3R3IA

Crystal structure of c-terminal truncation of udp-glucose pyrophosphorylase of homo sapiens
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
477
structure length
457
Chain Sequence
IRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UTP--glucose-1-phosphate uridylyltransferase
publication title Crystal Structure of UDP-glucose Pyrophosphorylase of Homo sapiens
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 98
structure length 457
sequence length 477
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.9: UTP--glucose-1-phosphate uridylyltransferase.
pdb deposition date 2011-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01704 UDPGP UTP--glucose-1-phosphate uridylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3r3iA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3r3iA01
1FWYA 5DEPA 1ZDFA 4AYJA 1NF5B 4HO5A 4MFGA 3BFPA 1MR9A 3I0KA 4AA7A 1XZ6A 2WLGA 2Z87A 5CMIA 2P6WA 1FXOA 3SX7A 2V0KA 1LZ0A 2QIAA 2D0JA 4FCUA 4IRPA 4IHGA 5CQOA 1ON8A 1R81A 4IHHA 2FYBA 2XATA 5AFUU 5CMGX 5C1HA 3TWDA 4HO9A 1T3DA 4ASJA 2FYAA 4HURA 2Q4JA 2O1FA 5AFUV 2XWLA 4KNXA 2OEGA 3PKQA 2AM3A 1TVYA 3OU9A 3I0GA 3F1YA 1ZJ3A 3OH4A 2IU9A 1INIA 1FO8A 1H7TA 2AH9A 4AAWA 2Y4JA 2YQHA 4HO2A 5FYEA 1YP4A 1OMXA 1KGQA 1I52A 5AJNA 3KWCA 1J2ZA 5DDVA 3SX3A 4G3SA 4B2WA 4BQHA 2VS5A 1HM9A 4ECMA 3HL3A 1ON6A 2RIXA 1H5RA 1WT0A 4FRAA 4KNRA 3RMWA 1VICA 2V0HA 2D7RA 1H3MA 4EGGA 2FKOA 3TISA 4HG6A 4KC2A 3D8VA 1GX0A 2AESA 2AM4A 3VBPA 4MYOA 2P72A 1VGWA 3DUVA 1MRLA 2NXVA 1R7YA 1ZCVA 4FRHA 4B3UA 1THJA 3V0QA 2WLCA 4EEAA 5EJ1A 1JVGA 1OQMB 3PMOA 1TZFA 1R7XA 1GQ9A 2JCJA 1SSMA 2WEEA 3BXYA 3HJJA 3E26A 1VGTA 4KC4A 4HOCA 1IIMA 3GOSA 5CMHA 1ZCYA 3ZGGA 1QRLA 5IDSA 2PGVA 3EEVA 1FOAA 2A8UA 3CKQA 4GBPA 1G0RA 5C1LA 1FXJA 1E5KA 3CKNA 1LZIA 1KK6A 2NPOA 5C47A 3FOQA 2W0WA 3VBLA 1INJA 3FTTA 2OI6A 4DDZA 4EEMA 4N27A 3I3AA 4B42A 5F42A 3V0MA 3FSCA 1ZIZA 2VSHA 2OI5A 1H7LA 2CU2A 3IOJA 1FGGA 5HS2A 5FTVA 4E79A 4FRMA 3ST8A 2RIYA 5FUHA 2W0VA 1ZJ0A 2Y4LA 1KK4A 4CVHA 4Y9XA 2WE9A 3C8VA 2WVLA 5CMFX 1H7EA 1NQIB 4FQWA 4EE5A 2RJ8A 2D7IA 4Y63A 2JCLA 3IGJA 3I0DA 1WT3A 2IUAA 3FS8A 4HZDA 4Y6UA 5C3AA 5I1FA 4FRLA 5BXCA 1O7OA 1VGZA 2E8BA 5AJPA 2VS3A 2VHEA 2VS4A 4M99A 1QRMA 1QGQA 1SSQA 3MC4A 1H4EA 1YROB 1LL2A 1ZI3A 3U2XA 3T7MA 3SX5A 1H5TB 2I5EA 2YCMA 2AQ9A 3JQYA 4FREA 2VSIA 4R37A 4HO6A 1JYKA 1H5SB 4M4KA 5CMJA 5ADXU 1G3LA 2YQSA 4FROA 4D11C 1S80A 1G8OA 4HO0A 4EVWA 1G95A 1JV1A 2PGYA 5ADXV 4L41C 3CKOA 1HM8A 4Y6NA 1VH1A 4E1KA 3TK8A 1ZJPA 2P2OA 3R5CA 2A8WA 2PX7A 4HO3A 1O7QA 4LW6A 4C2SA 4MZUA 4M28A 5C1GA 5C3DA 1H4CA 3V90A 4D11A 1LL3A 1SS9A 3R3RA 2I5KA 2XMEA 3FSYA 5U2KA 4KC1A 1V83A 4B4BA 3JUKA 2JF3A 1QREA 1QG8A 1EZIA 2RIJA 1FZWA 5C8RA 4EA7A 3T7NA 3HSQA 1KRUA 1ZI1A 2XMHA 1G93A 3K8EA 1NMMB 5DDTA 1Z90A 4G3QA 1XHDA 5CQMX 2YQJA 4JD0A 1VZUA 3R5BA 3U2TA 3I0EA 3OTMA 4M2AA 3TDTA 1NKHB 2O1HA 4Y7VA 3Q1XA 3CU0A 3VBJA 4B4MA 4D0TA 2YC5A 3SXCA 4KPXA 1SSTA 4B5BA 4R7PA 2BO8A 2FYCB 1H7QA 2WLFA 1LZJA 4EEOA 1S4OA 3OW5A 4ASYA 3DK5A 3PKPA 4J09A 1V3WA 4EABA 1PZTA 1OMZA 2VFZA 2OI7A 3V8ZA 1IINA 4Y64A 3POLA 3BSYA 1W55A 2Y4MA 4KT7A 4E6UA 3CKJA 4HUSA 4M9CA 5FV9A 2BO4A 1ZI5A 3NGWA 3U2WA 1R7VA 1S4NA 3OUPA 3I0HA 4EA8A 4Y7TA 2XWMA 1ZJ1A 3U2UA 4IHFA 3T7OA 3CGXA 3SXGA 1WSZA 1R82A 4FRDA 4J18A 2FY7A 2QIVX 3SRTA 4ISXA 2RJ4A 3R5DA 4FRPA 3JUJA 4Y62A 5CQPA 1HV9A 5C4FA 4CJ8A 5E3PA 4KPZA 3V8YA 4EQYA 3JTJA 3VNPA 1GX4A 3P1BA 2IC7A 1ZI4A 2FFVA 5AJOA 1ZJOA 1GA8A 4M98A 1H5SC 3MQHA 1QQ0A 1WT1A 2QKXA 3R3IA 3ECTA 4R36A 3SXEA 4D0ZA 2AGDA 1WVCA 5IFYA 1H5TA 1FO9A 2RJ6A 1KHRA 3V4EA 3K8DA 3R0SA 1QRGA 2V0JA 3P47A 1H5SA 3FWWA 1FRWA 3GUEA 4M2BA 4EA9A 2WAWA 4JISA 4G3PA 1ZDGA 1OCXA 1YP2A 3V0PA 1W77A 3USQA 1MP3A 1QGSA 1FR9A 2AM5A 3Q7UA 3IOIA 2JF2A 1GWVA 2APCA 4Y7UA 4DE7A 3FSXA 5C49A 4E6TA 3V0LA 4MNDA 5C4CA 1KRVA 3SX8A 1H5SD 2QGIA 3ZGFA 2WGZA 3KIAA 2ICXA 1H7HA 3D98A 3I0CA 3SPTA 4FCEA 4HZCA 5DEMA 2YC3A 1TW5A 1XHBA 2FFUA 3ZF8A 1G23A 3I0LA 3T57A 2X60A 4G87A 1XATA 3OH3A 5CQLX 4ZDQA 1MC3A 3F1CA 3USRA 1LVWA 3V0OA 4EE4A 3NZ2A 2RJ7A 4N6BA 3BSSA 3OH1A 1KGTA 5E3RA 5C4EA 2ZU7A 1VZXA 2O1GA 3U0YA 4KQLA 2Y4KA 2AE7A 4P00A 1LZ7A 1JV3A 4N69A 1KWSA 5C48A 1EYRA 4HCQA 2UX8A 3I3XA 3IXCA 1MR7A 1QRFA 3MQGA 3R5AA 1G1LA 4NAKA 3FSBA 3R2WA 1KRRA 1QWJA 1VGUA 2WLDA 2YQCA 3I0JA 3E25A 2E3DA 2BO6A 2P73A 2WLEA 1NHEB 5C4BA 4BMAA 1G97A 5C4DA 4FRQA 3U2VA 2IU8A 3U0XA 2ZU8A 4EEGA 1ZCUA 1MP5A 3OTZA 3F1XA 3IOHA 4Y7GA 2RJ5A 1LL0A 4P02A 5EIYA 5FTSA 1ZJ2A 3BCVA 1FGXA 2JCKA 2AECA 3EH0A 2BO7A 1GWWA 1PZYB 3TIOA 4LW3A 3TZTA 2ICYA 3EG4A 2RJ0A 1O23B 3VBNA 1R80A 1V84A 1S4PA 3CKVA 2WVMA 2MZBA 3ZLLA 4EAAA 2X65A 3EE5A 5DG3A 3O3PA 4KXOA 1KQAA 2Z86A 2DPWA 3V91A 1ZCTA 3VBMA 1TW1A 3KWEA 4D48A 4IRQA 1VZTA 1HJJA 2V0IA 3LW6A 3I0IX 2WVKA 2RJ1A 4KRVA 4CJBA 3CJ8A 3GVDA 3Q4SA 5JQQA 5C3BA 5EJZA 3VBKA 2GGQA 2X5ZA 4NAIA 1H5RB 3OGZA 4FRBA 3SXDA 1V82A 1YP3A 4XWIA 1FR8A 2JCOA 4H7OA 2RITA 5L6VA 3OC9A 4YS8A 3V0NA 4AYLA 2Y6PA 4K6RA 5E3QA 1W57A 3SXBA 1R7UA 3TV0A 3OH2A 4E75A 3QVBA 4EE3A 3PNNA 4UEGA 3DHOA 3R1WA 4N6AA 2YESA 1ZHJA 3RSBA 1R7TA 3D5NA 1H7FA 4AC3A 1HJLA 1VM8A 4ARWA 4NALA 2XWNA 3RMVA 3I0FA 2TDTA 2VXLA 4DECA 2I7BA 1LXAA 1JVDA 1JYLA 2FYDB 4HO8A 3ZLKA 5FU8A 1H7GA 3N9WA 1VPAA 5C36A 5CQNX 4B2XA 1GQCA 4HO4A 1O0RA 3KWDA 3OAMA 1KK5A 3R8YA 2RJ9A 2GGOA 5IDTA 2ZU9A 4MYBA 2V0LA 4Y7FA 1TDTA 2OEFA 2Y7AA 1MP4A 3VBIA 1HM0A 3TQDA 4NANA 2QH5A 2PA4A 3Q80A 3OH0A 5L6SA 4B4GA 4CJCA 3BSWA 3DJ4A 5C38A 1WT2A 3SXAA 5J49A 3OKRA 1K4VA 1G2VA 1VH3A 2VXMA 1V67A 1G9RA 2RIZA 4DCLA 2X5SA 2VD4A 5FU0A 1H4DA 3BRKX 1NWGB 1FG5N
chains in the Genus database with same CATH superfamily
1FWYA 5DEPA 1ZDFA 4AYJA 1NF5B 4HO5A 2J0BA 4MFGA 3BFPA 1MR9A 3I0KA 5D91A 4AA7A 1XZ6A 2WLGA 2Z87A 5CMIA 2P6WA 1FXOA 3SX7A 2V0KA 1LZ0A 2QIAA 2D0JA 4FCUA 4IRPA 5D92A 4IHGA 5CQOA 1ON8A 1R81A 4IHHA 2FYBA 2XATA 5AFUU 5CMGX 5C1HA 3TWDA 4HO9A 1T3DA 4ASJA 2FYAA 4HURA 2Q4JA 2O1FA 5AFUV 2XWLA 4KNXA 2OEGA 3PKQA 2AM3A 1TVYA 3OU9A 3I0GA 3F1YA 1ZJ3A 1N4IA 3OH4A 2IU9A 1INIA 1FO8A 1H7TA 2AH9A 4AAWA 2Y4JA 2YQHA 4HO2A 5FYEA 1YP4A 1OMXA 1KGQA 1I52A 5AJNA 3KWCA 1J2ZA 5DDVA 3SX3A 4G3SA 4B2WA 4BQHA 2VS5A 1HM9A 4ECMA 3HL3A 1ON6A 2RIXA 1H5RA 1WT0A 4FRAA 4KNRA 3RMWA 1VICA 2V0HA 2D7RA 1H3MA 4EGGA 2FKOA 3TISA 4HG6A 4KC2A 3D8VA 1GX0A 2AESA 2AM4A 3VBPA 4MYOA 2P72A 1VGWA 3DUVA 1MRLA 2NXVA 1R7YA 1ZCVA 4FRHA 4B3UA 1THJA 3V0QA 2WLCA 4EEAA 5EJ1A 1JVGA 1OQMB 3PMOA 1TZFA 1R7XA 1GQ9A 2JCJA 1SSMA 2WEEA 3BXYA 3HJJA 3E26A 1VGTA 4KC4A 4HOCA 1IIMA 3GOSA 5CMHA 1ZCYA 3ZGGA 1QRLA 5IDSA 2PGVA 3EEVA 1FOAA 2A8UA 3CKQA 4GBPA 1G0RA 5C1LA 1FXJA 1E5KA 3CKNA 1LZIA 1KK6A 2NPOA 5C47A 3FOQA 2W0WA 3VBLA 1INJA 4Q7CA 3FTTA 2OI6A 4DDZA 4EEMA 4N27A 3I3AA 4B42A 5F42A 3V0MA 3FSCA 1ZIZA 2VSHA 2OI5A 1H7LA 2CU2A 3IOJA 1FGGA 5HS2A 5FTVA 4E79A 4FRMA 3ST8A 2RIYA 5FUHA 2W0VA 1ZJ0A 2Y4LA 1KK4A 4CVHA 4Y9XA 2WE9A 3C8VA 2WVLA 5CMFX 1H7EA 1NQIB 4FQWA 4EE5A 2RJ8A 2D7IA 4Y63A 2JCLA 3IGJA 3I0DA 1WT3A 2IUAA 3FS8A 4HZDA 4Y6UA 5C3AA 5I1FA 4FRLA 5BXCA 1O7OA 1VGZA 2E8BA 5AJPA 2VS3A 2VHEA 2VS4A 4M99A 1QRMA 1QGQA 1SSQA 3MC4A 1H4EA 1YROB 1LL2A 1ZI3A 3U2XA 3T7MA 3SX5A 1H5TB 2I5EA 2YCMA 2AQ9A 3JQYA 4FREA 2VSIA 4R37A 4HO6A 1JYKA 1H5SB 4M4KA 5CMJA 5ADXU 1G3LA 2YQSA 4FROA 4D11C 1S80A 1G8OA 4HO0A 4EVWA 1G95A 1JV1A 2PGYA 5ADXV 4L41C 3CKOA 1HM8A 4Y6NA 1VH1A 4E1KA 3TK8A 1ZJPA 2P2OA 3R5CA 2A8WA 2PX7A 4HO3A 1O7QA 4LW6A 4C2SA 4MZUA 4M28A 5C1GA 5C3DA 1H4CA 3V90A 4D11A 1LL3A 1SS9A 3R3RA 2I5KA 2XMEA 1L0SA 3FSYA 5U2KA 4KC1A 4FIYA 1V83A 4B4BA 3JUKA 2JF3A 1QREA 1QG8A 1EZIA 2RIJA 1FZWA 5C8RA 4EA7A 3T7NA 3HSQA 1KRUA 1ZI1A 2XMHA 1G93A 3K8EA 1NMMB 5DDTA 1Z90A 4G3QA 1XHDA 5CQMX 3GQ7A 2VK9A 2YQJA 4JD0A 1VZUA 1EWWA 3R5BA 3U2TA 3I0EA 3OTMA 4M2AA 3TDTA 1NKHB 2O1HA 4Y7VA 3Q1XA 3CU0A 3VBJA 4B4MA 4D0TA 2YC5A 3SXCA 4KPXA 1SSTA 4B5BA 4R7PA 2BO8A 2FYCB 1H7QA 2WLFA 1LZJA 4EEOA 3GQ9A 1S4OA 3OW5A 4ASYA 3DK5A 3PKPA 4J09A 1V3WA 4EABA 1PZTA 1OMZA 2VFZA 2OI7A 1Z2FA 3V8ZA 1IINA 4Y64A 3POLA 3BSYA 1W55A 2Y4MA 4KT7A 4E6UA 3CKJA 4HUSA 4M9CA 5FV9A 2BO4A 1ZI5A 3NGWA 3U2WA 1R7VA 1S4NA 3OUPA 3I0HA 4EA8A 4Y7TA 2XWMA 1ZJ1A 3U2UA 4IHFA 3T7OA 3CGXA 3SXGA 1WSZA 1R82A 4FRDA 4J18A 2FY7A 2QIVX 3SRTA 4ISXA 2RJ4A 4FIXA 3R5DA 4FRPA 3JUJA 4Y62A 5CQPA 1HV9A 5C4FA 4CJ8A 1M8NA 5E3PA 4KPZA 3V8YA 4EQYA 3JTJA 3VNPA 1GX4A 3P1BA 2IC7A 1ZI4A 2FFVA 5AJOA 1ZJOA 1GA8A 4M98A 1H5SC 3MQHA 1QQ0A 1WT1A 2QKXA 3R3IA 3ECTA 4R36A 3SXEA 4D0ZA 2AGDA 1WVCA 5IFYA 1H5TA 1FO9A 2RJ6A 1KHRA 3V4EA 3K8DA 3R0SA 1QRGA 2V0JA 3P47A 1H5SA 3FWWA 1FRWA 3GUEA 4M2BA 4EA9A 2WAWA 4JISA 4G3PA 1ZDGA 1OCXA 1YP2A 3V0PA 1W77A 3USQA 1MP3A 1QGSA 1FR9A 2AM5A 3Q7UA 3IOIA 2JF2A 1GWVA 2APCA 4Y7UA 4DE7A 3FSXA 5C49A 4E6TA 3V0LA 4MNDA 5C4CA 1KRVA 3SX8A 1H5SD 2QGIA 3ZGFA 2WGZA 3KIAA 2ICXA 1H7HA 3D98A 3I0CA 3SPTA 4FCEA 4HZCA 5DEMA 2YC3A 1TW5A 1XHBA 4O6MA 2FFUA 3ZF8A 1G23A 3I0LA 3T57A 2X60A 4G87A 4MIXA 1XATA 3OH3A 5CQLX 4ZDQA 1MC3A 3F1CA 3USRA 1LVWA 3V0OA 4EE4A 3NZ2A 2RJ7A 4N6BA 3BSSA 3OH1A 1KGTA 5E3RA 5C4EA 2ZU7A 1VZXA 2O1GA 3U0YA 4KQLA 2Y4KA 2AE7A 4P00A 1LZ7A 1JV3A 4N69A 1KWSA 2J0AA 5C48A 1EYRA 4HCQA 2UX8A 3I3XA 3IXCA 1MR7A 1QRFA 3MQGA 3GQ8A 3R5AA 1G1LA 4NAKA 3FSBA 3R2WA 1KRRA 1QWJA 1VGUA 2WLDA 2YQCA 3I0JA 3E25A 2E3DA 2BO6A 2P73A 2WLEA 1NHEB 5C4BA 4BMAA 1G97A 5C4DA 4FRQA 3U2VA 2IU8A 3U0XA 2ZU8A 4EEGA 1ZCUA 1MP5A 3OTZA 3F1XA 3IOHA 4Y7GA 2RJ5A 1LL0A 4P02A 5EIYA 5FTSA 1ZJ2A 3BCVA 1FGXA 2JCKA 2AECA 3EH0A 2BO7A 1GWWA 1PZYB 3TIOA 4LW3A 3TZTA 2ICYA 3EG4A 2RJ0A 1O23B 3VBNA 1R80A 1V84A 1S4PA 3CKVA 2WVMA 2MZBA 3ZLLA 4EAAA 2X65A 3EE5A 5DG3A 3O3PA 4KXOA 1KQAA 2Z86A 2DPWA 3V91A 1ZCTA 3VBMA 1TW1A 3KWEA 4D48A 4IRQA 1VZTA 1HJJA 2V0IA 3LW6A 3I0IX 2WVKA 2RJ1A 4KRVA 4CJBA 3CJ8A 3GVDA 3Q4SA 5JQQA 5C3BA 5EJZA 3VBKA 2GGQA 2X5ZA 4NAIA 3OGZA 1H5RB 4FRBA 3SXDA 1V82A 1YP3A 4XWIA 1FR8A 2JCOA 4H7OA 2RITA 5L6VA 3OC9A 4YS8A 3V0NA 4AYLA 2Y6PA 4K6RA 5E3QA 1W57A 3SXBA 3GQAA 1R7UA 3TV0A 3OH2A 4E75A 3QVBA 4EE3A 3PNNA 4UEGA 3DHOA 3R1WA 4N6AA 2YESA 1ZHJA 3RSBA 1R7TA 3D5NA 1H7FA 4AC3A 1HJLA 1VM8A 4ARWA 4NALA 2XWNA 3RMVA 3I0FA 2TDTA 2VXLA 4DECA 2I7BA 1LXAA 1JVDA 1JYLA 2FYDB 4HO8A 3ZLKA 5FU8A 1H7GA 3N9WA 1VPAA 5C36A 5CQNX 2C0NA 4B2XA 1GQCA 4HO4A 1O0RA 3KWDA 3OAMA 1KK5A 3R8YA 2RJ9A 2GGOA 5IDTA 2ZU9A 4MYBA 2V0LA 4Y7FA 1TDTA 2OEFA 2Y7AA 1MP4A 3VBIA 1HM0A 4O6NA 4NANA 3TQDA 2QH5A 2PA4A 3Q80A 3OH0A 5L6SA 4B4GA 4CJCA 3BSWA 3DJ4A 5C38A 1WT2A 3SXAA 5J49A 3OKRA 1K4VA 3SUCA 1G2VA 1VH3A 2VXMA 1V67A 1G9RA 2RIZA 4DCLA 2X5SA 2VD4A 5FU0A 1H4DA 3BRKX 1NWGB 1FG5N
chains in the Genus database with same CATH topology
1FWYA 5DEPA 1ZDFA 4AYJA 1NF5B 4HO5A 2J0BA 4MFGA 3BFPA 1MR9A 3I0KA 5D91A 4AA7A 1XZ6A 2WLGA 2Z87A 5CMIA 2P6WA 1FXOA 3SX7A 2V0KA 1LZ0A 2QIAA 2D0JA 4FCUA 4IRPA 5D92A 4IHGA 5CQOA 1ON8A 1R81A 4IHHA 2FYBA 2XATA 5AFUU 5CMGX 5C1HA 3TWDA 4HO9A 1T3DA 4ASJA 2FYAA 4HURA 2Q4JA 2O1FA 5AFUV 2XWLA 4KNXA 2OEGA 3PKQA 2AM3A 1TVYA 3OU9A 3I0GA 3F1YA 1ZJ3A 3OH4A 2IU9A 1INIA 1FO8A 1H7TA 2AH9A 4AAWA 2Y4JA 2YQHA 4HO2A 5FYEA 1YP4A 1OMXA 1KGQA 1I52A 5AJNA 3KWCA 1J2ZA 5DDVA 3SX3A 4G3SA 4B2WA 4BQHA 2VS5A 1HM9A 4ECMA 3HL3A 1ON6A 2RIXA 1H5RA 1WT0A 4FRAA 4KNRA 3RMWA 1VICA 2V0HA 2D7RA 1H3MA 4EGGA 2FKOA 3TISA 4HG6A 4KC2A 3D8VA 1GX0A 2AESA 2AM4A 3VBPA 4MYOA 2P72A 1VGWA 3DUVA 1MRLA 2NXVA 1R7YA 1ZCVA 4FRHA 4B3UA 1THJA 3V0QA 2WLCA 4EEAA 5EJ1A 1JVGA 1OQMB 3PMOA 1TZFA 1R7XA 1GQ9A 2JCJA 1SSMA 2WEEA 3BXYA 3HJJA 3E26A 1VGTA 4KC4A 4HOCA 1IIMA 3GOSA 5CMHA 1ZCYA 3ZGGA 1QRLA 5IDSA 2PGVA 3EEVA 1FOAA 2A8UA 3CKQA 4GBPA 1G0RA 5C1LA 1FXJA 1E5KA 3CKNA 1LZIA 1KK6A 2NPOA 5C47A 3FOQA 2W0WA 3VBLA 1INJA 4Q7CA 3FTTA 2OI6A 4DDZA 4EEMA 4N27A 3I3AA 4B42A 5F42A 3V0MA 3FSCA 1ZIZA 2VSHA 2OI5A 1H7LA 2CU2A 3IOJA 1FGGA 5HS2A 5FTVA 4E79A 4FRMA 3ST8A 2RIYA 5FUHA 2W0VA 1ZJ0A 2Y4LA 1KK4A 4CVHA 4Y9XA 2WE9A 3C8VA 2WVLA 5CMFX 1H7EA 1NQIB 4FQWA 4EE5A 2RJ8A 2D7IA 4Y63A 2JCLA 3IGJA 3I0DA 1WT3A 2IUAA 3FS8A 4HZDA 4Y6UA 5C3AA 5I1FA 4FRLA 5BXCA 1O7OA 1VGZA 2E8BA 5AJPA 2VS3A 2VHEA 2VS4A 4M99A 1QRMA 1QGQA 1SSQA 3MC4A 1H4EA 1YROB 1LL2A 1ZI3A 3U2XA 3T7MA 3SX5A 1H5TB 2I5EA 2YCMA 2AQ9A 3JQYA 4FREA 2VSIA 4R37A 4HO6A 1JYKA 1H5SB 4M4KA 5CMJA 5ADXU 1G3LA 2YQSA 4FROA 4D11C 1S80A 1G8OA 4HO0A 4EVWA 1G95A 1JV1A 2PGYA 5ADXV 4L41C 3CKOA 1HM8A 4Y6NA 1VH1A 4E1KA 3TK8A 1ZJPA 2P2OA 3R5CA 2A8WA 2PX7A 4HO3A 1O7QA 4LW6A 4C2SA 4MZUA 4M28A 5C1GA 5C3DA 1H4CA 3V90A 4D11A 1LL3A 1SS9A 3R3RA 2I5KA 2XMEA 3FSYA 5U2KA 4KC1A 4FIYA 1V83A 4B4BA 3JUKA 2JF3A 1QREA 1QG8A 1EZIA 2RIJA 1FZWA 5C8RA 4EA7A 3T7NA 3HSQA 1KRUA 1ZI1A 2XMHA 1G93A 3K8EA 1NMMB 5DDTA 1Z90A 4G3QA 1XHDA 5CQMX 2VK9A 2YQJA 4JD0A 1VZUA 3R5BA 3U2TA 3I0EA 3OTMA 4M2AA 3TDTA 1NKHB 2O1HA 4Y7VA 3Q1XA 3CU0A 3VBJA 4B4MA 4D0TA 2YC5A 3SXCA 4KPXA 1SSTA 4B5BA 4R7PA 2BO8A 2FYCB 1H7QA 2WLFA 1LZJA 4EEOA 1S4OA 3OW5A 4ASYA 3DK5A 3PKPA 4J09A 1V3WA 4EABA 1PZTA 1OMZA 2VFZA 2OI7A 3V8ZA 1IINA 4Y64A 3POLA 3BSYA 1W55A 2Y4MA 4KT7A 4E6UA 3CKJA 4HUSA 4M9CA 5FV9A 2BO4A 1ZI5A 3NGWA 3U2WA 1R7VA 1S4NA 3OUPA 3I0HA 4EA8A 4Y7TA 2XWMA 1ZJ1A 3U2UA 4IHFA 3T7OA 3CGXA 3SXGA 1WSZA 1R82A 4FRDA 4J18A 2FY7A 2QIVX 3SRTA 4ISXA 2RJ4A 4FIXA 3R5DA 4FRPA 3JUJA 4Y62A 5CQPA 1HV9A 5C4FA 4CJ8A 5E3PA 4KPZA 3V8YA 4EQYA 3JTJA 3VNPA 1GX4A 3P1BA 2IC7A 1ZI4A 2FFVA 5AJOA 1ZJOA 1GA8A 4M98A 1H5SC 3MQHA 1QQ0A 1WT1A 2QKXA 3R3IA 3ECTA 4R36A 3SXEA 4D0ZA 2AGDA 1WVCA 5IFYA 1H5TA 1FO9A 2RJ6A 1KHRA 3V4EA 3K8DA 3R0SA 1QRGA 2V0JA 3P47A 1H5SA 3FWWA 1FRWA 3GUEA 4M2BA 4EA9A 2WAWA 4JISA 4G3PA 1ZDGA 1OCXA 1YP2A 3V0PA 1W77A 3USQA 1MP3A 1QGSA 1FR9A 2AM5A 3Q7UA 3IOIA 2JF2A 1GWVA 2APCA 4Y7UA 4DE7A 3FSXA 5C49A 4E6TA 3V0LA 4MNDA 5C4CA 1KRVA 3SX8A 1H5SD 2QGIA 3ZGFA 2WGZA 3KIAA 2ICXA 1H7HA 3D98A 3I0CA 3SPTA 4FCEA 4HZCA 5DEMA 2YC3A 1TW5A 1XHBA 4O6MA 2FFUA 3ZF8A 1G23A 3I0LA 3T57A 2X60A 4G87A 4MIXA 1XATA 3OH3A 5CQLX 4ZDQA 1MC3A 3F1CA 3USRA 1LVWA 3V0OA 4EE4A 3NZ2A 2RJ7A 4N6BA 3BSSA 3OH1A 1KGTA 5E3RA 5C4EA 2ZU7A 1VZXA 2O1GA 3U0YA 4KQLA 2Y4KA 2AE7A 4P00A 1LZ7A 1JV3A 4N69A 1KWSA 2J0AA 5C48A 1EYRA 4HCQA 2UX8A 3I3XA 3IXCA 1MR7A 1QRFA 3MQGA 3R5AA 1G1LA 4NAKA 3FSBA 3R2WA 1KRRA 1QWJA 1VGUA 2WLDA 2YQCA 3I0JA 3E25A 2E3DA 2BO6A 2P73A 2WLEA 1NHEB 5C4BA 4BMAA 1G97A 5C4DA 4FRQA 3U2VA 2IU8A 3U0XA 2ZU8A 4EEGA 1ZCUA 1MP5A 3OTZA 3F1XA 3IOHA 4Y7GA 2RJ5A 1LL0A 4P02A 5EIYA 5FTSA 1ZJ2A 3BCVA 1FGXA 2JCKA 2AECA 3EH0A 2BO7A 1GWWA 1PZYB 3TIOA 4LW3A 3TZTA 2ICYA 3EG4A 2RJ0A 1O23B 3VBNA 1R80A 1V84A 1S4PA 3CKVA 2WVMA 2MZBA 3ZLLA 4EAAA 2X65A 3EE5A 5DG3A 3O3PA 4KXOA 1KQAA 2Z86A 2DPWA 3V91A 1ZCTA 3VBMA 1TW1A 3KWEA 4D48A 4IRQA 1VZTA 1HJJA 2V0IA 3LW6A 3I0IX 2WVKA 2RJ1A 4KRVA 4CJBA 3CJ8A 3GVDA 3Q4SA 5JQQA 5C3BA 5EJZA 3VBKA 2GGQA 2X5ZA 4NAIA 1H5RB 3OGZA 4FRBA 3SXDA 1V82A 1YP3A 4XWIA 1FR8A 2JCOA 4H7OA 2RITA 5L6VA 3OC9A 4YS8A 3V0NA 4AYLA 2Y6PA 4K6RA 5E3QA 1W57A 3SXBA 1R7UA 3TV0A 3OH2A 4E75A 3QVBA 4EE3A 3PNNA 4UEGA 3DHOA 3R1WA 4N6AA 2YESA 1ZHJA 3RSBA 1R7TA 3D5NA 1H7FA 4AC3A 1HJLA 1VM8A 4ARWA 4NALA 2XWNA 3RMVA 3I0FA 2TDTA 2VXLA 4DECA 2I7BA 1LXAA 1JVDA 1JYLA 2FYDB 4HO8A 3ZLKA 5FU8A 1H7GA 3N9WA 1VPAA 5C36A 5CQNX 2C0NA 4B2XA 1GQCA 4HO4A 1O0RA 3KWDA 3OAMA 1KK5A 3R8YA 2RJ9A 2GGOA 5IDTA 2ZU9A 4MYBA 2V0LA 4Y7FA 1TDTA 2OEFA 2Y7AA 1MP4A 3VBIA 1HM0A 4O6NA 4NANA 3TQDA 2QH5A 2PA4A 3Q80A 3OH0A 5L6SA 4B4GA 4CJCA 3BSWA 3DJ4A 5C38A 1WT2A 3SXAA 5J49A 3OKRA 1K4VA 1G2VA 1VH3A 2VXMA 1V67A 1G9RA 2RIZA 4DCLA 2X5SA 2VD4A 5FU0A 1H4DA 3BRKX 1NWGB 1FG5N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FWY A;  5DEP A;  1ZDF A;  4AYJ A;  1NF5 B;  4HO5 A;  4MFG A;  3BFP A;  1MR9 A;  3I0K A;  4AA7 A;  1XZ6 A;  2WLG A;  2Z87 A;  5CMI A;  2P6W A;  1FXO A;  3SX7 A;  2V0K A;  1LZ0 A;  2QIA A;  2D0J A;  4FCU A;  4IRP A;  4IHG A;  5CQO A;  1ON8 A;  1R81 A;  4IHH A;  2FYB A;  2XAT A;  5AFU U;  5CMG X;  5C1H A;  3TWD A;  4HO9 A;  1T3D A;  4ASJ A;  2FYA A;  4HUR A;  2Q4J A;  2O1F A;  5AFU V;  2XWL A;  4KNX A;  2OEG A;  3PKQ A;  2AM3 A;  1TVY A;  3OU9 A;  3I0G A;  3F1Y A;  1ZJ3 A;  3OH4 A;  2IU9 A;  1INI A;  1FO8 A;  1H7T A;  2AH9 A;  4AAW A;  2Y4J A;  2YQH A;  4HO2 A;  5FYE A;  1YP4 A;  1OMX A;  1KGQ A;  1I52 A;  5AJN A;  3KWC A;  1J2Z A;  5DDV A;  3SX3 A;  4G3S A;  4B2W A;  4BQH A;  2VS5 A;  1HM9 A;  4ECM A;  3HL3 A;  1ON6 A;  2RIX A;  1H5R A;  1WT0 A;  4FRA A;  4KNR A;  3RMW A;  1VIC A;  2V0H A;  2D7R A;  1H3M A;  4EGG A;  2FKO A;  3TIS A;  4HG6 A;  4KC2 A;  3D8V A;  1GX0 A;  2AES A;  2AM4 A;  3VBP A;  4MYO A;  2P72 A;  1VGW A;  3DUV A;  1MRL A;  2NXV A;  1R7Y A;  1ZCV A;  4FRH A;  4B3U A;  1THJ A;  3V0Q A;  2WLC A;  4EEA A;  5EJ1 A;  1JVG A;  1OQM B;  3PMO A;  1TZF A;  1R7X A;  1GQ9 A;  2JCJ A;  1SSM A;  2WEE A;  3BXY A;  3HJJ A;  3E26 A;  1VGT A;  4KC4 A;  4HOC A;  1IIM A;  3GOS A;  5CMH A;  1ZCY A;  3ZGG A;  1QRL A;  5IDS A;  2PGV A;  3EEV A;  1FOA A;  2A8U A;  3CKQ A;  4GBP A;  1G0R A;  5C1L A;  1FXJ A;  1E5K A;  3CKN A;  1LZI A;  1KK6 A;  2NPO A;  5C47 A;  3FOQ A;  2W0W A;  3VBL A;  1INJ A;  3FTT A;  2OI6 A;  4DDZ A;  4EEM A;  4N27 A;  3I3A A;  4B42 A;  5F42 A;  3V0M A;  3FSC A;  1ZIZ A;  2VSH A;  2OI5 A;  1H7L A;  2CU2 A;  3IOJ A;  1FGG A;  5HS2 A;  5FTV A;  4E79 A;  4FRM A;  3ST8 A;  2RIY A;  5FUH A;  2W0V A;  1ZJ0 A;  2Y4L A;  1KK4 A;  4CVH A;  4Y9X A;  2WE9 A;  3C8V A;  2WVL A;  5CMF X;  1H7E A;  1NQI B;  4FQW A;  4EE5 A;  2RJ8 A;  2D7I A;  4Y63 A;  2JCL A;  3IGJ A;  3I0D A;  1WT3 A;  2IUA A;  3FS8 A;  4HZD A;  4Y6U A;  5C3A A;  5I1F A;  4FRL A;  5BXC A;  1O7O A;  1VGZ A;  2E8B A;  5AJP A;  2VS3 A;  2VHE A;  2VS4 A;  4M99 A;  1QRM A;  1QGQ A;  1SSQ A;  3MC4 A;  1H4E A;  1YRO B;  1LL2 A;  1ZI3 A;  3U2X A;  3T7M A;  3SX5 A;  1H5T B;  2I5E A;  2YCM A;  2AQ9 A;  3JQY A;  4FRE A;  2VSI A;  4R37 A;  4HO6 A;  1JYK A;  1H5S B;  4M4K A;  5CMJ A;  5ADX U;  1G3L A;  2YQS A;  4FRO A;  4D11 C;  1S80 A;  1G8O A;  4HO0 A;  4EVW A;  1G95 A;  1JV1 A;  2PGY A;  5ADX V;  4L41 C;  3CKO A;  1HM8 A;  4Y6N A;  1VH1 A;  4E1K A;  3TK8 A;  1ZJP A;  2P2O A;  3R5C A;  2A8W A;  2PX7 A;  4HO3 A;  1O7Q A;  4LW6 A;  4C2S A;  4MZU A;  4M28 A;  5C1G A;  5C3D A;  1H4C A;  3V90 A;  4D11 A;  1LL3 A;  1SS9 A;  3R3R A;  2I5K A;  2XME A;  3FSY A;  5U2K A;  4KC1 A;  1V83 A;  4B4B A;  3JUK A;  2JF3 A;  1QRE A;  1QG8 A;  1EZI A;  2RIJ A;  1FZW A;  5C8R A;  4EA7 A;  3T7N A;  3HSQ A;  1KRU A;  1ZI1 A;  2XMH A;  1G93 A;  3K8E A;  1NMM B;  5DDT A;  1Z90 A;  4G3Q A;  1XHD A;  5CQM X;  2YQJ A;  4JD0 A;  1VZU A;  3R5B A;  3U2T A;  3I0E A;  3OTM A;  4M2A A;  3TDT A;  1NKH B;  2O1H A;  4Y7V A;  3Q1X A;  3CU0 A;  3VBJ A;  4B4M A;  4D0T A;  2YC5 A;  3SXC A;  4KPX A;  1SST A;  4B5B A;  4R7P A;  2BO8 A;  2FYC B;  1H7Q A;  2WLF A;  1LZJ A;  4EEO A;  1S4O A;  3OW5 A;  4ASY A;  3DK5 A;  3PKP A;  4J09 A;  1V3W A;  4EAB A;  1PZT A;  1OMZ A;  2VFZ A;  2OI7 A;  3V8Z A;  1IIN A;  4Y64 A;  3POL A;  3BSY A;  1W55 A;  2Y4M A;  4KT7 A;  4E6U A;  3CKJ A;  4HUS A;  4M9C A;  5FV9 A;  2BO4 A;  1ZI5 A;  3NGW A;  3U2W A;  1R7V A;  1S4N A;  3OUP A;  3I0H A;  4EA8 A;  4Y7T A;  2XWM A;  1ZJ1 A;  3U2U A;  4IHF A;  3T7O A;  3CGX A;  3SXG A;  1WSZ A;  1R82 A;  4FRD A;  4J18 A;  2FY7 A;  2QIV X;  3SRT A;  4ISX A;  2RJ4 A;  3R5D A;  4FRP A;  3JUJ A;  4Y62 A;  5CQP A;  1HV9 A;  5C4F A;  4CJ8 A;  5E3P A;  4KPZ A;  3V8Y A;  4EQY A;  3JTJ A;  3VNP A;  1GX4 A;  3P1B A;  2IC7 A;  1ZI4 A;  2FFV A;  5AJO A;  1ZJO A;  1GA8 A;  4M98 A;  1H5S C;  3MQH A;  1QQ0 A;  1WT1 A;  2QKX A;  3R3I A;  3ECT A;  4R36 A;  3SXE A;  4D0Z A;  2AGD A;  1WVC A;  5IFY A;  1H5T A;  1FO9 A;  2RJ6 A;  1KHR A;  3V4E A;  3K8D A;  3R0S A;  1QRG A;  2V0J A;  3P47 A;  1H5S A;  3FWW A;  1FRW A;  3GUE A;  4M2B A;  4EA9 A;  2WAW A;  4JIS A;  4G3P A;  1ZDG A;  1OCX A;  1YP2 A;  3V0P A;  1W77 A;  3USQ A;  1MP3 A;  1QGS A;  1FR9 A;  2AM5 A;  3Q7U A;  3IOI A;  2JF2 A;  1GWV A;  2APC A;  4Y7U A;  4DE7 A;  3FSX A;  5C49 A;  4E6T A;  3V0L A;  4MND A;  5C4C A;  1KRV A;  3SX8 A;  1H5S D;  2QGI A;  3ZGF A;  2WGZ A;  3KIA A;  2ICX A;  1H7H A;  3D98 A;  3I0C A;  3SPT A;  4FCE A;  4HZC A;  5DEM A;  2YC3 A;  1TW5 A;  1XHB A;  2FFU A;  3ZF8 A;  1G23 A;  3I0L A;  3T57 A;  2X60 A;  4G87 A;  1XAT A;  3OH3 A;  5CQL X;  4ZDQ A;  1MC3 A;  3F1C A;  3USR A;  1LVW A;  3V0O A;  4EE4 A;  3NZ2 A;  2RJ7 A;  4N6B A;  3BSS A;  3OH1 A;  1KGT A;  5E3R A;  5C4E A;  2ZU7 A;  1VZX A;  2O1G A;  3U0Y A;  4KQL A;  2Y4K A;  2AE7 A;  4P00 A;  1LZ7 A;  1JV3 A;  4N69 A;  1KWS A;  5C48 A;  1EYR A;  4HCQ A;  2UX8 A;  3I3X A;  3IXC A;  1MR7 A;  1QRF A;  3MQG A;  3R5A A;  1G1L A;  4NAK A;  3FSB A;  3R2W A;  1KRR A;  1QWJ A;  1VGU A;  2WLD A;  2YQC A;  3I0J A;  3E25 A;  2E3D A;  2BO6 A;  2P73 A;  2WLE A;  1NHE B;  5C4B A;  4BMA A;  1G97 A;  5C4D A;  4FRQ A;  3U2V A;  2IU8 A;  3U0X A;  2ZU8 A;  4EEG A;  1ZCU A;  1MP5 A;  3OTZ A;  3F1X A;  3IOH A;  4Y7G A;  2RJ5 A;  1LL0 A;  4P02 A;  5EIY A;  5FTS A;  1ZJ2 A;  3BCV A;  1FGX A;  2JCK A;  2AEC A;  3EH0 A;  2BO7 A;  1GWW A;  1PZY B;  3TIO A;  4LW3 A;  3TZT A;  2ICY A;  3EG4 A;  2RJ0 A;  1O23 B;  3VBN A;  1R80 A;  1V84 A;  1S4P A;  3CKV A;  2WVM A;  2MZB A;  3ZLL A;  4EAA A;  2X65 A;  3EE5 A;  5DG3 A;  3O3P A;  4KXO A;  1KQA A;  2Z86 A;  2DPW A;  3V91 A;  1ZCT A;  3VBM A;  1TW1 A;  3KWE A;  4D48 A;  4IRQ A;  1VZT A;  1HJJ A;  2V0I A;  3LW6 A;  3I0I X;  2WVK A;  2RJ1 A;  4KRV A;  4CJB A;  3CJ8 A;  3GVD A;  3Q4S A;  5JQQ A;  5C3B A;  5EJZ A;  3VBK A;  2GGQ A;  2X5Z A;  4NAI A;  1H5R B;  3OGZ A;  4FRB A;  3SXD A;  1V82 A;  1YP3 A;  4XWI A;  1FR8 A;  2JCO A;  4H7O A;  2RIT A;  5L6V A;  3OC9 A;  4YS8 A;  3V0N A;  4AYL A;  2Y6P A;  4K6R A;  5E3Q A;  1W57 A;  3SXB A;  1R7U A;  3TV0 A;  3OH2 A;  4E75 A;  3QVB A;  4EE3 A;  3PNN A;  4UEG A;  3DHO A;  3R1W A;  4N6A A;  2YES A;  1ZHJ A;  3RSB A;  1R7T A;  3D5N A;  1H7F A;  4AC3 A;  1HJL A;  1VM8 A;  4ARW A;  4NAL A;  2XWN A;  3RMV A;  3I0F A;  2TDT A;  2VXL A;  4DEC A;  2I7B A;  1LXA A;  1JVD A;  1JYL A;  2FYD B;  4HO8 A;  3ZLK A;  5FU8 A;  1H7G A;  3N9W A;  1VPA A;  5C36 A;  5CQN X;  4B2X A;  1GQC A;  4HO4 A;  1O0R A;  3KWD A;  3OAM A;  1KK5 A;  3R8Y A;  2RJ9 A;  2GGO A;  5IDT A;  2ZU9 A;  4MYB A;  2V0L A;  4Y7F A;  1TDT A;  2OEF A;  2Y7A A;  1MP4 A;  3VBI A;  1HM0 A;  3TQD A;  4NAN A;  2QH5 A;  2PA4 A;  3Q80 A;  3OH0 A;  5L6S A;  4B4G A;  4CJC A;  3BSW A;  3DJ4 A;  5C38 A;  1WT2 A;  3SXA A;  5J49 A;  3OKR A;  1K4V A;  1G2V A;  1VH3 A;  2VXM A;  1V67 A;  1G9R A;  2RIZ A;  4DCL A;  2X5S A;  2VD4 A;  5FU0 A;  1H4D A;  3BRK X;  1NWG B;  1FG5 N; 
#chains in the Genus database with same CATH topology
 1FWY A;  5DEP A;  1ZDF A;  4AYJ A;  1NF5 B;  4HO5 A;  2J0B A;  4MFG A;  3BFP A;  1MR9 A;  3I0K A;  5D91 A;  4AA7 A;  1XZ6 A;  2WLG A;  2Z87 A;  5CMI A;  2P6W A;  1FXO A;  3SX7 A;  2V0K A;  1LZ0 A;  2QIA A;  2D0J A;  4FCU A;  4IRP A;  5D92 A;  4IHG A;  5CQO A;  1ON8 A;  1R81 A;  4IHH A;  2FYB A;  2XAT A;  5AFU U;  5CMG X;  5C1H A;  3TWD A;  4HO9 A;  1T3D A;  4ASJ A;  2FYA A;  4HUR A;  2Q4J A;  2O1F A;  5AFU V;  2XWL A;  4KNX A;  2OEG A;  3PKQ A;  2AM3 A;  1TVY A;  3OU9 A;  3I0G A;  3F1Y A;  1ZJ3 A;  1N4I A;  3OH4 A;  2IU9 A;  1INI A;  1FO8 A;  1H7T A;  2AH9 A;  4AAW A;  2Y4J A;  2YQH A;  4HO2 A;  5FYE A;  1YP4 A;  1OMX A;  1KGQ A;  1I52 A;  5AJN A;  3KWC A;  1J2Z A;  5DDV A;  3SX3 A;  4G3S A;  4B2W A;  4BQH A;  2VS5 A;  1HM9 A;  4ECM A;  3HL3 A;  1ON6 A;  2RIX A;  1H5R A;  1WT0 A;  4FRA A;  4KNR A;  3RMW A;  1VIC A;  2V0H A;  2D7R A;  1H3M A;  4EGG A;  2FKO A;  3TIS A;  4HG6 A;  4KC2 A;  3D8V A;  1GX0 A;  2AES A;  2AM4 A;  3VBP A;  4MYO A;  2P72 A;  1VGW A;  3DUV A;  1MRL A;  2NXV A;  1R7Y A;  1ZCV A;  4FRH A;  4B3U A;  1THJ A;  3V0Q A;  2WLC A;  4EEA A;  5EJ1 A;  1JVG A;  1OQM B;  3PMO A;  1TZF A;  1R7X A;  1GQ9 A;  2JCJ A;  1SSM A;  2WEE A;  3BXY A;  3HJJ A;  3E26 A;  1VGT A;  4KC4 A;  4HOC A;  1IIM A;  3GOS A;  5CMH A;  1ZCY A;  3ZGG A;  1QRL A;  5IDS A;  2PGV A;  3EEV A;  1FOA A;  2A8U A;  3CKQ A;  4GBP A;  1G0R A;  5C1L A;  1FXJ A;  1E5K A;  3CKN A;  1LZI A;  1KK6 A;  2NPO A;  5C47 A;  3FOQ A;  2W0W A;  3VBL A;  1INJ A;  4Q7C A;  3FTT A;  2OI6 A;  4DDZ A;  4EEM A;  4N27 A;  3I3A A;  4B42 A;  5F42 A;  3V0M A;  3FSC A;  1ZIZ A;  2VSH A;  2OI5 A;  1H7L A;  2CU2 A;  3IOJ A;  1FGG A;  5HS2 A;  5FTV A;  4E79 A;  4FRM A;  3ST8 A;  2RIY A;  5FUH A;  2W0V A;  1ZJ0 A;  2Y4L A;  1KK4 A;  4CVH A;  4Y9X A;  2WE9 A;  3C8V A;  2WVL A;  5CMF X;  1H7E A;  1NQI B;  4FQW A;  4EE5 A;  2RJ8 A;  2D7I A;  4Y63 A;  2JCL A;  3IGJ A;  3I0D A;  1WT3 A;  2IUA A;  3FS8 A;  4HZD A;  4Y6U A;  5C3A A;  5I1F A;  4FRL A;  5BXC A;  1O7O A;  1VGZ A;  2E8B A;  5AJP A;  2VS3 A;  2VHE A;  2VS4 A;  4M99 A;  1QRM A;  1QGQ A;  1SSQ A;  3MC4 A;  1H4E A;  1YRO B;  1LL2 A;  1ZI3 A;  3U2X A;  3T7M A;  3SX5 A;  1H5T B;  2I5E A;  2YCM A;  2AQ9 A;  3JQY A;  4FRE A;  2VSI A;  4R37 A;  4HO6 A;  1JYK A;  1H5S B;  4M4K A;  5CMJ A;  5ADX U;  1G3L A;  2YQS A;  4FRO A;  4D11 C;  1S80 A;  1G8O A;  4HO0 A;  4EVW A;  1G95 A;  1JV1 A;  2PGY A;  5ADX V;  4L41 C;  3CKO A;  1HM8 A;  4Y6N A;  1VH1 A;  4E1K A;  3TK8 A;  1ZJP A;  2P2O A;  3R5C A;  2A8W A;  2PX7 A;  4HO3 A;  1O7Q A;  4LW6 A;  4C2S A;  4MZU A;  4M28 A;  5C1G A;  5C3D A;  1H4C A;  3V90 A;  4D11 A;  1LL3 A;  1SS9 A;  3R3R A;  2I5K A;  2XME A;  1L0S A;  3FSY A;  5U2K A;  4KC1 A;  4FIY A;  1V83 A;  4B4B A;  3JUK A;  2JF3 A;  1QRE A;  1QG8 A;  1EZI A;  2RIJ A;  1FZW A;  5C8R A;  4EA7 A;  3T7N A;  3HSQ A;  1KRU A;  1ZI1 A;  2XMH A;  1G93 A;  3K8E A;  1NMM B;  5DDT A;  1Z90 A;  4G3Q A;  1XHD A;  5CQM X;  3GQ7 A;  2VK9 A;  2YQJ A;  4JD0 A;  1VZU A;  1EWW A;  3R5B A;  3U2T A;  3I0E A;  3OTM A;  4M2A A;  3TDT A;  1NKH B;  2O1H A;  4Y7V A;  3Q1X A;  3CU0 A;  3VBJ A;  4B4M A;  4D0T A;  2YC5 A;  3SXC A;  4KPX A;  1SST A;  4B5B A;  4R7P A;  2BO8 A;  2FYC B;  1H7Q A;  2WLF A;  1LZJ A;  4EEO A;  3GQ9 A;  1S4O A;  3OW5 A;  4ASY A;  3DK5 A;  3PKP A;  4J09 A;  1V3W A;  4EAB A;  1PZT A;  1OMZ A;  2VFZ A;  2OI7 A;  1Z2F A;  3V8Z A;  1IIN A;  4Y64 A;  3POL A;  3BSY A;  1W55 A;  2Y4M A;  4KT7 A;  4E6U A;  3CKJ A;  4HUS A;  4M9C A;  5FV9 A;  2BO4 A;  1ZI5 A;  3NGW A;  3U2W A;  1R7V A;  1S4N A;  3OUP A;  3I0H A;  4EA8 A;  4Y7T A;  2XWM A;  1ZJ1 A;  3U2U A;  4IHF A;  3T7O A;  3CGX A;  3SXG A;  1WSZ A;  1R82 A;  4FRD A;  4J18 A;  2FY7 A;  2QIV X;  3SRT A;  4ISX A;  2RJ4 A;  4FIX A;  3R5D A;  4FRP A;  3JUJ A;  4Y62 A;  5CQP A;  1HV9 A;  5C4F A;  4CJ8 A;  1M8N A;  5E3P A;  4KPZ A;  3V8Y A;  4EQY A;  3JTJ A;  3VNP A;  1GX4 A;  3P1B A;  2IC7 A;  1ZI4 A;  2FFV A;  5AJO A;  1ZJO A;  1GA8 A;  4M98 A;  1H5S C;  3MQH A;  1QQ0 A;  1WT1 A;  2QKX A;  3R3I A;  3ECT A;  4R36 A;  3SXE A;  4D0Z A;  2AGD A;  1WVC A;  5IFY A;  1H5T A;  1FO9 A;  2RJ6 A;  1KHR A;  3V4E A;  3K8D A;  3R0S A;  1QRG A;  2V0J A;  3P47 A;  1H5S A;  3FWW A;  1FRW A;  3GUE A;  4M2B A;  4EA9 A;  2WAW A;  4JIS A;  4G3P A;  1ZDG A;  1OCX A;  1YP2 A;  3V0P A;  1W77 A;  3USQ A;  1MP3 A;  1QGS A;  1FR9 A;  2AM5 A;  3Q7U A;  3IOI A;  2JF2 A;  1GWV A;  2APC A;  4Y7U A;  4DE7 A;  3FSX A;  5C49 A;  4E6T A;  3V0L A;  4MND A;  5C4C A;  1KRV A;  3SX8 A;  1H5S D;  2QGI A;  3ZGF A;  2WGZ A;  3KIA A;  2ICX A;  1H7H A;  3D98 A;  3I0C A;  3SPT A;  4FCE A;  4HZC A;  5DEM A;  2YC3 A;  1TW5 A;  1XHB A;  4O6M A;  2FFU A;  3ZF8 A;  1G23 A;  3I0L A;  3T57 A;  2X60 A;  4G87 A;  4MIX A;  1XAT A;  3OH3 A;  5CQL X;  4ZDQ A;  1MC3 A;  3F1C A;  3USR A;  1LVW A;  3V0O A;  4EE4 A;  3NZ2 A;  2RJ7 A;  4N6B A;  3BSS A;  3OH1 A;  1KGT A;  5E3R A;  5C4E A;  2ZU7 A;  1VZX A;  2O1G A;  3U0Y A;  4KQL A;  2Y4K A;  2AE7 A;  4P00 A;  1LZ7 A;  1JV3 A;  4N69 A;  1KWS A;  2J0A A;  5C48 A;  1EYR A;  4HCQ A;  2UX8 A;  3I3X A;  3IXC A;  1MR7 A;  1QRF A;  3MQG A;  3GQ8 A;  3R5A A;  1G1L A;  4NAK A;  3FSB A;  3R2W A;  1KRR A;  1QWJ A;  1VGU A;  2WLD A;  2YQC A;  3I0J A;  3E25 A;  2E3D A;  2BO6 A;  2P73 A;  2WLE A;  1NHE B;  5C4B A;  4BMA A;  1G97 A;  5C4D A;  4FRQ A;  3U2V A;  2IU8 A;  3U0X A;  2ZU8 A;  4EEG A;  1ZCU A;  1MP5 A;  3OTZ A;  3F1X A;  3IOH A;  4Y7G A;  2RJ5 A;  1LL0 A;  4P02 A;  5EIY A;  5FTS A;  1ZJ2 A;  3BCV A;  1FGX A;  2JCK A;  2AEC A;  3EH0 A;  2BO7 A;  1GWW A;  1PZY B;  3TIO A;  4LW3 A;  3TZT A;  2ICY A;  3EG4 A;  2RJ0 A;  1O23 B;  3VBN A;  1R80 A;  1V84 A;  1S4P A;  3CKV A;  2WVM A;  2MZB A;  3ZLL A;  4EAA A;  2X65 A;  3EE5 A;  5DG3 A;  3O3P A;  4KXO A;  1KQA A;  2Z86 A;  2DPW A;  3V91 A;  1ZCT A;  3VBM A;  1TW1 A;  3KWE A;  4D48 A;  4IRQ A;  1VZT A;  1HJJ A;  2V0I A;  3LW6 A;  3I0I X;  2WVK A;  2RJ1 A;  4KRV A;  4CJB A;  3CJ8 A;  3GVD A;  3Q4S A;  5JQQ A;  5C3B A;  5EJZ A;  3VBK A;  2GGQ A;  2X5Z A;  4NAI A;  3OGZ A;  1H5R B;  4FRB A;  3SXD A;  1V82 A;  1YP3 A;  4XWI A;  1FR8 A;  2JCO A;  4H7O A;  2RIT A;  5L6V A;  3OC9 A;  4YS8 A;  3V0N A;  4AYL A;  2Y6P A;  4K6R A;  5E3Q A;  1W57 A;  3SXB A;  3GQA A;  1R7U A;  3TV0 A;  3OH2 A;  4E75 A;  3QVB A;  4EE3 A;  3PNN A;  4UEG A;  3DHO A;  3R1W A;  4N6A A;  2YES A;  1ZHJ A;  3RSB A;  1R7T A;  3D5N A;  1H7F A;  4AC3 A;  1HJL A;  1VM8 A;  4ARW A;  4NAL A;  2XWN A;  3RMV A;  3I0F A;  2TDT A;  2VXL A;  4DEC A;  2I7B A;  1LXA A;  1JVD A;  1JYL A;  2FYD B;  4HO8 A;  3ZLK A;  5FU8 A;  1H7G A;  3N9W A;  1VPA A;  5C36 A;  5CQN X;  2C0N A;  4B2X A;  1GQC A;  4HO4 A;  1O0R A;  3KWD A;  3OAM A;  1KK5 A;  3R8Y A;  2RJ9 A;  2GGO A;  5IDT A;  2ZU9 A;  4MYB A;  2V0L A;  4Y7F A;  1TDT A;  2OEF A;  2Y7A A;  1MP4 A;  3VBI A;  1HM0 A;  4O6N A;  4NAN A;  3TQD A;  2QH5 A;  2PA4 A;  3Q80 A;  3OH0 A;  5L6S A;  4B4G A;  4CJC A;  3BSW A;  3DJ4 A;  5C38 A;  1WT2 A;  3SXA A;  5J49 A;  3OKR A;  1K4V A;  3SUC A;  1G2V A;  1VH3 A;  2VXM A;  1V67 A;  1G9R A;  2RIZ A;  4DCL A;  2X5S A;  2VD4 A;  5FU0 A;  1H4D A;  3BRK X;  1NWG B;  1FG5 N; 
#chains in the Genus database with same CATH homology
 1FWY A;  5DEP A;  1ZDF A;  4AYJ A;  1NF5 B;  4HO5 A;  2J0B A;  4MFG A;  3BFP A;  1MR9 A;  3I0K A;  5D91 A;  4AA7 A;  1XZ6 A;  2WLG A;  2Z87 A;  5CMI A;  2P6W A;  1FXO A;  3SX7 A;  2V0K A;  1LZ0 A;  2QIA A;  2D0J A;  4FCU A;  4IRP A;  5D92 A;  4IHG A;  5CQO A;  1ON8 A;  1R81 A;  4IHH A;  2FYB A;  2XAT A;  5AFU U;  5CMG X;  5C1H A;  3TWD A;  4HO9 A;  1T3D A;  4ASJ A;  2FYA A;  4HUR A;  2Q4J A;  2O1F A;  5AFU V;  2XWL A;  4KNX A;  2OEG A;  3PKQ A;  2AM3 A;  1TVY A;  3OU9 A;  3I0G A;  3F1Y A;  1ZJ3 A;  3OH4 A;  2IU9 A;  1INI A;  1FO8 A;  1H7T A;  2AH9 A;  4AAW A;  2Y4J A;  2YQH A;  4HO2 A;  5FYE A;  1YP4 A;  1OMX A;  1KGQ A;  1I52 A;  5AJN A;  3KWC A;  1J2Z A;  5DDV A;  3SX3 A;  4G3S A;  4B2W A;  4BQH A;  2VS5 A;  1HM9 A;  4ECM A;  3HL3 A;  1ON6 A;  2RIX A;  1H5R A;  1WT0 A;  4FRA A;  4KNR A;  3RMW A;  1VIC A;  2V0H A;  2D7R A;  1H3M A;  4EGG A;  2FKO A;  3TIS A;  4HG6 A;  4KC2 A;  3D8V A;  1GX0 A;  2AES A;  2AM4 A;  3VBP A;  4MYO A;  2P72 A;  1VGW A;  3DUV A;  1MRL A;  2NXV A;  1R7Y A;  1ZCV A;  4FRH A;  4B3U A;  1THJ A;  3V0Q A;  2WLC A;  4EEA A;  5EJ1 A;  1JVG A;  1OQM B;  3PMO A;  1TZF A;  1R7X A;  1GQ9 A;  2JCJ A;  1SSM A;  2WEE A;  3BXY A;  3HJJ A;  3E26 A;  1VGT A;  4KC4 A;  4HOC A;  1IIM A;  3GOS A;  5CMH A;  1ZCY A;  3ZGG A;  1QRL A;  5IDS A;  2PGV A;  3EEV A;  1FOA A;  2A8U A;  3CKQ A;  4GBP A;  1G0R A;  5C1L A;  1FXJ A;  1E5K A;  3CKN A;  1LZI A;  1KK6 A;  2NPO A;  5C47 A;  3FOQ A;  2W0W A;  3VBL A;  1INJ A;  4Q7C A;  3FTT A;  2OI6 A;  4DDZ A;  4EEM A;  4N27 A;  3I3A A;  4B42 A;  5F42 A;  3V0M A;  3FSC A;  1ZIZ A;  2VSH A;  2OI5 A;  1H7L A;  2CU2 A;  3IOJ A;  1FGG A;  5HS2 A;  5FTV A;  4E79 A;  4FRM A;  3ST8 A;  2RIY A;  5FUH A;  2W0V A;  1ZJ0 A;  2Y4L A;  1KK4 A;  4CVH A;  4Y9X A;  2WE9 A;  3C8V A;  2WVL A;  5CMF X;  1H7E A;  1NQI B;  4FQW A;  4EE5 A;  2RJ8 A;  2D7I A;  4Y63 A;  2JCL A;  3IGJ A;  3I0D A;  1WT3 A;  2IUA A;  3FS8 A;  4HZD A;  4Y6U A;  5C3A A;  5I1F A;  4FRL A;  5BXC A;  1O7O A;  1VGZ A;  2E8B A;  5AJP A;  2VS3 A;  2VHE A;  2VS4 A;  4M99 A;  1QRM A;  1QGQ A;  1SSQ A;  3MC4 A;  1H4E A;  1YRO B;  1LL2 A;  1ZI3 A;  3U2X A;  3T7M A;  3SX5 A;  1H5T B;  2I5E A;  2YCM A;  2AQ9 A;  3JQY A;  4FRE A;  2VSI A;  4R37 A;  4HO6 A;  1JYK A;  1H5S B;  4M4K A;  5CMJ A;  5ADX U;  1G3L A;  2YQS A;  4FRO A;  4D11 C;  1S80 A;  1G8O A;  4HO0 A;  4EVW A;  1G95 A;  1JV1 A;  2PGY A;  5ADX V;  4L41 C;  3CKO A;  1HM8 A;  4Y6N A;  1VH1 A;  4E1K A;  3TK8 A;  1ZJP A;  2P2O A;  3R5C A;  2A8W A;  2PX7 A;  4HO3 A;  1O7Q A;  4LW6 A;  4C2S A;  4MZU A;  4M28 A;  5C1G A;  5C3D A;  1H4C A;  3V90 A;  4D11 A;  1LL3 A;  1SS9 A;  3R3R A;  2I5K A;  2XME A;  3FSY A;  5U2K A;  4KC1 A;  4FIY A;  1V83 A;  4B4B A;  3JUK A;  2JF3 A;  1QRE A;  1QG8 A;  1EZI A;  2RIJ A;  1FZW A;  5C8R A;  4EA7 A;  3T7N A;  3HSQ A;  1KRU A;  1ZI1 A;  2XMH A;  1G93 A;  3K8E A;  1NMM B;  5DDT A;  1Z90 A;  4G3Q A;  1XHD A;  5CQM X;  2VK9 A;  2YQJ A;  4JD0 A;  1VZU A;  3R5B A;  3U2T A;  3I0E A;  3OTM A;  4M2A A;  3TDT A;  1NKH B;  2O1H A;  4Y7V A;  3Q1X A;  3CU0 A;  3VBJ A;  4B4M A;  4D0T A;  2YC5 A;  3SXC A;  4KPX A;  1SST A;  4B5B A;  4R7P A;  2BO8 A;  2FYC B;  1H7Q A;  2WLF A;  1LZJ A;  4EEO A;  1S4O A;  3OW5 A;  4ASY A;  3DK5 A;  3PKP A;  4J09 A;  1V3W A;  4EAB A;  1PZT A;  1OMZ A;  2VFZ A;  2OI7 A;  3V8Z A;  1IIN A;  4Y64 A;  3POL A;  3BSY A;  1W55 A;  2Y4M A;  4KT7 A;  4E6U A;  3CKJ A;  4HUS A;  4M9C A;  5FV9 A;  2BO4 A;  1ZI5 A;  3NGW A;  3U2W A;  1R7V A;  1S4N A;  3OUP A;  3I0H A;  4EA8 A;  4Y7T A;  2XWM A;  1ZJ1 A;  3U2U A;  4IHF A;  3T7O A;  3CGX A;  3SXG A;  1WSZ A;  1R82 A;  4FRD A;  4J18 A;  2FY7 A;  2QIV X;  3SRT A;  4ISX A;  2RJ4 A;  4FIX A;  3R5D A;  4FRP A;  3JUJ A;  4Y62 A;  5CQP A;  1HV9 A;  5C4F A;  4CJ8 A;  5E3P A;  4KPZ A;  3V8Y A;  4EQY A;  3JTJ A;  3VNP A;  1GX4 A;  3P1B A;  2IC7 A;  1ZI4 A;  2FFV A;  5AJO A;  1ZJO A;  1GA8 A;  4M98 A;  1H5S C;  3MQH A;  1QQ0 A;  1WT1 A;  2QKX A;  3R3I A;  3ECT A;  4R36 A;  3SXE A;  4D0Z A;  2AGD A;  1WVC A;  5IFY A;  1H5T A;  1FO9 A;  2RJ6 A;  1KHR A;  3V4E A;  3K8D A;  3R0S A;  1QRG A;  2V0J A;  3P47 A;  1H5S A;  3FWW A;  1FRW A;  3GUE A;  4M2B A;  4EA9 A;  2WAW A;  4JIS A;  4G3P A;  1ZDG A;  1OCX A;  1YP2 A;  3V0P A;  1W77 A;  3USQ A;  1MP3 A;  1QGS A;  1FR9 A;  2AM5 A;  3Q7U A;  3IOI A;  2JF2 A;  1GWV A;  2APC A;  4Y7U A;  4DE7 A;  3FSX A;  5C49 A;  4E6T A;  3V0L A;  4MND A;  5C4C A;  1KRV A;  3SX8 A;  1H5S D;  2QGI A;  3ZGF A;  2WGZ A;  3KIA A;  2ICX A;  1H7H A;  3D98 A;  3I0C A;  3SPT A;  4FCE A;  4HZC A;  5DEM A;  2YC3 A;  1TW5 A;  1XHB A;  4O6M A;  2FFU A;  3ZF8 A;  1G23 A;  3I0L A;  3T57 A;  2X60 A;  4G87 A;  4MIX A;  1XAT A;  3OH3 A;  5CQL X;  4ZDQ A;  1MC3 A;  3F1C A;  3USR A;  1LVW A;  3V0O A;  4EE4 A;  3NZ2 A;  2RJ7 A;  4N6B A;  3BSS A;  3OH1 A;  1KGT A;  5E3R A;  5C4E A;  2ZU7 A;  1VZX A;  2O1G A;  3U0Y A;  4KQL A;  2Y4K A;  2AE7 A;  4P00 A;  1LZ7 A;  1JV3 A;  4N69 A;  1KWS A;  2J0A A;  5C48 A;  1EYR A;  4HCQ A;  2UX8 A;  3I3X A;  3IXC A;  1MR7 A;  1QRF A;  3MQG A;  3R5A A;  1G1L A;  4NAK A;  3FSB A;  3R2W A;  1KRR A;  1QWJ A;  1VGU A;  2WLD A;  2YQC A;  3I0J A;  3E25 A;  2E3D A;  2BO6 A;  2P73 A;  2WLE A;  1NHE B;  5C4B A;  4BMA A;  1G97 A;  5C4D A;  4FRQ A;  3U2V A;  2IU8 A;  3U0X A;  2ZU8 A;  4EEG A;  1ZCU A;  1MP5 A;  3OTZ A;  3F1X A;  3IOH A;  4Y7G A;  2RJ5 A;  1LL0 A;  4P02 A;  5EIY A;  5FTS A;  1ZJ2 A;  3BCV A;  1FGX A;  2JCK A;  2AEC A;  3EH0 A;  2BO7 A;  1GWW A;  1PZY B;  3TIO A;  4LW3 A;  3TZT A;  2ICY A;  3EG4 A;  2RJ0 A;  1O23 B;  3VBN A;  1R80 A;  1V84 A;  1S4P A;  3CKV A;  2WVM A;  2MZB A;  3ZLL A;  4EAA A;  2X65 A;  3EE5 A;  5DG3 A;  3O3P A;  4KXO A;  1KQA A;  2Z86 A;  2DPW A;  3V91 A;  1ZCT A;  3VBM A;  1TW1 A;  3KWE A;  4D48 A;  4IRQ A;  1VZT A;  1HJJ A;  2V0I A;  3LW6 A;  3I0I X;  2WVK A;  2RJ1 A;  4KRV A;  4CJB A;  3CJ8 A;  3GVD A;  3Q4S A;  5JQQ A;  5C3B A;  5EJZ A;  3VBK A;  2GGQ A;  2X5Z A;  4NAI A;  1H5R B;  3OGZ A;  4FRB A;  3SXD A;  1V82 A;  1YP3 A;  4XWI A;  1FR8 A;  2JCO A;  4H7O A;  2RIT A;  5L6V A;  3OC9 A;  4YS8 A;  3V0N A;  4AYL A;  2Y6P A;  4K6R A;  5E3Q A;  1W57 A;  3SXB A;  1R7U A;  3TV0 A;  3OH2 A;  4E75 A;  3QVB A;  4EE3 A;  3PNN A;  4UEG A;  3DHO A;  3R1W A;  4N6A A;  2YES A;  1ZHJ A;  3RSB A;  1R7T A;  3D5N A;  1H7F A;  4AC3 A;  1HJL A;  1VM8 A;  4ARW A;  4NAL A;  2XWN A;  3RMV A;  3I0F A;  2TDT A;  2VXL A;  4DEC A;  2I7B A;  1LXA A;  1JVD A;  1JYL A;  2FYD B;  4HO8 A;  3ZLK A;  5FU8 A;  1H7G A;  3N9W A;  1VPA A;  5C36 A;  5CQN X;  2C0N A;  4B2X A;  1GQC A;  4HO4 A;  1O0R A;  3KWD A;  3OAM A;  1KK5 A;  3R8Y A;  2RJ9 A;  2GGO A;  5IDT A;  2ZU9 A;  4MYB A;  2V0L A;  4Y7F A;  1TDT A;  2OEF A;  2Y7A A;  1MP4 A;  3VBI A;  1HM0 A;  4O6N A;  4NAN A;  3TQD A;  2QH5 A;  2PA4 A;  3Q80 A;  3OH0 A;  5L6S A;  4B4G A;  4CJC A;  3BSW A;  3DJ4 A;  5C38 A;  1WT2 A;  3SXA A;  5J49 A;  3OKR A;  1K4V A;  1G2V A;  1VH3 A;  2VXM A;  1V67 A;  1G9R A;  2RIZ A;  4DCL A;  2X5S A;  2VD4 A;  5FU0 A;  1H4D A;  3BRK X;  1NWG B;  1FG5 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...