3R3IA

Crystal structure of c-terminal truncation of udp-glucose pyrophosphorylase of homo sapiens
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
477
structure length
457
Chain Sequence
b'IRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UTP--glucose-1-phosphate uridylyltransferase
publication title Crystal Structure of UDP-glucose Pyrophosphorylase of Homo sapiens
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 98
structure length 457
sequence length 477
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.9: UTP--glucose-1-phosphate uridylyltransferase.
pdb deposition date 2011-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01704 UDPGP UTP--glucose-1-phosphate uridylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3r3iA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3r3iA01
3VBIA 4DE7A 1EZIA 3PKQA 4KNRA 4B4MA 2FYDB 4AC3A 4M4KA 5CMJA 2AM5A 1W57A 2VXLA 1JYLA 2P2OA 4UEGA 2RJ1A 1TW5A 2V0IA 1HV9A 4AYJA 4HO0A 4HOCA 1V3WA 1H7QA 1KGQA 3I3XA 2XWNA 2WLFA 5FYEA 1VGTA 4AA7A 3BRKX 1VZUA 1LZ0A 3F1YA 2IC7A 2WGZA 3DJ4A 4KQLA 4Y7VA 1V83A 1W55A 3SXDA 3MQHA 1FGGA 2Y4MA 4Y6NA 4N6AA 1HM9A 4NAIA 2WLDA 4E1KA 4D48A 5FTSA 1LL3A 3R2WA 5ADXU 5C48A 1MP4A 3TZTA 5AFUU 2E3DA 5EIYA 4YS8A 1GA8A 1ON6A 4Y7UA 2VS3A 2RJ5A 3V4EA 3K8DA 5C3BA 1R82A 3T7NA 1QG8A 1GX0A 3P1BA 1WT1A 4M2AA 2Z87A 3FSBA 4FCEA 3T7OA 4KPZA 4J18A 3OAMA 2P6WA 1SSQA 1TW1A 4B42A 4HO2A 3I0FA 2JF2A 1QRLA 1SS9A 2P73A 3SX7A 3SPTA 2FFUA 4Y64A 4BQHA 3I0DA 5DEPA 5C4EA 4B2XA 5E3QA 2Y4JA 3V0NA 5C8RA 3Q80A 3JUJA 2JCKA 1WT3A 2ZU7A 2FYBA 3OU9A 1JV3A 4EE5A 1JVDA 1VGUA 1ZCYA 1YP4A 1WT2A 2YQHA 1ZCUA 2BO6A 1LL2A 1KHRA 5C4CA 1FO8A 2X5ZA 5AJPA 1G2VA 3U2XA 1XATA 3TK8A 1MP3A 1KQAA 1R80A 2RIYA 3ZGGA 1I52A 1OQMB 3I0EA 3CKVA 3GVDA 1NKHB 2AGDA 2A8WA 3CKNA 3CKOA 3RMWA 4C2SA 3I3AA 1MP5A 4HO6A 3RSBA 3FTTA 2AE7A 4D11C 2BO7A 2QH5A 4EA9A 3U2UA 3KWEA 2GGOA 3ZF8A 5EJ1A 1INIA 3BXYA 4KXOA 4EA7A 2O1GA 1LZ7A 3V8ZA 1PZTA 1G95A 3EH0A 4MZUA 3TISA 2D7IA 3R3IA 1S4OA 3SXBA 2PGYA 1IIMA 3JUKA 1R7XA 2OI5A 3DHOA 3R3RA 2WLGA 1LL0A 2APCA 2FKOA 1H7LA 4IHGA 3V0QA 1KRUA 5DG3A 2VSHA 1JVGA 2JF3A 4NAKA 5C49A 4R37A 4M98A 3P47A 1FZWA 1QGQA 4Y7GA 4G87A 3FSCA 3R5DA 1ZJ2A 4KT7A 1ZDFA 2RIZA 5L6SA 2NXVA 3U2TA 5C36A 4D0ZA 4IHFA 1GQCA 3I0CA 4Y62A 3OUPA 3VBLA 3Q4SA 2RIXA 4MYOA 2E8BA 4L41C 1JV1A 3FSYA 1GWWA 1XZ6A 4N69A 3CU0A 1ZI4A 2MZBA 4E6UA 3V0MA 2AESA 5FTVA 3CJ8A 3O3PA 1ZJPA 4FRDA 5FU8A 1H5RA 1VGZA 1SSTA 4D11A 2JCJA 3DK5A 1K4VA 2YC5A 4M99A 2OI6A 1VZXA 4HO4A 1OMXA 1G93A 2JCLA 1FXJA 1FGXA 1ZDGA 2RJ0A 1FWYA 1V82A 3C8VA 3I0JA 3OH1A 4G3QA 3U2WA 4E6TA 4FQWA 3R5AA 4MFGA 1VH1A 3CKJA 2X60A 5CQPA 4ASYA 2WEEA 4HO9A 1NHEB 1FRWA 4HO8A 1H7TA 4KC2A 4EEOA 3SX3A 4Y9XA 3D8VA 3SX5A 2RITA 4D0TA 3VBMA 1TDTA 1QRFA 3KWCA 3I0IX 1ZCVA 1J2ZA 1V67A 2VS5A 1GQ9A 2YESA 3F1CA 2WLCA 2AECA 3ZGFA 5DDTA 3SRTA 3OH0A 4FROA 1VM8A 3FS8A 5CMIA 1S4NA 5J49A 1R7UA 1VH3A 5E3PA 3TIOA 2Y4KA 3FSXA 4AAWA 2FFVA 2VS4A 4NALA 2QKXA 3R0SA 1O0RA 4JD0A 3U2VA 2OI7A 5JQQA 3SX8A 3VBNA 1ZJ3A 1ZJOA 1QREA 1H4CA 2X65A 3PMOA 1H5TA 2VHEA 4EE4A 2Q4JA 1IINA 4ECMA 4P00A 3JQYA 1HJLA 1ZIZA 3ZLLA 5C3AA 4EQYA 2IU8A 1GX4A 4Y7FA 5U2KA 3I0LA 4XWIA 3SXEA 1HM8A 2FY7A 4ASJA 1KK5A 1ZHJA 2D7RA 2YCMA 5AJNA 3V0PA 3IGJA 1KRVA 3SXGA 3VBPA 3IOJA 1LXAA 5IDSA 3POLA 3F1XA 2AM3A 4LW3A 4KRVA 4B4BA 1XHDA 4H7OA 1MC3A 4N6BA 3IOHA 4FREA 1HJJA 4BMAA 4EABA 1XHBA 1H5SC 4E75A 4B2WA 5C1GA 2Y7AA 4P02A 1OMZA 2RJ6A 2BO4A 5FU0A 5CMGX 2AQ9A 3SXAA 1H5RB 4EVWA 3EEVA 3OTZA 1R7YA 1PZYB 3OC9A 1VPAA 1ZJ1A 5C47A 4NANA 5IDTA 1KWSA 4HZCA 2QIVX 4HO3A 4M28A 5C4DA 3U0XA 1WVCA 3OGZA 3R5BA 3OH4A 3RMVA 4ZDQA 2UX8A 1Z90A 5C38A 3OW5A 3E25A 2YQJA 1MRLA 2AM4A 2XMHA 1NWGB 2DPWA 3ECTA 3OTMA 1ON8A 4HG6A 4HCQA 3MC4A 4ISXA 4JISA 1G3LA 2GGQA 2WE9A 3CGXA 4LW6A 1WSZA 4N27A 3IXCA 1O7OA 1YP3A 3BSWA 2TDTA 1WT0A 2YQCA 2WAWA 2WLEA 1NF5B 1FXOA 3D5NA 5C1HA 2ZU8A 2X5SA 2RJ4A 1INJA 1YROB 4G3SA 2V0KA 2IUAA 3V91A 1FR9A 2OEGA 4HUSA 2QGIA 4FRQA 3USQA 4EAAA 1YP2A 4KPXA 1KGTA 3NGWA 3LW6A 5ADXV 3EE5A 1H5SA 5AFUV 4EA8A 3PNNA 5C1LA 5IFYA 5DDVA 4CJBA 4KC1A 4Y7TA 3T7MA 1KK6A 2I7BA 4IRPA 1HM0A 1LVWA 2VXMA 2A8UA 3IOIA 1VGWA 1H5TB 1W77A 5CQNX 2QIAA 1LZJA 1H5SD 4MYBA 5BXCA 5FUHA 2Y6PA 1KK4A 2VD4A 5C4BA 1H3MA 2RJ7A 3QVBA 1R81A 1H7GA 2BO8A 1QGSA 3KIAA 4HZDA 1ZI3A 4GBPA 4Y6UA 4E79A 2O1FA 1G23A 2ZU9A 4FCUA 4KC4A 4EE3A 3ZLKA 1QWJA 2PA4A 5C4FA 3GUEA 2V0LA 4M9CA 2JCOA 1SSMA 2ICXA 1R7VA 2VFZA 4EGGA 3HSQA 3NZ2A 3VBKA 3TV0A 3V0LA 3KWDA 1THJA 2XWLA 4B3UA 3OH2A 2ICYA 2CU2A 3JTJA 2D0JA 3HJJA 4MNDA 3V90A 2YQSA 3MQGA 5FV9A 1H4DA 3USRA 3R5CA 2V0HA 4HURA 1FG5N 3R1WA 5DEMA 3Q1XA 5E3RA 1O7QA 1H7FA 1NQIB 3ST8A 5F42A 1TZFA 1ZCTA 2Z86A 2RJ8A 1QRMA 3N9WA 4DDZA 2Y4LA 4EEAA 5I1FA 2VSIA 2W0WA 1OCXA 2W0VA 4FRLA 1VICA 2FYAA 1ZJ0A 3CKQA 1S4PA 2WVLA 4G3PA 1T3DA 4HO5A 1H7HA 3I0GA 3K8EA 2XWMA 1ZI1A 2XMEA 3EG4A 1GWVA 3V8YA 1QQ0A 5CQMX 4Y63A 2PGVA 1NMMB 1G1LA 4CVHA 2NPOA 4FRHA 4FRBA 4IHHA 2O1HA 4AYLA 2YC3A 3TQDA 1FO9A 4CJ8A 4KNXA 3R8YA 1G0RA 3GOSA 3BFPA 2FYCB 1ZI5A 3HL3A 3DUVA 1G97A 4FRAA 5CMFX 3U0YA 3OKRA 1QRGA 2I5KA 3TDTA 3TWDA 4EEMA 4DECA 1R7TA 3BSYA 1TVYA 2XATA 3OH3A 3FWWA 1G9RA 3FOQA 4K6RA 4FRMA 5AJOA 4EEGA 1EYRA 1H7EA 2OEFA 1G8OA 1FOAA 3VBJA 1H4EA 4J09A 4DCLA 1LZIA 3I0KA 4R7PA 3T57A 4IRQA 2P72A 4FRPA 2AH9A 4B5BA 3BCVA 2I5EA 5CQOA 1MR9A 3BSSA 5EJZA 3D98A 3E26A 3SXCA 1KRRA 5CQLX 1S80A 2V0JA 1O23B 4R36A 1V84A 2IU9A 2PX7A 4ARWA 5HS2A 1H5SB 5CMHA 1FR8A 3I0HA 2RIJA 5C3DA 1E5KA 1JYKA 4M2BA 3Q7UA 3V0OA 4CJCA 2RJ9A 5L6VA 2WVKA 2WVMA 3PKPA 4B4GA 1VZTA 3VNPA 1MR7A
chains in the Genus database with same CATH superfamily
3VBIA 4DE7A 1EZIA 3PKQA 4KNRA 4B4MA 2FYDB 4AC3A 4M4KA 5CMJA 2AM5A 1W57A 2VXLA 1JYLA 2P2OA 4UEGA 2RJ1A 1TW5A 2V0IA 1HV9A 4AYJA 4HO0A 4HOCA 1V3WA 1H7QA 1KGQA 3I3XA 2XWNA 3GQ8A 2WLFA 5FYEA 1VGTA 4AA7A 3BRKX 1VZUA 1LZ0A 3F1YA 2IC7A 2WGZA 3DJ4A 4KQLA 4Y7VA 1V83A 1W55A 2VK9A 3SXDA 3MQHA 1FGGA 2Y4MA 4Y6NA 4N6AA 1HM9A 4NAIA 2WLDA 4E1KA 4D48A 5FTSA 1LL3A 3R2WA 5ADXU 5C48A 1MP4A 3TZTA 5AFUU 2E3DA 5EIYA 4YS8A 1GA8A 1ON6A 4Y7UA 2VS3A 2RJ5A 3V4EA 3K8DA 5C3BA 1R82A 3T7NA 1QG8A 2J0BA 1GX0A 3P1BA 4MIXA 1WT1A 4M2AA 2Z87A 3FSBA 4FCEA 3T7OA 4KPZA 4J18A 3OAMA 2P6WA 1SSQA 1TW1A 4B42A 4HO2A 3I0FA 2JF2A 1QRLA 1SS9A 2P73A 3SX7A 3GQAA 3SPTA 2FFUA 4Y64A 4BQHA 3I0DA 5DEPA 5C4EA 4B2XA 5E3QA 2Y4JA 3V0NA 5C8RA 3Q80A 3JUJA 2JCKA 1WT3A 2ZU7A 2FYBA 1M8NA 3OU9A 1JV3A 4EE5A 1JVDA 1VGUA 1ZCYA 1YP4A 1WT2A 2J0AA 2YQHA 1ZCUA 2BO6A 1LL2A 1KHRA 5C4CA 1FO8A 2X5ZA 5AJPA 1G2VA 3U2XA 1XATA 3TK8A 1MP3A 1KQAA 1R80A 2RIYA 3ZGGA 1I52A 1OQMB 3I0EA 3CKVA 3GVDA 1NKHB 2AGDA 2A8WA 3CKNA 3CKOA 3RMWA 4C2SA 3I3AA 1MP5A 4HO6A 4FIXA 3RSBA 3FTTA 2AE7A 4D11C 2BO7A 2QH5A 4EA9A 3U2UA 3KWEA 2GGOA 3ZF8A 5EJ1A 1INIA 3BXYA 4KXOA 4EA7A 2O1GA 1LZ7A 3V8ZA 1PZTA 1G95A 3EH0A 4MZUA 3TISA 2D7IA 3R3IA 1S4OA 3SXBA 2PGYA 1IIMA 3JUKA 1R7XA 2OI5A 3DHOA 3R3RA 2WLGA 1LL0A 2APCA 1Z2FA 2FKOA 1H7LA 4IHGA 3V0QA 1KRUA 5DG3A 2VSHA 1JVGA 2JF3A 4NAKA 5C49A 4R37A 3GQ7A 4M98A 3P47A 1FZWA 1QGQA 4Y7GA 4G87A 3FSCA 3R5DA 1ZJ2A 4KT7A 1ZDFA 2RIZA 4O6MA 5L6SA 2NXVA 3U2TA 5C36A 4D0ZA 4IHFA 1GQCA 3I0CA 4Y62A 3OUPA 3VBLA 3Q4SA 2RIXA 4MYOA 2E8BA 4L41C 1JV1A 3FSYA 1GWWA 1XZ6A 4N69A 3CU0A 1ZI4A 2MZBA 4E6UA 3V0MA 2AESA 5FTVA 3CJ8A 3O3PA 2C0NA 1ZJPA 4FRDA 5FU8A 1H5RA 1VGZA 1SSTA 4D11A 2JCJA 3DK5A 1K4VA 2YC5A 4M99A 2OI6A 1VZXA 5D91A 4HO4A 1OMXA 1G93A 1EWWA 2JCLA 1FXJA 1FGXA 1ZDGA 2RJ0A 1FWYA 1V82A 3C8VA 3I0JA 3OH1A 4G3QA 3U2WA 4E6TA 4FQWA 3R5AA 4MFGA 1VH1A 3CKJA 2X60A 5CQPA 4ASYA 2WEEA 4HO9A 1NHEB 1FRWA 4HO8A 1H7TA 4KC2A 4EEOA 3SX3A 4Y9XA 3D8VA 3SX5A 2RITA 4D0TA 3VBMA 1TDTA 1QRFA 3KWCA 3I0IX 1ZCVA 1J2ZA 1V67A 2VS5A 1GQ9A 2YESA 3F1CA 2WLCA 2AECA 3ZGFA 5DDTA 3OH0A 3SRTA 4FROA 1VM8A 3FS8A 5CMIA 1S4NA 5J49A 1R7UA 1VH3A 5E3PA 3TIOA 2Y4KA 3FSXA 4AAWA 2FFVA 2VS4A 4NALA 2QKXA 3R0SA 1O0RA 4JD0A 3U2VA 2OI7A 5JQQA 3SX8A 3VBNA 1ZJ3A 1ZJOA 1QREA 1H4CA 2X65A 3PMOA 1H5TA 2VHEA 4EE4A 2Q4JA 1IINA 4ECMA 4P00A 3JQYA 5D92A 1HJLA 1ZIZA 3ZLLA 5C3AA 4EQYA 2IU8A 1GX4A 4Y7FA 5U2KA 3I0LA 4XWIA 3SXEA 1HM8A 2FY7A 4ASJA 1KK5A 1ZHJA 2D7RA 2YCMA 5AJNA 3V0PA 3IGJA 1KRVA 3SXGA 3VBPA 3IOJA 1LXAA 5IDSA 3POLA 3F1XA 3GQ9A 2AM3A 4LW3A 4KRVA 4B4BA 1XHDA 4H7OA 1MC3A 4N6BA 3IOHA 4FREA 1HJJA 4BMAA 4EABA 1XHBA 1H5SC 4E75A 4B2WA 5C1GA 2Y7AA 4P02A 1OMZA 2RJ6A 2BO4A 5FU0A 5CMGX 2AQ9A 3SXAA 1H5RB 4EVWA 3EEVA 3OTZA 1R7YA 1PZYB 3OC9A 1VPAA 1ZJ1A 5C47A 4NANA 5IDTA 1KWSA 4HZCA 2QIVX 4HO3A 4M28A 5C4DA 3U0XA 3OGZA 1WVCA 1N4IA 3R5BA 3OH4A 3RMVA 4FIYA 4ZDQA 2UX8A 1Z90A 5C38A 5BXCA 3OW5A 3E25A 2YQJA 1MRLA 2AM4A 2XMHA 1NWGB 2DPWA 3ECTA 3OTMA 1ON8A 4HG6A 4HCQA 3MC4A 4ISXA 4JISA 1G3LA 2GGQA 2WE9A 3CGXA 4LW6A 1WSZA 4N27A 3IXCA 1O7OA 1YP3A 3BSWA 2TDTA 1WT0A 2YQCA 2WAWA 2WLEA 1NF5B 1FXOA 3D5NA 5C1HA 2ZU8A 2X5SA 2RJ4A 1INJA 1YROB 4G3SA 2V0KA 2IUAA 3V91A 1FR9A 2OEGA 4HUSA 2QGIA 4FRQA 3USQA 4EAAA 1YP2A 4KPXA 1KGTA 3NGWA 3LW6A 5ADXV 3EE5A 1H5SA 5AFUV 4EA8A 3PNNA 5C1LA 5IFYA 5DDVA 4CJBA 4KC1A 4Y7TA 3T7MA 1KK6A 2I7BA 4IRPA 1HM0A 1LVWA 2VXMA 2A8UA 3IOIA 1VGWA 1H5TB 1W77A 5CQNX 2QIAA 1LZJA 1H5SD 4MYBA 4O6NA 5FUHA 2Y6PA 1KK4A 2VD4A 5C4BA 1H3MA 2RJ7A 3QVBA 1R81A 1H7GA 2BO8A 1QGSA 3KIAA 4HZDA 1ZI3A 4GBPA 4Y6UA 4E79A 2O1FA 1G23A 2ZU9A 4FCUA 4KC4A 4EE3A 3ZLKA 1QWJA 2PA4A 5C4FA 3GUEA 2V0LA 4M9CA 1L0SA 2JCOA 1SSMA 2ICXA 1R7VA 2VFZA 4EGGA 3HSQA 3NZ2A 3VBKA 3TV0A 3V0LA 3KWDA 1THJA 2XWLA 4B3UA 3OH2A 2ICYA 2CU2A 3JTJA 2D0JA 3HJJA 4MNDA 3V90A 2YQSA 3MQGA 5FV9A 1H4DA 3USRA 3R5CA 2V0HA 4HURA 1FG5N 3R1WA 3SUCA 5DEMA 3Q1XA 5E3RA 1O7QA 1H7FA 1NQIB 3ST8A 5F42A 1TZFA 1ZCTA 2Z86A 2RJ8A 1QRMA 3N9WA 4DDZA 2Y4LA 4EEAA 5I1FA 2VSIA 2W0WA 1OCXA 2W0VA 4FRLA 1VICA 2FYAA 1ZJ0A 3CKQA 1S4PA 2WVLA 4G3PA 1T3DA 4HO5A 1H7HA 3I0GA 3K8EA 2XWMA 1ZI1A 2XMEA 3EG4A 1GWVA 3V8YA 1QQ0A 5CQMX 4Y63A 2PGVA 1NMMB 1G1LA 4CVHA 2NPOA 4FRHA 4FRBA 4IHHA 2O1HA 4AYLA 2YC3A 3TQDA 1FO9A 4CJ8A 4KNXA 3R8YA 1G0RA 3GOSA 3BFPA 2FYCB 1ZI5A 3HL3A 3DUVA 1G97A 4FRAA 5CMFX 3U0YA 3OKRA 1QRGA 2I5KA 3TDTA 3TWDA 4EEMA 4DECA 1R7TA 3BSYA 3OH3A 2XATA 1TVYA 3FWWA 1G9RA 3FOQA 4K6RA 4FRMA 5AJOA 4EEGA 1EYRA 1H7EA 2OEFA 1G8OA 1FOAA 3VBJA 1H4EA 4J09A 4DCLA 1LZIA 3I0KA 4R7PA 3T57A 4IRQA 2P72A 4FRPA 2AH9A 4B5BA 3BCVA 2I5EA 5CQOA 1MR9A 3BSSA 5EJZA 3D98A 3E26A 3SXCA 1KRRA 5CQLX 1S80A 2V0JA 1O23B 4R36A 1V84A 2IU9A 2PX7A 4ARWA 5HS2A 1H5SB 5CMHA 1FR8A 3I0HA 2RIJA 4Q7CA 5C3DA 1E5KA 1JYKA 4M2BA 3Q7UA 3V0OA 4CJCA 2RJ9A 5L6VA 2WVKA 2WVMA 3PKPA 4B4GA 1VZTA 3VNPA 1MR7A
chains in the Genus database with same CATH topology
3VBIA 4DE7A 1EZIA 3PKQA 4KNRA 4B4MA 2FYDB 4AC3A 4M4KA 5CMJA 2AM5A 1W57A 2VXLA 1JYLA 2P2OA 4UEGA 2RJ1A 1TW5A 2V0IA 1HV9A 4AYJA 4HO0A 4HOCA 1V3WA 1H7QA 1KGQA 3I3XA 2XWNA 2WLFA 5FYEA 1VGTA 4AA7A 3BRKX 1VZUA 1LZ0A 3F1YA 2IC7A 2WGZA 3DJ4A 4KQLA 4Y7VA 1V83A 1W55A 2VK9A 3SXDA 3MQHA 1FGGA 2Y4MA 4Y6NA 4N6AA 1HM9A 4NAIA 2WLDA 4E1KA 4D48A 5FTSA 1LL3A 3R2WA 5ADXU 5C48A 1MP4A 3TZTA 5AFUU 2E3DA 5EIYA 4YS8A 1GA8A 1ON6A 4Y7UA 2VS3A 2RJ5A 3V4EA 3K8DA 5C3BA 1R82A 3T7NA 1QG8A 2J0BA 1GX0A 3P1BA 4MIXA 1WT1A 4M2AA 2Z87A 3FSBA 4FCEA 3T7OA 4KPZA 4J18A 3OAMA 2P6WA 1SSQA 1TW1A 4B42A 4HO2A 3I0FA 2JF2A 1QRLA 1SS9A 2P73A 3SX7A 3SPTA 2FFUA 4Y64A 4BQHA 3I0DA 5DEPA 5C4EA 4B2XA 5E3QA 2Y4JA 3V0NA 5C8RA 3Q80A 3JUJA 2JCKA 1WT3A 2ZU7A 2FYBA 3OU9A 1JV3A 4EE5A 1JVDA 1VGUA 1ZCYA 1YP4A 1WT2A 2J0AA 2YQHA 1ZCUA 2BO6A 1LL2A 1KHRA 5C4CA 1FO8A 2X5ZA 5AJPA 1G2VA 3U2XA 1XATA 3TK8A 1MP3A 1KQAA 1R80A 2RIYA 3ZGGA 1I52A 1OQMB 3I0EA 3CKVA 3GVDA 1NKHB 2AGDA 2A8WA 3CKNA 3CKOA 3RMWA 4C2SA 3I3AA 1MP5A 4HO6A 4FIXA 3RSBA 3FTTA 2AE7A 4D11C 2BO7A 2QH5A 4EA9A 3U2UA 3KWEA 2GGOA 3ZF8A 5EJ1A 1INIA 3BXYA 4KXOA 4EA7A 2O1GA 1LZ7A 3V8ZA 1PZTA 1G95A 3EH0A 4MZUA 3TISA 2D7IA 3R3IA 1S4OA 3SXBA 2PGYA 1IIMA 3JUKA 1R7XA 2OI5A 3DHOA 3R3RA 2WLGA 1LL0A 2APCA 2FKOA 1H7LA 4IHGA 3V0QA 1KRUA 5DG3A 2VSHA 1JVGA 2JF3A 4NAKA 5C49A 4R37A 4M98A 3P47A 1FZWA 1QGQA 4Y7GA 4G87A 3FSCA 3R5DA 1ZJ2A 4KT7A 1ZDFA 2RIZA 4O6MA 5L6SA 2NXVA 3U2TA 5C36A 4D0ZA 4IHFA 1GQCA 3I0CA 4Y62A 3OUPA 3VBLA 3Q4SA 2RIXA 4MYOA 2E8BA 4L41C 1JV1A 3FSYA 1GWWA 1XZ6A 4N69A 3CU0A 1ZI4A 2MZBA 4E6UA 3V0MA 2AESA 5FTVA 3CJ8A 3O3PA 2C0NA 1ZJPA 4FRDA 5FU8A 1H5RA 1VGZA 1SSTA 4D11A 2JCJA 3DK5A 1K4VA 2YC5A 4M99A 2OI6A 1VZXA 5D91A 4HO4A 1OMXA 1G93A 2JCLA 1FXJA 1FGXA 1ZDGA 2RJ0A 1FWYA 1V82A 3C8VA 3I0JA 3OH1A 4G3QA 3U2WA 4E6TA 4FQWA 3R5AA 4MFGA 1VH1A 3CKJA 2X60A 5CQPA 4ASYA 2WEEA 4HO9A 1NHEB 1FRWA 4HO8A 1H7TA 4KC2A 4EEOA 3SX3A 4Y9XA 3D8VA 3SX5A 2RITA 4D0TA 3VBMA 1TDTA 1QRFA 3KWCA 3I0IX 1ZCVA 1J2ZA 1V67A 2VS5A 1GQ9A 2YESA 3F1CA 2WLCA 2AECA 3ZGFA 5DDTA 3SRTA 3OH0A 4FROA 1VM8A 3FS8A 5CMIA 1S4NA 5J49A 1R7UA 1VH3A 5E3PA 3TIOA 2Y4KA 3FSXA 4AAWA 2FFVA 2VS4A 4NALA 2QKXA 3R0SA 1O0RA 4JD0A 3U2VA 2OI7A 5JQQA 3SX8A 3VBNA 1ZJ3A 1ZJOA 1QREA 1H4CA 2X65A 3PMOA 1H5TA 2VHEA 4EE4A 2Q4JA 1IINA 4ECMA 4P00A 3JQYA 5D92A 1HJLA 1ZIZA 3ZLLA 5C3AA 4EQYA 2IU8A 1GX4A 4Y7FA 5U2KA 3I0LA 4XWIA 3SXEA 1HM8A 2FY7A 4ASJA 1KK5A 1ZHJA 2D7RA 2YCMA 5AJNA 3V0PA 3IGJA 1KRVA 3SXGA 3VBPA 3IOJA 1LXAA 5IDSA 3POLA 3F1XA 2AM3A 4LW3A 4KRVA 4B4BA 1XHDA 4H7OA 1MC3A 4N6BA 3IOHA 4FREA 1HJJA 4BMAA 4EABA 1XHBA 1H5SC 4E75A 4B2WA 5C1GA 2Y7AA 4P02A 1OMZA 2RJ6A 2BO4A 5FU0A 5CMGX 2AQ9A 3SXAA 1H5RB 4EVWA 3EEVA 3OTZA 1R7YA 1PZYB 3OC9A 1VPAA 1ZJ1A 5C47A 4NANA 5IDTA 1KWSA 4HZCA 2QIVX 4HO3A 4M28A 5C4DA 3U0XA 1WVCA 3OGZA 3R5BA 3OH4A 3RMVA 4FIYA 4ZDQA 2UX8A 1Z90A 5C38A 5BXCA 3OW5A 3E25A 2YQJA 1MRLA 2AM4A 2XMHA 1NWGB 2DPWA 3ECTA 3OTMA 1ON8A 4HG6A 4HCQA 3MC4A 4ISXA 4JISA 1G3LA 2GGQA 2WE9A 3CGXA 4LW6A 1WSZA 4N27A 3IXCA 1O7OA 1YP3A 3BSWA 2TDTA 1WT0A 2YQCA 2WAWA 2WLEA 1NF5B 1FXOA 3D5NA 5C1HA 2ZU8A 2X5SA 2RJ4A 1INJA 1YROB 4G3SA 2V0KA 2IUAA 3V91A 1FR9A 2OEGA 4HUSA 2QGIA 4FRQA 3USQA 4EAAA 1YP2A 4KPXA 1KGTA 3NGWA 3LW6A 5ADXV 3EE5A 1H5SA 5AFUV 4EA8A 3PNNA 5C1LA 5IFYA 5DDVA 4CJBA 4KC1A 4Y7TA 3T7MA 1KK6A 2I7BA 4IRPA 1HM0A 1LVWA 2VXMA 2A8UA 3IOIA 1VGWA 1H5TB 1W77A 5CQNX 2QIAA 1LZJA 1H5SD 4MYBA 4O6NA 5FUHA 2Y6PA 1KK4A 2VD4A 5C4BA 1H3MA 2RJ7A 3QVBA 1R81A 1H7GA 2BO8A 1QGSA 3KIAA 4HZDA 1ZI3A 4GBPA 4Y6UA 4E79A 2O1FA 1G23A 2ZU9A 4FCUA 4KC4A 4EE3A 3ZLKA 1QWJA 2PA4A 5C4FA 3GUEA 2V0LA 4M9CA 2JCOA 1SSMA 2ICXA 1R7VA 2VFZA 4EGGA 3HSQA 3NZ2A 3VBKA 3TV0A 3V0LA 3KWDA 1THJA 2XWLA 4B3UA 3OH2A 2ICYA 2CU2A 3JTJA 2D0JA 3HJJA 4MNDA 3V90A 2YQSA 3MQGA 5FV9A 1H4DA 3USRA 3R5CA 2V0HA 4HURA 1FG5N 3R1WA 5DEMA 3Q1XA 5E3RA 1O7QA 1H7FA 1NQIB 3ST8A 5F42A 1TZFA 1ZCTA 2Z86A 2RJ8A 1QRMA 3N9WA 4DDZA 2Y4LA 4EEAA 5I1FA 2VSIA 2W0WA 1OCXA 2W0VA 4FRLA 1VICA 2FYAA 1ZJ0A 3CKQA 1S4PA 2WVLA 4G3PA 1T3DA 4HO5A 1H7HA 3I0GA 3K8EA 2XWMA 1ZI1A 2XMEA 3EG4A 1GWVA 3V8YA 1QQ0A 5CQMX 4Y63A 2PGVA 1NMMB 1G1LA 4CVHA 2NPOA 4FRHA 4FRBA 4IHHA 2O1HA 4AYLA 2YC3A 3TQDA 1FO9A 4CJ8A 4KNXA 3R8YA 1G0RA 3GOSA 3BFPA 2FYCB 1ZI5A 3HL3A 3DUVA 1G97A 4FRAA 5CMFX 3U0YA 3OKRA 1QRGA 2I5KA 3TDTA 3TWDA 4EEMA 4DECA 1R7TA 3BSYA 1TVYA 2XATA 3OH3A 3FWWA 1G9RA 3FOQA 4K6RA 4FRMA 5AJOA 4EEGA 1EYRA 1H7EA 2OEFA 1G8OA 1FOAA 3VBJA 1H4EA 4J09A 4DCLA 1LZIA 3I0KA 4R7PA 3T57A 4IRQA 2P72A 4FRPA 2AH9A 4B5BA 3BCVA 2I5EA 5CQOA 1MR9A 3BSSA 5EJZA 3D98A 3E26A 3SXCA 1KRRA 5CQLX 1S80A 2V0JA 1O23B 4R36A 1V84A 2IU9A 2PX7A 4ARWA 5HS2A 1H5SB 5CMHA 1FR8A 3I0HA 2RIJA 4Q7CA 5C3DA 1E5KA 1JYKA 4M2BA 3Q7UA 3V0OA 4CJCA 2RJ9A 5L6VA 2WVKA 2WVMA 3PKPA 4B4GA 1VZTA 3VNPA 1MR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VBI A;  4DE7 A;  1EZI A;  3PKQ A;  4KNR A;  4B4M A;  2FYD B;  4AC3 A;  4M4K A;  5CMJ A;  2AM5 A;  1W57 A;  2VXL A;  1JYL A;  2P2O A;  4UEG A;  2RJ1 A;  1TW5 A;  2V0I A;  1HV9 A;  4AYJ A;  4HO0 A;  4HOC A;  1V3W A;  1H7Q A;  1KGQ A;  3I3X A;  2XWN A;  2WLF A;  5FYE A;  1VGT A;  4AA7 A;  3BRK X;  1VZU A;  1LZ0 A;  3F1Y A;  2IC7 A;  2WGZ A;  3DJ4 A;  4KQL A;  4Y7V A;  1V83 A;  1W55 A;  3SXD A;  3MQH A;  1FGG A;  2Y4M A;  4Y6N A;  4N6A A;  1HM9 A;  4NAI A;  2WLD A;  4E1K A;  4D48 A;  5FTS A;  1LL3 A;  3R2W A;  5ADX U;  5C48 A;  1MP4 A;  3TZT A;  5AFU U;  2E3D A;  5EIY A;  4YS8 A;  1GA8 A;  1ON6 A;  4Y7U A;  2VS3 A;  2RJ5 A;  3V4E A;  3K8D A;  5C3B A;  1R82 A;  3T7N A;  1QG8 A;  1GX0 A;  3P1B A;  1WT1 A;  4M2A A;  2Z87 A;  3FSB A;  4FCE A;  3T7O A;  4KPZ A;  4J18 A;  3OAM A;  2P6W A;  1SSQ A;  1TW1 A;  4B42 A;  4HO2 A;  3I0F A;  2JF2 A;  1QRL A;  1SS9 A;  2P73 A;  3SX7 A;  3SPT A;  2FFU A;  4Y64 A;  4BQH A;  3I0D A;  5DEP A;  5C4E A;  4B2X A;  5E3Q A;  2Y4J A;  3V0N A;  5C8R A;  3Q80 A;  3JUJ A;  2JCK A;  1WT3 A;  2ZU7 A;  2FYB A;  3OU9 A;  1JV3 A;  4EE5 A;  1JVD A;  1VGU A;  1ZCY A;  1YP4 A;  1WT2 A;  2YQH A;  1ZCU A;  2BO6 A;  1LL2 A;  1KHR A;  5C4C A;  1FO8 A;  2X5Z A;  5AJP A;  1G2V A;  3U2X A;  1XAT A;  3TK8 A;  1MP3 A;  1KQA A;  1R80 A;  2RIY A;  3ZGG A;  1I52 A;  1OQM B;  3I0E A;  3CKV A;  3GVD A;  1NKH B;  2AGD A;  2A8W A;  3CKN A;  3CKO A;  3RMW A;  4C2S A;  3I3A A;  1MP5 A;  4HO6 A;  3RSB A;  3FTT A;  2AE7 A;  4D11 C;  2BO7 A;  2QH5 A;  4EA9 A;  3U2U A;  3KWE A;  2GGO A;  3ZF8 A;  5EJ1 A;  1INI A;  3BXY A;  4KXO A;  4EA7 A;  2O1G A;  1LZ7 A;  3V8Z A;  1PZT A;  1G95 A;  3EH0 A;  4MZU A;  3TIS A;  2D7I A;  3R3I A;  1S4O A;  3SXB A;  2PGY A;  1IIM A;  3JUK A;  1R7X A;  2OI5 A;  3DHO A;  3R3R A;  2WLG A;  1LL0 A;  2APC A;  2FKO A;  1H7L A;  4IHG A;  3V0Q A;  1KRU A;  5DG3 A;  2VSH A;  1JVG A;  2JF3 A;  4NAK A;  5C49 A;  4R37 A;  4M98 A;  3P47 A;  1FZW A;  1QGQ A;  4Y7G A;  4G87 A;  3FSC A;  3R5D A;  1ZJ2 A;  4KT7 A;  1ZDF A;  2RIZ A;  5L6S A;  2NXV A;  3U2T A;  5C36 A;  4D0Z A;  4IHF A;  1GQC A;  3I0C A;  4Y62 A;  3OUP A;  3VBL A;  3Q4S A;  2RIX A;  4MYO A;  2E8B A;  4L41 C;  1JV1 A;  3FSY A;  1GWW A;  1XZ6 A;  4N69 A;  3CU0 A;  1ZI4 A;  2MZB A;  4E6U A;  3V0M A;  2AES A;  5FTV A;  3CJ8 A;  3O3P A;  1ZJP A;  4FRD A;  5FU8 A;  1H5R A;  1VGZ A;  1SST A;  4D11 A;  2JCJ A;  3DK5 A;  1K4V A;  2YC5 A;  4M99 A;  2OI6 A;  1VZX A;  4HO4 A;  1OMX A;  1G93 A;  2JCL A;  1FXJ A;  1FGX A;  1ZDG A;  2RJ0 A;  1FWY A;  1V82 A;  3C8V A;  3I0J A;  3OH1 A;  4G3Q A;  3U2W A;  4E6T A;  4FQW A;  3R5A A;  4MFG A;  1VH1 A;  3CKJ A;  2X60 A;  5CQP A;  4ASY A;  2WEE A;  4HO9 A;  1NHE B;  1FRW A;  4HO8 A;  1H7T A;  4KC2 A;  4EEO A;  3SX3 A;  4Y9X A;  3D8V A;  3SX5 A;  2RIT A;  4D0T A;  3VBM A;  1TDT A;  1QRF A;  3KWC A;  3I0I X;  1ZCV A;  1J2Z A;  1V67 A;  2VS5 A;  1GQ9 A;  2YES A;  3F1C A;  2WLC A;  2AEC A;  3ZGF A;  5DDT A;  3SRT A;  3OH0 A;  4FRO A;  1VM8 A;  3FS8 A;  5CMI A;  1S4N A;  5J49 A;  1R7U A;  1VH3 A;  5E3P A;  3TIO A;  2Y4K A;  3FSX A;  4AAW A;  2FFV A;  2VS4 A;  4NAL A;  2QKX A;  3R0S A;  1O0R A;  4JD0 A;  3U2V A;  2OI7 A;  5JQQ A;  3SX8 A;  3VBN A;  1ZJ3 A;  1ZJO A;  1QRE A;  1H4C A;  2X65 A;  3PMO A;  1H5T A;  2VHE A;  4EE4 A;  2Q4J A;  1IIN A;  4ECM A;  4P00 A;  3JQY A;  1HJL A;  1ZIZ A;  3ZLL A;  5C3A A;  4EQY A;  2IU8 A;  1GX4 A;  4Y7F A;  5U2K A;  3I0L A;  4XWI A;  3SXE A;  1HM8 A;  2FY7 A;  4ASJ A;  1KK5 A;  1ZHJ A;  2D7R A;  2YCM A;  5AJN A;  3V0P A;  3IGJ A;  1KRV A;  3SXG A;  3VBP A;  3IOJ A;  1LXA A;  5IDS A;  3POL A;  3F1X A;  2AM3 A;  4LW3 A;  4KRV A;  4B4B A;  1XHD A;  4H7O A;  1MC3 A;  4N6B A;  3IOH A;  4FRE A;  1HJJ A;  4BMA A;  4EAB A;  1XHB A;  1H5S C;  4E75 A;  4B2W A;  5C1G A;  2Y7A A;  4P02 A;  1OMZ A;  2RJ6 A;  2BO4 A;  5FU0 A;  5CMG X;  2AQ9 A;  3SXA A;  1H5R B;  4EVW A;  3EEV A;  3OTZ A;  1R7Y A;  1PZY B;  3OC9 A;  1VPA A;  1ZJ1 A;  5C47 A;  4NAN A;  5IDT A;  1KWS A;  4HZC A;  2QIV X;  4HO3 A;  4M28 A;  5C4D A;  3U0X A;  1WVC A;  3OGZ A;  3R5B A;  3OH4 A;  3RMV A;  4ZDQ A;  2UX8 A;  1Z90 A;  5C38 A;  3OW5 A;  3E25 A;  2YQJ A;  1MRL A;  2AM4 A;  2XMH A;  1NWG B;  2DPW A;  3ECT A;  3OTM A;  1ON8 A;  4HG6 A;  4HCQ A;  3MC4 A;  4ISX A;  4JIS A;  1G3L A;  2GGQ A;  2WE9 A;  3CGX A;  4LW6 A;  1WSZ A;  4N27 A;  3IXC A;  1O7O A;  1YP3 A;  3BSW A;  2TDT A;  1WT0 A;  2YQC A;  2WAW A;  2WLE A;  1NF5 B;  1FXO A;  3D5N A;  5C1H A;  2ZU8 A;  2X5S A;  2RJ4 A;  1INJ A;  1YRO B;  4G3S A;  2V0K A;  2IUA A;  3V91 A;  1FR9 A;  2OEG A;  4HUS A;  2QGI A;  4FRQ A;  3USQ A;  4EAA A;  1YP2 A;  4KPX A;  1KGT A;  3NGW A;  3LW6 A;  5ADX V;  3EE5 A;  1H5S A;  5AFU V;  4EA8 A;  3PNN A;  5C1L A;  5IFY A;  5DDV A;  4CJB A;  4KC1 A;  4Y7T A;  3T7M A;  1KK6 A;  2I7B A;  4IRP A;  1HM0 A;  1LVW A;  2VXM A;  2A8U A;  3IOI A;  1VGW A;  1H5T B;  1W77 A;  5CQN X;  2QIA A;  1LZJ A;  1H5S D;  4MYB A;  5BXC A;  5FUH A;  2Y6P A;  1KK4 A;  2VD4 A;  5C4B A;  1H3M A;  2RJ7 A;  3QVB A;  1R81 A;  1H7G A;  2BO8 A;  1QGS A;  3KIA A;  4HZD A;  1ZI3 A;  4GBP A;  4Y6U A;  4E79 A;  2O1F A;  1G23 A;  2ZU9 A;  4FCU A;  4KC4 A;  4EE3 A;  3ZLK A;  1QWJ A;  2PA4 A;  5C4F A;  3GUE A;  2V0L A;  4M9C A;  2JCO A;  1SSM A;  2ICX A;  1R7V A;  2VFZ A;  4EGG A;  3HSQ A;  3NZ2 A;  3VBK A;  3TV0 A;  3V0L A;  3KWD A;  1THJ A;  2XWL A;  4B3U A;  3OH2 A;  2ICY A;  2CU2 A;  3JTJ A;  2D0J A;  3HJJ A;  4MND A;  3V90 A;  2YQS A;  3MQG A;  5FV9 A;  1H4D A;  3USR A;  3R5C A;  2V0H A;  4HUR A;  1FG5 N;  3R1W A;  5DEM A;  3Q1X A;  5E3R A;  1O7Q A;  1H7F A;  1NQI B;  3ST8 A;  5F42 A;  1TZF A;  1ZCT A;  2Z86 A;  2RJ8 A;  1QRM A;  3N9W A;  4DDZ A;  2Y4L A;  4EEA A;  5I1F A;  2VSI A;  2W0W A;  1OCX A;  2W0V A;  4FRL A;  1VIC A;  2FYA A;  1ZJ0 A;  3CKQ A;  1S4P A;  2WVL A;  4G3P A;  1T3D A;  4HO5 A;  1H7H A;  3I0G A;  3K8E A;  2XWM A;  1ZI1 A;  2XME A;  3EG4 A;  1GWV A;  3V8Y A;  1QQ0 A;  5CQM X;  4Y63 A;  2PGV A;  1NMM B;  1G1L A;  4CVH A;  2NPO A;  4FRH A;  4FRB A;  4IHH A;  2O1H A;  4AYL A;  2YC3 A;  3TQD A;  1FO9 A;  4CJ8 A;  4KNX A;  3R8Y A;  1G0R A;  3GOS A;  3BFP A;  2FYC B;  1ZI5 A;  3HL3 A;  3DUV A;  1G97 A;  4FRA A;  5CMF X;  3U0Y A;  3OKR A;  1QRG A;  2I5K A;  3TDT A;  3TWD A;  4EEM A;  4DEC A;  1R7T A;  3BSY A;  1TVY A;  2XAT A;  3OH3 A;  3FWW A;  1G9R A;  3FOQ A;  4K6R A;  4FRM A;  5AJO A;  4EEG A;  1EYR A;  1H7E A;  2OEF A;  1G8O A;  1FOA A;  3VBJ A;  1H4E A;  4J09 A;  4DCL A;  1LZI A;  3I0K A;  4R7P A;  3T57 A;  4IRQ A;  2P72 A;  4FRP A;  2AH9 A;  4B5B A;  3BCV A;  2I5E A;  5CQO A;  1MR9 A;  3BSS A;  5EJZ A;  3D98 A;  3E26 A;  3SXC A;  1KRR A;  5CQL X;  1S80 A;  2V0J A;  1O23 B;  4R36 A;  1V84 A;  2IU9 A;  2PX7 A;  4ARW A;  5HS2 A;  1H5S B;  5CMH A;  1FR8 A;  3I0H A;  2RIJ A;  5C3D A;  1E5K A;  1JYK A;  4M2B A;  3Q7U A;  3V0O A;  4CJC A;  2RJ9 A;  5L6V A;  2WVK A;  2WVM A;  3PKP A;  4B4G A;  1VZT A;  3VNP A;  1MR7 A; 
#chains in the Genus database with same CATH topology
 3VBI A;  4DE7 A;  1EZI A;  3PKQ A;  4KNR A;  4B4M A;  2FYD B;  4AC3 A;  4M4K A;  5CMJ A;  2AM5 A;  1W57 A;  2VXL A;  1JYL A;  2P2O A;  4UEG A;  2RJ1 A;  1TW5 A;  2V0I A;  1HV9 A;  4AYJ A;  4HO0 A;  4HOC A;  1V3W A;  1H7Q A;  1KGQ A;  3I3X A;  2XWN A;  3GQ8 A;  2WLF A;  5FYE A;  1VGT A;  4AA7 A;  3BRK X;  1VZU A;  1LZ0 A;  3F1Y A;  2IC7 A;  2WGZ A;  3DJ4 A;  4KQL A;  4Y7V A;  1V83 A;  1W55 A;  2VK9 A;  3SXD A;  3MQH A;  1FGG A;  2Y4M A;  4Y6N A;  4N6A A;  1HM9 A;  4NAI A;  2WLD A;  4E1K A;  4D48 A;  5FTS A;  1LL3 A;  3R2W A;  5ADX U;  5C48 A;  1MP4 A;  3TZT A;  5AFU U;  2E3D A;  5EIY A;  4YS8 A;  1GA8 A;  1ON6 A;  4Y7U A;  2VS3 A;  2RJ5 A;  3V4E A;  3K8D A;  5C3B A;  1R82 A;  3T7N A;  1QG8 A;  2J0B A;  1GX0 A;  3P1B A;  4MIX A;  1WT1 A;  4M2A A;  2Z87 A;  3FSB A;  4FCE A;  3T7O A;  4KPZ A;  4J18 A;  3OAM A;  2P6W A;  1SSQ A;  1TW1 A;  4B42 A;  4HO2 A;  3I0F A;  2JF2 A;  1QRL A;  1SS9 A;  2P73 A;  3SX7 A;  3GQA A;  3SPT A;  2FFU A;  4Y64 A;  4BQH A;  3I0D A;  5DEP A;  5C4E A;  4B2X A;  5E3Q A;  2Y4J A;  3V0N A;  5C8R A;  3Q80 A;  3JUJ A;  2JCK A;  1WT3 A;  2ZU7 A;  2FYB A;  1M8N A;  3OU9 A;  1JV3 A;  4EE5 A;  1JVD A;  1VGU A;  1ZCY A;  1YP4 A;  1WT2 A;  2J0A A;  2YQH A;  1ZCU A;  2BO6 A;  1LL2 A;  1KHR A;  5C4C A;  1FO8 A;  2X5Z A;  5AJP A;  1G2V A;  3U2X A;  1XAT A;  3TK8 A;  1MP3 A;  1KQA A;  1R80 A;  2RIY A;  3ZGG A;  1I52 A;  1OQM B;  3I0E A;  3CKV A;  3GVD A;  1NKH B;  2AGD A;  2A8W A;  3CKN A;  3CKO A;  3RMW A;  4C2S A;  3I3A A;  1MP5 A;  4HO6 A;  4FIX A;  3RSB A;  3FTT A;  2AE7 A;  4D11 C;  2BO7 A;  2QH5 A;  4EA9 A;  3U2U A;  3KWE A;  2GGO A;  3ZF8 A;  5EJ1 A;  1INI A;  3BXY A;  4KXO A;  4EA7 A;  2O1G A;  1LZ7 A;  3V8Z A;  1PZT A;  1G95 A;  3EH0 A;  4MZU A;  3TIS A;  2D7I A;  3R3I A;  1S4O A;  3SXB A;  2PGY A;  1IIM A;  3JUK A;  1R7X A;  2OI5 A;  3DHO A;  3R3R A;  2WLG A;  1LL0 A;  2APC A;  1Z2F A;  2FKO A;  1H7L A;  4IHG A;  3V0Q A;  1KRU A;  5DG3 A;  2VSH A;  1JVG A;  2JF3 A;  4NAK A;  5C49 A;  4R37 A;  3GQ7 A;  4M98 A;  3P47 A;  1FZW A;  1QGQ A;  4Y7G A;  4G87 A;  3FSC A;  3R5D A;  1ZJ2 A;  4KT7 A;  1ZDF A;  2RIZ A;  4O6M A;  5L6S A;  2NXV A;  3U2T A;  5C36 A;  4D0Z A;  4IHF A;  1GQC A;  3I0C A;  4Y62 A;  3OUP A;  3VBL A;  3Q4S A;  2RIX A;  4MYO A;  2E8B A;  4L41 C;  1JV1 A;  3FSY A;  1GWW A;  1XZ6 A;  4N69 A;  3CU0 A;  1ZI4 A;  2MZB A;  4E6U A;  3V0M A;  2AES A;  5FTV A;  3CJ8 A;  3O3P A;  2C0N A;  1ZJP A;  4FRD A;  5FU8 A;  1H5R A;  1VGZ A;  1SST A;  4D11 A;  2JCJ A;  3DK5 A;  1K4V A;  2YC5 A;  4M99 A;  2OI6 A;  1VZX A;  5D91 A;  4HO4 A;  1OMX A;  1G93 A;  1EWW A;  2JCL A;  1FXJ A;  1FGX A;  1ZDG A;  2RJ0 A;  1FWY A;  1V82 A;  3C8V A;  3I0J A;  3OH1 A;  4G3Q A;  3U2W A;  4E6T A;  4FQW A;  3R5A A;  4MFG A;  1VH1 A;  3CKJ A;  2X60 A;  5CQP A;  4ASY A;  2WEE A;  4HO9 A;  1NHE B;  1FRW A;  4HO8 A;  1H7T A;  4KC2 A;  4EEO A;  3SX3 A;  4Y9X A;  3D8V A;  3SX5 A;  2RIT A;  4D0T A;  3VBM A;  1TDT A;  1QRF A;  3KWC A;  3I0I X;  1ZCV A;  1J2Z A;  1V67 A;  2VS5 A;  1GQ9 A;  2YES A;  3F1C A;  2WLC A;  2AEC A;  3ZGF A;  5DDT A;  3OH0 A;  3SRT A;  4FRO A;  1VM8 A;  3FS8 A;  5CMI A;  1S4N A;  5J49 A;  1R7U A;  1VH3 A;  5E3P A;  3TIO A;  2Y4K A;  3FSX A;  4AAW A;  2FFV A;  2VS4 A;  4NAL A;  2QKX A;  3R0S A;  1O0R A;  4JD0 A;  3U2V A;  2OI7 A;  5JQQ A;  3SX8 A;  3VBN A;  1ZJ3 A;  1ZJO A;  1QRE A;  1H4C A;  2X65 A;  3PMO A;  1H5T A;  2VHE A;  4EE4 A;  2Q4J A;  1IIN A;  4ECM A;  4P00 A;  3JQY A;  5D92 A;  1HJL A;  1ZIZ A;  3ZLL A;  5C3A A;  4EQY A;  2IU8 A;  1GX4 A;  4Y7F A;  5U2K A;  3I0L A;  4XWI A;  3SXE A;  1HM8 A;  2FY7 A;  4ASJ A;  1KK5 A;  1ZHJ A;  2D7R A;  2YCM A;  5AJN A;  3V0P A;  3IGJ A;  1KRV A;  3SXG A;  3VBP A;  3IOJ A;  1LXA A;  5IDS A;  3POL A;  3F1X A;  3GQ9 A;  2AM3 A;  4LW3 A;  4KRV A;  4B4B A;  1XHD A;  4H7O A;  1MC3 A;  4N6B A;  3IOH A;  4FRE A;  1HJJ A;  4BMA A;  4EAB A;  1XHB A;  1H5S C;  4E75 A;  4B2W A;  5C1G A;  2Y7A A;  4P02 A;  1OMZ A;  2RJ6 A;  2BO4 A;  5FU0 A;  5CMG X;  2AQ9 A;  3SXA A;  1H5R B;  4EVW A;  3EEV A;  3OTZ A;  1R7Y A;  1PZY B;  3OC9 A;  1VPA A;  1ZJ1 A;  5C47 A;  4NAN A;  5IDT A;  1KWS A;  4HZC A;  2QIV X;  4HO3 A;  4M28 A;  5C4D A;  3U0X A;  3OGZ A;  1WVC A;  1N4I A;  3R5B A;  3OH4 A;  3RMV A;  4FIY A;  4ZDQ A;  2UX8 A;  1Z90 A;  5C38 A;  5BXC A;  3OW5 A;  3E25 A;  2YQJ A;  1MRL A;  2AM4 A;  2XMH A;  1NWG B;  2DPW A;  3ECT A;  3OTM A;  1ON8 A;  4HG6 A;  4HCQ A;  3MC4 A;  4ISX A;  4JIS A;  1G3L A;  2GGQ A;  2WE9 A;  3CGX A;  4LW6 A;  1WSZ A;  4N27 A;  3IXC A;  1O7O A;  1YP3 A;  3BSW A;  2TDT A;  1WT0 A;  2YQC A;  2WAW A;  2WLE A;  1NF5 B;  1FXO A;  3D5N A;  5C1H A;  2ZU8 A;  2X5S A;  2RJ4 A;  1INJ A;  1YRO B;  4G3S A;  2V0K A;  2IUA A;  3V91 A;  1FR9 A;  2OEG A;  4HUS A;  2QGI A;  4FRQ A;  3USQ A;  4EAA A;  1YP2 A;  4KPX A;  1KGT A;  3NGW A;  3LW6 A;  5ADX V;  3EE5 A;  1H5S A;  5AFU V;  4EA8 A;  3PNN A;  5C1L A;  5IFY A;  5DDV A;  4CJB A;  4KC1 A;  4Y7T A;  3T7M A;  1KK6 A;  2I7B A;  4IRP A;  1HM0 A;  1LVW A;  2VXM A;  2A8U A;  3IOI A;  1VGW A;  1H5T B;  1W77 A;  5CQN X;  2QIA A;  1LZJ A;  1H5S D;  4MYB A;  4O6N A;  5FUH A;  2Y6P A;  1KK4 A;  2VD4 A;  5C4B A;  1H3M A;  2RJ7 A;  3QVB A;  1R81 A;  1H7G A;  2BO8 A;  1QGS A;  3KIA A;  4HZD A;  1ZI3 A;  4GBP A;  4Y6U A;  4E79 A;  2O1F A;  1G23 A;  2ZU9 A;  4FCU A;  4KC4 A;  4EE3 A;  3ZLK A;  1QWJ A;  2PA4 A;  5C4F A;  3GUE A;  2V0L A;  4M9C A;  1L0S A;  2JCO A;  1SSM A;  2ICX A;  1R7V A;  2VFZ A;  4EGG A;  3HSQ A;  3NZ2 A;  3VBK A;  3TV0 A;  3V0L A;  3KWD A;  1THJ A;  2XWL A;  4B3U A;  3OH2 A;  2ICY A;  2CU2 A;  3JTJ A;  2D0J A;  3HJJ A;  4MND A;  3V90 A;  2YQS A;  3MQG A;  5FV9 A;  1H4D A;  3USR A;  3R5C A;  2V0H A;  4HUR A;  1FG5 N;  3R1W A;  3SUC A;  5DEM A;  3Q1X A;  5E3R A;  1O7Q A;  1H7F A;  1NQI B;  3ST8 A;  5F42 A;  1TZF A;  1ZCT A;  2Z86 A;  2RJ8 A;  1QRM A;  3N9W A;  4DDZ A;  2Y4L A;  4EEA A;  5I1F A;  2VSI A;  2W0W A;  1OCX A;  2W0V A;  4FRL A;  1VIC A;  2FYA A;  1ZJ0 A;  3CKQ A;  1S4P A;  2WVL A;  4G3P A;  1T3D A;  4HO5 A;  1H7H A;  3I0G A;  3K8E A;  2XWM A;  1ZI1 A;  2XME A;  3EG4 A;  1GWV A;  3V8Y A;  1QQ0 A;  5CQM X;  4Y63 A;  2PGV A;  1NMM B;  1G1L A;  4CVH A;  2NPO A;  4FRH A;  4FRB A;  4IHH A;  2O1H A;  4AYL A;  2YC3 A;  3TQD A;  1FO9 A;  4CJ8 A;  4KNX A;  3R8Y A;  1G0R A;  3GOS A;  3BFP A;  2FYC B;  1ZI5 A;  3HL3 A;  3DUV A;  1G97 A;  4FRA A;  5CMF X;  3U0Y A;  3OKR A;  1QRG A;  2I5K A;  3TDT A;  3TWD A;  4EEM A;  4DEC A;  1R7T A;  3BSY A;  3OH3 A;  2XAT A;  1TVY A;  3FWW A;  1G9R A;  3FOQ A;  4K6R A;  4FRM A;  5AJO A;  4EEG A;  1EYR A;  1H7E A;  2OEF A;  1G8O A;  1FOA A;  3VBJ A;  1H4E A;  4J09 A;  4DCL A;  1LZI A;  3I0K A;  4R7P A;  3T57 A;  4IRQ A;  2P72 A;  4FRP A;  2AH9 A;  4B5B A;  3BCV A;  2I5E A;  5CQO A;  1MR9 A;  3BSS A;  5EJZ A;  3D98 A;  3E26 A;  3SXC A;  1KRR A;  5CQL X;  1S80 A;  2V0J A;  1O23 B;  4R36 A;  1V84 A;  2IU9 A;  2PX7 A;  4ARW A;  5HS2 A;  1H5S B;  5CMH A;  1FR8 A;  3I0H A;  2RIJ A;  4Q7C A;  5C3D A;  1E5K A;  1JYK A;  4M2B A;  3Q7U A;  3V0O A;  4CJC A;  2RJ9 A;  5L6V A;  2WVK A;  2WVM A;  3PKP A;  4B4G A;  1VZT A;  3VNP A;  1MR7 A; 
#chains in the Genus database with same CATH homology
 3VBI A;  4DE7 A;  1EZI A;  3PKQ A;  4KNR A;  4B4M A;  2FYD B;  4AC3 A;  4M4K A;  5CMJ A;  2AM5 A;  1W57 A;  2VXL A;  1JYL A;  2P2O A;  4UEG A;  2RJ1 A;  1TW5 A;  2V0I A;  1HV9 A;  4AYJ A;  4HO0 A;  4HOC A;  1V3W A;  1H7Q A;  1KGQ A;  3I3X A;  2XWN A;  2WLF A;  5FYE A;  1VGT A;  4AA7 A;  3BRK X;  1VZU A;  1LZ0 A;  3F1Y A;  2IC7 A;  2WGZ A;  3DJ4 A;  4KQL A;  4Y7V A;  1V83 A;  1W55 A;  2VK9 A;  3SXD A;  3MQH A;  1FGG A;  2Y4M A;  4Y6N A;  4N6A A;  1HM9 A;  4NAI A;  2WLD A;  4E1K A;  4D48 A;  5FTS A;  1LL3 A;  3R2W A;  5ADX U;  5C48 A;  1MP4 A;  3TZT A;  5AFU U;  2E3D A;  5EIY A;  4YS8 A;  1GA8 A;  1ON6 A;  4Y7U A;  2VS3 A;  2RJ5 A;  3V4E A;  3K8D A;  5C3B A;  1R82 A;  3T7N A;  1QG8 A;  2J0B A;  1GX0 A;  3P1B A;  4MIX A;  1WT1 A;  4M2A A;  2Z87 A;  3FSB A;  4FCE A;  3T7O A;  4KPZ A;  4J18 A;  3OAM A;  2P6W A;  1SSQ A;  1TW1 A;  4B42 A;  4HO2 A;  3I0F A;  2JF2 A;  1QRL A;  1SS9 A;  2P73 A;  3SX7 A;  3SPT A;  2FFU A;  4Y64 A;  4BQH A;  3I0D A;  5DEP A;  5C4E A;  4B2X A;  5E3Q A;  2Y4J A;  3V0N A;  5C8R A;  3Q80 A;  3JUJ A;  2JCK A;  1WT3 A;  2ZU7 A;  2FYB A;  3OU9 A;  1JV3 A;  4EE5 A;  1JVD A;  1VGU A;  1ZCY A;  1YP4 A;  1WT2 A;  2J0A A;  2YQH A;  1ZCU A;  2BO6 A;  1LL2 A;  1KHR A;  5C4C A;  1FO8 A;  2X5Z A;  5AJP A;  1G2V A;  3U2X A;  1XAT A;  3TK8 A;  1MP3 A;  1KQA A;  1R80 A;  2RIY A;  3ZGG A;  1I52 A;  1OQM B;  3I0E A;  3CKV A;  3GVD A;  1NKH B;  2AGD A;  2A8W A;  3CKN A;  3CKO A;  3RMW A;  4C2S A;  3I3A A;  1MP5 A;  4HO6 A;  4FIX A;  3RSB A;  3FTT A;  2AE7 A;  4D11 C;  2BO7 A;  2QH5 A;  4EA9 A;  3U2U A;  3KWE A;  2GGO A;  3ZF8 A;  5EJ1 A;  1INI A;  3BXY A;  4KXO A;  4EA7 A;  2O1G A;  1LZ7 A;  3V8Z A;  1PZT A;  1G95 A;  3EH0 A;  4MZU A;  3TIS A;  2D7I A;  3R3I A;  1S4O A;  3SXB A;  2PGY A;  1IIM A;  3JUK A;  1R7X A;  2OI5 A;  3DHO A;  3R3R A;  2WLG A;  1LL0 A;  2APC A;  2FKO A;  1H7L A;  4IHG A;  3V0Q A;  1KRU A;  5DG3 A;  2VSH A;  1JVG A;  2JF3 A;  4NAK A;  5C49 A;  4R37 A;  4M98 A;  3P47 A;  1FZW A;  1QGQ A;  4Y7G A;  4G87 A;  3FSC A;  3R5D A;  1ZJ2 A;  4KT7 A;  1ZDF A;  2RIZ A;  4O6M A;  5L6S A;  2NXV A;  3U2T A;  5C36 A;  4D0Z A;  4IHF A;  1GQC A;  3I0C A;  4Y62 A;  3OUP A;  3VBL A;  3Q4S A;  2RIX A;  4MYO A;  2E8B A;  4L41 C;  1JV1 A;  3FSY A;  1GWW A;  1XZ6 A;  4N69 A;  3CU0 A;  1ZI4 A;  2MZB A;  4E6U A;  3V0M A;  2AES A;  5FTV A;  3CJ8 A;  3O3P A;  2C0N A;  1ZJP A;  4FRD A;  5FU8 A;  1H5R A;  1VGZ A;  1SST A;  4D11 A;  2JCJ A;  3DK5 A;  1K4V A;  2YC5 A;  4M99 A;  2OI6 A;  1VZX A;  5D91 A;  4HO4 A;  1OMX A;  1G93 A;  2JCL A;  1FXJ A;  1FGX A;  1ZDG A;  2RJ0 A;  1FWY A;  1V82 A;  3C8V A;  3I0J A;  3OH1 A;  4G3Q A;  3U2W A;  4E6T A;  4FQW A;  3R5A A;  4MFG A;  1VH1 A;  3CKJ A;  2X60 A;  5CQP A;  4ASY A;  2WEE A;  4HO9 A;  1NHE B;  1FRW A;  4HO8 A;  1H7T A;  4KC2 A;  4EEO A;  3SX3 A;  4Y9X A;  3D8V A;  3SX5 A;  2RIT A;  4D0T A;  3VBM A;  1TDT A;  1QRF A;  3KWC A;  3I0I X;  1ZCV A;  1J2Z A;  1V67 A;  2VS5 A;  1GQ9 A;  2YES A;  3F1C A;  2WLC A;  2AEC A;  3ZGF A;  5DDT A;  3SRT A;  3OH0 A;  4FRO A;  1VM8 A;  3FS8 A;  5CMI A;  1S4N A;  5J49 A;  1R7U A;  1VH3 A;  5E3P A;  3TIO A;  2Y4K A;  3FSX A;  4AAW A;  2FFV A;  2VS4 A;  4NAL A;  2QKX A;  3R0S A;  1O0R A;  4JD0 A;  3U2V A;  2OI7 A;  5JQQ A;  3SX8 A;  3VBN A;  1ZJ3 A;  1ZJO A;  1QRE A;  1H4C A;  2X65 A;  3PMO A;  1H5T A;  2VHE A;  4EE4 A;  2Q4J A;  1IIN A;  4ECM A;  4P00 A;  3JQY A;  5D92 A;  1HJL A;  1ZIZ A;  3ZLL A;  5C3A A;  4EQY A;  2IU8 A;  1GX4 A;  4Y7F A;  5U2K A;  3I0L A;  4XWI A;  3SXE A;  1HM8 A;  2FY7 A;  4ASJ A;  1KK5 A;  1ZHJ A;  2D7R A;  2YCM A;  5AJN A;  3V0P A;  3IGJ A;  1KRV A;  3SXG A;  3VBP A;  3IOJ A;  1LXA A;  5IDS A;  3POL A;  3F1X A;  2AM3 A;  4LW3 A;  4KRV A;  4B4B A;  1XHD A;  4H7O A;  1MC3 A;  4N6B A;  3IOH A;  4FRE A;  1HJJ A;  4BMA A;  4EAB A;  1XHB A;  1H5S C;  4E75 A;  4B2W A;  5C1G A;  2Y7A A;  4P02 A;  1OMZ A;  2RJ6 A;  2BO4 A;  5FU0 A;  5CMG X;  2AQ9 A;  3SXA A;  1H5R B;  4EVW A;  3EEV A;  3OTZ A;  1R7Y A;  1PZY B;  3OC9 A;  1VPA A;  1ZJ1 A;  5C47 A;  4NAN A;  5IDT A;  1KWS A;  4HZC A;  2QIV X;  4HO3 A;  4M28 A;  5C4D A;  3U0X A;  1WVC A;  3OGZ A;  3R5B A;  3OH4 A;  3RMV A;  4FIY A;  4ZDQ A;  2UX8 A;  1Z90 A;  5C38 A;  5BXC A;  3OW5 A;  3E25 A;  2YQJ A;  1MRL A;  2AM4 A;  2XMH A;  1NWG B;  2DPW A;  3ECT A;  3OTM A;  1ON8 A;  4HG6 A;  4HCQ A;  3MC4 A;  4ISX A;  4JIS A;  1G3L A;  2GGQ A;  2WE9 A;  3CGX A;  4LW6 A;  1WSZ A;  4N27 A;  3IXC A;  1O7O A;  1YP3 A;  3BSW A;  2TDT A;  1WT0 A;  2YQC A;  2WAW A;  2WLE A;  1NF5 B;  1FXO A;  3D5N A;  5C1H A;  2ZU8 A;  2X5S A;  2RJ4 A;  1INJ A;  1YRO B;  4G3S A;  2V0K A;  2IUA A;  3V91 A;  1FR9 A;  2OEG A;  4HUS A;  2QGI A;  4FRQ A;  3USQ A;  4EAA A;  1YP2 A;  4KPX A;  1KGT A;  3NGW A;  3LW6 A;  5ADX V;  3EE5 A;  1H5S A;  5AFU V;  4EA8 A;  3PNN A;  5C1L A;  5IFY A;  5DDV A;  4CJB A;  4KC1 A;  4Y7T A;  3T7M A;  1KK6 A;  2I7B A;  4IRP A;  1HM0 A;  1LVW A;  2VXM A;  2A8U A;  3IOI A;  1VGW A;  1H5T B;  1W77 A;  5CQN X;  2QIA A;  1LZJ A;  1H5S D;  4MYB A;  4O6N A;  5FUH A;  2Y6P A;  1KK4 A;  2VD4 A;  5C4B A;  1H3M A;  2RJ7 A;  3QVB A;  1R81 A;  1H7G A;  2BO8 A;  1QGS A;  3KIA A;  4HZD A;  1ZI3 A;  4GBP A;  4Y6U A;  4E79 A;  2O1F A;  1G23 A;  2ZU9 A;  4FCU A;  4KC4 A;  4EE3 A;  3ZLK A;  1QWJ A;  2PA4 A;  5C4F A;  3GUE A;  2V0L A;  4M9C A;  2JCO A;  1SSM A;  2ICX A;  1R7V A;  2VFZ A;  4EGG A;  3HSQ A;  3NZ2 A;  3VBK A;  3TV0 A;  3V0L A;  3KWD A;  1THJ A;  2XWL A;  4B3U A;  3OH2 A;  2ICY A;  2CU2 A;  3JTJ A;  2D0J A;  3HJJ A;  4MND A;  3V90 A;  2YQS A;  3MQG A;  5FV9 A;  1H4D A;  3USR A;  3R5C A;  2V0H A;  4HUR A;  1FG5 N;  3R1W A;  5DEM A;  3Q1X A;  5E3R A;  1O7Q A;  1H7F A;  1NQI B;  3ST8 A;  5F42 A;  1TZF A;  1ZCT A;  2Z86 A;  2RJ8 A;  1QRM A;  3N9W A;  4DDZ A;  2Y4L A;  4EEA A;  5I1F A;  2VSI A;  2W0W A;  1OCX A;  2W0V A;  4FRL A;  1VIC A;  2FYA A;  1ZJ0 A;  3CKQ A;  1S4P A;  2WVL A;  4G3P A;  1T3D A;  4HO5 A;  1H7H A;  3I0G A;  3K8E A;  2XWM A;  1ZI1 A;  2XME A;  3EG4 A;  1GWV A;  3V8Y A;  1QQ0 A;  5CQM X;  4Y63 A;  2PGV A;  1NMM B;  1G1L A;  4CVH A;  2NPO A;  4FRH A;  4FRB A;  4IHH A;  2O1H A;  4AYL A;  2YC3 A;  3TQD A;  1FO9 A;  4CJ8 A;  4KNX A;  3R8Y A;  1G0R A;  3GOS A;  3BFP A;  2FYC B;  1ZI5 A;  3HL3 A;  3DUV A;  1G97 A;  4FRA A;  5CMF X;  3U0Y A;  3OKR A;  1QRG A;  2I5K A;  3TDT A;  3TWD A;  4EEM A;  4DEC A;  1R7T A;  3BSY A;  1TVY A;  2XAT A;  3OH3 A;  3FWW A;  1G9R A;  3FOQ A;  4K6R A;  4FRM A;  5AJO A;  4EEG A;  1EYR A;  1H7E A;  2OEF A;  1G8O A;  1FOA A;  3VBJ A;  1H4E A;  4J09 A;  4DCL A;  1LZI A;  3I0K A;  4R7P A;  3T57 A;  4IRQ A;  2P72 A;  4FRP A;  2AH9 A;  4B5B A;  3BCV A;  2I5E A;  5CQO A;  1MR9 A;  3BSS A;  5EJZ A;  3D98 A;  3E26 A;  3SXC A;  1KRR A;  5CQL X;  1S80 A;  2V0J A;  1O23 B;  4R36 A;  1V84 A;  2IU9 A;  2PX7 A;  4ARW A;  5HS2 A;  1H5S B;  5CMH A;  1FR8 A;  3I0H A;  2RIJ A;  4Q7C A;  5C3D A;  1E5K A;  1JYK A;  4M2B A;  3Q7U A;  3V0O A;  4CJC A;  2RJ9 A;  5L6V A;  2WVK A;  2WVM A;  3PKP A;  4B4G A;  1VZT A;  3VNP A;  1MR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...