3R2SA

2.1a resolution structure of doubly soaked ftna from pseudomonas aeruginosa (ph 6.0)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
154
structure length
154
Chain Sequence
MQGHPEVIDYLNTLLTGELAARDQYFIHSRMYEDWGFSKLYERLNHEMEEETQHADALLRRILLLEGTPRMRPDDIHPGTTVPEMLEADLKLERHVRAALAKGIALCEQHKDFVSRDILKAQLADTEEDHAYWLEQQLGLIARMGLENYLQSQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterioferritin
publication title Two distinct ferritin-like molecules in Pseudomonas aeruginosa: the product of the bfrA gene is a bacterial ferritin (FtnA) and not a bacterioferritin (Bfr).
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Metal binding protein
total genus 77
structure length 154
sequence length 154
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2011-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3r2sA00
3E6RA 4XGSA 4EVCA 3AF7X 3F36A 3O7RA 3PW1A 3KWOA 3EZUA 1LKPA 2C2JA 4MY7A 2HR5A 4CVSA 2VXIA 3KA9A 2FKZA 1OTKA 3AK9A 2Z5QA 4ITTA 3RAVA 5FFCA 2V2IA 3GE4A 4PGKA 3U90A 2FZFA 5FFEA 1TJOA 1TK6A 2Z6MA 4IWKA 4TOAA 1QGHA 3A9QA 3E1PA 2JD60 3Q4QA 1LKMA 5HJHA 5FEJA 2ITBA 4DASA 3HL1A 2QQYA 3BVLA 1NF6A 1F30A 4RC5B 1S30A 3PVTA 4Z5SA 4IXKA 1KRQA 3AJQA 3KXUA 1TKOA 2FG8A 4LPJA 3E1NA 2WTLA 5D8OA 2V2LA 2CLUA 3EGMA 4M34A 1S3QA 2XJNA 1SQ3A 1VLGA 3PVRA 2V2RA 3HIUA 2FG4A 5CMQA 4ETRA 3BKNA 2C2UA 2C41A 3TA8A 1NFVA 4KVRA 2PYBA 1JREA 2CHPA 1H96A 1RCGA 2CIHA 4CYBA 4YKHA 4XKTA 4QUWA 1NNQA 2VZBA 1F33A 4LYXA 1UMNA 1S2ZA 5LS9A 2XJOA 4II4A 3KA4A 4EVEA 2F7NA 3R2SA 3E1QA 2IB0A 1N1QA 1VELA 2FFXJ 2FJCA 1DATA 1L8HA 5AXSA 4ZL6A 3PVYA 3AJPA 3GHQA 4CVTA 4TOEA 4RC7B 5CMRA 3OJ5A 2BK6A 3E1OA 3H7GA 2UX1A 4ZMCA 4M32A 4TW3A 5C6FA 4LQNA 1R03A 4Z3BA 4MUDA 4DZ0A 1DVBA 1IERA 5JACA 4XKSA 2CF7A 2V2PA 4CVRA 2OC5A 2YW6A 2YJKA 4TODA 5ERJA 3EZ0A 3QD8A 1Z6OM 5E1UA 1JKUA 3PZAA 5GU1X 4ZKXA 2WLUA 3E6SA 3F37A 2Z5RA 3AK8A 1JTSA 3R2OA 4ISMA 3FI6A 3PWQC 5K53A 4CMYA 4IWJA 1JI4A 2GS4A 1JYBA 2Z90A 3PVRB 4ZKWA 3BVKA 3SH6A 1VEIA 3Q4OA 3R2HA 2WLAA 1RCIA 4ISPA 5J93A 4ZTTA 2GYDA 3F34A 5HJFA 3O7SA 4LPNA 3F39A 2ZA6A 2GYQA 4TOGA 4TOBA 4LQHA 4DI0A 2CN7A 5FFAA 2YW7A 1JGCA 3GVYA 3IQ1A 2XGWA 4TOFA 3AJOA 3WNWA 4II4B 3A68A 3QB9A 4E6KA 4PG0A 2CLBA 2JD70 2RBDA 2D5KA 3F38A 3RE7A 4KVQA 1MFRA 5LG2A 3IS8A 3PVYB 5J8SA 2VXXA 3R2MA 4TOHA 3NOZX 4A25A 3SE1A 2CN6A 2IU2A 1YUZA 4ZL5A 3RBCA 4TOCA 3SHXA 5JKMA 3ISEA 3MPSA 1Z4AA 2V2JA 2G4HA 2V2OA 4CYAA 4R42A 4AM4A 1YV1A 4RC5A 3QVDA 1DPSA 1BG7A 5GN8A 2BKCA 3E1LA 4ZKHA 3PW1B 5J8WA 3PWQA 3UNOA 2HTNA 2X170 4DYXA 1AEWA 1ZS3A 2YJJA 3BT5A 2W0OA 2C2FA 3T9JA 1JI5A 1XZ3A 5D8RA 3RD0A 1LB3A 3Q4RA 4MKUA 1GWGA 4AM2A 1QYBA 4OYNA 3R2KA 3SIDA 1RCCA 4ZLWA 4RC8A 3VNXA 2V2SA 1BFRA 4U3GA 4REUA 3KA3A 4EVDA 1IESA 1VEQA 3PW8C 3AF9X 5GU3X 3PVTB 2ZG7X 3KX9A 4TO9A 5D8YA 3QHBA 3RGDA 5D8QA 2QF9A 4DYYA 1EUMA 2C6RA 1ZUJA 5HQOA 4XKUA 1MOJA 5JKLA 3ISFA 2CEIA 1FHAA 3UOFA 4EVBA 1XZ1A 3F32A 5D8PA 4LQVA 2JD80 1JKVA 3WVWA 5LG8A 3F35A 4RC7A 1RCDA 3PWFA 5GU0X 4LPMA 5D8XA 2ZG8X 3R2LA 4RC6A 4CMYV 1HRSA 4P18A 1O9IA 4PG1A 2V15A 5LBHA 3IS7A 4CVPA 4KVSA 1NF4A 3ES3A 1SOFA 5E2DA 4MN9A 5GN8B 3FVBA 2Y3QA 2ZA7A 3E1MA 4ZJKA 2BJYA 1O9RA 3R2RA 1UVHA 2FHAA 4DE6A 4LYUA 1LKOA 5JKMG 4LQJA 5CZUA 3E1JA 3AF8X 4ML5A 1VJXA 4DYZA 5I4JA 3BVIA 2ZURX 3WVVA 4AM5A 4Y08A 3Q4NA 5IX6A 3KA6A 3BVFA 3PW8A 4M33A 3F33A 4ERUA 3QZ3A 1J30A 4DYUA 2OH3A 3BVEA 2XKQA 5FFDA 2IY4A 5K52A 2Z5PA 3NP2X 3OGHA 5ERKA 1BCFA 1JIGA 5FFBA 4ITWA 1RYTA 5D8SA 5J9VA 4MJYA 1L8IA 3WVUA 3E2CA 3ERZA 2V2MA 2V2NA 2CHIA 1TKPA 2ZA8A 3FSEA 3QHCA 5GOUA 3KA8A 1RCEA 3NP0X 2ZG9X 4PGIA 1YUXA 4M35A 5JKLG 5GU2X 4CY9A 1Z6OA 3UOIA 4RC6B 1B71A 2XJMA 2BW1A 2FL0A
chains in the Genus database with same CATH superfamily
3E6RA 4XGSA 4EVCA 3AF7X 3N6OA 3F36A 3O7RA 3PW1A 3KWOA 3EZUA 1LKPA 2C2JA 4MY7A 2HR5A 2V8UA 4CVSA 2VXIA 3KA9A 2FKZA 1OTKA 3AK9A 2Z5QA 4ITTA 3RAVA 5FFCA 2V2IA 3GE4A 4PGKA 3U90A 2FZFA 5FFEA 1TJOA 1TK6A 2Z6MA 4IWKA 4TOAA 1QGHA 3A9QA 3E1PA 2JD60 3Q4QA 1LKMA 5HJHA 5FEJA 2ITBA 4DASA 3HL1A 2QQYA 3BVLA 1NF6A 1F30A 4RC5B 1S30A 3PVTA 4Z5SA 4IXKA 1KRQA 3AJQA 3KXUA 1TKOA 2FG8A 4LPJA 3E1NA 2WTLA 5D8OA 2V2LA 2CLUA 3EGMA 4M34A 1S3QA 2XJNA 3M6JA 1SQ3A 1VLGA 3PVRA 2V2RA 3HIUA 2FG4A 5CMQA 4ETRA 3BKNA 2C2UA 2C41A 3TA8A 1NFVA 4KVRA 2MGYA 2PYBA 1JREA 2CHPA 1H96A 5JDOA 1RCGA 2CIHA 4CYBA 4YKHA 4XKTA 4QUWA 1NNQA 2VZBA 1F33A 4LYXA 1UMNA 1S2ZA 5LS9A 2XJOA 4II4A 3KA4A 4EVEA 3JZAB 5HU6D 2F7NA 3R2SA 3E1QA 2IB0A 1N1QA 1VELA 2FFXJ 2FJCA 1DATA 4E40A 1L8HA 5AXSA 4ZL6A 3W54A 3PVYA 3AJPA 2WWXB 3GHQA 4CVTA 4TOEA 4RC7B 5CMRA 3OJ5A 2BK6A 3E1OA 3H7GA 2UX1A 4ZMCA 4M32A 3LKDA 4TW3A 5C6FA 4LQNA 1R03A 4Z3BA 3C1ZA 4MUDA 4DZ0A 1DVBA 2G38B 1IERA 5JACA 4XKSA 2CF7A 2V2PA 4CVRA 3DBYA 2OC5A 2YW6A 2YJKA 4TODA 5ERJA 3EZ0A 3QD8A 1Z6OM 5E1UA 1JKUA 3PZAA 5GU1X 4ZKXA 2WLUA 3E6SA 3F37A 2Z5RA 3AK8A 1JTSA 3R2OA 4ISMA 3FI6A 3PWQC 5K53A 4CMYA 4IWJA 1JI4A 2GS4A 1JYBA 3L0MA 2Z90A 3PVRB 4ZKWA 3BVKA 3SH6A 1VEIA 3Q4OA 3R2HA 2WLAA 1RCIA 4ISPA 5J93A 4ZTTA 2GYDA 4WJG4 3F34A 5HJFA 3O7SA 4LPNA 3F39A 3VV9A 2ZA6A 5JDOB 2GYQA 2CWLA 3JZ9A 4TOGA 4TOBA 4LQHA 4DI0A 2CN7A 5FFAA 2YW7A 1JGCA 3GVYA 3IQ1A 2XGWA 4TOFA 3AJOA 3WNWA 4II4B 3A68A 3QB9A 4E6KA 4PG0A 2CLBA 2JD70 2RBDA 2D5KA 3F38A 3RE7A 4KVQA 1MFRA 5LG2A 3IS8A 3PVYB 5J8SA 2V8TA 2VXXA 3R2MA 4TOHA 3NOZX 4A25A 3SE1A 2CN6A 2IU2A 1YUZA 4ZL5A 3RBCA 4TOCA 3SHXA 5JKMA 3ISEA 3MPSA 1Z4AA 2V2JA 2G4HA 2V2OA 4CYAA 4R42A 4AM4A 1YV1A 4RC5A 3QVDA 1DPSA 1BG7A 5GN8A 2BKCA 3E1LA 4ZKHA 3PW1B 3C1YA 5J8WA 4W4LB 3PWQA 3UNOA 2HTNA 2X170 4DYXA 1AEWA 1ZS3A 2YJJA 3BT5A 2W0OA 2C2FA 3T9JA 1JI5A 1XZ3A 5D8RA 3RD0A 1LB3A 3Q4RA 3FRSA 4MKUA 1GWGA 4W4KB 4AM2A 1QYBA 4OYNA 3R2KA 3SIDA 1RCCA 4ZLWA 4RC8A 3VNXA 2V2SA 3FRRA 1BFRA 4U3GA 4REUA 3KA3A 3KHKA 4EVDA 1IESA 1VEQA 3PW8C 3AF9X 5GU3X 3PVTB 2ZG7X 3KX9A 4TO9A 5D8YA 3V3KB 3QHBA 3RGDA 3GGYA 2QF9A 5D8QA 4DYYA 1EUMA 2C6RA 1ZUJA 5HQOA 4XKUA 1MOJA 5JKLA 3ISFA 2CEIA 1FHAA 2OKCA 3UOFA 4EVBA 1XZ1A 3F32A 5D8PA 4LQVA 2JD80 1JKVA 3GGZA 3WVWA 5LG8A 2AR0A 3F35A 4RC7A 1RCDA 3PWFA 3C21A 5GU0X 4LPMA 5D8XA 2ZG8X 3R2LA 4RC6A 4YXJA 4CMYV 1HRSA 4P18A 1O9IA 4PG1A 2V15A 5LBHA 3IS7A 4CVPA 4KVSA 1NF4A 3ES3A 1SOFA 5E2DA 4MN9A 5GN8B 3FVBA 2Y3QA 2ZA7A 3UFBA 3E1MA 4ZJKA 2BJYA 1O9RA 3R2RA 1UVHA 2FHAA 4YXMA 4DE6A 4LYUA 1LKOA 5JKMG 4LQJA 5CZUA 4YVZA 3VVAA 2Y44A 2N02A 3AF8X 3E1JA 4ML5A 1VJXA 4DYZA 5I4JA 3BVIA 2ZURX 3WVVA 4AM5A 4Y08A 3Q4NA 4X0JA 5IX6A 3KA6A 3BVFA 3PW8A 4M33A 3F33A 4ERUA 3C23A 3QZ3A 3D19A 1J30A 4DYUA 2OH3A 3BVEA 2XKQA 5FFDA 3KDQA 2IY4A 5K52A 2Z5PA 3NP2X 3OGHA 5ERKA 1BCFA 1JIGA 5FFBA 4ITWA 1RYTA 5D8SA 5J9VA 4MJYA 1L8IA 3WVUA 3E2CA 3ERZA 2V2MA 2V2NA 2CHIA 1TKPA 2ZA8A 3FSEA 3QHCA 5GOUA 3KA8A 4KXRB 1RCEA 3NP0X 2ZG9X 4PGIA 1YUXA 4M35A 4MXPA 5JKLG 5GU2X 4CY9A 1Z6OA 3UOIA 4RC6B 1B71A 2XJMA 2BW1A 2FL0A
chains in the Genus database with same CATH topology
3E6RA 4XGSA 4EVCA 3AF7X 3N6OA 3F36A 3O7RA 3PW1A 3KWOA 3EZUA 1LKPA 2C2JA 4MY7A 2HR5A 2V8UA 4CVSA 2VXIA 3KA9A 2FKZA 1OTKA 3AK9A 2Z5QA 4ITTA 3RAVA 5FFCA 2V2IA 3GE4A 4PGKA 3U90A 2FZFA 5FFEA 1TJOA 1TK6A 2Z6MA 4IWKA 4TOAA 1QGHA 3A9QA 3E1PA 2JD60 3Q4QA 1LKMA 5HJHA 5FEJA 2ITBA 4DASA 3HL1A 2QQYA 3BVLA 1NF6A 1F30A 4RC5B 1S30A 3PVTA 4Z5SA 4IXKA 1KRQA 3AJQA 3KXUA 1TKOA 2FG8A 4LPJA 3E1NA 2WTLA 5D8OA 2V2LA 2CLUA 3EGMA 4M34A 1S3QA 2XJNA 3M6JA 1SQ3A 1VLGA 3PVRA 2V2RA 3HIUA 2FG4A 5CMQA 4ETRA 3BKNA 2C2UA 2C41A 3TA8A 1NFVA 4KVRA 2MGYA 2PYBA 1JREA 2CHPA 1H96A 5JDOA 1RCGA 2CIHA 4CYBA 4YKHA 4XKTA 4QUWA 1NNQA 2VZBA 1F33A 4LYXA 1UMNA 1S2ZA 5LS9A 2XJOA 4II4A 3KA4A 4EVEA 3JZAB 5HU6D 2F7NA 3R2SA 3E1QA 2IB0A 1N1QA 1VELA 2FFXJ 2FJCA 1DATA 4E40A 1L8HA 5AXSA 4ZL6A 3W54A 3PVYA 3AJPA 2WWXB 3GHQA 4CVTA 4TOEA 4RC7B 5CMRA 3OJ5A 2BK6A 3E1OA 3H7GA 2UX1A 4ZMCA 4M32A 3LKDA 4TW3A 5C6FA 4LQNA 1R03A 4Z3BA 3C1ZA 4MUDA 4DZ0A 1DVBA 2G38B 1IERA 5JACA 4XKSA 2CF7A 2V2PA 4CVRA 3DBYA 2OC5A 2YW6A 2YJKA 4TODA 5ERJA 3EZ0A 3QD8A 1Z6OM 5E1UA 1JKUA 3PZAA 5GU1X 4ZKXA 2WLUA 3E6SA 3F37A 2Z5RA 3AK8A 1JTSA 3R2OA 4ISMA 3FI6A 3PWQC 5K53A 4CMYA 4IWJA 1JI4A 2GS4A 1JYBA 3L0MA 2Z90A 3PVRB 4ZKWA 3BVKA 3SH6A 1VEIA 3Q4OA 3R2HA 2WLAA 1RCIA 4ISPA 5J93A 4ZTTA 2GYDA 4WJG4 3F34A 5HJFA 3O7SA 4LPNA 3F39A 3VV9A 2ZA6A 5JDOB 2GYQA 2CWLA 3JZ9A 4TOGA 4TOBA 4LQHA 4DI0A 2CN7A 5FFAA 2YW7A 1JGCA 3GVYA 3IQ1A 2XGWA 4TOFA 3AJOA 3WNWA 4II4B 3A68A 3QB9A 4E6KA 4PG0A 2CLBA 2JD70 2RBDA 2D5KA 3F38A 3RE7A 4KVQA 1MFRA 5LG2A 3IS8A 3PVYB 5J8SA 2V8TA 2VXXA 3R2MA 4TOHA 3NOZX 4A25A 3SE1A 2CN6A 2IU2A 1YUZA 4ZL5A 3RBCA 4TOCA 3SHXA 5JKMA 3ISEA 3MPSA 1Z4AA 2V2JA 2G4HA 2V2OA 4CYAA 4R42A 4AM4A 1YV1A 4RC5A 3QVDA 1DPSA 1BG7A 5GN8A 2BKCA 3E1LA 4ZKHA 3PW1B 3C1YA 5J8WA 4W4LB 3PWQA 3UNOA 2HTNA 2X170 4DYXA 1AEWA 1ZS3A 2YJJA 3BT5A 2W0OA 2C2FA 3T9JA 1JI5A 1XZ3A 5D8RA 3RD0A 1LB3A 3Q4RA 3FRSA 4MKUA 1GWGA 4W4KB 4AM2A 1QYBA 4OYNA 3R2KA 3SIDA 1RCCA 4ZLWA 4RC8A 3VNXA 2V2SA 3FRRA 1BFRA 4U3GA 4REUA 3KA3A 3KHKA 4EVDA 1IESA 1VEQA 3PW8C 3AF9X 5GU3X 3PVTB 2ZG7X 3KX9A 4TO9A 5D8YA 3V3KB 3QHBA 3RGDA 3GGYA 2QF9A 5D8QA 4DYYA 1EUMA 2C6RA 1ZUJA 5HQOA 4XKUA 1MOJA 5JKLA 3ISFA 2CEIA 1FHAA 2OKCA 3UOFA 4EVBA 1XZ1A 3F32A 5D8PA 4LQVA 2JD80 1JKVA 3GGZA 3WVWA 5LG8A 2AR0A 3F35A 4RC7A 1RCDA 3PWFA 3C21A 5GU0X 4LPMA 5D8XA 2ZG8X 3R2LA 4RC6A 4YXJA 4CMYV 1HRSA 4P18A 1O9IA 4PG1A 2V15A 5LBHA 3IS7A 4CVPA 4KVSA 1NF4A 3ES3A 1SOFA 5E2DA 4MN9A 5GN8B 3FVBA 2Y3QA 2ZA7A 3UFBA 3E1MA 4ZJKA 2BJYA 1O9RA 3R2RA 1UVHA 2FHAA 4YXMA 4DE6A 4LYUA 1LKOA 5JKMG 4LQJA 5CZUA 4YVZA 3VVAA 2Y44A 2N02A 3AF8X 3E1JA 4ML5A 1VJXA 4DYZA 5I4JA 3BVIA 2ZURX 3WVVA 4AM5A 4Y08A 3Q4NA 4X0JA 5IX6A 3KA6A 3BVFA 3PW8A 4M33A 3F33A 4ERUA 3C23A 3QZ3A 3D19A 1J30A 4DYUA 2OH3A 3BVEA 2XKQA 5FFDA 3KDQA 2IY4A 5K52A 2Z5PA 3NP2X 3OGHA 5ERKA 1BCFA 1JIGA 5FFBA 4ITWA 1RYTA 5D8SA 5J9VA 4MJYA 1L8IA 3WVUA 3E2CA 3ERZA 2V2MA 2V2NA 2CHIA 1TKPA 2ZA8A 3FSEA 3QHCA 5GOUA 3KA8A 4KXRB 1RCEA 3NP0X 2ZG9X 4PGIA 1YUXA 4M35A 4MXPA 5JKLG 5GU2X 4CY9A 1Z6OA 3UOIA 4RC6B 1B71A 2XJMA 2BW1A 2FL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E6R A;  4XGS A;  4EVC A;  3AF7 X;  3F36 A;  3O7R A;  3PW1 A;  3KWO A;  3EZU A;  1LKP A;  2C2J A;  4MY7 A;  2HR5 A;  4CVS A;  2VXI A;  3KA9 A;  2FKZ A;  1OTK A;  3AK9 A;  2Z5Q A;  4ITT A;  3RAV A;  5FFC A;  2V2I A;  3GE4 A;  4PGK A;  3U90 A;  2FZF A;  5FFE A;  1TJO A;  1TK6 A;  2Z6M A;  4IWK A;  4TOA A;  1QGH A;  3A9Q A;  3E1P A;  2JD6 0;  3Q4Q A;  1LKM A;  5HJH A;  5FEJ A;  2ITB A;  4DAS A;  3HL1 A;  2QQY A;  3BVL A;  1NF6 A;  1F30 A;  4RC5 B;  1S30 A;  3PVT A;  4Z5S A;  4IXK A;  1KRQ A;  3AJQ A;  3KXU A;  1TKO A;  2FG8 A;  4LPJ A;  3E1N A;  2WTL A;  5D8O A;  2V2L A;  2CLU A;  3EGM A;  4M34 A;  1S3Q A;  2XJN A;  1SQ3 A;  1VLG A;  3PVR A;  2V2R A;  3HIU A;  2FG4 A;  5CMQ A;  4ETR A;  3BKN A;  2C2U A;  2C41 A;  3TA8 A;  1NFV A;  4KVR A;  2PYB A;  1JRE A;  2CHP A;  1H96 A;  1RCG A;  2CIH A;  4CYB A;  4YKH A;  4XKT A;  4QUW A;  1NNQ A;  2VZB A;  1F33 A;  4LYX A;  1UMN A;  1S2Z A;  5LS9 A;  2XJO A;  4II4 A;  3KA4 A;  4EVE A;  2F7N A;  3R2S A;  3E1Q A;  2IB0 A;  1N1Q A;  1VEL A;  2FFX J;  2FJC A;  1DAT A;  1L8H A;  5AXS A;  4ZL6 A;  3PVY A;  3AJP A;  3GHQ A;  4CVT A;  4TOE A;  4RC7 B;  5CMR A;  3OJ5 A;  2BK6 A;  3E1O A;  3H7G A;  2UX1 A;  4ZMC A;  4M32 A;  4TW3 A;  5C6F A;  4LQN A;  1R03 A;  4Z3B A;  4MUD A;  4DZ0 A;  1DVB A;  1IER A;  5JAC A;  4XKS A;  2CF7 A;  2V2P A;  4CVR A;  2OC5 A;  2YW6 A;  2YJK A;  4TOD A;  5ERJ A;  3EZ0 A;  3QD8 A;  1Z6O M;  5E1U A;  1JKU A;  3PZA A;  5GU1 X;  4ZKX A;  2WLU A;  3E6S A;  3F37 A;  2Z5R A;  3AK8 A;  1JTS A;  3R2O A;  4ISM A;  3FI6 A;  3PWQ C;  5K53 A;  4CMY A;  4IWJ A;  1JI4 A;  2GS4 A;  1JYB A;  2Z90 A;  3PVR B;  4ZKW A;  3BVK A;  3SH6 A;  1VEI A;  3Q4O A;  3R2H A;  2WLA A;  1RCI A;  4ISP A;  5J93 A;  4ZTT A;  2GYD A;  3F34 A;  5HJF A;  3O7S A;  4LPN A;  3F39 A;  2ZA6 A;  2GYQ A;  4TOG A;  4TOB A;  4LQH A;  4DI0 A;  2CN7 A;  5FFA A;  2YW7 A;  1JGC A;  3GVY A;  3IQ1 A;  2XGW A;  4TOF A;  3AJO A;  3WNW A;  4II4 B;  3A68 A;  3QB9 A;  4E6K A;  4PG0 A;  2CLB A;  2JD7 0;  2RBD A;  2D5K A;  3F38 A;  3RE7 A;  4KVQ A;  1MFR A;  5LG2 A;  3IS8 A;  3PVY B;  5J8S A;  2VXX A;  3R2M A;  4TOH A;  3NOZ X;  4A25 A;  3SE1 A;  2CN6 A;  2IU2 A;  1YUZ A;  4ZL5 A;  3RBC A;  4TOC A;  3SHX A;  5JKM A;  3ISE A;  3MPS A;  1Z4A A;  2V2J A;  2G4H A;  2V2O A;  4CYA A;  4R42 A;  4AM4 A;  1YV1 A;  4RC5 A;  3QVD A;  1DPS A;  1BG7 A;  5GN8 A;  2BKC A;  3E1L A;  4ZKH A;  3PW1 B;  5J8W A;  3PWQ A;  3UNO A;  2HTN A;  2X17 0;  4DYX A;  1AEW A;  1ZS3 A;  2YJJ A;  3BT5 A;  2W0O A;  2C2F A;  3T9J A;  1JI5 A;  1XZ3 A;  5D8R A;  3RD0 A;  1LB3 A;  3Q4R A;  4MKU A;  1GWG A;  4AM2 A;  1QYB A;  4OYN A;  3R2K A;  3SID A;  1RCC A;  4ZLW A;  4RC8 A;  3VNX A;  2V2S A;  1BFR A;  4U3G A;  4REU A;  3KA3 A;  4EVD A;  1IES A;  1VEQ A;  3PW8 C;  3AF9 X;  5GU3 X;  3PVT B;  2ZG7 X;  3KX9 A;  4TO9 A;  5D8Y A;  3QHB A;  3RGD A;  5D8Q A;  2QF9 A;  4DYY A;  1EUM A;  2C6R A;  1ZUJ A;  5HQO A;  4XKU A;  1MOJ A;  5JKL A;  3ISF A;  2CEI A;  1FHA A;  3UOF A;  4EVB A;  1XZ1 A;  3F32 A;  5D8P A;  4LQV A;  2JD8 0;  1JKV A;  3WVW A;  5LG8 A;  3F35 A;  4RC7 A;  1RCD A;  3PWF A;  5GU0 X;  4LPM A;  5D8X A;  2ZG8 X;  3R2L A;  4RC6 A;  4CMY V;  1HRS A;  4P18 A;  1O9I A;  4PG1 A;  2V15 A;  5LBH A;  3IS7 A;  4CVP A;  4KVS A;  1NF4 A;  3ES3 A;  1SOF A;  5E2D A;  4MN9 A;  5GN8 B;  3FVB A;  2Y3Q A;  2ZA7 A;  3E1M A;  4ZJK A;  2BJY A;  1O9R A;  3R2R A;  1UVH A;  2FHA A;  4DE6 A;  4LYU A;  1LKO A;  5JKM G;  4LQJ A;  5CZU A;  3E1J A;  3AF8 X;  4ML5 A;  1VJX A;  4DYZ A;  5I4J A;  3BVI A;  2ZUR X;  3WVV A;  4AM5 A;  4Y08 A;  3Q4N A;  5IX6 A;  3KA6 A;  3BVF A;  3PW8 A;  4M33 A;  3F33 A;  4ERU A;  3QZ3 A;  1J30 A;  4DYU A;  2OH3 A;  3BVE A;  2XKQ A;  5FFD A;  2IY4 A;  5K52 A;  2Z5P A;  3NP2 X;  3OGH A;  5ERK A;  1BCF A;  1JIG A;  5FFB A;  4ITW A;  1RYT A;  5D8S A;  5J9V A;  4MJY A;  1L8I A;  3WVU A;  3E2C A;  3ERZ A;  2V2M A;  2V2N A;  2CHI A;  1TKP A;  2ZA8 A;  3FSE A;  3QHC A;  5GOU A;  3KA8 A;  1RCE A;  3NP0 X;  2ZG9 X;  4PGI A;  1YUX A;  4M35 A;  5JKL G;  5GU2 X;  4CY9 A;  1Z6O A;  3UOI A;  4RC6 B;  1B71 A;  2XJM A;  2BW1 A;  2FL0 A; 
#chains in the Genus database with same CATH topology
 3E6R A;  4XGS A;  4EVC A;  3AF7 X;  3N6O A;  3F36 A;  3O7R A;  3PW1 A;  3KWO A;  3EZU A;  1LKP A;  2C2J A;  4MY7 A;  2HR5 A;  2V8U A;  4CVS A;  2VXI A;  3KA9 A;  2FKZ A;  1OTK A;  3AK9 A;  2Z5Q A;  4ITT A;  3RAV A;  5FFC A;  2V2I A;  3GE4 A;  4PGK A;  3U90 A;  2FZF A;  5FFE A;  1TJO A;  1TK6 A;  2Z6M A;  4IWK A;  4TOA A;  1QGH A;  3A9Q A;  3E1P A;  2JD6 0;  3Q4Q A;  1LKM A;  5HJH A;  5FEJ A;  2ITB A;  4DAS A;  3HL1 A;  2QQY A;  3BVL A;  1NF6 A;  1F30 A;  4RC5 B;  1S30 A;  3PVT A;  4Z5S A;  4IXK A;  1KRQ A;  3AJQ A;  3KXU A;  1TKO A;  2FG8 A;  4LPJ A;  3E1N A;  2WTL A;  5D8O A;  2V2L A;  2CLU A;  3EGM A;  4M34 A;  1S3Q A;  2XJN A;  3M6J A;  1SQ3 A;  1VLG A;  3PVR A;  2V2R A;  3HIU A;  2FG4 A;  5CMQ A;  4ETR A;  3BKN A;  2C2U A;  2C41 A;  3TA8 A;  1NFV A;  4KVR A;  2MGY A;  2PYB A;  1JRE A;  2CHP A;  1H96 A;  5JDO A;  1RCG A;  2CIH A;  4CYB A;  4YKH A;  4XKT A;  4QUW A;  1NNQ A;  2VZB A;  1F33 A;  4LYX A;  1UMN A;  1S2Z A;  5LS9 A;  2XJO A;  4II4 A;  3KA4 A;  4EVE A;  3JZA B;  5HU6 D;  2F7N A;  3R2S A;  3E1Q A;  2IB0 A;  1N1Q A;  1VEL A;  2FFX J;  2FJC A;  1DAT A;  4E40 A;  1L8H A;  5AXS A;  4ZL6 A;  3W54 A;  3PVY A;  3AJP A;  2WWX B;  3GHQ A;  4CVT A;  4TOE A;  4RC7 B;  5CMR A;  3OJ5 A;  2BK6 A;  3E1O A;  3H7G A;  2UX1 A;  4ZMC A;  4M32 A;  3LKD A;  4TW3 A;  5C6F A;  4LQN A;  1R03 A;  4Z3B A;  3C1Z A;  4MUD A;  4DZ0 A;  1DVB A;  2G38 B;  1IER A;  5JAC A;  4XKS A;  2CF7 A;  2V2P A;  4CVR A;  3DBY A;  2OC5 A;  2YW6 A;  2YJK A;  4TOD A;  5ERJ A;  3EZ0 A;  3QD8 A;  1Z6O M;  5E1U A;  1JKU A;  3PZA A;  5GU1 X;  4ZKX A;  2WLU A;  3E6S A;  3F37 A;  2Z5R A;  3AK8 A;  1JTS A;  3R2O A;  4ISM A;  3FI6 A;  3PWQ C;  5K53 A;  4CMY A;  4IWJ A;  1JI4 A;  2GS4 A;  1JYB A;  3L0M A;  2Z90 A;  3PVR B;  4ZKW A;  3BVK A;  3SH6 A;  1VEI A;  3Q4O A;  3R2H A;  2WLA A;  1RCI A;  4ISP A;  5J93 A;  4ZTT A;  2GYD A;  4WJG 4;  3F34 A;  5HJF A;  3O7S A;  4LPN A;  3F39 A;  3VV9 A;  2ZA6 A;  5JDO B;  2GYQ A;  2CWL A;  3JZ9 A;  4TOG A;  4TOB A;  4LQH A;  4DI0 A;  2CN7 A;  5FFA A;  2YW7 A;  1JGC A;  3GVY A;  3IQ1 A;  2XGW A;  4TOF A;  3AJO A;  3WNW A;  4II4 B;  3A68 A;  3QB9 A;  4E6K A;  4PG0 A;  2CLB A;  2JD7 0;  2RBD A;  2D5K A;  3F38 A;  3RE7 A;  4KVQ A;  1MFR A;  5LG2 A;  3IS8 A;  3PVY B;  5J8S A;  2V8T A;  2VXX A;  3R2M A;  4TOH A;  3NOZ X;  4A25 A;  3SE1 A;  2CN6 A;  2IU2 A;  1YUZ A;  4ZL5 A;  3RBC A;  4TOC A;  3SHX A;  5JKM A;  3ISE A;  3MPS A;  1Z4A A;  2V2J A;  2G4H A;  2V2O A;  4CYA A;  4R42 A;  4AM4 A;  1YV1 A;  4RC5 A;  3QVD A;  1DPS A;  1BG7 A;  5GN8 A;  2BKC A;  3E1L A;  4ZKH A;  3PW1 B;  3C1Y A;  5J8W A;  4W4L B;  3PWQ A;  3UNO A;  2HTN A;  2X17 0;  4DYX A;  1AEW A;  1ZS3 A;  2YJJ A;  3BT5 A;  2W0O A;  2C2F A;  3T9J A;  1JI5 A;  1XZ3 A;  5D8R A;  3RD0 A;  1LB3 A;  3Q4R A;  3FRS A;  4MKU A;  1GWG A;  4W4K B;  4AM2 A;  1QYB A;  4OYN A;  3R2K A;  3SID A;  1RCC A;  4ZLW A;  4RC8 A;  3VNX A;  2V2S A;  3FRR A;  1BFR A;  4U3G A;  4REU A;  3KA3 A;  3KHK A;  4EVD A;  1IES A;  1VEQ A;  3PW8 C;  3AF9 X;  5GU3 X;  3PVT B;  2ZG7 X;  3KX9 A;  4TO9 A;  5D8Y A;  3V3K B;  3QHB A;  3RGD A;  3GGY A;  2QF9 A;  5D8Q A;  4DYY A;  1EUM A;  2C6R A;  1ZUJ A;  5HQO A;  4XKU A;  1MOJ A;  5JKL A;  3ISF A;  2CEI A;  1FHA A;  2OKC A;  3UOF A;  4EVB A;  1XZ1 A;  3F32 A;  5D8P A;  4LQV A;  2JD8 0;  1JKV A;  3GGZ A;  3WVW A;  5LG8 A;  2AR0 A;  3F35 A;  4RC7 A;  1RCD A;  3PWF A;  3C21 A;  5GU0 X;  4LPM A;  5D8X A;  2ZG8 X;  3R2L A;  4RC6 A;  4YXJ A;  4CMY V;  1HRS A;  4P18 A;  1O9I A;  4PG1 A;  2V15 A;  5LBH A;  3IS7 A;  4CVP A;  4KVS A;  1NF4 A;  3ES3 A;  1SOF A;  5E2D A;  4MN9 A;  5GN8 B;  3FVB A;  2Y3Q A;  2ZA7 A;  3UFB A;  3E1M A;  4ZJK A;  2BJY A;  1O9R A;  3R2R A;  1UVH A;  2FHA A;  4YXM A;  4DE6 A;  4LYU A;  1LKO A;  5JKM G;  4LQJ A;  5CZU A;  4YVZ A;  3VVA A;  2Y44 A;  2N02 A;  3AF8 X;  3E1J A;  4ML5 A;  1VJX A;  4DYZ A;  5I4J A;  3BVI A;  2ZUR X;  3WVV A;  4AM5 A;  4Y08 A;  3Q4N A;  4X0J A;  5IX6 A;  3KA6 A;  3BVF A;  3PW8 A;  4M33 A;  3F33 A;  4ERU A;  3C23 A;  3QZ3 A;  3D19 A;  1J30 A;  4DYU A;  2OH3 A;  3BVE A;  2XKQ A;  5FFD A;  3KDQ A;  2IY4 A;  5K52 A;  2Z5P A;  3NP2 X;  3OGH A;  5ERK A;  1BCF A;  1JIG A;  5FFB A;  4ITW A;  1RYT A;  5D8S A;  5J9V A;  4MJY A;  1L8I A;  3WVU A;  3E2C A;  3ERZ A;  2V2M A;  2V2N A;  2CHI A;  1TKP A;  2ZA8 A;  3FSE A;  3QHC A;  5GOU A;  3KA8 A;  4KXR B;  1RCE A;  3NP0 X;  2ZG9 X;  4PGI A;  1YUX A;  4M35 A;  4MXP A;  5JKL G;  5GU2 X;  4CY9 A;  1Z6O A;  3UOI A;  4RC6 B;  1B71 A;  2XJM A;  2BW1 A;  2FL0 A; 
#chains in the Genus database with same CATH homology
 3E6R A;  4XGS A;  4EVC A;  3AF7 X;  3N6O A;  3F36 A;  3O7R A;  3PW1 A;  3KWO A;  3EZU A;  1LKP A;  2C2J A;  4MY7 A;  2HR5 A;  2V8U A;  4CVS A;  2VXI A;  3KA9 A;  2FKZ A;  1OTK A;  3AK9 A;  2Z5Q A;  4ITT A;  3RAV A;  5FFC A;  2V2I A;  3GE4 A;  4PGK A;  3U90 A;  2FZF A;  5FFE A;  1TJO A;  1TK6 A;  2Z6M A;  4IWK A;  4TOA A;  1QGH A;  3A9Q A;  3E1P A;  2JD6 0;  3Q4Q A;  1LKM A;  5HJH A;  5FEJ A;  2ITB A;  4DAS A;  3HL1 A;  2QQY A;  3BVL A;  1NF6 A;  1F30 A;  4RC5 B;  1S30 A;  3PVT A;  4Z5S A;  4IXK A;  1KRQ A;  3AJQ A;  3KXU A;  1TKO A;  2FG8 A;  4LPJ A;  3E1N A;  2WTL A;  5D8O A;  2V2L A;  2CLU A;  3EGM A;  4M34 A;  1S3Q A;  2XJN A;  3M6J A;  1SQ3 A;  1VLG A;  3PVR A;  2V2R A;  3HIU A;  2FG4 A;  5CMQ A;  4ETR A;  3BKN A;  2C2U A;  2C41 A;  3TA8 A;  1NFV A;  4KVR A;  2MGY A;  2PYB A;  1JRE A;  2CHP A;  1H96 A;  5JDO A;  1RCG A;  2CIH A;  4CYB A;  4YKH A;  4XKT A;  4QUW A;  1NNQ A;  2VZB A;  1F33 A;  4LYX A;  1UMN A;  1S2Z A;  5LS9 A;  2XJO A;  4II4 A;  3KA4 A;  4EVE A;  3JZA B;  5HU6 D;  2F7N A;  3R2S A;  3E1Q A;  2IB0 A;  1N1Q A;  1VEL A;  2FFX J;  2FJC A;  1DAT A;  4E40 A;  1L8H A;  5AXS A;  4ZL6 A;  3W54 A;  3PVY A;  3AJP A;  2WWX B;  3GHQ A;  4CVT A;  4TOE A;  4RC7 B;  5CMR A;  3OJ5 A;  2BK6 A;  3E1O A;  3H7G A;  2UX1 A;  4ZMC A;  4M32 A;  3LKD A;  4TW3 A;  5C6F A;  4LQN A;  1R03 A;  4Z3B A;  3C1Z A;  4MUD A;  4DZ0 A;  1DVB A;  2G38 B;  1IER A;  5JAC A;  4XKS A;  2CF7 A;  2V2P A;  4CVR A;  3DBY A;  2OC5 A;  2YW6 A;  2YJK A;  4TOD A;  5ERJ A;  3EZ0 A;  3QD8 A;  1Z6O M;  5E1U A;  1JKU A;  3PZA A;  5GU1 X;  4ZKX A;  2WLU A;  3E6S A;  3F37 A;  2Z5R A;  3AK8 A;  1JTS A;  3R2O A;  4ISM A;  3FI6 A;  3PWQ C;  5K53 A;  4CMY A;  4IWJ A;  1JI4 A;  2GS4 A;  1JYB A;  3L0M A;  2Z90 A;  3PVR B;  4ZKW A;  3BVK A;  3SH6 A;  1VEI A;  3Q4O A;  3R2H A;  2WLA A;  1RCI A;  4ISP A;  5J93 A;  4ZTT A;  2GYD A;  4WJG 4;  3F34 A;  5HJF A;  3O7S A;  4LPN A;  3F39 A;  3VV9 A;  2ZA6 A;  5JDO B;  2GYQ A;  2CWL A;  3JZ9 A;  4TOG A;  4TOB A;  4LQH A;  4DI0 A;  2CN7 A;  5FFA A;  2YW7 A;  1JGC A;  3GVY A;  3IQ1 A;  2XGW A;  4TOF A;  3AJO A;  3WNW A;  4II4 B;  3A68 A;  3QB9 A;  4E6K A;  4PG0 A;  2CLB A;  2JD7 0;  2RBD A;  2D5K A;  3F38 A;  3RE7 A;  4KVQ A;  1MFR A;  5LG2 A;  3IS8 A;  3PVY B;  5J8S A;  2V8T A;  2VXX A;  3R2M A;  4TOH A;  3NOZ X;  4A25 A;  3SE1 A;  2CN6 A;  2IU2 A;  1YUZ A;  4ZL5 A;  3RBC A;  4TOC A;  3SHX A;  5JKM A;  3ISE A;  3MPS A;  1Z4A A;  2V2J A;  2G4H A;  2V2O A;  4CYA A;  4R42 A;  4AM4 A;  1YV1 A;  4RC5 A;  3QVD A;  1DPS A;  1BG7 A;  5GN8 A;  2BKC A;  3E1L A;  4ZKH A;  3PW1 B;  3C1Y A;  5J8W A;  4W4L B;  3PWQ A;  3UNO A;  2HTN A;  2X17 0;  4DYX A;  1AEW A;  1ZS3 A;  2YJJ A;  3BT5 A;  2W0O A;  2C2F A;  3T9J A;  1JI5 A;  1XZ3 A;  5D8R A;  3RD0 A;  1LB3 A;  3Q4R A;  3FRS A;  4MKU A;  1GWG A;  4W4K B;  4AM2 A;  1QYB A;  4OYN A;  3R2K A;  3SID A;  1RCC A;  4ZLW A;  4RC8 A;  3VNX A;  2V2S A;  3FRR A;  1BFR A;  4U3G A;  4REU A;  3KA3 A;  3KHK A;  4EVD A;  1IES A;  1VEQ A;  3PW8 C;  3AF9 X;  5GU3 X;  3PVT B;  2ZG7 X;  3KX9 A;  4TO9 A;  5D8Y A;  3V3K B;  3QHB A;  3RGD A;  3GGY A;  2QF9 A;  5D8Q A;  4DYY A;  1EUM A;  2C6R A;  1ZUJ A;  5HQO A;  4XKU A;  1MOJ A;  5JKL A;  3ISF A;  2CEI A;  1FHA A;  2OKC A;  3UOF A;  4EVB A;  1XZ1 A;  3F32 A;  5D8P A;  4LQV A;  2JD8 0;  1JKV A;  3GGZ A;  3WVW A;  5LG8 A;  2AR0 A;  3F35 A;  4RC7 A;  1RCD A;  3PWF A;  3C21 A;  5GU0 X;  4LPM A;  5D8X A;  2ZG8 X;  3R2L A;  4RC6 A;  4YXJ A;  4CMY V;  1HRS A;  4P18 A;  1O9I A;  4PG1 A;  2V15 A;  5LBH A;  3IS7 A;  4CVP A;  4KVS A;  1NF4 A;  3ES3 A;  1SOF A;  5E2D A;  4MN9 A;  5GN8 B;  3FVB A;  2Y3Q A;  2ZA7 A;  3UFB A;  3E1M A;  4ZJK A;  2BJY A;  1O9R A;  3R2R A;  1UVH A;  2FHA A;  4YXM A;  4DE6 A;  4LYU A;  1LKO A;  5JKM G;  4LQJ A;  5CZU A;  4YVZ A;  3VVA A;  2Y44 A;  2N02 A;  3AF8 X;  3E1J A;  4ML5 A;  1VJX A;  4DYZ A;  5I4J A;  3BVI A;  2ZUR X;  3WVV A;  4AM5 A;  4Y08 A;  3Q4N A;  4X0J A;  5IX6 A;  3KA6 A;  3BVF A;  3PW8 A;  4M33 A;  3F33 A;  4ERU A;  3C23 A;  3QZ3 A;  3D19 A;  1J30 A;  4DYU A;  2OH3 A;  3BVE A;  2XKQ A;  5FFD A;  3KDQ A;  2IY4 A;  5K52 A;  2Z5P A;  3NP2 X;  3OGH A;  5ERK A;  1BCF A;  1JIG A;  5FFB A;  4ITW A;  1RYT A;  5D8S A;  5J9V A;  4MJY A;  1L8I A;  3WVU A;  3E2C A;  3ERZ A;  2V2M A;  2V2N A;  2CHI A;  1TKP A;  2ZA8 A;  3FSE A;  3QHC A;  5GOU A;  3KA8 A;  4KXR B;  1RCE A;  3NP0 X;  2ZG9 X;  4PGI A;  1YUX A;  4M35 A;  4MXP A;  5JKL G;  5GU2 X;  4CY9 A;  1Z6O A;  3UOI A;  4RC6 B;  1B71 A;  2XJM A;  2BW1 A;  2FL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...