3R3IA

Crystal structure of c-terminal truncation of udp-glucose pyrophosphorylase of homo sapiens
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
477
structure length
457
Chain Sequence
IRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of UDP-glucose Pyrophosphorylase of Homo sapiens
rcsb
molecule keywords UTP--glucose-1-phosphate uridylyltransferase
molecule tags Transferase
source organism Homo sapiens
total genus 98
structure length 457
sequence length 477
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.9: UTP--glucose-1-phosphate uridylyltransferase.
pdb deposition date 2011-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01704 UDPGP UTP--glucose-1-phosphate uridylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3r3iA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3r3iA01
2JF3A 4EABA 3IOJA 3V90A 4B2XA 2YESA 5ADXV 1JYLA 3V0QA 1ZJ1A 1O0RA 3PKQA 3R3IA 2XWNA 3R5AA 4HZCA 4FCEA 3CKJA 2QIVX 1ZCYA 2AGDA 2RIZA 3D5NA 3SXGA 1H4CA 3F1CA 2OEFA 3R2WA 1R7XA 4KPZA 2PX7A 3P47A 3JUKA 2ZU8A 5EIYA 3BFPA 4HG6A 1H7TA 4EA8A 3I3AA 2PGYA 2RJ6A 5C38A 4Y7TA 1LZJA 3U2TA 2V0IA 4M2AA 3DK5A 1ON8A 3I0JA 3V0OA 1FR9A 1VPAA 1MR9A 1V67A 2VSIA 5C3DA 3GOSA 3O3PA 4H7OA 1YP3A 2GGQA 2D0JA 3NGWA 4FRPA 5C48A 4FRMA 1TZFA 1VGZA 1G93A 1O7OA 3SXCA 5AJPA 5ADXU 3VBMA 4G3PA 1QRMA 2Y6PA 4CVHA 4G3SA 4B5BA 3VBKA 5FV9A 4IRQA 2V0JA 1QG8A 2Z87A 2QKXA 1TDTA 1YP2A 3V4EA 2NXVA 1V3WA 2AESA 4KRVA 3ZLKA 3GVDA 1FO9A 1VICA 4D11A 5C4DA 1XZ6A 4IHGA 2XWLA 5E3PA 4KPXA 3FSYA 3CU0A 5C1HA 2YC5A 4KNXA 1G95A 5CQPA 1YROB 1NHEB 5AJOA 4HO6A 1KK6A 4LW6A 4J18A 2BO8A 3U2VA 4IRPA 1QRFA 4FRHA 4EAAA 3I0HA 2V0KA 4FREA 1XATA 3OH4A 2APCA 4FCUA 2V0LA 2VS5A 1FWYA 2YQHA 5C8RA 1SS9A 1XHDA 4DCLA 4UEGA 2VS4A 2RJ7A 4Y6UA 2V0HA 3V8YA 4E6TA 1FXOA 3Q4SA 4EVWA 3DHOA 2NPOA 2WVLA 1S80A 1HJJA 1S4NA 4AYLA 1WVCA 2AM4A 3OH1A 2MZBA 5CQOA 4DECA 4BQHA 5CMJA 2RIXA 3OTZA 3U2XA 4FRAA 3FSBA 3V8ZA 5JQQA 1G23A 1KRUA 5IFYA 3K8EA 5FTVA 2ICYA 1H5SD 2Y4KA 4L41C 2FFVA 1R80A 1ZJ3A 1QGSA 3TZTA 1O23B 1OMZA 3SX5A 3E26A 2XATA 3FWWA 4HO8A 1TW5A 2P73A 2VS3A 1H5SA 1R7YA 5DDVA 3USRA 3TQDA 1KGQA 1ZDGA 1R82A 4D48A 4EA7A 2WGZA 2AM5A 2RITA 4R37A 1WT3A 3KWEA 3MC4A 2VXLA 2X5SA 2FYDB 3R5CA 3Q80A 4IHFA 4N69A 3SRTA 3HL3A 2A8WA 1GX4A 1JYKA 4EQYA 1JV3A 1GWVA 1S4OA 4C2SA 1G9RA 2O1GA 2IUAA 3VBIA 2QGIA 3HJJA 4HURA 1SSMA 2PGVA 3OU9A 2RJ8A 3TDTA 1FXJA 1FGXA 2FFUA 1LZ7A 2AECA 3TIOA 3TISA 2RJ9A 2XWMA 3I0FA 5FU8A 4CJBA 2E3DA 4KC2A 4FRLA 2FYBA 1K4VA 4J09A 2W0VA 4AYJA 2CU2A 2ZU9A 3VBNA 3LW6A 4KNRA 3CKOA 1HM9A 2O1HA 2ZU7A 1ON6A 3OH0A 4D0ZA 3OTMA 3HSQA 5E3RA 4G3QA 5J49A 1SSQA 2WVKA 3OGZA 5C4BA 3R5BA 4CJ8A 1EYRA 2VFZA 1G1LA 2AH9A 2Z86A 4NAIA 1T3DA 3CJ8A 2QH5A 3D8VA 3VNPA 4EE3A 2Y4LA 1VZTA 4Y9XA 3V91A 4HO2A 2WLGA 3R8YA 3CKVA 1LL0A 1MP5A 3IOHA 1HM8A 1H4EA 4N27A 4M99A 1LZ0A 3DJ4A 3ZGGA 3I3XA 5CQNX 2Y4MA 2TDTA 1R81A 3NZ2A 3ST8A 2OI5A 4N6BA 1LVWA 4KQLA 4LW3A 3RSBA 3SXDA 1G97A 1ZCVA 4M2BA 3QVBA 1GQ9A 1WT2A 2GGOA 3BSYA 3R3RA 4R7PA 3Q1XA 3VBPA 3D98A 4GBPA 4NALA 1IINA 2IU8A 2RJ5A 4EA9A 3I0CA 5I1FA 1FGGA 3I0GA 3R0SA 5CQMX 2JCKA 1G8OA 3RMVA 3CKQA 2FKOA 3SXAA 1G3LA 2WLEA 1FZWA 5C47A 3F1XA 2XMEA 4Y7UA 3JQYA 4HZDA 2BO6A 4M4KA 4YS8A 1W57A 4ASYA 1H5SB 3TWDA 3I0KA 3DUVA 4EEAA 4B4BA 3VBLA 5E3QA 2WE9A 3ECTA 2WVMA 4FQWA 1KK5A 3KWDA 1KRRA 3E25A 2I7BA 2X5ZA 4EE4A 1QREA 3MQHA 2FY7A 4FRBA 4E1KA 1ZIZA 1H7HA 2IU9A 2RJ4A 3OC9A 2A8UA 4BMAA 1R7VA 4CJCA 1W55A 1ZI3A 1INJA 2P2OA 2RJ1A 4NAKA 3USQA 1V84A 1NQIB 1ZI1A 4Y64A 5C1GA 1FO8A 1ZCTA 2OI7A 1KGTA 5AJNA 5HS2A 3ZLLA 4R36A 1ZJ2A 5FYEA 3CGXA 1KK4A 3VBJA 5DG3A 4HO0A 3U2WA 1GX0A 1LXAA 5L6SA 1R7TA 4XWIA 1R7UA 2Q4JA 4NANA 2AM3A 4P02A 1FRWA 4AC3A 1GWWA 2D7RA 1VH1A 3C8VA 1QGQA 3V0PA 1VZUA 4AAWA 2YQCA 3GUEA 3I0DA 3BSWA 1VGUA 3RMWA 5DEPA 5AFUV 5L6VA 3CKNA 1EZIA 2UX8A 3JUJA 1WT1A 3OH2A 1MP4A 1VGTA 3OH3A 3I0LA 4B3UA 5C4FA 1ZJ0A 3JTJA 1VGWA 1OMXA 1TW1A 1THJA 3V0NA 1G2VA 3KIAA 4HCQA 2JCJA 4Y7GA 3FTTA 2W0WA 1E5KA 3EH0A 1FG5N 5CMFX 2PA4A 5FUHA 5EJZA 1KQAA 4E6UA 4MYOA 1H7FA 1H7LA 1H7GA 1HV9A 3SXBA 1H4DA 1H7EA 3R1WA 1GQCA 1S4PA 5FTSA 3Q7UA 4KT7A 5AFUU 5DDTA 2JCLA 3POLA 4ECMA 1LZIA 3SX8A 2RJ0A 3ZGFA 3BSSA 4JD0A 4HO9A 3BXYA 2BO7A 4M9CA 2IC7A 4MZUA 1VZXA 3IGJA 1SSTA 4FROA 2FYCB 2YC3A 2VSHA 3N9WA 1I52A 4Y63A 5DEMA 1V83A 4HO4A 3FS8A 1MC3A 5CMIA 1H3MA 1JVGA 2YCMA 3T7MA 4M98A 1IIMA 1JV1A 2XMHA 3FSCA 1G0RA 1YP4A 3SPTA 3PKPA 3V0MA 1LL3A 4HO3A 4Y7VA 4DE7A 2WEEA 4IHHA 1PZYB 3F1YA 1ZCUA 4EE5A 1KRVA 3I0EA 3ZF8A 1NF5B 4D0TA 3T7OA 5IDSA 1NKHB 1XHBA 4D11C 2ICXA 1QRLA 1H5TA 5C4CA 2I5EA 2VD4A 1MR7A 2RIJA 5C1LA 5C4EA 2O1FA 1VM8A 1OQMB 4EEOA 1Z90A 1ZI5A 4JISA 3SX7A 2WLCA 2X65A 1ZDFA 5CMGX 1ZJOA 2E8BA 1LL2A 2D7IA 2P72A 4KXOA 4E79A 4K6RA 2P6WA 2RIYA 4B42A 3IOIA 3EE5A 2WAWA 4HOCA 2YQSA 4HUSA 4ARWA 3R5DA 1NMMB 1MRLA 4DDZA 4ZDQA 2DPWA 3U2UA 2X60A 2JF2A 1HM0A 2OEGA 4AA7A 3OUPA 4M28A 4HO5A 2WLDA 1QRGA 4G87A 4E75A 1INIA 1TVYA 4Y7FA 3IXCA 1ZJPA 3OAMA 4EEMA 4P00A 3I0IX 5FU0A 3FSXA 2AE7A 2BO4A 5U2KA 1FR8A 3KWCA 4Y62A 3EEVA 2VHEA 5BXCA 4KC4A 2YQJA 4EEGA 2AQ9A 2JCOA 1OCXA 1QWJA 1H5SC 1QQ0A 4B2WA 4Y6NA 4ASJA 3K8DA 1HJLA 5C3BA 2OI6A 3BCVA 1H5RB 3U0YA 1H7QA 3PNNA 5F42A 3OW5A 4FRDA 3TV0A 4FRQA 1NWGB 3FOQA 2I5KA 1W77A 2FYAA 4EGGA 1WSZA 1ZHJA 3SXEA 5C49A 1MP3A 5IDTA 1WT0A 3T57A 4B4GA 3BRKX 5EJ1A 1J2ZA 5C3AA 4MFGA 4ISXA 1JVDA 1KWSA 3V0LA 4KC1A 1GA8A 4MNDA 3MQGA 1V82A 5CQLX 3T7NA 2QIAA 3OKRA 4MYBA 3SX3A 1PZTA 5C36A 3PMOA 1FOAA 3U0XA 1O7QA 4N6AA 1H5RA 1VH3A 1H5TB 3P1BA 3TK8A 5CMHA 2WLFA 2Y7AA 2VXMA 2Y4JA 4B4MA 1KHRA 3EG4A 1ZI4A
chains in the Genus database with same CATH superfamily
2JF3A 4EABA 3IOJA 3V90A 4B2XA 2YESA 5ADXV 1JYLA 3V0QA 1ZJ1A 1O0RA 3PKQA 3R3IA 2XWNA 3R5AA 4HZCA 4FCEA 3CKJA 2QIVX 1ZCYA 2AGDA 2RIZA 3D5NA 3SXGA 1H4CA 3F1CA 2OEFA 3R2WA 1R7XA 4KPZA 2PX7A 3P47A 3JUKA 2ZU8A 5EIYA 3BFPA 4Q7CA 4HG6A 1H7TA 4EA8A 3I3AA 2PGYA 2RJ6A 5C38A 4Y7TA 1LZJA 3U2TA 2V0IA 4M2AA 3DK5A 1ON8A 3I0JA 3V0OA 1FR9A 1VPAA 1MR9A 1V67A 2VSIA 5C3DA 3GOSA 3O3PA 4H7OA 1YP3A 2GGQA 2D0JA 3NGWA 4FRPA 5C48A 4FRMA 1L0SA 1TZFA 1VGZA 1G93A 1O7OA 3SXCA 5AJPA 5ADXU 3VBMA 4G3PA 1QRMA 2Y6PA 4CVHA 4G3SA 5D91A 4B5BA 3VBKA 5FV9A 4IRQA 2V0JA 1QG8A 2Z87A 2QKXA 1TDTA 1YP2A 3V4EA 2NXVA 1V3WA 2AESA 4KRVA 3ZLKA 3GVDA 1FO9A 1VICA 4D11A 5C4DA 3GQ8A 1XZ6A 4IHGA 2XWLA 5E3PA 4KPXA 3FSYA 3CU0A 5C1HA 2YC5A 4KNXA 1G95A 5CQPA 1YROB 1NHEB 5AJOA 4HO6A 1KK6A 4LW6A 4J18A 2BO8A 3U2VA 4IRPA 1QRFA 4FRHA 4EAAA 3I0HA 2V0KA 4FREA 1XATA 3OH4A 2APCA 4FCUA 2V0LA 2VS5A 1FWYA 2YQHA 5C8RA 1SS9A 1XHDA 4DCLA 4UEGA 2VS4A 2RJ7A 4Y6UA 2V0HA 3V8YA 4E6TA 1FXOA 3Q4SA 4EVWA 3DHOA 2NPOA 2WVLA 1S80A 1HJJA 1S4NA 4AYLA 1WVCA 2AM4A 3OH1A 2MZBA 5CQOA 4DECA 4BQHA 5CMJA 2RIXA 3OTZA 3U2XA 4FRAA 3FSBA 3V8ZA 5JQQA 1G23A 1KRUA 5IFYA 3K8EA 5FTVA 2ICYA 1H5SD 2Y4KA 4L41C 2FFVA 1R80A 1ZJ3A 1QGSA 3TZTA 1O23B 1OMZA 3SX5A 3E26A 2XATA 3FWWA 4HO8A 1TW5A 2P73A 2VS3A 1H5SA 1R7YA 5DDVA 3USRA 3TQDA 1KGQA 1ZDGA 1R82A 4D48A 4EA7A 2WGZA 2AM5A 2RITA 4R37A 1WT3A 3KWEA 3MC4A 2VXLA 2X5SA 2FYDB 3R5CA 3Q80A 4IHFA 4N69A 3SRTA 3HL3A 2A8WA 1GX4A 1JYKA 4EQYA 1JV3A 1GWVA 1S4OA 4C2SA 1G9RA 2O1GA 2IUAA 3VBIA 2QGIA 3HJJA 4HURA 1SSMA 2PGVA 3OU9A 2RJ8A 3TDTA 1FXJA 1FGXA 2FFUA 1LZ7A 2AECA 3TIOA 3TISA 2RJ9A 2XWMA 3I0FA 5FU8A 3GQ9A 4CJBA 2E3DA 4KC2A 4FRLA 4O6MA 2FYBA 1K4VA 2VK9A 4J09A 2W0VA 4AYJA 2CU2A 2ZU9A 3VBNA 3LW6A 4KNRA 3CKOA 1HM9A 2O1HA 2ZU7A 1ON6A 3OH0A 4D0ZA 3OTMA 3HSQA 5E3RA 4G3QA 5J49A 1SSQA 3OGZA 2WVKA 5C4BA 3R5BA 4CJ8A 1EYRA 2VFZA 3SUCA 1G1LA 2AH9A 2Z86A 4NAIA 1T3DA 3CJ8A 2QH5A 3D8VA 3VNPA 4EE3A 2Y4LA 1VZTA 1EWWA 4Y9XA 3V91A 4HO2A 2WLGA 3R8YA 3CKVA 1LL0A 1MP5A 3IOHA 1HM8A 1H4EA 4N27A 4M99A 1LZ0A 3DJ4A 3ZGGA 3I3XA 5CQNX 2Y4MA 2TDTA 1R81A 3NZ2A 3ST8A 2OI5A 4N6BA 1LVWA 4KQLA 4LW3A 3RSBA 3SXDA 1G97A 1ZCVA 4M2BA 3QVBA 1GQ9A 1WT2A 2GGOA 3BSYA 3R3RA 4R7PA 3Q1XA 3VBPA 3D98A 4GBPA 4NALA 1IINA 2IU8A 2RJ5A 4EA9A 3I0CA 5I1FA 1FGGA 3I0GA 3R0SA 5CQMX 2JCKA 1G8OA 3RMVA 3CKQA 2FKOA 3SXAA 1G3LA 2WLEA 1FZWA 5C47A 3F1XA 2XMEA 4Y7UA 3JQYA 4HZDA 2BO6A 4M4KA 4YS8A 1W57A 4ASYA 1H5SB 3TWDA 3I0KA 3DUVA 4EEAA 4B4BA 3VBLA 5E3QA 2WE9A 3ECTA 2WVMA 4FQWA 1KK5A 3KWDA 1KRRA 3E25A 2I7BA 2X5ZA 4EE4A 1QREA 3MQHA 2FY7A 4FRBA 4E1KA 1ZIZA 1H7HA 2IU9A 2RJ4A 3OC9A 2J0AA 3GQAA 2A8UA 4BMAA 1R7VA 4CJCA 1W55A 1ZI3A 1INJA 2P2OA 2RJ1A 4NAKA 4FIXA 3USQA 1V84A 1NQIB 1ZI1A 4Y64A 5C1GA 1FO8A 1ZCTA 2OI7A 1KGTA 2J0BA 5AJNA 5HS2A 3ZLLA 4R36A 1ZJ2A 5FYEA 3CGXA 1KK4A 3VBJA 5DG3A 4HO0A 3U2WA 1GX0A 1LXAA 5L6SA 1R7TA 4XWIA 1R7UA 2Q4JA 4NANA 2AM3A 4P02A 1FRWA 4AC3A 1GWWA 2D7RA 1VH1A 3C8VA 1QGQA 3V0PA 1VZUA 4AAWA 2YQCA 3GUEA 3I0DA 3BSWA 1VGUA 3RMWA 5DEPA 5AFUV 5L6VA 3CKNA 1EZIA 2UX8A 3JUJA 1WT1A 3OH2A 2C0NA 1MP4A 3OH3A 1VGTA 3I0LA 4B3UA 5C4FA 1ZJ0A 3JTJA 1VGWA 1OMXA 1TW1A 1THJA 3V0NA 1G2VA 3KIAA 4HCQA 2JCJA 4Y7GA 3FTTA 2W0WA 1E5KA 3EH0A 1FG5N 5CMFX 2PA4A 5FUHA 5EJZA 1KQAA 4E6UA 4MYOA 1H7FA 1H7LA 1H7GA 1HV9A 3SXBA 1H4DA 1H7EA 3R1WA 1GQCA 1S4PA 5FTSA 3Q7UA 4KT7A 1M8NA 5AFUU 5DDTA 2JCLA 3POLA 4ECMA 1LZIA 3SX8A 2RJ0A 3ZGFA 3BSSA 4JD0A 4HO9A 3BXYA 2BO7A 4M9CA 2IC7A 4MZUA 1VZXA 3IGJA 1SSTA 4FROA 2FYCB 2YC3A 2VSHA 3N9WA 1I52A 4Y63A 5DEMA 1V83A 3GQ7A 4HO4A 3FS8A 1MC3A 5CMIA 1H3MA 1JVGA 2YCMA 3T7MA 1Z2FA 4M98A 1IIMA 1JV1A 2XMHA 3FSCA 1G0RA 4FIYA 1YP4A 3SPTA 3PKPA 3V0MA 1LL3A 4HO3A 4Y7VA 4DE7A 2WEEA 4IHHA 1PZYB 3F1YA 1ZCUA 4EE5A 1KRVA 3I0EA 3ZF8A 1NF5B 4D0TA 3T7OA 5IDSA 1NKHB 1XHBA 4D11C 2ICXA 1QRLA 1H5TA 5C4CA 2I5EA 2VD4A 1MR7A 2RIJA 5C1LA 5C4EA 2O1FA 1VM8A 1OQMB 4EEOA 1Z90A 1ZI5A 4JISA 3SX7A 2WLCA 2X65A 1ZDFA 5CMGX 1N4IA 1ZJOA 1LL2A 2D7IA 2E8BA 2P72A 4KXOA 4E79A 4K6RA 2P6WA 2RIYA 4B42A 3IOIA 3EE5A 2WAWA 4HOCA 2YQSA 4HUSA 4ARWA 3R5DA 1NMMB 1MRLA 4DDZA 4ZDQA 2DPWA 3U2UA 2X60A 2JF2A 1HM0A 2OEGA 4AA7A 3OUPA 4M28A 4HO5A 2WLDA 1QRGA 4G87A 4E75A 1INIA 1TVYA 4Y7FA 3IXCA 1ZJPA 3OAMA 4EEMA 4P00A 3I0IX 5FU0A 3FSXA 2AE7A 2BO4A 5U2KA 1FR8A 3KWCA 4Y62A 3EEVA 2VHEA 5BXCA 4KC4A 2YQJA 4EEGA 2AQ9A 2JCOA 1OCXA 1QWJA 1H5SC 1QQ0A 5D92A 4B2WA 4Y6NA 4ASJA 3K8DA 1HJLA 5C3BA 2OI6A 3BCVA 1H5RB 3U0YA 1H7QA 3PNNA 5F42A 3OW5A 4FRDA 3TV0A 4FRQA 1NWGB 4O6NA 3FOQA 2I5KA 1W77A 2FYAA 4EGGA 1WSZA 1ZHJA 3SXEA 5C49A 1MP3A 5IDTA 1WT0A 3T57A 4B4GA 3BRKX 5EJ1A 1J2ZA 5C3AA 4MFGA 4ISXA 1JVDA 1KWSA 3V0LA 4KC1A 1GA8A 4MIXA 4MNDA 3MQGA 1V82A 5CQLX 3T7NA 2QIAA 3OKRA 4MYBA 3SX3A 1PZTA 5C36A 3PMOA 1FOAA 3U0XA 1O7QA 4N6AA 1H5RA 1VH3A 1H5TB 3P1BA 3TK8A 5CMHA 2WLFA 2Y7AA 2VXMA 2Y4JA 4B4MA 1KHRA 3EG4A 1ZI4A
chains in the Genus database with same CATH topology
2JF3A 4EABA 3IOJA 3V90A 4B2XA 2YESA 5ADXV 1JYLA 3V0QA 1ZJ1A 1O0RA 3PKQA 3R3IA 2XWNA 3R5AA 4HZCA 4FCEA 3CKJA 2QIVX 1ZCYA 2AGDA 2RIZA 3D5NA 3SXGA 1H4CA 3F1CA 2OEFA 3R2WA 1R7XA 4KPZA 2PX7A 3P47A 3JUKA 2ZU8A 5EIYA 3BFPA 4Q7CA 4HG6A 1H7TA 4EA8A 3I3AA 2PGYA 2RJ6A 5C38A 4Y7TA 1LZJA 3U2TA 2V0IA 4M2AA 3DK5A 1ON8A 3I0JA 3V0OA 1FR9A 1VPAA 1MR9A 1V67A 2VSIA 5C3DA 3GOSA 3O3PA 4H7OA 1YP3A 2GGQA 2D0JA 3NGWA 4FRPA 5C48A 4FRMA 1TZFA 1VGZA 1G93A 1O7OA 3SXCA 5AJPA 5ADXU 3VBMA 4G3PA 1QRMA 2Y6PA 4CVHA 4G3SA 5D91A 4B5BA 3VBKA 5FV9A 4IRQA 2V0JA 1QG8A 2Z87A 2QKXA 1TDTA 1YP2A 3V4EA 2NXVA 1V3WA 2AESA 4KRVA 3ZLKA 3GVDA 1FO9A 1VICA 4D11A 5C4DA 1XZ6A 4IHGA 2XWLA 5E3PA 4KPXA 3FSYA 3CU0A 5C1HA 2YC5A 4KNXA 1G95A 5CQPA 1YROB 1NHEB 5AJOA 4HO6A 1KK6A 4LW6A 4J18A 2BO8A 3U2VA 4IRPA 1QRFA 4FRHA 4EAAA 3I0HA 2V0KA 4FREA 1XATA 3OH4A 2APCA 4FCUA 2V0LA 2VS5A 1FWYA 2YQHA 5C8RA 1SS9A 1XHDA 4DCLA 4UEGA 2VS4A 2RJ7A 4Y6UA 2V0HA 3V8YA 4E6TA 1FXOA 3Q4SA 4EVWA 3DHOA 2NPOA 2WVLA 1S80A 1HJJA 1S4NA 4AYLA 1WVCA 2AM4A 3OH1A 2MZBA 5CQOA 4DECA 4BQHA 5CMJA 2RIXA 3OTZA 3U2XA 4FRAA 3FSBA 3V8ZA 5JQQA 1G23A 1KRUA 5IFYA 3K8EA 5FTVA 2ICYA 1H5SD 2Y4KA 4L41C 2FFVA 1R80A 1ZJ3A 1QGSA 3TZTA 1O23B 1OMZA 3SX5A 3E26A 2XATA 3FWWA 4HO8A 1TW5A 2P73A 2VS3A 1H5SA 1R7YA 5DDVA 3USRA 3TQDA 1KGQA 1ZDGA 1R82A 4D48A 4EA7A 2WGZA 2AM5A 2RITA 4R37A 1WT3A 3KWEA 3MC4A 2VXLA 2X5SA 2FYDB 3R5CA 3Q80A 4IHFA 4N69A 3SRTA 3HL3A 2A8WA 1GX4A 1JYKA 4EQYA 1JV3A 1GWVA 1S4OA 4C2SA 1G9RA 2O1GA 2IUAA 3VBIA 2QGIA 3HJJA 4HURA 1SSMA 2PGVA 3OU9A 2RJ8A 3TDTA 1FXJA 1FGXA 2FFUA 1LZ7A 2AECA 3TIOA 3TISA 2RJ9A 2XWMA 3I0FA 5FU8A 4CJBA 2E3DA 4KC2A 4FRLA 4O6MA 2FYBA 1K4VA 2VK9A 4J09A 2W0VA 4AYJA 2CU2A 2ZU9A 3VBNA 3LW6A 4KNRA 3CKOA 1HM9A 2O1HA 2ZU7A 1ON6A 3OH0A 4D0ZA 3OTMA 3HSQA 5E3RA 4G3QA 5J49A 1SSQA 2WVKA 3OGZA 5C4BA 3R5BA 4CJ8A 1EYRA 2VFZA 1G1LA 2AH9A 2Z86A 4NAIA 1T3DA 3CJ8A 2QH5A 3D8VA 3VNPA 4EE3A 2Y4LA 1VZTA 4Y9XA 3V91A 4HO2A 2WLGA 3R8YA 3CKVA 1LL0A 1MP5A 3IOHA 1HM8A 1H4EA 4N27A 4M99A 1LZ0A 3DJ4A 3ZGGA 3I3XA 5CQNX 2Y4MA 2TDTA 1R81A 3NZ2A 3ST8A 2OI5A 4N6BA 1LVWA 4KQLA 4LW3A 3RSBA 3SXDA 1G97A 1ZCVA 4M2BA 3QVBA 1GQ9A 1WT2A 2GGOA 3BSYA 3R3RA 4R7PA 3Q1XA 3VBPA 3D98A 4GBPA 4NALA 1IINA 2IU8A 2RJ5A 4EA9A 3I0CA 5I1FA 1FGGA 3I0GA 3R0SA 5CQMX 2JCKA 1G8OA 3RMVA 3CKQA 2FKOA 3SXAA 1G3LA 2WLEA 1FZWA 5C47A 3F1XA 2XMEA 4Y7UA 3JQYA 4HZDA 2BO6A 4M4KA 4YS8A 1W57A 4ASYA 1H5SB 3TWDA 3I0KA 3DUVA 4EEAA 4B4BA 3VBLA 5E3QA 2WE9A 3ECTA 2WVMA 4FQWA 1KK5A 3KWDA 1KRRA 3E25A 2I7BA 2X5ZA 4EE4A 1QREA 3MQHA 2FY7A 4FRBA 4E1KA 1ZIZA 1H7HA 2IU9A 2RJ4A 3OC9A 2J0AA 2A8UA 4BMAA 1R7VA 4CJCA 1W55A 1ZI3A 1INJA 2P2OA 2RJ1A 4NAKA 4FIXA 3USQA 1V84A 1NQIB 1ZI1A 4Y64A 5C1GA 1FO8A 1ZCTA 2OI7A 1KGTA 2J0BA 5AJNA 5HS2A 3ZLLA 4R36A 1ZJ2A 5FYEA 3CGXA 1KK4A 3VBJA 5DG3A 4HO0A 3U2WA 1GX0A 1LXAA 5L6SA 1R7TA 4XWIA 1R7UA 2Q4JA 4NANA 2AM3A 4P02A 1FRWA 4AC3A 1GWWA 2D7RA 1VH1A 3C8VA 1QGQA 3V0PA 1VZUA 4AAWA 2YQCA 3GUEA 3I0DA 3BSWA 1VGUA 3RMWA 5DEPA 5AFUV 5L6VA 3CKNA 1EZIA 2UX8A 3JUJA 1WT1A 3OH2A 2C0NA 1MP4A 1VGTA 3OH3A 3I0LA 4B3UA 5C4FA 1ZJ0A 3JTJA 1VGWA 1OMXA 1TW1A 1THJA 3V0NA 1G2VA 3KIAA 4HCQA 2JCJA 4Y7GA 3FTTA 2W0WA 1E5KA 3EH0A 1FG5N 5CMFX 2PA4A 5FUHA 5EJZA 1KQAA 4E6UA 4MYOA 1H7FA 1H7LA 1H7GA 1HV9A 3SXBA 1H4DA 1H7EA 3R1WA 1GQCA 1S4PA 5FTSA 3Q7UA 4KT7A 5AFUU 5DDTA 2JCLA 3POLA 4ECMA 1LZIA 3SX8A 2RJ0A 3ZGFA 3BSSA 4JD0A 4HO9A 3BXYA 2BO7A 4M9CA 2IC7A 4MZUA 1VZXA 3IGJA 1SSTA 4FROA 2FYCB 2YC3A 2VSHA 3N9WA 1I52A 4Y63A 5DEMA 1V83A 4HO4A 3FS8A 1MC3A 5CMIA 1H3MA 1JVGA 2YCMA 3T7MA 4M98A 1IIMA 1JV1A 2XMHA 3FSCA 1G0RA 4FIYA 1YP4A 3SPTA 3PKPA 3V0MA 1LL3A 4HO3A 4Y7VA 4DE7A 2WEEA 4IHHA 1PZYB 3F1YA 1ZCUA 4EE5A 1KRVA 3I0EA 3ZF8A 1NF5B 4D0TA 3T7OA 5IDSA 1NKHB 1XHBA 4D11C 2ICXA 1QRLA 1H5TA 5C4CA 2I5EA 2VD4A 1MR7A 2RIJA 5C1LA 5C4EA 2O1FA 1VM8A 1OQMB 4EEOA 1Z90A 1ZI5A 4JISA 3SX7A 2WLCA 2X65A 1ZDFA 5CMGX 1ZJOA 2E8BA 1LL2A 2D7IA 2P72A 4KXOA 4E79A 4K6RA 2P6WA 2RIYA 4B42A 3IOIA 3EE5A 2WAWA 4HOCA 2YQSA 4HUSA 4ARWA 3R5DA 1NMMB 1MRLA 4DDZA 4ZDQA 2DPWA 3U2UA 2X60A 2JF2A 1HM0A 2OEGA 4AA7A 3OUPA 4M28A 4HO5A 2WLDA 1QRGA 4G87A 4E75A 1INIA 1TVYA 4Y7FA 3IXCA 1ZJPA 3OAMA 4EEMA 4P00A 3I0IX 5FU0A 3FSXA 2AE7A 2BO4A 5U2KA 1FR8A 3KWCA 4Y62A 3EEVA 2VHEA 5BXCA 4KC4A 2YQJA 4EEGA 2AQ9A 2JCOA 1OCXA 1QWJA 1H5SC 1QQ0A 5D92A 4B2WA 4Y6NA 4ASJA 3K8DA 1HJLA 5C3BA 2OI6A 3BCVA 1H5RB 3U0YA 1H7QA 3PNNA 5F42A 3OW5A 4FRDA 3TV0A 4FRQA 1NWGB 4O6NA 3FOQA 2I5KA 1W77A 2FYAA 4EGGA 1WSZA 1ZHJA 3SXEA 5C49A 1MP3A 5IDTA 1WT0A 3T57A 4B4GA 3BRKX 5EJ1A 1J2ZA 5C3AA 4MFGA 4ISXA 1JVDA 1KWSA 3V0LA 4KC1A 1GA8A 4MIXA 4MNDA 3MQGA 1V82A 5CQLX 3T7NA 2QIAA 3OKRA 4MYBA 3SX3A 1PZTA 5C36A 3PMOA 1FOAA 3U0XA 1O7QA 4N6AA 1H5RA 1VH3A 1H5TB 3P1BA 3TK8A 5CMHA 2WLFA 2Y7AA 2VXMA 2Y4JA 4B4MA 1KHRA 3EG4A 1ZI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JF3 A;  4EAB A;  3IOJ A;  3V90 A;  4B2X A;  2YES A;  5ADX V;  1JYL A;  3V0Q A;  1ZJ1 A;  1O0R A;  3PKQ A;  3R3I A;  2XWN A;  3R5A A;  4HZC A;  4FCE A;  3CKJ A;  2QIV X;  1ZCY A;  2AGD A;  2RIZ A;  3D5N A;  3SXG A;  1H4C A;  3F1C A;  2OEF A;  3R2W A;  1R7X A;  4KPZ A;  2PX7 A;  3P47 A;  3JUK A;  2ZU8 A;  5EIY A;  3BFP A;  4HG6 A;  1H7T A;  4EA8 A;  3I3A A;  2PGY A;  2RJ6 A;  5C38 A;  4Y7T A;  1LZJ A;  3U2T A;  2V0I A;  4M2A A;  3DK5 A;  1ON8 A;  3I0J A;  3V0O A;  1FR9 A;  1VPA A;  1MR9 A;  1V67 A;  2VSI A;  5C3D A;  3GOS A;  3O3P A;  4H7O A;  1YP3 A;  2GGQ A;  2D0J A;  3NGW A;  4FRP A;  5C48 A;  4FRM A;  1TZF A;  1VGZ A;  1G93 A;  1O7O A;  3SXC A;  5AJP A;  5ADX U;  3VBM A;  4G3P A;  1QRM A;  2Y6P A;  4CVH A;  4G3S A;  4B5B A;  3VBK A;  5FV9 A;  4IRQ A;  2V0J A;  1QG8 A;  2Z87 A;  2QKX A;  1TDT A;  1YP2 A;  3V4E A;  2NXV A;  1V3W A;  2AES A;  4KRV A;  3ZLK A;  3GVD A;  1FO9 A;  1VIC A;  4D11 A;  5C4D A;  1XZ6 A;  4IHG A;  2XWL A;  5E3P A;  4KPX A;  3FSY A;  3CU0 A;  5C1H A;  2YC5 A;  4KNX A;  1G95 A;  5CQP A;  1YRO B;  1NHE B;  5AJO A;  4HO6 A;  1KK6 A;  4LW6 A;  4J18 A;  2BO8 A;  3U2V A;  4IRP A;  1QRF A;  4FRH A;  4EAA A;  3I0H A;  2V0K A;  4FRE A;  1XAT A;  3OH4 A;  2APC A;  4FCU A;  2V0L A;  2VS5 A;  1FWY A;  2YQH A;  5C8R A;  1SS9 A;  1XHD A;  4DCL A;  4UEG A;  2VS4 A;  2RJ7 A;  4Y6U A;  2V0H A;  3V8Y A;  4E6T A;  1FXO A;  3Q4S A;  4EVW A;  3DHO A;  2NPO A;  2WVL A;  1S80 A;  1HJJ A;  1S4N A;  4AYL A;  1WVC A;  2AM4 A;  3OH1 A;  2MZB A;  5CQO A;  4DEC A;  4BQH A;  5CMJ A;  2RIX A;  3OTZ A;  3U2X A;  4FRA A;  3FSB A;  3V8Z A;  5JQQ A;  1G23 A;  1KRU A;  5IFY A;  3K8E A;  5FTV A;  2ICY A;  1H5S D;  2Y4K A;  4L41 C;  2FFV A;  1R80 A;  1ZJ3 A;  1QGS A;  3TZT A;  1O23 B;  1OMZ A;  3SX5 A;  3E26 A;  2XAT A;  3FWW A;  4HO8 A;  1TW5 A;  2P73 A;  2VS3 A;  1H5S A;  1R7Y A;  5DDV A;  3USR A;  3TQD A;  1KGQ A;  1ZDG A;  1R82 A;  4D48 A;  4EA7 A;  2WGZ A;  2AM5 A;  2RIT A;  4R37 A;  1WT3 A;  3KWE A;  3MC4 A;  2VXL A;  2X5S A;  2FYD B;  3R5C A;  3Q80 A;  4IHF A;  4N69 A;  3SRT A;  3HL3 A;  2A8W A;  1GX4 A;  1JYK A;  4EQY A;  1JV3 A;  1GWV A;  1S4O A;  4C2S A;  1G9R A;  2O1G A;  2IUA A;  3VBI A;  2QGI A;  3HJJ A;  4HUR A;  1SSM A;  2PGV A;  3OU9 A;  2RJ8 A;  3TDT A;  1FXJ A;  1FGX A;  2FFU A;  1LZ7 A;  2AEC A;  3TIO A;  3TIS A;  2RJ9 A;  2XWM A;  3I0F A;  5FU8 A;  4CJB A;  2E3D A;  4KC2 A;  4FRL A;  2FYB A;  1K4V A;  4J09 A;  2W0V A;  4AYJ A;  2CU2 A;  2ZU9 A;  3VBN A;  3LW6 A;  4KNR A;  3CKO A;  1HM9 A;  2O1H A;  2ZU7 A;  1ON6 A;  3OH0 A;  4D0Z A;  3OTM A;  3HSQ A;  5E3R A;  4G3Q A;  5J49 A;  1SSQ A;  2WVK A;  3OGZ A;  5C4B A;  3R5B A;  4CJ8 A;  1EYR A;  2VFZ A;  1G1L A;  2AH9 A;  2Z86 A;  4NAI A;  1T3D A;  3CJ8 A;  2QH5 A;  3D8V A;  3VNP A;  4EE3 A;  2Y4L A;  1VZT A;  4Y9X A;  3V91 A;  4HO2 A;  2WLG A;  3R8Y A;  3CKV A;  1LL0 A;  1MP5 A;  3IOH A;  1HM8 A;  1H4E A;  4N27 A;  4M99 A;  1LZ0 A;  3DJ4 A;  3ZGG A;  3I3X A;  5CQN X;  2Y4M A;  2TDT A;  1R81 A;  3NZ2 A;  3ST8 A;  2OI5 A;  4N6B A;  1LVW A;  4KQL A;  4LW3 A;  3RSB A;  3SXD A;  1G97 A;  1ZCV A;  4M2B A;  3QVB A;  1GQ9 A;  1WT2 A;  2GGO A;  3BSY A;  3R3R A;  4R7P A;  3Q1X A;  3VBP A;  3D98 A;  4GBP A;  4NAL A;  1IIN A;  2IU8 A;  2RJ5 A;  4EA9 A;  3I0C A;  5I1F A;  1FGG A;  3I0G A;  3R0S A;  5CQM X;  2JCK A;  1G8O A;  3RMV A;  3CKQ A;  2FKO A;  3SXA A;  1G3L A;  2WLE A;  1FZW A;  5C47 A;  3F1X A;  2XME A;  4Y7U A;  3JQY A;  4HZD A;  2BO6 A;  4M4K A;  4YS8 A;  1W57 A;  4ASY A;  1H5S B;  3TWD A;  3I0K A;  3DUV A;  4EEA A;  4B4B A;  3VBL A;  5E3Q A;  2WE9 A;  3ECT A;  2WVM A;  4FQW A;  1KK5 A;  3KWD A;  1KRR A;  3E25 A;  2I7B A;  2X5Z A;  4EE4 A;  1QRE A;  3MQH A;  2FY7 A;  4FRB A;  4E1K A;  1ZIZ A;  1H7H A;  2IU9 A;  2RJ4 A;  3OC9 A;  2A8U A;  4BMA A;  1R7V A;  4CJC A;  1W55 A;  1ZI3 A;  1INJ A;  2P2O A;  2RJ1 A;  4NAK A;  3USQ A;  1V84 A;  1NQI B;  1ZI1 A;  4Y64 A;  5C1G A;  1FO8 A;  1ZCT A;  2OI7 A;  1KGT A;  5AJN A;  5HS2 A;  3ZLL A;  4R36 A;  1ZJ2 A;  5FYE A;  3CGX A;  1KK4 A;  3VBJ A;  5DG3 A;  4HO0 A;  3U2W A;  1GX0 A;  1LXA A;  5L6S A;  1R7T A;  4XWI A;  1R7U A;  2Q4J A;  4NAN A;  2AM3 A;  4P02 A;  1FRW A;  4AC3 A;  1GWW A;  2D7R A;  1VH1 A;  3C8V A;  1QGQ A;  3V0P A;  1VZU A;  4AAW A;  2YQC A;  3GUE A;  3I0D A;  3BSW A;  1VGU A;  3RMW A;  5DEP A;  5AFU V;  5L6V A;  3CKN A;  1EZI A;  2UX8 A;  3JUJ A;  1WT1 A;  3OH2 A;  1MP4 A;  1VGT A;  3OH3 A;  3I0L A;  4B3U A;  5C4F A;  1ZJ0 A;  3JTJ A;  1VGW A;  1OMX A;  1TW1 A;  1THJ A;  3V0N A;  1G2V A;  3KIA A;  4HCQ A;  2JCJ A;  4Y7G A;  3FTT A;  2W0W A;  1E5K A;  3EH0 A;  1FG5 N;  5CMF X;  2PA4 A;  5FUH A;  5EJZ A;  1KQA A;  4E6U A;  4MYO A;  1H7F A;  1H7L A;  1H7G A;  1HV9 A;  3SXB A;  1H4D A;  1H7E A;  3R1W A;  1GQC A;  1S4P A;  5FTS A;  3Q7U A;  4KT7 A;  5AFU U;  5DDT A;  2JCL A;  3POL A;  4ECM A;  1LZI A;  3SX8 A;  2RJ0 A;  3ZGF A;  3BSS A;  4JD0 A;  4HO9 A;  3BXY A;  2BO7 A;  4M9C A;  2IC7 A;  4MZU A;  1VZX A;  3IGJ A;  1SST A;  4FRO A;  2FYC B;  2YC3 A;  2VSH A;  3N9W A;  1I52 A;  4Y63 A;  5DEM A;  1V83 A;  4HO4 A;  3FS8 A;  1MC3 A;  5CMI A;  1H3M A;  1JVG A;  2YCM A;  3T7M A;  4M98 A;  1IIM A;  1JV1 A;  2XMH A;  3FSC A;  1G0R A;  1YP4 A;  3SPT A;  3PKP A;  3V0M A;  1LL3 A;  4HO3 A;  4Y7V A;  4DE7 A;  2WEE A;  4IHH A;  1PZY B;  3F1Y A;  1ZCU A;  4EE5 A;  1KRV A;  3I0E A;  3ZF8 A;  1NF5 B;  4D0T A;  3T7O A;  5IDS A;  1NKH B;  1XHB A;  4D11 C;  2ICX A;  1QRL A;  1H5T A;  5C4C A;  2I5E A;  2VD4 A;  1MR7 A;  2RIJ A;  5C1L A;  5C4E A;  2O1F A;  1VM8 A;  1OQM B;  4EEO A;  1Z90 A;  1ZI5 A;  4JIS A;  3SX7 A;  2WLC A;  2X65 A;  1ZDF A;  5CMG X;  1ZJO A;  2E8B A;  1LL2 A;  2D7I A;  2P72 A;  4KXO A;  4E79 A;  4K6R A;  2P6W A;  2RIY A;  4B42 A;  3IOI A;  3EE5 A;  2WAW A;  4HOC A;  2YQS A;  4HUS A;  4ARW A;  3R5D A;  1NMM B;  1MRL A;  4DDZ A;  4ZDQ A;  2DPW A;  3U2U A;  2X60 A;  2JF2 A;  1HM0 A;  2OEG A;  4AA7 A;  3OUP A;  4M28 A;  4HO5 A;  2WLD A;  1QRG A;  4G87 A;  4E75 A;  1INI A;  1TVY A;  4Y7F A;  3IXC A;  1ZJP A;  3OAM A;  4EEM A;  4P00 A;  3I0I X;  5FU0 A;  3FSX A;  2AE7 A;  2BO4 A;  5U2K A;  1FR8 A;  3KWC A;  4Y62 A;  3EEV A;  2VHE A;  5BXC A;  4KC4 A;  2YQJ A;  4EEG A;  2AQ9 A;  2JCO A;  1OCX A;  1QWJ A;  1H5S C;  1QQ0 A;  4B2W A;  4Y6N A;  4ASJ A;  3K8D A;  1HJL A;  5C3B A;  2OI6 A;  3BCV A;  1H5R B;  3U0Y A;  1H7Q A;  3PNN A;  5F42 A;  3OW5 A;  4FRD A;  3TV0 A;  4FRQ A;  1NWG B;  3FOQ A;  2I5K A;  1W77 A;  2FYA A;  4EGG A;  1WSZ A;  1ZHJ A;  3SXE A;  5C49 A;  1MP3 A;  5IDT A;  1WT0 A;  3T57 A;  4B4G A;  3BRK X;  5EJ1 A;  1J2Z A;  5C3A A;  4MFG A;  4ISX A;  1JVD A;  1KWS A;  3V0L A;  4KC1 A;  1GA8 A;  4MND A;  3MQG A;  1V82 A;  5CQL X;  3T7N A;  2QIA A;  3OKR A;  4MYB A;  3SX3 A;  1PZT A;  5C36 A;  3PMO A;  1FOA A;  3U0X A;  1O7Q A;  4N6A A;  1H5R A;  1VH3 A;  1H5T B;  3P1B A;  3TK8 A;  5CMH A;  2WLF A;  2Y7A A;  2VXM A;  2Y4J A;  4B4M A;  1KHR A;  3EG4 A;  1ZI4 A; 
#chains in the Genus database with same CATH topology
 2JF3 A;  4EAB A;  3IOJ A;  3V90 A;  4B2X A;  2YES A;  5ADX V;  1JYL A;  3V0Q A;  1ZJ1 A;  1O0R A;  3PKQ A;  3R3I A;  2XWN A;  3R5A A;  4HZC A;  4FCE A;  3CKJ A;  2QIV X;  1ZCY A;  2AGD A;  2RIZ A;  3D5N A;  3SXG A;  1H4C A;  3F1C A;  2OEF A;  3R2W A;  1R7X A;  4KPZ A;  2PX7 A;  3P47 A;  3JUK A;  2ZU8 A;  5EIY A;  3BFP A;  4Q7C A;  4HG6 A;  1H7T A;  4EA8 A;  3I3A A;  2PGY A;  2RJ6 A;  5C38 A;  4Y7T A;  1LZJ A;  3U2T A;  2V0I A;  4M2A A;  3DK5 A;  1ON8 A;  3I0J A;  3V0O A;  1FR9 A;  1VPA A;  1MR9 A;  1V67 A;  2VSI A;  5C3D A;  3GOS A;  3O3P A;  4H7O A;  1YP3 A;  2GGQ A;  2D0J A;  3NGW A;  4FRP A;  5C48 A;  4FRM A;  1L0S A;  1TZF A;  1VGZ A;  1G93 A;  1O7O A;  3SXC A;  5AJP A;  5ADX U;  3VBM A;  4G3P A;  1QRM A;  2Y6P A;  4CVH A;  4G3S A;  5D91 A;  4B5B A;  3VBK A;  5FV9 A;  4IRQ A;  2V0J A;  1QG8 A;  2Z87 A;  2QKX A;  1TDT A;  1YP2 A;  3V4E A;  2NXV A;  1V3W A;  2AES A;  4KRV A;  3ZLK A;  3GVD A;  1FO9 A;  1VIC A;  4D11 A;  5C4D A;  3GQ8 A;  1XZ6 A;  4IHG A;  2XWL A;  5E3P A;  4KPX A;  3FSY A;  3CU0 A;  5C1H A;  2YC5 A;  4KNX A;  1G95 A;  5CQP A;  1YRO B;  1NHE B;  5AJO A;  4HO6 A;  1KK6 A;  4LW6 A;  4J18 A;  2BO8 A;  3U2V A;  4IRP A;  1QRF A;  4FRH A;  4EAA A;  3I0H A;  2V0K A;  4FRE A;  1XAT A;  3OH4 A;  2APC A;  4FCU A;  2V0L A;  2VS5 A;  1FWY A;  2YQH A;  5C8R A;  1SS9 A;  1XHD A;  4DCL A;  4UEG A;  2VS4 A;  2RJ7 A;  4Y6U A;  2V0H A;  3V8Y A;  4E6T A;  1FXO A;  3Q4S A;  4EVW A;  3DHO A;  2NPO A;  2WVL A;  1S80 A;  1HJJ A;  1S4N A;  4AYL A;  1WVC A;  2AM4 A;  3OH1 A;  2MZB A;  5CQO A;  4DEC A;  4BQH A;  5CMJ A;  2RIX A;  3OTZ A;  3U2X A;  4FRA A;  3FSB A;  3V8Z A;  5JQQ A;  1G23 A;  1KRU A;  5IFY A;  3K8E A;  5FTV A;  2ICY A;  1H5S D;  2Y4K A;  4L41 C;  2FFV A;  1R80 A;  1ZJ3 A;  1QGS A;  3TZT A;  1O23 B;  1OMZ A;  3SX5 A;  3E26 A;  2XAT A;  3FWW A;  4HO8 A;  1TW5 A;  2P73 A;  2VS3 A;  1H5S A;  1R7Y A;  5DDV A;  3USR A;  3TQD A;  1KGQ A;  1ZDG A;  1R82 A;  4D48 A;  4EA7 A;  2WGZ A;  2AM5 A;  2RIT A;  4R37 A;  1WT3 A;  3KWE A;  3MC4 A;  2VXL A;  2X5S A;  2FYD B;  3R5C A;  3Q80 A;  4IHF A;  4N69 A;  3SRT A;  3HL3 A;  2A8W A;  1GX4 A;  1JYK A;  4EQY A;  1JV3 A;  1GWV A;  1S4O A;  4C2S A;  1G9R A;  2O1G A;  2IUA A;  3VBI A;  2QGI A;  3HJJ A;  4HUR A;  1SSM A;  2PGV A;  3OU9 A;  2RJ8 A;  3TDT A;  1FXJ A;  1FGX A;  2FFU A;  1LZ7 A;  2AEC A;  3TIO A;  3TIS A;  2RJ9 A;  2XWM A;  3I0F A;  5FU8 A;  3GQ9 A;  4CJB A;  2E3D A;  4KC2 A;  4FRL A;  4O6M A;  2FYB A;  1K4V A;  2VK9 A;  4J09 A;  2W0V A;  4AYJ A;  2CU2 A;  2ZU9 A;  3VBN A;  3LW6 A;  4KNR A;  3CKO A;  1HM9 A;  2O1H A;  2ZU7 A;  1ON6 A;  3OH0 A;  4D0Z A;  3OTM A;  3HSQ A;  5E3R A;  4G3Q A;  5J49 A;  1SSQ A;  3OGZ A;  2WVK A;  5C4B A;  3R5B A;  4CJ8 A;  1EYR A;  2VFZ A;  3SUC A;  1G1L A;  2AH9 A;  2Z86 A;  4NAI A;  1T3D A;  3CJ8 A;  2QH5 A;  3D8V A;  3VNP A;  4EE3 A;  2Y4L A;  1VZT A;  1EWW A;  4Y9X A;  3V91 A;  4HO2 A;  2WLG A;  3R8Y A;  3CKV A;  1LL0 A;  1MP5 A;  3IOH A;  1HM8 A;  1H4E A;  4N27 A;  4M99 A;  1LZ0 A;  3DJ4 A;  3ZGG A;  3I3X A;  5CQN X;  2Y4M A;  2TDT A;  1R81 A;  3NZ2 A;  3ST8 A;  2OI5 A;  4N6B A;  1LVW A;  4KQL A;  4LW3 A;  3RSB A;  3SXD A;  1G97 A;  1ZCV A;  4M2B A;  3QVB A;  1GQ9 A;  1WT2 A;  2GGO A;  3BSY A;  3R3R A;  4R7P A;  3Q1X A;  3VBP A;  3D98 A;  4GBP A;  4NAL A;  1IIN A;  2IU8 A;  2RJ5 A;  4EA9 A;  3I0C A;  5I1F A;  1FGG A;  3I0G A;  3R0S A;  5CQM X;  2JCK A;  1G8O A;  3RMV A;  3CKQ A;  2FKO A;  3SXA A;  1G3L A;  2WLE A;  1FZW A;  5C47 A;  3F1X A;  2XME A;  4Y7U A;  3JQY A;  4HZD A;  2BO6 A;  4M4K A;  4YS8 A;  1W57 A;  4ASY A;  1H5S B;  3TWD A;  3I0K A;  3DUV A;  4EEA A;  4B4B A;  3VBL A;  5E3Q A;  2WE9 A;  3ECT A;  2WVM A;  4FQW A;  1KK5 A;  3KWD A;  1KRR A;  3E25 A;  2I7B A;  2X5Z A;  4EE4 A;  1QRE A;  3MQH A;  2FY7 A;  4FRB A;  4E1K A;  1ZIZ A;  1H7H A;  2IU9 A;  2RJ4 A;  3OC9 A;  2J0A A;  3GQA A;  2A8U A;  4BMA A;  1R7V A;  4CJC A;  1W55 A;  1ZI3 A;  1INJ A;  2P2O A;  2RJ1 A;  4NAK A;  4FIX A;  3USQ A;  1V84 A;  1NQI B;  1ZI1 A;  4Y64 A;  5C1G A;  1FO8 A;  1ZCT A;  2OI7 A;  1KGT A;  2J0B A;  5AJN A;  5HS2 A;  3ZLL A;  4R36 A;  1ZJ2 A;  5FYE A;  3CGX A;  1KK4 A;  3VBJ A;  5DG3 A;  4HO0 A;  3U2W A;  1GX0 A;  1LXA A;  5L6S A;  1R7T A;  4XWI A;  1R7U A;  2Q4J A;  4NAN A;  2AM3 A;  4P02 A;  1FRW A;  4AC3 A;  1GWW A;  2D7R A;  1VH1 A;  3C8V A;  1QGQ A;  3V0P A;  1VZU A;  4AAW A;  2YQC A;  3GUE A;  3I0D A;  3BSW A;  1VGU A;  3RMW A;  5DEP A;  5AFU V;  5L6V A;  3CKN A;  1EZI A;  2UX8 A;  3JUJ A;  1WT1 A;  3OH2 A;  2C0N A;  1MP4 A;  3OH3 A;  1VGT A;  3I0L A;  4B3U A;  5C4F A;  1ZJ0 A;  3JTJ A;  1VGW A;  1OMX A;  1TW1 A;  1THJ A;  3V0N A;  1G2V A;  3KIA A;  4HCQ A;  2JCJ A;  4Y7G A;  3FTT A;  2W0W A;  1E5K A;  3EH0 A;  1FG5 N;  5CMF X;  2PA4 A;  5FUH A;  5EJZ A;  1KQA A;  4E6U A;  4MYO A;  1H7F A;  1H7L A;  1H7G A;  1HV9 A;  3SXB A;  1H4D A;  1H7E A;  3R1W A;  1GQC A;  1S4P A;  5FTS A;  3Q7U A;  4KT7 A;  1M8N A;  5AFU U;  5DDT A;  2JCL A;  3POL A;  4ECM A;  1LZI A;  3SX8 A;  2RJ0 A;  3ZGF A;  3BSS A;  4JD0 A;  4HO9 A;  3BXY A;  2BO7 A;  4M9C A;  2IC7 A;  4MZU A;  1VZX A;  3IGJ A;  1SST A;  4FRO A;  2FYC B;  2YC3 A;  2VSH A;  3N9W A;  1I52 A;  4Y63 A;  5DEM A;  1V83 A;  3GQ7 A;  4HO4 A;  3FS8 A;  1MC3 A;  5CMI A;  1H3M A;  1JVG A;  2YCM A;  3T7M A;  1Z2F A;  4M98 A;  1IIM A;  1JV1 A;  2XMH A;  3FSC A;  1G0R A;  4FIY A;  1YP4 A;  3SPT A;  3PKP A;  3V0M A;  1LL3 A;  4HO3 A;  4Y7V A;  4DE7 A;  2WEE A;  4IHH A;  1PZY B;  3F1Y A;  1ZCU A;  4EE5 A;  1KRV A;  3I0E A;  3ZF8 A;  1NF5 B;  4D0T A;  3T7O A;  5IDS A;  1NKH B;  1XHB A;  4D11 C;  2ICX A;  1QRL A;  1H5T A;  5C4C A;  2I5E A;  2VD4 A;  1MR7 A;  2RIJ A;  5C1L A;  5C4E A;  2O1F A;  1VM8 A;  1OQM B;  4EEO A;  1Z90 A;  1ZI5 A;  4JIS A;  3SX7 A;  2WLC A;  2X65 A;  1ZDF A;  5CMG X;  1N4I A;  1ZJO A;  1LL2 A;  2D7I A;  2E8B A;  2P72 A;  4KXO A;  4E79 A;  4K6R A;  2P6W A;  2RIY A;  4B42 A;  3IOI A;  3EE5 A;  2WAW A;  4HOC A;  2YQS A;  4HUS A;  4ARW A;  3R5D A;  1NMM B;  1MRL A;  4DDZ A;  4ZDQ A;  2DPW A;  3U2U A;  2X60 A;  2JF2 A;  1HM0 A;  2OEG A;  4AA7 A;  3OUP A;  4M28 A;  4HO5 A;  2WLD A;  1QRG A;  4G87 A;  4E75 A;  1INI A;  1TVY A;  4Y7F A;  3IXC A;  1ZJP A;  3OAM A;  4EEM A;  4P00 A;  3I0I X;  5FU0 A;  3FSX A;  2AE7 A;  2BO4 A;  5U2K A;  1FR8 A;  3KWC A;  4Y62 A;  3EEV A;  2VHE A;  5BXC A;  4KC4 A;  2YQJ A;  4EEG A;  2AQ9 A;  2JCO A;  1OCX A;  1QWJ A;  1H5S C;  1QQ0 A;  5D92 A;  4B2W A;  4Y6N A;  4ASJ A;  3K8D A;  1HJL A;  5C3B A;  2OI6 A;  3BCV A;  1H5R B;  3U0Y A;  1H7Q A;  3PNN A;  5F42 A;  3OW5 A;  4FRD A;  3TV0 A;  4FRQ A;  1NWG B;  4O6N A;  3FOQ A;  2I5K A;  1W77 A;  2FYA A;  4EGG A;  1WSZ A;  1ZHJ A;  3SXE A;  5C49 A;  1MP3 A;  5IDT A;  1WT0 A;  3T57 A;  4B4G A;  3BRK X;  5EJ1 A;  1J2Z A;  5C3A A;  4MFG A;  4ISX A;  1JVD A;  1KWS A;  3V0L A;  4KC1 A;  1GA8 A;  4MIX A;  4MND A;  3MQG A;  1V82 A;  5CQL X;  3T7N A;  2QIA A;  3OKR A;  4MYB A;  3SX3 A;  1PZT A;  5C36 A;  3PMO A;  1FOA A;  3U0X A;  1O7Q A;  4N6A A;  1H5R A;  1VH3 A;  1H5T B;  3P1B A;  3TK8 A;  5CMH A;  2WLF A;  2Y7A A;  2VXM A;  2Y4J A;  4B4M A;  1KHR A;  3EG4 A;  1ZI4 A; 
#chains in the Genus database with same CATH homology
 2JF3 A;  4EAB A;  3IOJ A;  3V90 A;  4B2X A;  2YES A;  5ADX V;  1JYL A;  3V0Q A;  1ZJ1 A;  1O0R A;  3PKQ A;  3R3I A;  2XWN A;  3R5A A;  4HZC A;  4FCE A;  3CKJ A;  2QIV X;  1ZCY A;  2AGD A;  2RIZ A;  3D5N A;  3SXG A;  1H4C A;  3F1C A;  2OEF A;  3R2W A;  1R7X A;  4KPZ A;  2PX7 A;  3P47 A;  3JUK A;  2ZU8 A;  5EIY A;  3BFP A;  4Q7C A;  4HG6 A;  1H7T A;  4EA8 A;  3I3A A;  2PGY A;  2RJ6 A;  5C38 A;  4Y7T A;  1LZJ A;  3U2T A;  2V0I A;  4M2A A;  3DK5 A;  1ON8 A;  3I0J A;  3V0O A;  1FR9 A;  1VPA A;  1MR9 A;  1V67 A;  2VSI A;  5C3D A;  3GOS A;  3O3P A;  4H7O A;  1YP3 A;  2GGQ A;  2D0J A;  3NGW A;  4FRP A;  5C48 A;  4FRM A;  1TZF A;  1VGZ A;  1G93 A;  1O7O A;  3SXC A;  5AJP A;  5ADX U;  3VBM A;  4G3P A;  1QRM A;  2Y6P A;  4CVH A;  4G3S A;  5D91 A;  4B5B A;  3VBK A;  5FV9 A;  4IRQ A;  2V0J A;  1QG8 A;  2Z87 A;  2QKX A;  1TDT A;  1YP2 A;  3V4E A;  2NXV A;  1V3W A;  2AES A;  4KRV A;  3ZLK A;  3GVD A;  1FO9 A;  1VIC A;  4D11 A;  5C4D A;  1XZ6 A;  4IHG A;  2XWL A;  5E3P A;  4KPX A;  3FSY A;  3CU0 A;  5C1H A;  2YC5 A;  4KNX A;  1G95 A;  5CQP A;  1YRO B;  1NHE B;  5AJO A;  4HO6 A;  1KK6 A;  4LW6 A;  4J18 A;  2BO8 A;  3U2V A;  4IRP A;  1QRF A;  4FRH A;  4EAA A;  3I0H A;  2V0K A;  4FRE A;  1XAT A;  3OH4 A;  2APC A;  4FCU A;  2V0L A;  2VS5 A;  1FWY A;  2YQH A;  5C8R A;  1SS9 A;  1XHD A;  4DCL A;  4UEG A;  2VS4 A;  2RJ7 A;  4Y6U A;  2V0H A;  3V8Y A;  4E6T A;  1FXO A;  3Q4S A;  4EVW A;  3DHO A;  2NPO A;  2WVL A;  1S80 A;  1HJJ A;  1S4N A;  4AYL A;  1WVC A;  2AM4 A;  3OH1 A;  2MZB A;  5CQO A;  4DEC A;  4BQH A;  5CMJ A;  2RIX A;  3OTZ A;  3U2X A;  4FRA A;  3FSB A;  3V8Z A;  5JQQ A;  1G23 A;  1KRU A;  5IFY A;  3K8E A;  5FTV A;  2ICY A;  1H5S D;  2Y4K A;  4L41 C;  2FFV A;  1R80 A;  1ZJ3 A;  1QGS A;  3TZT A;  1O23 B;  1OMZ A;  3SX5 A;  3E26 A;  2XAT A;  3FWW A;  4HO8 A;  1TW5 A;  2P73 A;  2VS3 A;  1H5S A;  1R7Y A;  5DDV A;  3USR A;  3TQD A;  1KGQ A;  1ZDG A;  1R82 A;  4D48 A;  4EA7 A;  2WGZ A;  2AM5 A;  2RIT A;  4R37 A;  1WT3 A;  3KWE A;  3MC4 A;  2VXL A;  2X5S A;  2FYD B;  3R5C A;  3Q80 A;  4IHF A;  4N69 A;  3SRT A;  3HL3 A;  2A8W A;  1GX4 A;  1JYK A;  4EQY A;  1JV3 A;  1GWV A;  1S4O A;  4C2S A;  1G9R A;  2O1G A;  2IUA A;  3VBI A;  2QGI A;  3HJJ A;  4HUR A;  1SSM A;  2PGV A;  3OU9 A;  2RJ8 A;  3TDT A;  1FXJ A;  1FGX A;  2FFU A;  1LZ7 A;  2AEC A;  3TIO A;  3TIS A;  2RJ9 A;  2XWM A;  3I0F A;  5FU8 A;  4CJB A;  2E3D A;  4KC2 A;  4FRL A;  4O6M A;  2FYB A;  1K4V A;  2VK9 A;  4J09 A;  2W0V A;  4AYJ A;  2CU2 A;  2ZU9 A;  3VBN A;  3LW6 A;  4KNR A;  3CKO A;  1HM9 A;  2O1H A;  2ZU7 A;  1ON6 A;  3OH0 A;  4D0Z A;  3OTM A;  3HSQ A;  5E3R A;  4G3Q A;  5J49 A;  1SSQ A;  2WVK A;  3OGZ A;  5C4B A;  3R5B A;  4CJ8 A;  1EYR A;  2VFZ A;  1G1L A;  2AH9 A;  2Z86 A;  4NAI A;  1T3D A;  3CJ8 A;  2QH5 A;  3D8V A;  3VNP A;  4EE3 A;  2Y4L A;  1VZT A;  4Y9X A;  3V91 A;  4HO2 A;  2WLG A;  3R8Y A;  3CKV A;  1LL0 A;  1MP5 A;  3IOH A;  1HM8 A;  1H4E A;  4N27 A;  4M99 A;  1LZ0 A;  3DJ4 A;  3ZGG A;  3I3X A;  5CQN X;  2Y4M A;  2TDT A;  1R81 A;  3NZ2 A;  3ST8 A;  2OI5 A;  4N6B A;  1LVW A;  4KQL A;  4LW3 A;  3RSB A;  3SXD A;  1G97 A;  1ZCV A;  4M2B A;  3QVB A;  1GQ9 A;  1WT2 A;  2GGO A;  3BSY A;  3R3R A;  4R7P A;  3Q1X A;  3VBP A;  3D98 A;  4GBP A;  4NAL A;  1IIN A;  2IU8 A;  2RJ5 A;  4EA9 A;  3I0C A;  5I1F A;  1FGG A;  3I0G A;  3R0S A;  5CQM X;  2JCK A;  1G8O A;  3RMV A;  3CKQ A;  2FKO A;  3SXA A;  1G3L A;  2WLE A;  1FZW A;  5C47 A;  3F1X A;  2XME A;  4Y7U A;  3JQY A;  4HZD A;  2BO6 A;  4M4K A;  4YS8 A;  1W57 A;  4ASY A;  1H5S B;  3TWD A;  3I0K A;  3DUV A;  4EEA A;  4B4B A;  3VBL A;  5E3Q A;  2WE9 A;  3ECT A;  2WVM A;  4FQW A;  1KK5 A;  3KWD A;  1KRR A;  3E25 A;  2I7B A;  2X5Z A;  4EE4 A;  1QRE A;  3MQH A;  2FY7 A;  4FRB A;  4E1K A;  1ZIZ A;  1H7H A;  2IU9 A;  2RJ4 A;  3OC9 A;  2J0A A;  2A8U A;  4BMA A;  1R7V A;  4CJC A;  1W55 A;  1ZI3 A;  1INJ A;  2P2O A;  2RJ1 A;  4NAK A;  4FIX A;  3USQ A;  1V84 A;  1NQI B;  1ZI1 A;  4Y64 A;  5C1G A;  1FO8 A;  1ZCT A;  2OI7 A;  1KGT A;  2J0B A;  5AJN A;  5HS2 A;  3ZLL A;  4R36 A;  1ZJ2 A;  5FYE A;  3CGX A;  1KK4 A;  3VBJ A;  5DG3 A;  4HO0 A;  3U2W A;  1GX0 A;  1LXA A;  5L6S A;  1R7T A;  4XWI A;  1R7U A;  2Q4J A;  4NAN A;  2AM3 A;  4P02 A;  1FRW A;  4AC3 A;  1GWW A;  2D7R A;  1VH1 A;  3C8V A;  1QGQ A;  3V0P A;  1VZU A;  4AAW A;  2YQC A;  3GUE A;  3I0D A;  3BSW A;  1VGU A;  3RMW A;  5DEP A;  5AFU V;  5L6V A;  3CKN A;  1EZI A;  2UX8 A;  3JUJ A;  1WT1 A;  3OH2 A;  2C0N A;  1MP4 A;  1VGT A;  3OH3 A;  3I0L A;  4B3U A;  5C4F A;  1ZJ0 A;  3JTJ A;  1VGW A;  1OMX A;  1TW1 A;  1THJ A;  3V0N A;  1G2V A;  3KIA A;  4HCQ A;  2JCJ A;  4Y7G A;  3FTT A;  2W0W A;  1E5K A;  3EH0 A;  1FG5 N;  5CMF X;  2PA4 A;  5FUH A;  5EJZ A;  1KQA A;  4E6U A;  4MYO A;  1H7F A;  1H7L A;  1H7G A;  1HV9 A;  3SXB A;  1H4D A;  1H7E A;  3R1W A;  1GQC A;  1S4P A;  5FTS A;  3Q7U A;  4KT7 A;  5AFU U;  5DDT A;  2JCL A;  3POL A;  4ECM A;  1LZI A;  3SX8 A;  2RJ0 A;  3ZGF A;  3BSS A;  4JD0 A;  4HO9 A;  3BXY A;  2BO7 A;  4M9C A;  2IC7 A;  4MZU A;  1VZX A;  3IGJ A;  1SST A;  4FRO A;  2FYC B;  2YC3 A;  2VSH A;  3N9W A;  1I52 A;  4Y63 A;  5DEM A;  1V83 A;  4HO4 A;  3FS8 A;  1MC3 A;  5CMI A;  1H3M A;  1JVG A;  2YCM A;  3T7M A;  4M98 A;  1IIM A;  1JV1 A;  2XMH A;  3FSC A;  1G0R A;  4FIY A;  1YP4 A;  3SPT A;  3PKP A;  3V0M A;  1LL3 A;  4HO3 A;  4Y7V A;  4DE7 A;  2WEE A;  4IHH A;  1PZY B;  3F1Y A;  1ZCU A;  4EE5 A;  1KRV A;  3I0E A;  3ZF8 A;  1NF5 B;  4D0T A;  3T7O A;  5IDS A;  1NKH B;  1XHB A;  4D11 C;  2ICX A;  1QRL A;  1H5T A;  5C4C A;  2I5E A;  2VD4 A;  1MR7 A;  2RIJ A;  5C1L A;  5C4E A;  2O1F A;  1VM8 A;  1OQM B;  4EEO A;  1Z90 A;  1ZI5 A;  4JIS A;  3SX7 A;  2WLC A;  2X65 A;  1ZDF A;  5CMG X;  1ZJO A;  2E8B A;  1LL2 A;  2D7I A;  2P72 A;  4KXO A;  4E79 A;  4K6R A;  2P6W A;  2RIY A;  4B42 A;  3IOI A;  3EE5 A;  2WAW A;  4HOC A;  2YQS A;  4HUS A;  4ARW A;  3R5D A;  1NMM B;  1MRL A;  4DDZ A;  4ZDQ A;  2DPW A;  3U2U A;  2X60 A;  2JF2 A;  1HM0 A;  2OEG A;  4AA7 A;  3OUP A;  4M28 A;  4HO5 A;  2WLD A;  1QRG A;  4G87 A;  4E75 A;  1INI A;  1TVY A;  4Y7F A;  3IXC A;  1ZJP A;  3OAM A;  4EEM A;  4P00 A;  3I0I X;  5FU0 A;  3FSX A;  2AE7 A;  2BO4 A;  5U2K A;  1FR8 A;  3KWC A;  4Y62 A;  3EEV A;  2VHE A;  5BXC A;  4KC4 A;  2YQJ A;  4EEG A;  2AQ9 A;  2JCO A;  1OCX A;  1QWJ A;  1H5S C;  1QQ0 A;  5D92 A;  4B2W A;  4Y6N A;  4ASJ A;  3K8D A;  1HJL A;  5C3B A;  2OI6 A;  3BCV A;  1H5R B;  3U0Y A;  1H7Q A;  3PNN A;  5F42 A;  3OW5 A;  4FRD A;  3TV0 A;  4FRQ A;  1NWG B;  4O6N A;  3FOQ A;  2I5K A;  1W77 A;  2FYA A;  4EGG A;  1WSZ A;  1ZHJ A;  3SXE A;  5C49 A;  1MP3 A;  5IDT A;  1WT0 A;  3T57 A;  4B4G A;  3BRK X;  5EJ1 A;  1J2Z A;  5C3A A;  4MFG A;  4ISX A;  1JVD A;  1KWS A;  3V0L A;  4KC1 A;  1GA8 A;  4MIX A;  4MND A;  3MQG A;  1V82 A;  5CQL X;  3T7N A;  2QIA A;  3OKR A;  4MYB A;  3SX3 A;  1PZT A;  5C36 A;  3PMO A;  1FOA A;  3U0X A;  1O7Q A;  4N6A A;  1H5R A;  1VH3 A;  1H5T B;  3P1B A;  3TK8 A;  5CMH A;  2WLF A;  2Y7A A;  2VXM A;  2Y4J A;  4B4M A;  1KHR A;  3EG4 A;  1ZI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...