOC A;  1YUX A;  5D8Y A;  4ML5 A;  3E1L A;  3PW8 C;  4DI0 A;  2Z90 A;  4Z5S A;  3KA3 A;  4AM5 A; 
#chains in the Genus database with same CATH homology
 3Q4Q A;  3C1Z A;  1O9R A;  3F38 A;  1NF6 A;  2IU2 A;  2XGW A;  3F33 A;  2V8T A;  1JI4 A;  5IX6 A;  1RCE A;  1LKO A;  4ISM A;  4Y08 A;  5D8X A;  3C21 A;  1BG7 A;  3IS7 A;  3KA4 A;  5LG2 A;  3R2H A;  4CVT A;  1ZS3 A;  1B71 A;  1J30 A;  1QYB A;  3BT5 A;  4XKU A;  2FZF A;  3UOI A;  3ES3 A;  1Z4A A;  3PW1 A;  5GU2 X;  3AF9 X;  3F32 A;  3LKD A;  2GYD A;  3DBY A;  3JZ9 A;  4W4L B;  2ZA8 A;  3L0M A;  4TOH A;  5D8S A;  5I4J A;  1LKP A;  1O9I A;  2JD7 0;  4YXM A;  4TW3 A;  2Z6M A;  1BFR A;  4U3G A;  5JAC A;  3AJO A;  5FFB A;  2ITB A;  1NFV A;  3R2M A;  2OH3 A;  4PG0 A;  3H7G A;  5ERJ A;  2V2S A;  4RC6 A;  1VEI A;  2VXI A;  4CY9 A;  3BVE A;  2V2M A;  1R03 A;  4CMY V;  2FG4 A;  2XJN A;  3PWQ A;  2FKZ A;  4TO9 A;  5HJF A;  1TKO A;  3PVT B;  4RC5 B;  4LPJ A;  4AM4 A;  2Z5P A;  1TK6 A;  1VLG A;  2WLA A;  5LS9 A;  5GN8 A;  2OC5 A;  2C6R A;  2CHI A;  4CVS A;  3UOF A;  4REU A;  4MN9 A;  2D5K A;  3E6S A;  3UNO A;  5GU0 X;  1MFR A;  4TOF A;  4II4 A;  3PWQ C;  3SHX A;  4W4K B;  4DAS A;  2QQY A;  4CYB A;  5FFD A;  3KWO A;  5JKL G;  2ZG7 X;  4TOB A;  2VZB A;  4E40 A;  4EVC A;  4ZMC A;  3A9Q A;  3PVY A;  2AR0 A;  5GU1 X;  3GGZ A;  2V2N A;  3Q4R A;  1EUM A;  1YUZ A;  3C23 A;  5D8Q A;  4ZTT A;  2QF9 A;  3R2R A;  3EZU A;  2GYQ A;  4LQJ A;  5JKM G;  4CVR A;  5J93 A;  2FFX J;  1VEQ A;  5J9V A;  3F36 A;  3PVR B;  3KXU A;  4AM2 A;  1IER A;  4TOA A;  1JKU A;  3O7R A;  4RC8 A;  2FHA A;  1JGC A;  1QGH A;  3ISF A;  5ERK A;  1H96 A;  2FJC A;  4ZKX A;  4ZJK A;  3AJQ A;  1RCD A;  2C2F A;  4M32 A;  3GGY A;  3SID A;  3D19 A;  1DAT A;  4ETR A;  2C2J A;  4ZKW A;  1RCI A;  3QVD A;  3SH6 A;  3QHB A;  4ZKH A;  2CN6 A;  2ZG8 X;  3WVV A;  5D8O A;  1MOJ A;  3AJP A;  4P18 A;  3M6J A;  4DYU A;  4KVR A;  3WVU A;  1JKV A;  4R42 A;  2Z5R A;  5HQO A;  3RBC A;  1RCG A;  1DVB A;  4M33 A;  1NF4 A;  5D8R A;  3HL1 A;  4LYU A;  4DYX A;  2V2O A;  4LPM A;  5C6F A;  2G4H A;  3FVB A;  1L8I A;  2HR5 A;  3KDQ A;  1VEL A;  5FFC A;  5HJH A;  4CMY A;  5GOU A;  4MY7 A;  4ITT A;  3PW1 B;  1JYB A;  3PVT A;  4ZLW A;  4MJY A;  3FRR A;  3VV9 A;  3JZA B;  4QUW A;  4DZ0 A;  3UFB A;  4DYY A;  3QZ3 A;  5CMQ A;  1OTK A;  1YV1 A;  2V2I A;  3E1O A;  3AF7 X;  3F37 A;  2JD8 0;  1LB3 A;  2BK6 A;  2FL0 A;  4ISP A;  3AF8 X;  3RD0 A;  3ERZ A;  4PGI A;  1L8H A;  3PZA A;  1JTS A;  3SE1 A;  3E2C A;  1FHA A;  4DYZ A;  4EVE A;  4RC6 B;  3VNX A;  3EZ0 A;  5E2D A;  5LG8 A;  2YJJ A;  1RYT A;  1TJO A;  1Z6O A;  3KHK A;  3PWF A;  2YW7 A;  4IWJ A;  2BW1 A;  2CF7 A;  4RC7 B;  5K52 A;  3FI6 A;  4ZL6 A;  3HIU A;  3V3K B;  5JDO B;  5AXS A;  4TOD A;  5FFA A;  5GN8 B;  1DPS A;  3F35 A;  2CLB A;  5D8P A;  1AEW A;  4YKH A;  5J8S A;  5GU3 X;  4YXJ A;  1JRE A;  3E1N A;  1N1Q A;  2ZA6 A;  4LQV A;  2V15 A;  5E1U A;  4CYA A;  4II4 B;  2V2J A;  1S3Q A;  4EVD A;  3R2S A;  1UMN A;  4KVQ A;  1KRQ A;  3IQ1 A;  3RGD A;  5CZU A;  3OGH A;  3NP0 X;  4WJG 4;  2WTL A;  5FFE A;  2V2R A;  3PVY B;  3AK8 A;  2UX1 A;  1LKM A;  4MKU A;  1BCF A;  2ZUR X;  3QB9 A;  5J8W A;  4ERU A;  3BVF A;  1F33 A;  1UVH A;  2CEI A;  1SOF A;  3BVI A;  4X0J A;  1Z6O M;  2CWL A;  4KVS A;  4PGK A;  4IWK A;  3O7S A;  4MXP A;  2V2P A;  2HTN A;  3MPS A;  4Z3B A;  4YVZ A;  3WNW A;  2GS4 A;  1VJX A;  3AK9 A;  3F34 A;  4CVP A;  1XZ3 A;  2PYB A;  3R2O A;  5LBH A;  4LQH A;  1F30 A;  3VVA A;  1JIG A;  1HRS A;  3IS8 A;  2CHP A;  2IY4 A;  1RCC A;  2Y44 A;  4A25 A;  5K53 A;  1XZ1 A;  5CMR A;  2G38 B;  2FG8 A;  2BJY A;  4LYX A;  3BVK A;  4M34 A;  3FRS A;  2VXX A;  2XJM A;  5FEJ A;  3BVL A;  1ZUJ A;  4EVB A;  1GWG A;  2RBD A;  3BKN A;  3R2L A;  3KA6 A;  3U90 A;  3W54 A;  1IES A;  4RC5 A;  2XKQ A;  4LPN A;  4M35 A;  2F7N A;  1NNQ A;  4PG1 A;  4TOG A;  3ISE A;  2YJK A;  1TKP A;  3T9J A;  2CLU A;  2JD6 0;  1SQ3 A;  3KA8 A;  4ITW A;  3QHC A;  3FSE A;  3E1M A;  2V2L A;  2CN7 A;  4XKT A;  5JKL A;  4TOE A;  2CIH A;  3EGM A;  4IXK A;  3E1Q A;  4OYN A;  3N6O A;  4RC7 A;  2X17 0;  2XJO A;  1S2Z A;  3QD8 A;  2OKC A;  3NP2 X;  5JDO A;  4KXR B;  3RAV A;  4LQN A;  1JI5 A;  3Q4N A;  2WWX B;  3Q4O A;  3TA8 A;  4DE6 A;  2Z5Q A;  2ZG9 X;  3R2K A;  4ZL5 A;  5JKM A;  2WLU A;  2C2U A;  3E1P A;  3KX9 A;  5HU6 D;  3A68 A;  4XKS A;  4E6K A;  3E6R A;  3PVR A;  2BKC A;  3F39 A;  2C41 A;  4MUD A;  3NOZ X;  4XGS A;  3PW8 A;  2ZA7 A;  2YW6 A;  3GHQ A;  3KA9 A;  2V8U A;  3WVW A;  2IB0 A;  3GVY A;  3E1J A;  1S30 A;  3RE7 A;  3OJ5 A;  2W0O A;  3GE4 A;  2MGY A;  2N02 A;  2Y3Q A;  3C1Y A;  4TOC A;  1YUX A;  5D8Y A;  4ML5 A;  3E1L A;  3PW8 C;  4DI0 A;  2Z90 A;  4Z5S A;  3KA3 A;  4AM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...