3R3IA

Crystal structure of c-terminal truncation of udp-glucose pyrophosphorylase of homo sapiens
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
477
structure length
457
Chain Sequence
IRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of UDP-glucose Pyrophosphorylase of Homo sapiens
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords UTP--glucose-1-phosphate uridylyltransferase
total genus 98
structure length 457
sequence length 477
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.9: UTP--glucose-1-phosphate uridylyltransferase.
pdb deposition date 2011-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01704 UDPGP UTP--glucose-1-phosphate uridylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3r3iA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3r3iA01
1ZJPA 1WSZA 2VD4A 1LZIA 3P1BA 2PX7A 2RJ1A 1YP2A 3VBLA 1H4CA 3OUPA 4AYLA 1THJA 3TQDA 4DECA 1JV3A 3TV0A 2MZBA 3SX5A 1J2ZA 2YESA 3PNNA 4E6TA 1ZDGA 3P47A 3KWEA 5C48A 2W0WA 3FSCA 2AESA 2AQ9A 2IU8A 2BO6A 2AM5A 4D11C 2X65A 2FYCB 1VH1A 2P72A 2WEEA 5C1LA 3DUVA 3ST8A 1GQ9A 1H5SA 3R5DA 4HCQA 1VGTA 2AE7A 1LXAA 2IU9A 2O1GA 4HO2A 3VBPA 3PKPA 3SXAA 3TK8A 5FU0A 3I0KA 1S80A 2VFZA 2RJ7A 4HO0A 4G3QA 1WT1A 1ZCYA 1ZCVA 3ECTA 1FZWA 4MFGA 1HJLA 4EE5A 3I0JA 5AJOA 1WT3A 3ZGGA 2V0JA 1TDTA 3U2XA 1LZJA 3I0EA 1JV1A 5CMHA 4FQWA 1EZIA 2RJ9A 1MP3A 1QQ0A 1INIA 1LZ7A 5JQQA 1S4OA 2AM3A 3SPTA 3VNPA 3VBKA 1MP4A 1OMZA 2WVLA 5BXCA 5DDTA 3E26A 4D48A 5I1FA 4EGGA 1WT0A 2P2OA 3GUEA 5EJ1A 1MC3A 3NGWA 2BO7A 2OI7A 3ZF8A 4ARWA 4K6RA 2OEGA 2AH9A 4HO4A 1GX0A 2ZU8A 3USRA 3T7OA 3BSWA 2APCA 1R80A 1R7UA 2ICYA 1XZ6A 4JISA 4EEGA 5IDTA 3LW6A 1VM8A 1FR9A 5C3DA 3NZ2A 3JUKA 4KT7A 3SXDA 5C1HA 4FRAA 1ZI5A 3E25A 4MZUA 4EEMA 3OH4A 5FV9A 2D0JA 2RITA 5E3QA 3OC9A 4HO6A 3IOJA 3IGJA 3TDTA 2FFVA 4N6BA 4EEOA 3R2WA 3FSXA 4HZDA 2CU2A 3OH2A 1JVGA 3T7MA 3EH0A 5F42A 3Q4SA 1H7TA 2V0KA 2XWMA 2WVKA 3F1XA 1VZTA 4IRPA 4B4MA 2QGIA 3BFPA 1G95A 4M2BA 4E6UA 2YQHA 4KPXA 1ON6A 3Q80A 4B2WA 1ZI4A 1V67A 2OI5A 2YC3A 2JCKA 3OH3A 2FKOA 1G3LA 5EIYA 4HO5A 2O1HA 4JD0A 4XWIA 4D0TA 5C3BA 5IFYA 4Y7UA 1S4PA 1FXJA 4CVHA 1SS9A 1VH3A 2FYBA 4N6AA 3Q1XA 1T3DA 3R5AA 1LL2A 4ZDQA 3I0HA 2QH5A 2W0VA 5DDVA 4D0ZA 2FY7A 1VGZA 2OI6A 3V0NA 1W77A 2PA4A 1GX4A 3V4EA 1H4DA 3PKQA 4Y64A 3O3PA 3DJ4A 1YROB 1R81A 2TDTA 1HM9A 5FUHA 2A8WA 2JF2A 1O7OA 1G97A 4AC3A 4E1KA 4HO8A 1H5SC 3V91A 3V8YA 1FO8A 2XMEA 1O0RA 1H7EA 1JYKA 3D5NA 4D11A 4M28A 3FS8A 1MP5A 3F1YA 3DHOA 1ZCUA 3SXEA 1IIMA 1E5KA 4R37A 4CJ8A 2AGDA 3CJ8A 1H5TA 4HO3A 1NMMB 1ZHJA 1FOAA 5L6SA 3R1WA 3BCVA 3HJJA 1MRLA 3KWDA 5L6VA 1H7HA 1ZJ1A 4FRMA 1MR7A 1QRMA 3R8YA 3MC4A 1V82A 4HZCA 3OW5A 1FWYA 1WT2A 1G0RA 3I0DA 3BSSA 4DE7A 3IXCA 4KNRA 3R5CA 3SRTA 5C36A 3MQGA 1O7QA 2RIXA 1HM0A 2A8UA 3SXBA 1V84A 3KWCA 2QKXA 4ASJA 2YQCA 5CQNX 5CMJA 3DK5A 1O23B 5CMFX 1VICA 1GWWA 4B2XA 4MYBA 1FR8A 1JYLA 4AYJA 3OTZA 1VGWA 5C3AA 1VZUA 3V0MA 1FGXA 5ADXU 5FU8A 3MQHA 3I0FA 4BMAA 5CQOA 1ZCTA 1LL0A 3FWWA 3TIOA 1S4NA 1TW5A 3V0OA 4C2SA 5DG3A 1H5SD 4FRQA 4HO9A 5C4CA 3OU9A 5AJNA 2VS4A 3JUJA 4NALA 4Y7VA 1TW1A 4CJCA 3T57A 3I0LA 3OH1A 4M4KA 2JF3A 2XWLA 3CKJA 2WGZA 4L41C 2YCMA 3I3AA 4G3PA 2O1FA 2RJ6A 1KK6A 1H5RB 3BSYA 1INJA 2Y4KA 2WE9A 3CU0A 4P02A 5C1GA 4FRBA 2ICXA 3SX8A 3OKRA 3RMVA 4KC4A 2WLFA 4IHGA 5ADXV 3BRKX 5C4DA 3PMOA 3I3XA 2WLDA 2FYAA 5CQPA 1PZTA 1SSMA 5HS2A 3V0PA 3SXGA 4EAAA 4B5BA 1KRVA 3D98A 1VGUA 3CGXA 2D7IA 2QIVX 1KGTA 3VBMA 3U2WA 5J49A 5CQLX 2V0HA 3OGZA 2JCOA 5C4FA 1NHEB 3OAMA 4AAWA 1H7LA 3TWDA 1KWSA 2V0IA 4LW6A 1I52A 5FYEA 1V3WA 1XHDA 1XHBA 2E8BA 4N27A 1GWVA 3R3RA 5CMIA 2GGQA 2BO8A 1VPAA 2Q4JA 2P6WA 2AM4A 4HOCA 3IOHA 2YQJA 3I0GA 4BQHA 5C8RA 5DEMA 4R7PA 3CKQA 2I5KA 1XATA 4G3SA 2PGYA 3POLA 3FSBA 3TISA 1H7QA 3EEVA 4DCLA 1OQMB 3FOQA 3VBJA 2VSHA 3FTTA 5C47A 1YP4A 3ZLKA 1FG5N 1ZJ0A 4Y7TA 1W57A 2D7RA 5FTSA 3U2UA 3SX3A 1FRWA 4EE3A 1R82A 1KGQA 1NWGB 1ZJOA 1QRGA 5AFUU 1NF5B 4FROA 5C49A 1G2VA 2DPWA 1VZXA 2E3DA 1KQAA 4M98A 2XMHA 4Y7GA 2ZU7A 3TZTA 2IUAA 4KXOA 3CKNA 4HUSA 1NKHB 1G8OA 1Z90A 1GQCA 2VXMA 4R36A 1H4EA 1ZJ3A 2RJ4A 1G93A 4M99A 1OCXA 4J18A 2FYDB 5CMGX 1QGQA 2Y4JA 4B42A 4KC2A 3RMWA 2RIZA 1FXOA 3GVDA 5FTVA 3Q7UA 2GGOA 4UEGA 3V8ZA 4YS8A 1QG8A 2WVMA 1NQIB 1WVCA 4KPZA 2I7BA 3V0LA 3C8VA 2XWNA 4EEAA 2JCJA 4M9CA 3V90A 4ISXA 4DDZA 2RIJA 3D8VA 2NXVA 2RJ0A 5IDSA 1W55A 2Y6PA 4ECMA 5C38A 2JCLA 4Y7FA 3BXYA 1HV9A 2I5EA 2YQSA 3VBNA 4KC1A 4GBPA 1R7YA 1KHRA 2V0LA 5C4EA 4M2AA 1IINA 5EJZA 1HM8A 2Y4MA 2IC7A 2WLCA 2FFUA 3EE5A 2Y4LA 5U2KA 1H7GA 1QREA 1H5SB 3KIAA 2AECA 4NANA 1G1LA 1LL3A 3JTJA 4KRVA 2VS5A 4N69A 2Z87A 2Y7AA 1MR9A 2X5ZA 2XATA 2PGVA 1G23A 1KRUA 3JQYA 1V83A 3OH0A 1QWJA 1ZI1A 2BO4A 5AJPA 3R3IA 5DEPA 1H5RA 4IRQA 5AFUV 4Y62A 3K8DA 4MNDA 3I0CA 3U0YA 2YC5A 4FCEA 4FRHA 2X60A 1HJJA 3HL3A 4KQLA 2VHEA 5E3PA 4E75A 2OEFA 1R7TA 4EA9A 2Z86A 3T7NA 2WLGA 4FRLA 4HURA 3F1CA 1GA8A 1ON8A 1PZYB 1H7FA 4NAKA 4IHHA 1QRFA 1QGSA 4P00A 3GOSA 1R7VA 4EA7A 1QRLA 3CKOA 3FSYA 1G9RA 4LW3A 3V0QA 2RIYA 1EYRA 4Y63A 3U0XA 3SX7A 2NPOA 4EQYA 3I0IX 4ASYA 3RSBA 4EA8A 2VS3A 4H7OA 4EABA 4HG6A 1TZFA 4G87A 4Y9XA 1SSTA 3QVBA 4B3UA 3VBIA 4NAIA 3R5BA 1K4VA 2P73A 3SXCA 3ZLLA 2QIAA 2WAWA 5C4BA 3USQA 2WLEA 3U2VA 3CKVA 4EE4A 1FGGA 1ZDFA 1TVYA 1LVWA 1OMXA 1H3MA 2RJ5A 3EG4A 4Y6UA 4CJBA 4J09A 1JVDA 5E3RA 1LZ0A 1SSQA 2X5SA 4FREA 1H5TB 3R0SA 4MYOA 2RJ8A 2UX8A 2VSIA 3U2TA 2VXLA 4EVWA 1ZI3A 4AA7A 1ZIZA 3HSQA 1YP3A 4IHFA 2ZU9A 1R7XA 1KK5A 4FRDA 1ZJ2A 4B4GA 4FCUA 4Y6NA 4FRPA 3N9WA 3ZGFA 4E79A 3IOIA 5CQMX 4B4BA 1KK4A 1KRRA 3K8EA 3OTMA 4KNXA 1FO9A
chains in the Genus database with same CATH superfamily
1ZJPA 1WSZA 2VD4A 1LZIA 3P1BA 2PX7A 2RJ1A 1YP2A 3VBLA 1H4CA 3OUPA 4AYLA 1THJA 3TQDA 4DECA 1JV3A 3TV0A 2MZBA 3SX5A 1J2ZA 2YESA 3PNNA 4E6TA 1ZDGA 3P47A 3KWEA 5C48A 2W0WA 3FSCA 2AESA 2AQ9A 2IU8A 2BO6A 2AM5A 4D11C 2X65A 2FYCB 1VH1A 2P72A 2WEEA 5C1LA 3DUVA 3ST8A 1GQ9A 1H5SA 3R5DA 4HCQA 1VGTA 2AE7A 1LXAA 2IU9A 2O1GA 4HO2A 3VBPA 3PKPA 3SXAA 3TK8A 5FU0A 3I0KA 1S80A 2VFZA 2RJ7A 4HO0A 4G3QA 1WT1A 1ZCYA 1ZCVA 3ECTA 1FZWA 4MFGA 1HJLA 4EE5A 3I0JA 5AJOA 1WT3A 3ZGGA 2V0JA 1TDTA 3U2XA 1LZJA 3I0EA 1JV1A 5CMHA 4FIXA 4FQWA 1EZIA 2RJ9A 1MP3A 1QQ0A 1INIA 1LZ7A 5JQQA 1S4OA 2J0BA 2AM3A 3SPTA 3VNPA 3VBKA 1MP4A 1OMZA 2WVLA 5BXCA 5DDTA 3E26A 4D48A 5I1FA 4EGGA 1WT0A 2P2OA 3GUEA 5EJ1A 1MC3A 3NGWA 2BO7A 2OI7A 3ZF8A 5D92A 2J0AA 4ARWA 4K6RA 2OEGA 2AH9A 4HO4A 1GX0A 2ZU8A 3USRA 3T7OA 3BSWA 2APCA 1R80A 1R7UA 2ICYA 1XZ6A 4JISA 4EEGA 5IDTA 3LW6A 1VM8A 1FR9A 5C3DA 3NZ2A 3JUKA 4KT7A 3SXDA 5C1HA 4FRAA 1ZI5A 3E25A 4MZUA 4EEMA 3OH4A 5FV9A 2D0JA 2RITA 5E3QA 3OC9A 4HO6A 3IOJA 3IGJA 3TDTA 2FFVA 4N6BA 4EEOA 3R2WA 3FSXA 4HZDA 3OH2A 2CU2A 4MIXA 1JVGA 3T7MA 3EH0A 5F42A 3Q4SA 1H7TA 2V0KA 2XWMA 2WVKA 3F1XA 1VZTA 4IRPA 4B4MA 2QGIA 3BFPA 1G95A 4M2BA 3SUCA 4E6UA 2VK9A 4KPXA 1ON6A 2YQHA 3Q80A 1ZI4A 4B2WA 1V67A 2OI5A 2YC3A 4FIYA 2JCKA 3OH3A 2FKOA 1G3LA 5EIYA 4HO5A 2O1HA 4JD0A 4XWIA 4D0TA 5C3BA 5IFYA 4Y7UA 1S4PA 1FXJA 4CVHA 1SS9A 1VH3A 2FYBA 4N6AA 3Q1XA 1T3DA 3R5AA 1LL2A 1N4IA 4ZDQA 3I0HA 2QH5A 2W0VA 5DDVA 4D0ZA 2FY7A 1VGZA 2OI6A 3V0NA 1W77A 2PA4A 1GX4A 3V4EA 1H4DA 3PKQA 4Y64A 3O3PA 3DJ4A 1YROB 1R81A 1L0SA 2TDTA 1HM9A 5FUHA 2A8WA 2JF2A 1O7OA 1G97A 4AC3A 4E1KA 4HO8A 1H5SC 3V91A 3V8YA 1FO8A 2XMEA 1O0RA 1H7EA 1JYKA 3D5NA 4D11A 3GQ8A 4M28A 3FS8A 1MP5A 3F1YA 3DHOA 1ZCUA 3SXEA 1IIMA 1E5KA 4R37A 4CJ8A 2AGDA 3CJ8A 1H5TA 4HO3A 1NMMB 1ZHJA 1FOAA 5L6SA 3R1WA 3BCVA 3HJJA 1MRLA 3KWDA 5L6VA 1H7HA 1ZJ1A 4FRMA 1MR7A 1QRMA 3R8YA 3MC4A 1V82A 4HZCA 3OW5A 1FWYA 1WT2A 1G0RA 3I0DA 3BSSA 4DE7A 3IXCA 4KNRA 3R5CA 3SRTA 5C36A 3MQGA 1O7QA 2RIXA 1HM0A 2A8UA 3SXBA 1V84A 3KWCA 2QKXA 4ASJA 2YQCA 5CQNX 5CMJA 3DK5A 1O23B 5CMFX 1VICA 1GWWA 4B2XA 4MYBA 1FR8A 4Q7CA 1JYLA 4AYJA 3OTZA 1VGWA 5C3AA 1VZUA 3V0MA 1FGXA 5ADXU 5FU8A 2C0NA 3MQHA 3I0FA 4BMAA 5CQOA 1ZCTA 1LL0A 3FWWA 3TIOA 1S4NA 1TW5A 3V0OA 4C2SA 5DG3A 1H5SD 4FRQA 4HO9A 5C4CA 3OU9A 5AJNA 2VS4A 4O6MA 3GQ9A 3JUJA 4NALA 4Y7VA 1TW1A 4CJCA 3T57A 3OH1A 3I0LA 4M4KA 2JF3A 2XWLA 3CKJA 2WGZA 4L41C 2YCMA 3I3AA 4G3PA 2O1FA 2RJ6A 1KK6A 1H5RB 3BSYA 1INJA 2Y4KA 2WE9A 3CU0A 4P02A 5C1GA 4FRBA 2ICXA 3SX8A 3OKRA 3RMVA 4KC4A 2WLFA 4IHGA 5ADXV 3BRKX 5C4DA 3PMOA 3I3XA 2WLDA 2FYAA 5CQPA 1PZTA 1SSMA 5HS2A 3V0PA 3SXGA 4EAAA 4B5BA 1KRVA 3D98A 1VGUA 3CGXA 2D7IA 2QIVX 1KGTA 3VBMA 3U2WA 5J49A 5CQLX 2V0HA 3OGZA 2JCOA 5C4FA 1NHEB 3OAMA 4AAWA 1H7LA 3TWDA 1KWSA 2V0IA 4LW6A 1I52A 5FYEA 1V3WA 1XHDA 1XHBA 2E8BA 4N27A 1GWVA 3R3RA 5CMIA 2GGQA 2BO8A 1VPAA 2Q4JA 2P6WA 2AM4A 4HOCA 3IOHA 2YQJA 3I0GA 4BQHA 5C8RA 5DEMA 4R7PA 3CKQA 2I5KA 1XATA 4G3SA 2PGYA 3POLA 3FSBA 3TISA 1H7QA 3EEVA 4DCLA 1OQMB 3FOQA 3GQAA 3VBJA 2VSHA 3FTTA 5C47A 1YP4A 3ZLKA 1FG5N 1ZJ0A 4Y7TA 1W57A 2D7RA 5FTSA 3U2UA 3SX3A 1FRWA 4EE3A 1R82A 1KGQA 1NWGB 1ZJOA 1QRGA 5AFUU 1NF5B 4FROA 5C49A 1G2VA 2DPWA 1VZXA 2E3DA 1KQAA 4M98A 2XMHA 4Y7GA 2ZU7A 3TZTA 2IUAA 4KXOA 3CKNA 4HUSA 1NKHB 1G8OA 1Z90A 1GQCA 2VXMA 5D91A 4R36A 1H4EA 1ZJ3A 2RJ4A 1G93A 4M99A 1OCXA 4J18A 2FYDB 5CMGX 1QGQA 2Y4JA 4B42A 4KC2A 3RMWA 2RIZA 1FXOA 3GVDA 5FTVA 3Q7UA 2GGOA 4UEGA 3V8ZA 4YS8A 1QG8A 2WVMA 1NQIB 1WVCA 4KPZA 2I7BA 3V0LA 3C8VA 2XWNA 4EEAA 4O6NA 2JCJA 4M9CA 3V90A 4ISXA 4DDZA 2RIJA 3D8VA 2NXVA 2RJ0A 5IDSA 1W55A 2Y6PA 4ECMA 5C38A 2JCLA 4Y7FA 1HV9A 3BXYA 2I5EA 2YQSA 3VBNA 4KC1A 4GBPA 1R7YA 1KHRA 2V0LA 5C4EA 4M2AA 1IINA 5EJZA 1HM8A 2Y4MA 2IC7A 2WLCA 2FFUA 3EE5A 2Y4LA 5U2KA 1H7GA 1QREA 1H5SB 3KIAA 2AECA 4NANA 1G1LA 1LL3A 3JTJA 4KRVA 2VS5A 4N69A 2Z87A 2Y7AA 1MR9A 2X5ZA 2XATA 3OH0A 1G23A 1KRUA 3JQYA 1V83A 2PGVA 1QWJA 1ZI1A 2BO4A 5AJPA 3R3IA 5DEPA 1H5RA 4IRQA 5AFUV 4Y62A 1EWWA 3K8DA 4MNDA 3I0CA 3U0YA 2YC5A 4FCEA 4FRHA 2X60A 1HJJA 3HL3A 4KQLA 2VHEA 5E3PA 4E75A 2OEFA 1R7TA 4EA9A 2Z86A 3T7NA 2WLGA 4FRLA 4HURA 3F1CA 1GA8A 1ON8A 1PZYB 1H7FA 4NAKA 4IHHA 1QRFA 1QGSA 4P00A 3GOSA 1R7VA 4EA7A 1QRLA 3CKOA 3FSYA 1G9RA 4LW3A 3V0QA 2RIYA 1EYRA 4Y63A 3U0XA 3SX7A 2NPOA 4EQYA 3I0IX 4ASYA 3RSBA 4EA8A 2VS3A 4H7OA 4EABA 4HG6A 1TZFA 4G87A 4Y9XA 1SSTA 3QVBA 4B3UA 3VBIA 4NAIA 3R5BA 1K4VA 2P73A 3SXCA 3ZLLA 2QIAA 2WAWA 5C4BA 3USQA 2WLEA 3U2VA 3CKVA 4EE4A 1FGGA 1ZDFA 1TVYA 1LVWA 1OMXA 1H3MA 2RJ5A 3EG4A 4Y6UA 4CJBA 4J09A 1JVDA 5E3RA 1Z2FA 3GQ7A 1LZ0A 1SSQA 2X5SA 4FREA 1H5TB 3R0SA 4MYOA 2RJ8A 2UX8A 2VSIA 3U2TA 2VXLA 4EVWA 1ZI3A 4AA7A 1ZIZA 3HSQA 1YP3A 4IHFA 2ZU9A 1R7XA 1KK5A 4FRDA 1ZJ2A 4B4GA 4FCUA 4Y6NA 4FRPA 3N9WA 3ZGFA 4E79A 3IOIA 5CQMX 4B4BA 1KK4A 1M8NA 1KRRA 3K8EA 3OTMA 4KNXA 1FO9A
chains in the Genus database with same CATH topology
1ZJPA 1WSZA 2VD4A 1LZIA 3P1BA 2PX7A 2RJ1A 1YP2A 3VBLA 1H4CA 3OUPA 4AYLA 1THJA 3TQDA 4DECA 1JV3A 3TV0A 2MZBA 3SX5A 1J2ZA 2YESA 3PNNA 4E6TA 1ZDGA 3P47A 3KWEA 5C48A 2W0WA 3FSCA 2AESA 2AQ9A 2IU8A 2BO6A 2AM5A 4D11C 2X65A 2FYCB 1VH1A 2P72A 2WEEA 5C1LA 3DUVA 3ST8A 1GQ9A 1H5SA 3R5DA 4HCQA 1VGTA 2AE7A 1LXAA 2IU9A 2O1GA 4HO2A 3VBPA 3PKPA 3SXAA 3TK8A 5FU0A 3I0KA 1S80A 2VFZA 2RJ7A 4HO0A 4G3QA 1WT1A 1ZCYA 1ZCVA 3ECTA 1FZWA 4MFGA 1HJLA 4EE5A 3I0JA 5AJOA 1WT3A 3ZGGA 2V0JA 1TDTA 3U2XA 1LZJA 3I0EA 1JV1A 5CMHA 4FIXA 4FQWA 1EZIA 2RJ9A 1MP3A 1QQ0A 1INIA 1LZ7A 5JQQA 1S4OA 2J0BA 2AM3A 3SPTA 3VNPA 3VBKA 1MP4A 1OMZA 2WVLA 5BXCA 5DDTA 3E26A 4D48A 5I1FA 4EGGA 1WT0A 2P2OA 3GUEA 5EJ1A 1MC3A 3NGWA 2BO7A 2OI7A 3ZF8A 5D92A 2J0AA 4ARWA 4K6RA 2OEGA 2AH9A 4HO4A 1GX0A 2ZU8A 3USRA 3T7OA 3BSWA 2APCA 1R80A 1R7UA 2ICYA 1XZ6A 4JISA 4EEGA 5IDTA 3LW6A 1VM8A 1FR9A 5C3DA 3NZ2A 3JUKA 4KT7A 3SXDA 5C1HA 4FRAA 1ZI5A 3E25A 4MZUA 4EEMA 3OH4A 5FV9A 2D0JA 2RITA 5E3QA 3OC9A 4HO6A 3IOJA 3IGJA 3TDTA 2FFVA 4N6BA 4EEOA 3R2WA 3FSXA 4HZDA 2CU2A 3OH2A 4MIXA 1JVGA 3T7MA 3EH0A 5F42A 3Q4SA 1H7TA 2V0KA 2XWMA 2WVKA 3F1XA 1VZTA 4IRPA 4B4MA 2QGIA 3BFPA 1G95A 4M2BA 4E6UA 2YQHA 2VK9A 4KPXA 1ON6A 3Q80A 4B2WA 1ZI4A 1V67A 2OI5A 2YC3A 4FIYA 2JCKA 3OH3A 2FKOA 1G3LA 5EIYA 4HO5A 2O1HA 4JD0A 4XWIA 4D0TA 5C3BA 5IFYA 4Y7UA 1S4PA 1FXJA 4CVHA 1SS9A 1VH3A 2FYBA 4N6AA 3Q1XA 1T3DA 3R5AA 1LL2A 4ZDQA 3I0HA 2QH5A 2W0VA 5DDVA 4D0ZA 2FY7A 1VGZA 2OI6A 3V0NA 1W77A 2PA4A 1GX4A 3V4EA 1H4DA 3PKQA 4Y64A 3O3PA 3DJ4A 1YROB 1R81A 2TDTA 1HM9A 5FUHA 2A8WA 2JF2A 1O7OA 1G97A 4AC3A 4E1KA 4HO8A 1H5SC 3V91A 3V8YA 1FO8A 2XMEA 1O0RA 1H7EA 1JYKA 3D5NA 4D11A 4M28A 3FS8A 1MP5A 3F1YA 3DHOA 1ZCUA 3SXEA 1IIMA 1E5KA 4R37A 4CJ8A 2AGDA 3CJ8A 1H5TA 4HO3A 1NMMB 1ZHJA 1FOAA 5L6SA 3R1WA 3BCVA 3HJJA 1MRLA 3KWDA 5L6VA 1H7HA 1ZJ1A 4FRMA 1MR7A 1QRMA 3R8YA 3MC4A 1V82A 4HZCA 3OW5A 1FWYA 1WT2A 1G0RA 3I0DA 3BSSA 4DE7A 3IXCA 4KNRA 3R5CA 3SRTA 5C36A 3MQGA 1O7QA 2RIXA 1HM0A 2A8UA 3SXBA 1V84A 3KWCA 2QKXA 4ASJA 2YQCA 5CQNX 5CMJA 3DK5A 1O23B 5CMFX 1VICA 1GWWA 4B2XA 4MYBA 1FR8A 4Q7CA 1JYLA 4AYJA 3OTZA 1VGWA 5C3AA 1VZUA 3V0MA 1FGXA 5ADXU 5FU8A 2C0NA 3MQHA 3I0FA 4BMAA 5CQOA 1ZCTA 1LL0A 3FWWA 3TIOA 1S4NA 1TW5A 3V0OA 4C2SA 5DG3A 1H5SD 4FRQA 4HO9A 5C4CA 3OU9A 5AJNA 2VS4A 4O6MA 3JUJA 4NALA 4Y7VA 1TW1A 4CJCA 3T57A 3I0LA 3OH1A 4M4KA 2JF3A 2XWLA 3CKJA 2WGZA 4L41C 2YCMA 3I3AA 4G3PA 2O1FA 2RJ6A 1KK6A 1H5RB 3BSYA 1INJA 2Y4KA 2WE9A 3CU0A 4P02A 5C1GA 4FRBA 2ICXA 3SX8A 3OKRA 3RMVA 4KC4A 2WLFA 4IHGA 5ADXV 3BRKX 5C4DA 3PMOA 3I3XA 2WLDA 2FYAA 5CQPA 1PZTA 1SSMA 5HS2A 3V0PA 3SXGA 4EAAA 4B5BA 1KRVA 3D98A 1VGUA 3CGXA 2D7IA 2QIVX 1KGTA 3VBMA 3U2WA 5J49A 5CQLX 2V0HA 3OGZA 2JCOA 5C4FA 1NHEB 3OAMA 4AAWA 1H7LA 3TWDA 1KWSA 2V0IA 4LW6A 1I52A 5FYEA 1V3WA 1XHDA 1XHBA 2E8BA 4N27A 1GWVA 3R3RA 5CMIA 2GGQA 2BO8A 1VPAA 2Q4JA 2P6WA 2AM4A 4HOCA 3IOHA 2YQJA 3I0GA 4BQHA 5C8RA 5DEMA 4R7PA 3CKQA 2I5KA 1XATA 4G3SA 2PGYA 3POLA 3FSBA 3TISA 1H7QA 3EEVA 4DCLA 1OQMB 3FOQA 3VBJA 2VSHA 3FTTA 5C47A 1YP4A 3ZLKA 1FG5N 1ZJ0A 4Y7TA 1W57A 2D7RA 5FTSA 3U2UA 3SX3A 1FRWA 4EE3A 1R82A 1KGQA 1NWGB 1ZJOA 1QRGA 5AFUU 1NF5B 4FROA 5C49A 1G2VA 2DPWA 1VZXA 2E3DA 1KQAA 4M98A 2XMHA 4Y7GA 2ZU7A 3TZTA 2IUAA 4KXOA 3CKNA 4HUSA 1NKHB 1G8OA 1Z90A 1GQCA 2VXMA 5D91A 4R36A 1H4EA 1ZJ3A 2RJ4A 1G93A 4M99A 1OCXA 4J18A 2FYDB 5CMGX 1QGQA 2Y4JA 4B42A 4KC2A 3RMWA 2RIZA 1FXOA 3GVDA 5FTVA 3Q7UA 2GGOA 4UEGA 3V8ZA 4YS8A 1QG8A 2WVMA 1NQIB 1WVCA 4KPZA 2I7BA 3V0LA 3C8VA 2XWNA 4EEAA 4O6NA 2JCJA 4M9CA 3V90A 4ISXA 4DDZA 2RIJA 3D8VA 2NXVA 2RJ0A 5IDSA 1W55A 2Y6PA 4ECMA 5C38A 2JCLA 4Y7FA 3BXYA 1HV9A 2I5EA 2YQSA 3VBNA 4KC1A 4GBPA 1R7YA 1KHRA 2V0LA 5C4EA 4M2AA 1IINA 5EJZA 1HM8A 2Y4MA 2IC7A 2WLCA 2FFUA 3EE5A 2Y4LA 5U2KA 1H7GA 1QREA 1H5SB 3KIAA 2AECA 4NANA 1G1LA 1LL3A 3JTJA 4KRVA 2VS5A 4N69A 2Z87A 2Y7AA 1MR9A 2X5ZA 2XATA 2PGVA 1G23A 1KRUA 3JQYA 1V83A 3OH0A 1QWJA 1ZI1A 2BO4A 5AJPA 3R3IA 5DEPA 1H5RA 4IRQA 5AFUV 4Y62A 3K8DA 4MNDA 3I0CA 3U0YA 2YC5A 4FCEA 4FRHA 2X60A 1HJJA 3HL3A 4KQLA 2VHEA 5E3PA 4E75A 2OEFA 1R7TA 4EA9A 2Z86A 3T7NA 2WLGA 4FRLA 4HURA 3F1CA 1GA8A 1ON8A 1PZYB 1H7FA 4NAKA 4IHHA 1QRFA 1QGSA 4P00A 3GOSA 1R7VA 4EA7A 1QRLA 3CKOA 3FSYA 1G9RA 4LW3A 3V0QA 2RIYA 1EYRA 4Y63A 3U0XA 3SX7A 2NPOA 4EQYA 3I0IX 4ASYA 3RSBA 4EA8A 2VS3A 4H7OA 4EABA 4HG6A 1TZFA 4G87A 4Y9XA 1SSTA 3QVBA 4B3UA 3VBIA 4NAIA 3R5BA 1K4VA 2P73A 3SXCA 3ZLLA 2QIAA 2WAWA 5C4BA 3USQA 2WLEA 3U2VA 3CKVA 4EE4A 1FGGA 1ZDFA 1TVYA 1LVWA 1OMXA 1H3MA 2RJ5A 3EG4A 4Y6UA 4CJBA 4J09A 1JVDA 5E3RA 1LZ0A 1SSQA 2X5SA 4FREA 1H5TB 3R0SA 4MYOA 2RJ8A 2UX8A 2VSIA 3U2TA 2VXLA 4EVWA 1ZI3A 4AA7A 1ZIZA 3HSQA 1YP3A 4IHFA 2ZU9A 1R7XA 1KK5A 4FRDA 1ZJ2A 4B4GA 4FCUA 4Y6NA 4FRPA 3N9WA 3ZGFA 4E79A 3IOIA 5CQMX 4B4BA 1KK4A 1KRRA 3K8EA 3OTMA 4KNXA 1FO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZJP A;  1WSZ A;  2VD4 A;  1LZI A;  3P1B A;  2PX7 A;  2RJ1 A;  1YP2 A;  3VBL A;  1H4C A;  3OUP A;  4AYL A;  1THJ A;  3TQD A;  4DEC A;  1JV3 A;  3TV0 A;  2MZB A;  3SX5 A;  1J2Z A;  2YES A;  3PNN A;  4E6T A;  1ZDG A;  3P47 A;  3KWE A;  5C48 A;  2W0W A;  3FSC A;  2AES A;  2AQ9 A;  2IU8 A;  2BO6 A;  2AM5 A;  4D11 C;  2X65 A;  2FYC B;  1VH1 A;  2P72 A;  2WEE A;  5C1L A;  3DUV A;  3ST8 A;  1GQ9 A;  1H5S A;  3R5D A;  4HCQ A;  1VGT A;  2AE7 A;  1LXA A;  2IU9 A;  2O1G A;  4HO2 A;  3VBP A;  3PKP A;  3SXA A;  3TK8 A;  5FU0 A;  3I0K A;  1S80 A;  2VFZ A;  2RJ7 A;  4HO0 A;  4G3Q A;  1WT1 A;  1ZCY A;  1ZCV A;  3ECT A;  1FZW A;  4MFG A;  1HJL A;  4EE5 A;  3I0J A;  5AJO A;  1WT3 A;  3ZGG A;  2V0J A;  1TDT A;  3U2X A;  1LZJ A;  3I0E A;  1JV1 A;  5CMH A;  4FQW A;  1EZI A;  2RJ9 A;  1MP3 A;  1QQ0 A;  1INI A;  1LZ7 A;  5JQQ A;  1S4O A;  2AM3 A;  3SPT A;  3VNP A;  3VBK A;  1MP4 A;  1OMZ A;  2WVL A;  5BXC A;  5DDT A;  3E26 A;  4D48 A;  5I1F A;  4EGG A;  1WT0 A;  2P2O A;  3GUE A;  5EJ1 A;  1MC3 A;  3NGW A;  2BO7 A;  2OI7 A;  3ZF8 A;  4ARW A;  4K6R A;  2OEG A;  2AH9 A;  4HO4 A;  1GX0 A;  2ZU8 A;  3USR A;  3T7O A;  3BSW A;  2APC A;  1R80 A;  1R7U A;  2ICY A;  1XZ6 A;  4JIS A;  4EEG A;  5IDT A;  3LW6 A;  1VM8 A;  1FR9 A;  5C3D A;  3NZ2 A;  3JUK A;  4KT7 A;  3SXD A;  5C1H A;  4FRA A;  1ZI5 A;  3E25 A;  4MZU A;  4EEM A;  3OH4 A;  5FV9 A;  2D0J A;  2RIT A;  5E3Q A;  3OC9 A;  4HO6 A;  3IOJ A;  3IGJ A;  3TDT A;  2FFV A;  4N6B A;  4EEO A;  3R2W A;  3FSX A;  4HZD A;  2CU2 A;  3OH2 A;  1JVG A;  3T7M A;  3EH0 A;  5F42 A;  3Q4S A;  1H7T A;  2V0K A;  2XWM A;  2WVK A;  3F1X A;  1VZT A;  4IRP A;  4B4M A;  2QGI A;  3BFP A;  1G95 A;  4M2B A;  4E6U A;  2YQH A;  4KPX A;  1ON6 A;  3Q80 A;  4B2W A;  1ZI4 A;  1V67 A;  2OI5 A;  2YC3 A;  2JCK A;  3OH3 A;  2FKO A;  1G3L A;  5EIY A;  4HO5 A;  2O1H A;  4JD0 A;  4XWI A;  4D0T A;  5C3B A;  5IFY A;  4Y7U A;  1S4P A;  1FXJ A;  4CVH A;  1SS9 A;  1VH3 A;  2FYB A;  4N6A A;  3Q1X A;  1T3D A;  3R5A A;  1LL2 A;  4ZDQ A;  3I0H A;  2QH5 A;  2W0V A;  5DDV A;  4D0Z A;  2FY7 A;  1VGZ A;  2OI6 A;  3V0N A;  1W77 A;  2PA4 A;  1GX4 A;  3V4E A;  1H4D A;  3PKQ A;  4Y64 A;  3O3P A;  3DJ4 A;  1YRO B;  1R81 A;  2TDT A;  1HM9 A;  5FUH A;  2A8W A;  2JF2 A;  1O7O A;  1G97 A;  4AC3 A;  4E1K A;  4HO8 A;  1H5S C;  3V91 A;  3V8Y A;  1FO8 A;  2XME A;  1O0R A;  1H7E A;  1JYK A;  3D5N A;  4D11 A;  4M28 A;  3FS8 A;  1MP5 A;  3F1Y A;  3DHO A;  1ZCU A;  3SXE A;  1IIM A;  1E5K A;  4R37 A;  4CJ8 A;  2AGD A;  3CJ8 A;  1H5T A;  4HO3 A;  1NMM B;  1ZHJ A;  1FOA A;  5L6S A;  3R1W A;  3BCV A;  3HJJ A;  1MRL A;  3KWD A;  5L6V A;  1H7H A;  1ZJ1 A;  4FRM A;  1MR7 A;  1QRM A;  3R8Y A;  3MC4 A;  1V82 A;  4HZC A;  3OW5 A;  1FWY A;  1WT2 A;  1G0R A;  3I0D A;  3BSS A;  4DE7 A;  3IXC A;  4KNR A;  3R5C A;  3SRT A;  5C36 A;  3MQG A;  1O7Q A;  2RIX A;  1HM0 A;  2A8U A;  3SXB A;  1V84 A;  3KWC A;  2QKX A;  4ASJ A;  2YQC A;  5CQN X;  5CMJ A;  3DK5 A;  1O23 B;  5CMF X;  1VIC A;  1GWW A;  4B2X A;  4MYB A;  1FR8 A;  1JYL A;  4AYJ A;  3OTZ A;  1VGW A;  5C3A A;  1VZU A;  3V0M A;  1FGX A;  5ADX U;  5FU8 A;  3MQH A;  3I0F A;  4BMA A;  5CQO A;  1ZCT A;  1LL0 A;  3FWW A;  3TIO A;  1S4N A;  1TW5 A;  3V0O A;  4C2S A;  5DG3 A;  1H5S D;  4FRQ A;  4HO9 A;  5C4C A;  3OU9 A;  5AJN A;  2VS4 A;  3JUJ A;  4NAL A;  4Y7V A;  1TW1 A;  4CJC A;  3T57 A;  3I0L A;  3OH1 A;  4M4K A;  2JF3 A;  2XWL A;  3CKJ A;  2WGZ A;  4L41 C;  2YCM A;  3I3A A;  4G3P A;  2O1F A;  2RJ6 A;  1KK6 A;  1H5R B;  3BSY A;  1INJ A;  2Y4K A;  2WE9 A;  3CU0 A;  4P02 A;  5C1G A;  4FRB A;  2ICX A;  3SX8 A;  3OKR A;  3RMV A;  4KC4 A;  2WLF A;  4IHG A;  5ADX V;  3BRK X;  5C4D A;  3PMO A;  3I3X A;  2WLD A;  2FYA A;  5CQP A;  1PZT A;  1SSM A;  5HS2 A;  3V0P A;  3SXG A;  4EAA A;  4B5B A;  1KRV A;  3D98 A;  1VGU A;  3CGX A;  2D7I A;  2QIV X;  1KGT A;  3VBM A;  3U2W A;  5J49 A;  5CQL X;  2V0H A;  3OGZ A;  2JCO A;  5C4F A;  1NHE B;  3OAM A;  4AAW A;  1H7L A;  3TWD A;  1KWS A;  2V0I A;  4LW6 A;  1I52 A;  5FYE A;  1V3W A;  1XHD A;  1XHB A;  2E8B A;  4N27 A;  1GWV A;  3R3R A;  5CMI A;  2GGQ A;  2BO8 A;  1VPA A;  2Q4J A;  2P6W A;  2AM4 A;  4HOC A;  3IOH A;  2YQJ A;  3I0G A;  4BQH A;  5C8R A;  5DEM A;  4R7P A;  3CKQ A;  2I5K A;  1XAT A;  4G3S A;  2PGY A;  3POL A;  3FSB A;  3TIS A;  1H7Q A;  3EEV A;  4DCL A;  1OQM B;  3FOQ A;  3VBJ A;  2VSH A;  3FTT A;  5C47 A;  1YP4 A;  3ZLK A;  1FG5 N;  1ZJ0 A;  4Y7T A;  1W57 A;  2D7R A;  5FTS A;  3U2U A;  3SX3 A;  1FRW A;  4EE3 A;  1R82 A;  1KGQ A;  1NWG B;  1ZJO A;  1QRG A;  5AFU U;  1NF5 B;  4FRO A;  5C49 A;  1G2V A;  2DPW A;  1VZX A;  2E3D A;  1KQA A;  4M98 A;  2XMH A;  4Y7G A;  2ZU7 A;  3TZT A;  2IUA A;  4KXO A;  3CKN A;  4HUS A;  1NKH B;  1G8O A;  1Z90 A;  1GQC A;  2VXM A;  4R36 A;  1H4E A;  1ZJ3 A;  2RJ4 A;  1G93 A;  4M99 A;  1OCX A;  4J18 A;  2FYD B;  5CMG X;  1QGQ A;  2Y4J A;  4B42 A;  4KC2 A;  3RMW A;  2RIZ A;  1FXO A;  3GVD A;  5FTV A;  3Q7U A;  2GGO A;  4UEG A;  3V8Z A;  4YS8 A;  1QG8 A;  2WVM A;  1NQI B;  1WVC A;  4KPZ A;  2I7B A;  3V0L A;  3C8V A;  2XWN A;  4EEA A;  2JCJ A;  4M9C A;  3V90 A;  4ISX A;  4DDZ A;  2RIJ A;  3D8V A;  2NXV A;  2RJ0 A;  5IDS A;  1W55 A;  2Y6P A;  4ECM A;  5C38 A;  2JCL A;  4Y7F A;  3BXY A;  1HV9 A;  2I5E A;  2YQS A;  3VBN A;  4KC1 A;  4GBP A;  1R7Y A;  1KHR A;  2V0L A;  5C4E A;  4M2A A;  1IIN A;  5EJZ A;  1HM8 A;  2Y4M A;  2IC7 A;  2WLC A;  2FFU A;  3EE5 A;  2Y4L A;  5U2K A;  1H7G A;  1QRE A;  1H5S B;  3KIA A;  2AEC A;  4NAN A;  1G1L A;  1LL3 A;  3JTJ A;  4KRV A;  2VS5 A;  4N69 A;  2Z87 A;  2Y7A A;  1MR9 A;  2X5Z A;  2XAT A;  2PGV A;  1G23 A;  1KRU A;  3JQY A;  1V83 A;  3OH0 A;  1QWJ A;  1ZI1 A;  2BO4 A;  5AJP A;  3R3I A;  5DEP A;  1H5R A;  4IRQ A;  5AFU V;  4Y62 A;  3K8D A;  4MND A;  3I0C A;  3U0Y A;  2YC5 A;  4FCE A;  4FRH A;  2X60 A;  1HJJ A;  3HL3 A;  4KQL A;  2VHE A;  5E3P A;  4E75 A;  2OEF A;  1R7T A;  4EA9 A;  2Z86 A;  3T7N A;  2WLG A;  4FRL A;  4HUR A;  3F1C A;  1GA8 A;  1ON8 A;  1PZY B;  1H7F A;  4NAK A;  4IHH A;  1QRF A;  1QGS A;  4P00 A;  3GOS A;  1R7V A;  4EA7 A;  1QRL A;  3CKO A;  3FSY A;  1G9R A;  4LW3 A;  3V0Q A;  2RIY A;  1EYR A;  4Y63 A;  3U0X A;  3SX7 A;  2NPO A;  4EQY A;  3I0I X;  4ASY A;  3RSB A;  4EA8 A;  2VS3 A;  4H7O A;  4EAB A;  4HG6 A;  1TZF A;  4G87 A;  4Y9X A;  1SST A;  3QVB A;  4B3U A;  3VBI A;  4NAI A;  3R5B A;  1K4V A;  2P73 A;  3SXC A;  3ZLL A;  2QIA A;  2WAW A;  5C4B A;  3USQ A;  2WLE A;  3U2V A;  3CKV A;  4EE4 A;  1FGG A;  1ZDF A;  1TVY A;  1LVW A;  1OMX A;  1H3M A;  2RJ5 A;  3EG4 A;  4Y6U A;  4CJB A;  4J09 A;  1JVD A;  5E3R A;  1LZ0 A;  1SSQ A;  2X5S A;  4FRE A;  1H5T B;  3R0S A;  4MYO A;  2RJ8 A;  2UX8 A;  2VSI A;  3U2T A;  2VXL A;  4EVW A;  1ZI3 A;  4AA7 A;  1ZIZ A;  3HSQ A;  1YP3 A;  4IHF A;  2ZU9 A;  1R7X A;  1KK5 A;  4FRD A;  1ZJ2 A;  4B4G A;  4FCU A;  4Y6N A;  4FRP A;  3N9W A;  3ZGF A;  4E79 A;  3IOI A;  5CQM X;  4B4B A;  1KK4 A;  1KRR A;  3K8E A;  3OTM A;  4KNX A;  1FO9 A; 
#chains in the Genus database with same CATH topology
 1ZJP A;  1WSZ A;  2VD4 A;  1LZI A;  3P1B A;  2PX7 A;  2RJ1 A;  1YP2 A;  3VBL A;  1H4C A;  3OUP A;  4AYL A;  1THJ A;  3TQD A;  4DEC A;  1JV3 A;  3TV0 A;  2MZB A;  3SX5 A;  1J2Z A;  2YES A;  3PNN A;  4E6T A;  1ZDG A;  3P47 A;  3KWE A;  5C48 A;  2W0W A;  3FSC A;  2AES A;  2AQ9 A;  2IU8 A;  2BO6 A;  2AM5 A;  4D11 C;  2X65 A;  2FYC B;  1VH1 A;  2P72 A;  2WEE A;  5C1L A;  3DUV A;  3ST8 A;  1GQ9 A;  1H5S A;  3R5D A;  4HCQ A;  1VGT A;  2AE7 A;  1LXA A;  2IU9 A;  2O1G A;  4HO2 A;  3VBP A;  3PKP A;  3SXA A;  3TK8 A;  5FU0 A;  3I0K A;  1S80 A;  2VFZ A;  2RJ7 A;  4HO0 A;  4G3Q A;  1WT1 A;  1ZCY A;  1ZCV A;  3ECT A;  1FZW A;  4MFG A;  1HJL A;  4EE5 A;  3I0J A;  5AJO A;  1WT3 A;  3ZGG A;  2V0J A;  1TDT A;  3U2X A;  1LZJ A;  3I0E A;  1JV1 A;  5CMH A;  4FIX A;  4FQW A;  1EZI A;  2RJ9 A;  1MP3 A;  1QQ0 A;  1INI A;  1LZ7 A;  5JQQ A;  1S4O A;  2J0B A;  2AM3 A;  3SPT A;  3VNP A;  3VBK A;  1MP4 A;  1OMZ A;  2WVL A;  5BXC A;  5DDT A;  3E26 A;  4D48 A;  5I1F A;  4EGG A;  1WT0 A;  2P2O A;  3GUE A;  5EJ1 A;  1MC3 A;  3NGW A;  2BO7 A;  2OI7 A;  3ZF8 A;  5D92 A;  2J0A A;  4ARW A;  4K6R A;  2OEG A;  2AH9 A;  4HO4 A;  1GX0 A;  2ZU8 A;  3USR A;  3T7O A;  3BSW A;  2APC A;  1R80 A;  1R7U A;  2ICY A;  1XZ6 A;  4JIS A;  4EEG A;  5IDT A;  3LW6 A;  1VM8 A;  1FR9 A;  5C3D A;  3NZ2 A;  3JUK A;  4KT7 A;  3SXD A;  5C1H A;  4FRA A;  1ZI5 A;  3E25 A;  4MZU A;  4EEM A;  3OH4 A;  5FV9 A;  2D0J A;  2RIT A;  5E3Q A;  3OC9 A;  4HO6 A;  3IOJ A;  3IGJ A;  3TDT A;  2FFV A;  4N6B A;  4EEO A;  3R2W A;  3FSX A;  4HZD A;  3OH2 A;  2CU2 A;  4MIX A;  1JVG A;  3T7M A;  3EH0 A;  5F42 A;  3Q4S A;  1H7T A;  2V0K A;  2XWM A;  2WVK A;  3F1X A;  1VZT A;  4IRP A;  4B4M A;  2QGI A;  3BFP A;  1G95 A;  4M2B A;  3SUC A;  4E6U A;  2VK9 A;  4KPX A;  1ON6 A;  2YQH A;  3Q80 A;  1ZI4 A;  4B2W A;  1V67 A;  2OI5 A;  2YC3 A;  4FIY A;  2JCK A;  3OH3 A;  2FKO A;  1G3L A;  5EIY A;  4HO5 A;  2O1H A;  4JD0 A;  4XWI A;  4D0T A;  5C3B A;  5IFY A;  4Y7U A;  1S4P A;  1FXJ A;  4CVH A;  1SS9 A;  1VH3 A;  2FYB A;  4N6A A;  3Q1X A;  1T3D A;  3R5A A;  1LL2 A;  1N4I A;  4ZDQ A;  3I0H A;  2QH5 A;  2W0V A;  5DDV A;  4D0Z A;  2FY7 A;  1VGZ A;  2OI6 A;  3V0N A;  1W77 A;  2PA4 A;  1GX4 A;  3V4E A;  1H4D A;  3PKQ A;  4Y64 A;  3O3P A;  3DJ4 A;  1YRO B;  1R81 A;  1L0S A;  2TDT A;  1HM9 A;  5FUH A;  2A8W A;  2JF2 A;  1O7O A;  1G97 A;  4AC3 A;  4E1K A;  4HO8 A;  1H5S C;  3V91 A;  3V8Y A;  1FO8 A;  2XME A;  1O0R A;  1H7E A;  1JYK A;  3D5N A;  4D11 A;  3GQ8 A;  4M28 A;  3FS8 A;  1MP5 A;  3F1Y A;  3DHO A;  1ZCU A;  3SXE A;  1IIM A;  1E5K A;  4R37 A;  4CJ8 A;  2AGD A;  3CJ8 A;  1H5T A;  4HO3 A;  1NMM B;  1ZHJ A;  1FOA A;  5L6S A;  3R1W A;  3BCV A;  3HJJ A;  1MRL A;  3KWD A;  5L6V A;  1H7H A;  1ZJ1 A;  4FRM A;  1MR7 A;  1QRM A;  3R8Y A;  3MC4 A;  1V82 A;  4HZC A;  3OW5 A;  1FWY A;  1WT2 A;  1G0R A;  3I0D A;  3BSS A;  4DE7 A;  3IXC A;  4KNR A;  3R5C A;  3SRT A;  5C36 A;  3MQG A;  1O7Q A;  2RIX A;  1HM0 A;  2A8U A;  3SXB A;  1V84 A;  3KWC A;  2QKX A;  4ASJ A;  2YQC A;  5CQN X;  5CMJ A;  3DK5 A;  1O23 B;  5CMF X;  1VIC A;  1GWW A;  4B2X A;  4MYB A;  1FR8 A;  4Q7C A;  1JYL A;  4AYJ A;  3OTZ A;  1VGW A;  5C3A A;  1VZU A;  3V0M A;  1FGX A;  5ADX U;  5FU8 A;  2C0N A;  3MQH A;  3I0F A;  4BMA A;  5CQO A;  1ZCT A;  1LL0 A;  3FWW A;  3TIO A;  1S4N A;  1TW5 A;  3V0O A;  4C2S A;  5DG3 A;  1H5S D;  4FRQ A;  4HO9 A;  5C4C A;  3OU9 A;  5AJN A;  2VS4 A;  4O6M A;  3GQ9 A;  3JUJ A;  4NAL A;  4Y7V A;  1TW1 A;  4CJC A;  3T57 A;  3OH1 A;  3I0L A;  4M4K A;  2JF3 A;  2XWL A;  3CKJ A;  2WGZ A;  4L41 C;  2YCM A;  3I3A A;  4G3P A;  2O1F A;  2RJ6 A;  1KK6 A;  1H5R B;  3BSY A;  1INJ A;  2Y4K A;  2WE9 A;  3CU0 A;  4P02 A;  5C1G A;  4FRB A;  2ICX A;  3SX8 A;  3OKR A;  3RMV A;  4KC4 A;  2WLF A;  4IHG A;  5ADX V;  3BRK X;  5C4D A;  3PMO A;  3I3X A;  2WLD A;  2FYA A;  5CQP A;  1PZT A;  1SSM A;  5HS2 A;  3V0P A;  3SXG A;  4EAA A;  4B5B A;  1KRV A;  3D98 A;  1VGU A;  3CGX A;  2D7I A;  2QIV X;  1KGT A;  3VBM A;  3U2W A;  5J49 A;  5CQL X;  2V0H A;  3OGZ A;  2JCO A;  5C4F A;  1NHE B;  3OAM A;  4AAW A;  1H7L A;  3TWD A;  1KWS A;  2V0I A;  4LW6 A;  1I52 A;  5FYE A;  1V3W A;  1XHD A;  1XHB A;  2E8B A;  4N27 A;  1GWV A;  3R3R A;  5CMI A;  2GGQ A;  2BO8 A;  1VPA A;  2Q4J A;  2P6W A;  2AM4 A;  4HOC A;  3IOH A;  2YQJ A;  3I0G A;  4BQH A;  5C8R A;  5DEM A;  4R7P A;  3CKQ A;  2I5K A;  1XAT A;  4G3S A;  2PGY A;  3POL A;  3FSB A;  3TIS A;  1H7Q A;  3EEV A;  4DCL A;  1OQM B;  3FOQ A;  3GQA A;  3VBJ A;  2VSH A;  3FTT A;  5C47 A;  1YP4 A;  3ZLK A;  1FG5 N;  1ZJ0 A;  4Y7T A;  1W57 A;  2D7R A;  5FTS A;  3U2U A;  3SX3 A;  1FRW A;  4EE3 A;  1R82 A;  1KGQ A;  1NWG B;  1ZJO A;  1QRG A;  5AFU U;  1NF5 B;  4FRO A;  5C49 A;  1G2V A;  2DPW A;  1VZX A;  2E3D A;  1KQA A;  4M98 A;  2XMH A;  4Y7G A;  2ZU7 A;  3TZT A;  2IUA A;  4KXO A;  3CKN A;  4HUS A;  1NKH B;  1G8O A;  1Z90 A;  1GQC A;  2VXM A;  5D91 A;  4R36 A;  1H4E A;  1ZJ3 A;  2RJ4 A;  1G93 A;  4M99 A;  1OCX A;  4J18 A;  2FYD B;  5CMG X;  1QGQ A;  2Y4J A;  4B42 A;  4KC2 A;  3RMW A;  2RIZ A;  1FXO A;  3GVD A;  5FTV A;  3Q7U A;  2GGO A;  4UEG A;  3V8Z A;  4YS8 A;  1QG8 A;  2WVM A;  1NQI B;  1WVC A;  4KPZ A;  2I7B A;  3V0L A;  3C8V A;  2XWN A;  4EEA A;  4O6N A;  2JCJ A;  4M9C A;  3V90 A;  4ISX A;  4DDZ A;  2RIJ A;  3D8V A;  2NXV A;  2RJ0 A;  5IDS A;  1W55 A;  2Y6P A;  4ECM A;  5C38 A;  2JCL A;  4Y7F A;  1HV9 A;  3BXY A;  2I5E A;  2YQS A;  3VBN A;  4KC1 A;  4GBP A;  1R7Y A;  1KHR A;  2V0L A;  5C4E A;  4M2A A;  1IIN A;  5EJZ A;  1HM8 A;  2Y4M A;  2IC7 A;  2WLC A;  2FFU A;  3EE5 A;  2Y4L A;  5U2K A;  1H7G A;  1QRE A;  1H5S B;  3KIA A;  2AEC A;  4NAN A;  1G1L A;  1LL3 A;  3JTJ A;  4KRV A;  2VS5 A;  4N69 A;  2Z87 A;  2Y7A A;  1MR9 A;  2X5Z A;  2XAT A;  3OH0 A;  1G23 A;  1KRU A;  3JQY A;  1V83 A;  2PGV A;  1QWJ A;  1ZI1 A;  2BO4 A;  5AJP A;  3R3I A;  5DEP A;  1H5R A;  4IRQ A;  5AFU V;  4Y62 A;  1EWW A;  3K8D A;  4MND A;  3I0C A;  3U0Y A;  2YC5 A;  4FCE A;  4FRH A;  2X60 A;  1HJJ A;  3HL3 A;  4KQL A;  2VHE A;  5E3P A;  4E75 A;  2OEF A;  1R7T A;  4EA9 A;  2Z86 A;  3T7N A;  2WLG A;  4FRL A;  4HUR A;  3F1C A;  1GA8 A;  1ON8 A;  1PZY B;  1H7F A;  4NAK A;  4IHH A;  1QRF A;  1QGS A;  4P00 A;  3GOS A;  1R7V A;  4EA7 A;  1QRL A;  3CKO A;  3FSY A;  1G9R A;  4LW3 A;  3V0Q A;  2RIY A;  1EYR A;  4Y63 A;  3U0X A;  3SX7 A;  2NPO A;  4EQY A;  3I0I X;  4ASY A;  3RSB A;  4EA8 A;  2VS3 A;  4H7O A;  4EAB A;  4HG6 A;  1TZF A;  4G87 A;  4Y9X A;  1SST A;  3QVB A;  4B3U A;  3VBI A;  4NAI A;  3R5B A;  1K4V A;  2P73 A;  3SXC A;  3ZLL A;  2QIA A;  2WAW A;  5C4B A;  3USQ A;  2WLE A;  3U2V A;  3CKV A;  4EE4 A;  1FGG A;  1ZDF A;  1TVY A;  1LVW A;  1OMX A;  1H3M A;  2RJ5 A;  3EG4 A;  4Y6U A;  4CJB A;  4J09 A;  1JVD A;  5E3R A;  1Z2F A;  3GQ7 A;  1LZ0 A;  1SSQ A;  2X5S A;  4FRE A;  1H5T B;  3R0S A;  4MYO A;  2RJ8 A;  2UX8 A;  2VSI A;  3U2T A;  2VXL A;  4EVW A;  1ZI3 A;  4AA7 A;  1ZIZ A;  3HSQ A;  1YP3 A;  4IHF A;  2ZU9 A;  1R7X A;  1KK5 A;  4FRD A;  1ZJ2 A;  4B4G A;  4FCU A;  4Y6N A;  4FRP A;  3N9W A;  3ZGF A;  4E79 A;  3IOI A;  5CQM X;  4B4B A;  1KK4 A;  1M8N A;  1KRR A;  3K8E A;  3OTM A;  4KNX A;  1FO9 A; 
#chains in the Genus database with same CATH homology
 1ZJP A;  1WSZ A;  2VD4 A;  1LZI A;  3P1B A;  2PX7 A;  2RJ1 A;  1YP2 A;  3VBL A;  1H4C A;  3OUP A;  4AYL A;  1THJ A;  3TQD A;  4DEC A;  1JV3 A;  3TV0 A;  2MZB A;  3SX5 A;  1J2Z A;  2YES A;  3PNN A;  4E6T A;  1ZDG A;  3P47 A;  3KWE A;  5C48 A;  2W0W A;  3FSC A;  2AES A;  2AQ9 A;  2IU8 A;  2BO6 A;  2AM5 A;  4D11 C;  2X65 A;  2FYC B;  1VH1 A;  2P72 A;  2WEE A;  5C1L A;  3DUV A;  3ST8 A;  1GQ9 A;  1H5S A;  3R5D A;  4HCQ A;  1VGT A;  2AE7 A;  1LXA A;  2IU9 A;  2O1G A;  4HO2 A;  3VBP A;  3PKP A;  3SXA A;  3TK8 A;  5FU0 A;  3I0K A;  1S80 A;  2VFZ A;  2RJ7 A;  4HO0 A;  4G3Q A;  1WT1 A;  1ZCY A;  1ZCV A;  3ECT A;  1FZW A;  4MFG A;  1HJL A;  4EE5 A;  3I0J A;  5AJO A;  1WT3 A;  3ZGG A;  2V0J A;  1TDT A;  3U2X A;  1LZJ A;  3I0E A;  1JV1 A;  5CMH A;  4FIX A;  4FQW A;  1EZI A;  2RJ9 A;  1MP3 A;  1QQ0 A;  1INI A;  1LZ7 A;  5JQQ A;  1S4O A;  2J0B A;  2AM3 A;  3SPT A;  3VNP A;  3VBK A;  1MP4 A;  1OMZ A;  2WVL A;  5BXC A;  5DDT A;  3E26 A;  4D48 A;  5I1F A;  4EGG A;  1WT0 A;  2P2O A;  3GUE A;  5EJ1 A;  1MC3 A;  3NGW A;  2BO7 A;  2OI7 A;  3ZF8 A;  5D92 A;  2J0A A;  4ARW A;  4K6R A;  2OEG A;  2AH9 A;  4HO4 A;  1GX0 A;  2ZU8 A;  3USR A;  3T7O A;  3BSW A;  2APC A;  1R80 A;  1R7U A;  2ICY A;  1XZ6 A;  4JIS A;  4EEG A;  5IDT A;  3LW6 A;  1VM8 A;  1FR9 A;  5C3D A;  3NZ2 A;  3JUK A;  4KT7 A;  3SXD A;  5C1H A;  4FRA A;  1ZI5 A;  3E25 A;  4MZU A;  4EEM A;  3OH4 A;  5FV9 A;  2D0J A;  2RIT A;  5E3Q A;  3OC9 A;  4HO6 A;  3IOJ A;  3IGJ A;  3TDT A;  2FFV A;  4N6B A;  4EEO A;  3R2W A;  3FSX A;  4HZD A;  2CU2 A;  3OH2 A;  4MIX A;  1JVG A;  3T7M A;  3EH0 A;  5F42 A;  3Q4S A;  1H7T A;  2V0K A;  2XWM A;  2WVK A;  3F1X A;  1VZT A;  4IRP A;  4B4M A;  2QGI A;  3BFP A;  1G95 A;  4M2B A;  4E6U A;  2YQH A;  2VK9 A;  4KPX A;  1ON6 A;  3Q80 A;  4B2W A;  1ZI4 A;  1V67 A;  2OI5 A;  2YC3 A;  4FIY A;  2JCK A;  3OH3 A;  2FKO A;  1G3L A;  5EIY A;  4HO5 A;  2O1H A;  4JD0 A;  4XWI A;  4D0T A;  5C3B A;  5IFY A;  4Y7U A;  1S4P A;  1FXJ A;  4CVH A;  1SS9 A;  1VH3 A;  2FYB A;  4N6A A;  3Q1X A;  1T3D A;  3R5A A;  1LL2 A;  4ZDQ A;  3I0H A;  2QH5 A;  2W0V A;  5DDV A;  4D0Z A;  2FY7 A;  1VGZ A;  2OI6 A;  3V0N A;  1W77 A;  2PA4 A;  1GX4 A;  3V4E A;  1H4D A;  3PKQ A;  4Y64 A;  3O3P A;  3DJ4 A;  1YRO B;  1R81 A;  2TDT A;  1HM9 A;  5FUH A;  2A8W A;  2JF2 A;  1O7O A;  1G97 A;  4AC3 A;  4E1K A;  4HO8 A;  1H5S C;  3V91 A;  3V8Y A;  1FO8 A;  2XME A;  1O0R A;  1H7E A;  1JYK A;  3D5N A;  4D11 A;  4M28 A;  3FS8 A;  1MP5 A;  3F1Y A;  3DHO A;  1ZCU A;  3SXE A;  1IIM A;  1E5K A;  4R37 A;  4CJ8 A;  2AGD A;  3CJ8 A;  1H5T A;  4HO3 A;  1NMM B;  1ZHJ A;  1FOA A;  5L6S A;  3R1W A;  3BCV A;  3HJJ A;  1MRL A;  3KWD A;  5L6V A;  1H7H A;  1ZJ1 A;  4FRM A;  1MR7 A;  1QRM A;  3R8Y A;  3MC4 A;  1V82 A;  4HZC A;  3OW5 A;  1FWY A;  1WT2 A;  1G0R A;  3I0D A;  3BSS A;  4DE7 A;  3IXC A;  4KNR A;  3R5C A;  3SRT A;  5C36 A;  3MQG A;  1O7Q A;  2RIX A;  1HM0 A;  2A8U A;  3SXB A;  1V84 A;  3KWC A;  2QKX A;  4ASJ A;  2YQC A;  5CQN X;  5CMJ A;  3DK5 A;  1O23 B;  5CMF X;  1VIC A;  1GWW A;  4B2X A;  4MYB A;  1FR8 A;  4Q7C A;  1JYL A;  4AYJ A;  3OTZ A;  1VGW A;  5C3A A;  1VZU A;  3V0M A;  1FGX A;  5ADX U;  5FU8 A;  2C0N A;  3MQH A;  3I0F A;  4BMA A;  5CQO A;  1ZCT A;  1LL0 A;  3FWW A;  3TIO A;  1S4N A;  1TW5 A;  3V0O A;  4C2S A;  5DG3 A;  1H5S D;  4FRQ A;  4HO9 A;  5C4C A;  3OU9 A;  5AJN A;  2VS4 A;  4O6M A;  3JUJ A;  4NAL A;  4Y7V A;  1TW1 A;  4CJC A;  3T57 A;  3I0L A;  3OH1 A;  4M4K A;  2JF3 A;  2XWL A;  3CKJ A;  2WGZ A;  4L41 C;  2YCM A;  3I3A A;  4G3P A;  2O1F A;  2RJ6 A;  1KK6 A;  1H5R B;  3BSY A;  1INJ A;  2Y4K A;  2WE9 A;  3CU0 A;  4P02 A;  5C1G A;  4FRB A;  2ICX A;  3SX8 A;  3OKR A;  3RMV A;  4KC4 A;  2WLF A;  4IHG A;  5ADX V;  3BRK X;  5C4D A;  3PMO A;  3I3X A;  2WLD A;  2FYA A;  5CQP A;  1PZT A;  1SSM A;  5HS2 A;  3V0P A;  3SXG A;  4EAA A;  4B5B A;  1KRV A;  3D98 A;  1VGU A;  3CGX A;  2D7I A;  2QIV X;  1KGT A;  3VBM A;  3U2W A;  5J49 A;  5CQL X;  2V0H A;  3OGZ A;  2JCO A;  5C4F A;  1NHE B;  3OAM A;  4AAW A;  1H7L A;  3TWD A;  1KWS A;  2V0I A;  4LW6 A;  1I52 A;  5FYE A;  1V3W A;  1XHD A;  1XHB A;  2E8B A;  4N27 A;  1GWV A;  3R3R A;  5CMI A;  2GGQ A;  2BO8 A;  1VPA A;  2Q4J A;  2P6W A;  2AM4 A;  4HOC A;  3IOH A;  2YQJ A;  3I0G A;  4BQH A;  5C8R A;  5DEM A;  4R7P A;  3CKQ A;  2I5K A;  1XAT A;  4G3S A;  2PGY A;  3POL A;  3FSB A;  3TIS A;  1H7Q A;  3EEV A;  4DCL A;  1OQM B;  3FOQ A;  3VBJ A;  2VSH A;  3FTT A;  5C47 A;  1YP4 A;  3ZLK A;  1FG5 N;  1ZJ0 A;  4Y7T A;  1W57 A;  2D7R A;  5FTS A;  3U2U A;  3SX3 A;  1FRW A;  4EE3 A;  1R82 A;  1KGQ A;  1NWG B;  1ZJO A;  1QRG A;  5AFU U;  1NF5 B;  4FRO A;  5C49 A;  1G2V A;  2DPW A;  1VZX A;  2E3D A;  1KQA A;  4M98 A;  2XMH A;  4Y7G A;  2ZU7 A;  3TZT A;  2IUA A;  4KXO A;  3CKN A;  4HUS A;  1NKH B;  1G8O A;  1Z90 A;  1GQC A;  2VXM A;  5D91 A;  4R36 A;  1H4E A;  1ZJ3 A;  2RJ4 A;  1G93 A;  4M99 A;  1OCX A;  4J18 A;  2FYD B;  5CMG X;  1QGQ A;  2Y4J A;  4B42 A;  4KC2 A;  3RMW A;  2RIZ A;  1FXO A;  3GVD A;  5FTV A;  3Q7U A;  2GGO A;  4UEG A;  3V8Z A;  4YS8 A;  1QG8 A;  2WVM A;  1NQI B;  1WVC A;  4KPZ A;  2I7B A;  3V0L A;  3C8V A;  2XWN A;  4EEA A;  4O6N A;  2JCJ A;  4M9C A;  3V90 A;  4ISX A;  4DDZ A;  2RIJ A;  3D8V A;  2NXV A;  2RJ0 A;  5IDS A;  1W55 A;  2Y6P A;  4ECM A;  5C38 A;  2JCL A;  4Y7F A;  3BXY A;  1HV9 A;  2I5E A;  2YQS A;  3VBN A;  4KC1 A;  4GBP A;  1R7Y A;  1KHR A;  2V0L A;  5C4E A;  4M2A A;  1IIN A;  5EJZ A;  1HM8 A;  2Y4M A;  2IC7 A;  2WLC A;  2FFU A;  3EE5 A;  2Y4L A;  5U2K A;  1H7G A;  1QRE A;  1H5S B;  3KIA A;  2AEC A;  4NAN A;  1G1L A;  1LL3 A;  3JTJ A;  4KRV A;  2VS5 A;  4N69 A;  2Z87 A;  2Y7A A;  1MR9 A;  2X5Z A;  2XAT A;  2PGV A;  1G23 A;  1KRU A;  3JQY A;  1V83 A;  3OH0 A;  1QWJ A;  1ZI1 A;  2BO4 A;  5AJP A;  3R3I A;  5DEP A;  1H5R A;  4IRQ A;  5AFU V;  4Y62 A;  3K8D A;  4MND A;  3I0C A;  3U0Y A;  2YC5 A;  4FCE A;  4FRH A;  2X60 A;  1HJJ A;  3HL3 A;  4KQL A;  2VHE A;  5E3P A;  4E75 A;  2OEF A;  1R7T A;  4EA9 A;  2Z86 A;  3T7N A;  2WLG A;  4FRL A;  4HUR A;  3F1C A;  1GA8 A;  1ON8 A;  1PZY B;  1H7F A;  4NAK A;  4IHH A;  1QRF A;  1QGS A;  4P00 A;  3GOS A;  1R7V A;  4EA7 A;  1QRL A;  3CKO A;  3FSY A;  1G9R A;  4LW3 A;  3V0Q A;  2RIY A;  1EYR A;  4Y63 A;  3U0X A;  3SX7 A;  2NPO A;  4EQY A;  3I0I X;  4ASY A;  3RSB A;  4EA8 A;  2VS3 A;  4H7O A;  4EAB A;  4HG6 A;  1TZF A;  4G87 A;  4Y9X A;  1SST A;  3QVB A;  4B3U A;  3VBI A;  4NAI A;  3R5B A;  1K4V A;  2P73 A;  3SXC A;  3ZLL A;  2QIA A;  2WAW A;  5C4B A;  3USQ A;  2WLE A;  3U2V A;  3CKV A;  4EE4 A;  1FGG A;  1ZDF A;  1TVY A;  1LVW A;  1OMX A;  1H3M A;  2RJ5 A;  3EG4 A;  4Y6U A;  4CJB A;  4J09 A;  1JVD A;  5E3R A;  1LZ0 A;  1SSQ A;  2X5S A;  4FRE A;  1H5T B;  3R0S A;  4MYO A;  2RJ8 A;  2UX8 A;  2VSI A;  3U2T A;  2VXL A;  4EVW A;  1ZI3 A;  4AA7 A;  1ZIZ A;  3HSQ A;  1YP3 A;  4IHF A;  2ZU9 A;  1R7X A;  1KK5 A;  4FRD A;  1ZJ2 A;  4B4G A;  4FCU A;  4Y6N A;  4FRP A;  3N9W A;  3ZGF A;  4E79 A;  3IOI A;  5CQM X;  4B4B A;  1KK4 A;  1KRR A;  3K8E A;  3OTM A;  4KNX A;  1FO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...