3R3MA

Crystal structure of the faf1 ubx domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
84
structure length
84
Chain Sequence
MSENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Hierarchical Binding of Cofactors to the AAA ATPase p97.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords FAS-associated factor 1
total genus 22
structure length 84
sequence length 84
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00789 UBX UBX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3r3mA00
3N3KB 4KDIC 3ZNZB 2N9PC 1J0GA 4IWOA 1PQSA 4A20A 2LASA 5E6NA 4RM9A 2MCNB 5IA7A 3AU5A 1WGYA 5D7GA 3NHEB 4EFOA 2RD0A 3ZNGC 3R7RA 3HK0A 4IWQA 2DAFA 2IY0B 4FJVB 1UH6A 3O65B 3PPAA 3LDZE 3T8MA 3ZTCA 2KX0A 1C3TA 2KXJA 3L0WB 4AJWA 3RT3B 1UELA 3GOEA 3RCZA 2KHWB 4IM3A 3UQBA 2M0XA 1UZXB 4W9EA 3DBHI 5C1ZA 4YL8A 1TZ1A 3OLMD 2FCMA 3QQ8B 4PS8A 4W9GA 4AOFA 4IWPA 4P7IA 1XD3B 1KM7A 3DVGY 1E7VA 3ML8A 3QX1A 2ZVNA 3ZTDA 2DZMA 5J17A 3NS8A 2MX2A 2O6VA 3BINA 3WA0A 4G11A 4HVBA 2YLMA 4N9F4 3B1LX 2G4SA 2FCNA 3R66C 2RSUA 3ALBA 1YIWA 3L54A 2A5UA 2KLGA 3ZW3A 2MBOA 2QHOA 1RAXA 3HHMA 2V1YA 5JHBA 4W9FA 4BKGA 3KYCD 3EHVA 3A9KB 4DDGD 2NBWB 2RPQA 4OVVA 3APFA 3PS6A 2BPSA 4GU2A 1LM8B 1GC7A 1XT9B 2DHZA 2GBJA 4DXAB 3H7PA 5AZGA 5DPRA 3RZFA 5C23A 2ZNVB 3V6CB 1VCBA 2FUHB 2C7MB 3JW0X 5D2MB 4MELA 2OOBB 3KUZA 5CTRC 5JZEB 1P0RA 2R2QA 4IG7B 3WALA 4FHKA 1KJTA 1JRUA 2WWZA 1LFDA 4W9HA 2M4NA 3PRPB 3U8ZA 3UQAA 1WE6A 3PRMB 3QWZB 2NS5A 4B95A 4MJSA 3QC8B 2HE7A 4TUUA 3ZO5B 1V5OA 3PTFC 2JWZA 1C1YB 2MW5A 5D6JB 1V80A 2KC2A 5CX3A 2KQSA 2MWSB 4EZJA 1ZKHA 4GIVA 1L7YA 2ZCBA 4AWJA 4MGIE 3VUWA 4NY0A 4W9KA 2NBVB 1GNUA 3DBRI 4GMVA 3DCGA 4X57B 2WDTB 2AEHA 4W9CA 2PE9A 1ZW7A 2RR9A 4FADA 4CO7A 1GJZA 1WGGA 3PVLA 4CYEA 4GDKB 5J2RA 4W9LA 3KYDD 2XK5A 2GBMA 4OVUA 2FNJB 3MJWA 4G0NB 4E3CA 2BYVE 2CHZA 2JZZA 2LXCA 4HPLB 2C9WB 3PGEA 1HE8A 4NJ6A 3UF8A 3D32A 3W1SC 4EOYA 1R4MI 1KOTA 3AXCA 1WX9A 2GBNA 3VQIA 3DVNU 3ONSA 2K8HA 2O6VD 2Z59B 2ZPYA 4XZ4A 1R4NI 2KQ7A 3R3MA 1TGZB 2KVRA 3UIPB 2VRRB 1WM3A 4EUTA 3C0RB 1V6EA 3QJZA 4BKSD 4NAWB 4FJYA 4DWFA 1TBEA 2LI5A 3S2AA 4M8NA 4NPNA 1WJUA 3V6EB 1GC6A 3ENEA 3IVFA 4JQWC 4HLEA 1M94A 4LJOB 2EMTA 2UYZB 4GDKA 2V3SA 5JH5C 1KLVA 4WWPA 3WIMA 4E74A 2HD5B 1EUVB 3LJ3A 3PHWB 4K7SA 3SHQA 5AZHA 1NDDA 1Q5WB 4DBGA 4IM0A 2DENB 1Z5SB 4JLCA 2N9XA 1WGRA 3A33B 4BKSA 5LXIB 4DHZB 2L05A 3AU4A 4KIKB 1V86A 4KSKC 2G45B 3EECA 2LJ5A 2CS4A 4MSQB 4ZRIA 3B0AA 2KDBA 5CHWA 1RRBA 3PLUA 4PS7A 4MH0E 4WWNA 1UBIA 4G50A 5DPSA 2JRHA 3KH0A 3QARA 3A4SC 3ZNID 1WM2A 2IO1B 4ZRJA 3T9LA 2L00B 1Q0WB 2AL6A 4EZLA 3VTUA 2FAZA 3L16A 3L17A 2KD0A 2ZEQA 4WAAA 1D3ZA 2KJHB 3DQVA 2K8CA 1P98A 2R2OA 3H7SA 3W1YA 2JY6A 2HJ8A 2N9EB 4TQ0A 4NQLB 5G55A 2EKEC 2NBUA 4FHJA 2WX0A 3ZLZA 1J8CA 1WJ6A 4HJKA 1E8WA 4FULA 4NNJB 3U7DA 4MEMA 2N1WA 4XX5A 2I1KA 3TIXA 2G3QB 4LDTD 3VVWB 3BY4B 2KJ6A 4LCDE 4PS3A 4BVUC 2AWTA 2K8BA 3AULA 4ICUA 2L3ZA 3JYUA 4KSLC 4MGKE 5LXHA 2BYFA 2JUOA 3DVGX 4A3OA 3VFKA 4FLHA 3HM3A 2IY1B 3ECIA 4E71A 4ICVA 4MGZE 2KFKA 1WR1A 3X0WA 2XEWA 3VTWA 4LDTB 3Q3JA 2BYEA 1UBQA 1V9JA 2LGDA 2KANA 4GDLB 2KWCA 4RMAA 3RYTA 2FIFA 3VDZA 4DDID 3OJ4B 2GBRA 2K6QA 2ZNVC 3MTNB 4FBJB 1WJNA 2Z0EB 3DBSA 2LRUA 3AI5A 4I6NB 1T0YA 3R7QA 2C5LC 2NR2A 4CHKA 3RUIB 2BWES 4EZKA 3PZDA 3QHTA 2BF8B 4AP4C 2DZIA 2L76A 4F1SA 1I35A 2JVCA 2KTRB 3A9JA 3RULA 4B6WA 3UIOB 2O2VA 1WIAA 2FCSA 4EKUA 1LXDA 3QIJA 1EO6A 4HWIB 4KV2A 2LRWA 4WJNA 2REXA 3VH3B 1WRDB 2JRIB 3RZWC 3H9DA 1E8YA 1WMHB 2K6DB 2NVUI 3L08A 4I6LB 4TKNA 4ANUA 3SU8X 2YVCA 2ZJDA 1IPGA 2C60A 2JZ3B 1WJ4A 5AZFA 3TCAA 1WX7A 2LGYA 2FCQA 3QA8A 4MDKE 3WAOA 3EFUA 5TR5A 3ZRCA 5HKHA 1IP9A 3M63B 4DHZE 2LVOA 1V81A 2UWQA 3JSVA 4GOCA 3VUYA 1Z2MA 2XK5B 4HDOA 2LVQA 2B3AA 2GOWA 3QAQA 3HIZA 2AYOB 2BWFA 1WXVA 3N32A 1OEYA 2KO3A 2BKRB 4BKTA 3K9OB 2MRPA 1WF9A 4HXDA 4NAWA 1FXTB 4II3B 1UD7A 1WX8A 1YX6B 3A1QB 1E8ZA 3L10B 4M8MA 3OJ3A 5EDSA 1E7UA 3APDA 4WJPA 3M3JA 3VHTC 3CF6E 2M1MA 1IYFA 1WFYA 3U30A 4DHJB 2BGFA 1YQBA 2KMAA 3KW5B 4I6PA 2JPHA 4KZ0A 2CU1A 3P2BA 1WZ3A 2DYMA 2MQJA 3KVFB 2KDIA 3Q3FA 2RGFA 4MGYE 4BFRA 3ZRFA 3V61A 2DZJA 2PE6B 4HCNB 1E90A 3DBLI 2KX3A 1SE9A 3CSFA 2LWPA 1OQYA 4PYUA 4URKA 2DYOA 2XBBC 4PYZA 4M0WB 4GXBA 3B08A 4ZRKA 1WH3A 4MJSB 4MM3A 3SDLC 2DAJA 3KUDB 2KFJA 4KIKA 1WI0A 4W9IA 3DVNV 1WE7A 1LQBA 4F8CB 1WMHA 3A1QA 3IHPC 2KWVB 3ZDTA 1CMXB 1WY8A 4HDQA 3A4RA 4G3XB 3W1SA 2WYQA 4GDLA 2I1JA 2O6VB 3ML9A 1UGMA 2JXXA 2MP2A 4WJQA 3VAWA 3ZVVA 1U4AA 4IUMB 5AEKB 2J0MA 2NPTB 3TJPA 1I42A 1E5WA 5DPTA 2GMIC 2D3GA 1MG8A 5E6PA 5KHQA 2MLBA 2N7DA 2PPHA 2KTFA 2CKHB 3V62A 3PLVA 2ZPNA 4HPMB 2LXAA 1WR6E 4TV3A 2PJHA 4HK2A 2D07B 2KOXA 2C7HA 1Q1OA 2JT4B 2CHXA 3X23A 1K8RB 2N4FA 3UGBB 3VH4B 3MHSD 1E8XA 1WGDA 2C7NB 1EF1A 2KKCA 4XC2A 4ZYNA 1H4RA 2HTHA 4ASWC 1A5RA 2MA9B 2K39A 2J7QB 2L0FA 3PREA 1XQQA 3H7PB 3ZIMA 2KJRA 4B9KA 2MBBB 3KUCB 2CR5A 2PEAA 2K25A 3NOBA 3NZSA 2IYDB 1S3SG 5JHAA 5KHOA 1YJ1A 1VD2A 3RD2A 1G6JA 5IAAC 4LJPB 4A3PA 2N7EA 2IO0B 4NQKE 4W9JA 3V60A 4BBNF 3IBEA 4MSMB 3DOWA 2M8SA 3IFWB 3UINB 2N1VA 4GGQA 4KDLB 3NY5A 1YX5B 1RLFA 3H1UA 4GSWA 1GUAB 4JIOU 1WYWB 2DZKA 2L8JA 2MSED 2ZCCA 5J18A 3VTVA 4FN2A 3VXWA 1WXMA 1ISNA 2J0JA 1H8CA 3CSTA 2MBEA 2ZZPB 3PRZA 3ZDMC 4K7WA 2D2QA 2KMCA 2KN5A 3I3TB 3WAMA 4ANWA 2MBHA 3WANA 2Z0DB 1TTNA 4EEWA 1V5TA 1WGHA 2LVPA 3N30A 4W9DA 4KVGB 1AARA 3ZUNA 3DPDA 4JL9A 1J19A 3VUXA 1GG3A 4IW0A 4TQ1A 2WX1A 3PT2B 3PV1A 2KDEB 4K81A 2IBIB 3M62B 1OTRB 2NCNA 2G4DB 4GB9A 5BO4B 4IC7B 2GBKA 3PHXB 2KC1A 4DHJD 2NPTA 4NJ7A 2IZVB 2DX5B 1SIFA 2KWUB 3JVZX 3QK0A 1V2YA 2V4LA 1OGWA 1P1AA 3IG3A 1P9DU 2FIDA 3PSEB 3M95A 2L7RA 5CHFA 5DCNA 3ZNHB 2KFKB 4FA6A 2O2VB 4WWOA 1QZEA 1WXAA 2K1FA 2LZ6A 3APCA 3EC8A 5DPWA 4ZDVA 5L95C 3L13A 1X1MA 4BOSC 1NBFC 3H6NA 1ZGUB 3NZUA 2LUEA 3A9KA 5LLIA 1EF5A 2A4ZA 4GN1A 2KDFB 4K7UA 5FR6A 3TMPB 4BBNC 3OAWA 4JGHB 2MBQA 2Y5BB 2IO2B 2D11A 5GMVA 1WZ0A 1YD8U 1F9JA 2OJRA 4WJOA 2KK8A 4II2B 1RFAA 1V49A 2MP2B 2ZVOA 2ASQA 2J0KA 4FJZA 3GZNI 5E6OA 4AUQC 1OEYJ 3WAPA 5D94A 2LGXA 2KZRA 2KTRA 3A9JB 1P3QU 2LD9A 2W9NA 4F7ZA 1NI2A 3HM6X 4AJYB 3JSVB 4ANVA 2KLCA 5CHVC 2EMSA 3TBLD 1BT0A 4RM8A 4WQOB 1S1QB 4KZCA 4ANXA 2D10A 2BKFA 3ZKJC 4DK5A 4K1RB 3TL5A 2IO3B 2M17A 4J6IA 5G2NA 2AL3A 2L0TA 3K9PB 1SGHA 2CHWA 1L2NA 3DDCB 3SD5A 2DYBA 1Y8RC 5L83A 1WXSA 2KNBA 4IM2A 4HCPB 4BOZB 3CMMB 2JF5A 3QCAA
chains in the Genus database with same CATH superfamily
4LNKA 2N9PC 1MPEA 4A20A 1K50A 5E6NA 2V3PA 5IA7A 3AU5A 3U2SC 3RFZB 3R7RA 4ZOHC 2DAFA 2WHIA 2NTSA 2IJ0A 4AS1A 1JWBD 1DGJA 3L0WB 4L23A 1KH0A 1RWSA 1FIQA 4W9EA 2N7JA 3IAM1 4YL8A 1P7FA 2FCMA 4W9GA 4XGAB 1XD3B 1E7VA 4KGTA 2ZVNA 5FKAC 3ZTDA 1QOGA 3NS8A 4YTNB 2WXIA 3ZW3A 1C77A 3HHMA 2V1YA 2NTTA 3VRBB 3EHVA 2NBWB 4HJGE 4OZCA 2WXHA 4OVVA 2GBJA 3RZFA 1KFYB 3V3XA 2X38A 5EE9A 4MELA 3KUZA 5BYQA 2XNAC 4L2YA 4RCOA 2WWZA 3QWZB 4B95A 2BB6A 4MJSA 2QEJC 4TUUA 1AWDA 2MW5A 5D6JB 4US8A 5CX3A 3NS1A 1FFVA 1ZKHA 4AWJA 3Q69A 4FXCA 3AECB 4BZAA 2RR9A 4CO7A 3ETRA 2PVOD 3Q2AC 4YXDB 1QLBB 2PMVA 4GDKB 3KYDD 1C4CA 3MJWA 2BYVE 2BS2B 2JZZA 3DWMA 3W1SC 2BB5A 3IAS1 3ZGZA 2GBNA 3DVNU 2K8HA 2Z59B 4XZ4A 2ZPYA 4K3BA 4KGSA 1TGZB 1V6EA 1N6ZA 4FJYA 2LI5A 3S2AA 3V6EB 3IVFA 2JQRB 1TKYA 4LJOB 2EMTA 4GDKA 2WP9B 1E7PB 1KLVA 3O13A 1MI0A 1EUVB 1Q5WB 4DBGA 4XWWA 2KWDA 3A33B 4BKSA 2L05A 1TS2A 2AX5A 3TEZA 2D3AA 3MHZA 2MJEA 3PLUA 3HVZA 2BVCA 1UBIA 1JROA 4R3DA 3QARA 2UU7A 3ZJTA 1DOYA 4EZLA 2AL6A 3RNBC 1D3ZA 1P98A 1SEBD 4NQLB 3ZLZA 1E8WA 4FULA 1BMLC 4MEMA 2N1WA 2DLBA 2I1KA 1I4PA 2G3QB 3BY4B 2KACA 3PZ8A 2K8BA 3AH7A 4ICUA 4A8XC 4M00A 3JYUA 4KSLC 4MGKE 3DVGX 3BYTB 4ICVA 4MGZE 3X0WA 1UBQA 2KANA 4RMAA 3RPFC 2K6QA 2OHFA 4FBJB 1WJNA 2LRUA 3AI5A 4I6NB 2LGIA 1A70A 2C5LC 4IDIA 3RUIB 3PZDA 3AN1A 4F1SA 1SSNA 4A9AA 3URYA 3T3OA 2LHEA 1HXYD 1WYGA 3Q8BA 3QIJA 1EO6A 2QILA 4HWIB 3Q8AA 4KV2A 2REXA 1WRDB 1WSPA 3RZWC 1B9RA 1E8YA 2ZJDA 1IPGA 2C60A 2G1EA 1KLUD 4MDKE 4LTUA 1FXAA 5AUKA 2VZKD 1HZ5A 3JSVA 3VUYA 1I4GA 3QAQA 3U52E 3BIID 2BKRB 3Q8CA 4BKTA 4MACA 1YX6B 2L83A 3MC0B 4WWMA 1N5XA 3OJ3A 1HTOA 1P7EA 4JX1C 3CF6E 3L4PA 1QKZA 1HTQA 2INDC 4DHJB 2KMAA 4KZ0A 1D6EC 1XEEA 3P2BA 2DYMA 5IKCM 3KVFB 2JXTA 2RGFA 4MGYE 1ZPSA 4JPSA 1E90A 2KX3A 1SE9A 2WXFA 1OQYA 4PYUA 2INNE 2WXMA 4MJSB 1VRAB 2DAJA 3TEWA 1MHXA 4YSZB 1K51A 2L32A 4H2AA 1LQBA 2WXKA 4F8CB 5LNK1 3IHPC 2M0AA 2KWVB 3BVMA 1D5MC 3W1SA 2WYQA 3ZVVA 2JXXA 3VAWA 1U4AA 1DOXA 1I42A 2IGGA 4USAA 5E6PA 5KHQA 2MLBA 2PPHA 1F2RC 3V62A 4OZAA 2ZW0A 2MH7A 4HK2A 1L0VB 3C19A 3VH4B 2C7NB 5FR3A 1H4RA 1LO5D 1A5RA 1YNTE 5GXGB 3PREA 2LMCA 2KJRA 4D2KA 1YJ1A 4LJPB 1QQRA 4NQKE 3DOWA 5HG2A 4PK1A 2M8SA 4GGQA 1I4RA 1EU3A 5BYSA 2DZKA 2GI9A 3VXWA 1WXMA 1ISNA 1H8CA 2MBEA 2ZZPB 4ARIA 1JQ4A 3GE8C 3WAMA 4ANWA 2MBHA 3WANA 4W9DA 3ZUNA 3DPDA 4IW0A 4US9A 1D5ZC 1WXQA 3PV1A 4XWTA 2KDEB 2IBIB 2MHJA 5BO4B 2GBKA 1FXIA 1C4PA 1VZ8A 3NRZA 1T6BX 3JVZX 2DWQA 2V4LA 2SAKA 1JWMD 1P1AA 3ZJVA 5IO9A 2BW2A 5CHFA 4FA6A 2O2VB 4YSYB 2BT6A 2LZ6A 3APCA 3L13A 1X1MA 1I4HA 4BOSC 1NBFC 3H6NA 3BWUD 2KDFB 4BBNC 3OAWA 2TSSA 1WZ0A 4WJOA 3KLSX 1GB4A 4II2B 3Q14C 3RI7C 2E6XA 2RDGA 5E6OA 4AUQC 1P3QU 2LD9A 2W9NA 1NI3A 2EMSA 4C4VA 4WQOB 3ZKJC 2MJDA 3R8BA 1SGHA 5D3DA 1ZDVA 2DYBA 3BYYB 4HEA1 1JALA 1WXSA 2KNBA 4IM2A 4HCPB 1FCLA 2PIAA 1QOBA 3ZNZB 3AE2B 1D4BA 5IP4D 1J7AA 1YMHE 4ZHPA 4BAXA 2V9HA 2WXGA 4FJVB 1UF0A 1MHHE 3ZTCA 4WAFA 2W3RA 3AEDB 4RGMA 3AEGB 1F0ZA 2KHWB 4YT0B 4PS8A 4YTMB 1DYQA 3DVGY 1IUEA 1KRHA 2KN4A 3ML8A 1YOVB 1L0XB 4C56C 2O6VA 2Q5WD 3WA0A 4G11A 4N9F4 1TZOA 2GB1A 3R66C 3ALBA 3L54A 2A5UA 1F77A 2MBOA 4W9FA 3U7ZA 4C7ZA 2IGDA 2RPQA 3P63A 2QIEB 2WNMA 1LM8B 1GC7A 1XT9B 2DHZA 2INCC 3H7PA 3E56A 2R61A 3BK2A 5AZGA 5C23A 3V6CB 3W5UB 4A6QA 1YN3A 1VCBA 2C7MB 1FD6A 4IG7B 4FHKA 3U8ZA 2BQQA 1WE6A 1NYQA 2NS5A 2L1AA 1SE3A 3ZO5B 1ET9A 1T5XD 2I2YA 2KC2A 1FNVA 4EZJA 1L7YA 2MJ3A 4MGIE 3DBRI 3DCGA 1JWSD 4X57B 2VH1A 2WDQB 1GJZA 3E9SA 3PVLA 4N58A 3FKYA 4E3CA 2LXCA 4HPLB 2FUG1 4RFBA 1I7HA 4EOYA 3TSSA 1WX9A 2W54A 1R4NI 5MPOA 1C79A 1EWCA 3R3MA 2KVRA 4WQMA 3UIPB 1F52A 2D5GA 1WJUA 1VDVA 4P1BC 2M56B 2AQ3B 3P1MA 2V0GA 2WU2B 2BYTA 3W5VB 2M19A 3WIMA 1JW9D 3LJ3A 3RNFC 1NDDA 2W3SA 4IM0A 2N9XA 4HRSA 3OWEB 4KIKB 3GS2A 2G45B 2IGHA 4RGOS 1L4DB 3B0AA 1Y56A 2B76B 4MH0E 4S0RA 3KH0A 1WM2A 2IO1B 2ZW1A 1Q0WB 2WXNA 3L16A 1UNSA 3L17A 2KD0A 2WS3B 4WAAA 5C2TB 3W1YA 2N9EB 4TQ0A 4TMAB 4OZBA 2EKEC 5G55A 1J8CA 3EGRA 3Q3NC 3ABVB 3TIXA 4NZLB 2KJ6A 4PS3A 1UUPA 2AWTA 4RF0A 2L3ZA 3NUHB 2BS4B 4A3OA 2IY1B 4A90A 4E71A 1AYFA 3Q3JA 4GDLB 2FIFA 3OJ4B 2GBRA 1FPYA 3MTNB 3P4RB 1T0YA 1I35A 2JVCA 3U4EG 1JWAD 2JRIB 2K6DB 4I6LB 3SU8X 4WH4A 3BVGA 3TEXA 1WJ4A 1E0ZA 1WX7A 1HZ6A 2FCQA 3ZRCA 3KWVA 2UWQA 4WURA 3EA6A 1Z2MA 4OW0A 2XK5B 3AE8B 2AYOB 1FRDA 1JRPA 1PYWD 3IXSA 1WF9A 4HXDA 4II3B 3A1QB 1E8ZA 3IT6B 4JWSC 4XDDA 3RNAC 3APDA 1K53A 3U30A 1YQBA 2KT7A 4I6PA 4XYCA 4AQ7A 2CU1A 2MQJA 3Q3FA 3ZRFA 4ITKA 2PE6B 4HCNB 3DBLI 3RMKC 2N9KA 3CSFA 1CJEA 1AN8A 2DYOA 3B08A 4MM3A 1SJHD 2E3TA 4ZYSA 1FO4A 3AE4B 4KIKA 3I57A 1WE7A 1IGCA 1WMHA 2YEPF 3A4RA 1XLNA 2MP2A 2HTME 1CZPA 1E5WA 2D3GA 2KTFA 3SEBA 2LJIA 1ZDXA 3PLVA 4HPMB 2BS3B 2LXAA 2CHXA 1QILA 2N4FA 1N5WA 3UGBB 2WXOA 1WGDA 1EF1A 1TJEA 2J4XA 4ASWC 2HTHA 2MA9B 2K39A 2L0FA 1XQQA 3ZIMA 4B9KA 2MBBB 1N62A 1L6UA 5JHAA 3NOBA 1S3SG 1VD2A 1T0QC 2PTLA 3RD2A 2LUMA 5IAAC 5H8YE 4A3PA 2N7EA 3V60A 4BBNF 2J52A 4OHJA 3IFWB 2N1VA 4C4VB 1XLPA 1YX5B 3MP9A 1RLFA 3H1UA 4GSWA 5EE0A 1EM7A 1QOFA 1HEZE 1WYWB 5J18A 4WIPA 4LNIA 4K7WA 2D2QA 3I3TB 2Z0DB 1MG4A 5IOIA 1GG3A 2JZPA 4TQ1A 4TSSA 4K81A 3MC9A 1OTRB 1T0RC 2G4DB 3RNEC 3PHXB 3KQ4A 4DHJD 5C3JB 1SIFA 2KWUB 3QK0A 2BTEA 5T8IA 4HKQA 3P4SB 1GOZA 3DBLB 2W82A 3M95A 3N1ZC 5DCNA 1QZEA 1WXAA 3R2IA 2GLSA 3CIRB 3A9KA 5LLIA 4GN1A 4K7UA 2KMMA 4JGHB 2MBQA 1YD8U 1F9JA 2OJRA 1SB3C 2ONQA 2KK8A 1V49A 2ZVOA 2ASQA 3Q8EA 3MFGA 3MJ5A 3I9V1 5BYRA 3IT4B 4ANVA 5CHVC 3TBLD 2I38A 1BT0A 1YQ4B 4ANXA 2BKFA 4DK5A 2IO3B 5G2NA 1FFUA 2AL3A 3K9PB 3SD5A 4A55A 3ZJUA 1FRRA 2BBCA 2AQ1B 3RN9C 2FBWB 2JF5A 3N3KB 4KDIC 1NVID 3WCQA 1J0GA 4IWOA 1PQSA 2MCNB 1L0YB 1WGYA 5D7GA 4YTPB 3ZNGC 1R4MB 3LB8C 3HK0A 4IWQA 2IY0B 3GE3C 2RMMA 3O65B 1V1OA 3PPAA 3LDZE 1C3TA 1PGAA 2KXJA 2JYEA 3GOEA 3HUIA 3RCZA 3UQBA 1UZXB 3DBHI 3OLMD 3QQ8B 3AEAB 4AOFA 4IWPA 3QX1A 3N1YC 2G9HD 2MX2A 2YLMA 2WDRB 1SIJA 3B1LX 2FCNA 3W2DA 1NEKB 4MM3B 5JHBA 1RAXA 4K3CA 3KYCD 4DDGD 3APFA 1NENB 1ENFA 4IOIE 2QDFA 2ZNVB 3JW0X 1JCKB 5D2MB 2WLBA 4PT5A 2OOBB 5JZEB 1P0RA 2R2QA 4MH8A 3WALA 1I4XA 2KDMA 3I5JC 1JRUA 1LFDA 4C80A 1V5OA 2JWZA 2KQSA 4GIVA 3NVZA 4NY0A 4W9KA 2NBVB 2WU5B 5G5GA 1KF6B 3AEEB 1PGBA 2AEHA 4W9CA 2PE9A 1ZW7A 4FADA 1WGGA 1ZXIA 4W9LA 2XK5A 5HFYA 2GBMA 4OVUA 5BMIA 4G0NB 3RNCC 3AM9A 1HE8A 4KKIA 1R4MI 1QF6A 2PKOA 3ZXVA 3AMZA 2KQ7A 2L52A 2VRRB 1WM3A 3QJZA 4BKSD 4DWFA 4HKZE 2QC8A 4NPNA 3B2FA 1GC6A 3AE7B 3ENEA 4JQWC 4HLEA 1M94A 1ZOYB 2UYZB 4ARCA 3PHWB 4M0WA 3SHQA 2DENB 3LXFA 1Z5SB 1JMLA 4JLCA 1KTKA 1WGRA 4LLGM 1V86A 4ZRIA 2KDBA 5CHWA 5E6JA 4PS7A 1FNWA 5FK9C 3A4SC 3ZNID 2LHDA 5JXVA 3VTUA 3DQVA 2K8CA 2R2OA 2HJ8A 2NBUA 2EELA 2WX0A 3AEBB 5I4DA 4NNJB 3U7DA 2Y5PA 4LDTD 2ICIA 4LCDE 4XE0A 3VR8B 1ZUD2 1VLBA 2BYFA 2JUOA 3GZNB 3VFKA 1TY2A 2FE8A 2ACZB 2KFKA 2WXPA 3VTWA 3DHGC 2BYEA 2D3BA 2LGDA 3SR6A 2KWCA 3RYTA 1V1PB 2Z0EB 2NR2A 4EZKA 3QHTA 2BF8B 2DZIA 4J3OD 3A9JA 4B6WA 3UIOB 1M4VA 2O2VA 1WIAA 2FCSA 1MVKA 4ZRPA 2LRWA 3VH3B 3I63C 1WMHB 3L08A 1QOAA 5AZFA 3TCAA 1KLGD 1V1PA 5HKHA 3EFUA 1V81A 3EUB2 2JU6X 4HDOA 2LVQA 1T3QA 2GOWA 3SFEB 1WXVA 1OEYA 1QT9A 2MRPA 1XCQL 4NAWA 1HA5A 1UD7A 1WX8A 3L10B 1MJDA 4B0EA 2JX5A 3AB5A 1E7UA 2M1MA 1IYFA 1ZXHA 2JPHA 1YN5A 3NJTA 2KDIA 1JWUD 3KWLA 1L6VA 1UWXA 2SEBD 4JE3B 2LWPA 4PYZA 4M0WB 2JSVX 1WH3A 3KUDB 3UI3A 5AUIA 3DVNV 4Q2JA 3A1QA 2LEKA 3ZDTA 4DXGA 1CMXB 4UDUC 1WY8A 3ZYYX 1ET6A 4GDLA 2O6VB 2DNFA 1CQVA 2J42A 3GB1A 2GMIC 3DHIC 1MG8A 3ZXRA 2N7DA 1RM6C 1CK1A 2ZPNA 4N59A 2PJHA 2D07B 2KOXA 2C7HA 2DBYA 5BMHA 1K8RB 3MHSD 1C4AA 4XC2A 4ZYNA 1UWMA 4N6EB 1ACCA 3H7PB 3GP7A 3KUCB 1T0SC 2CR5A 2PEAA 2VH2A 2K0PA 5KHOA 2KVZA 5TSSA 2IO0B 4W9JA 4IKGA 1NYRA 2W55A 2X8XX 5D3IB 4KDLB 3AV8A 2Y3AA 3NVYA 3HVDA 1FM0D 3AE3B 1GUAB 4KX6B 2L8JA 2ZCCA 3VTVA 4FN2A 3CSTA 1R7SA 3PRZA 3ZDMC 2KMCA 3J9CA 1WGHA 4KVGB 2Z8LA 4JL9A 1RYJA 3VUXA 1YQ3B 2K3UA 4IC7B 1EU4A 2NPTA 4NJ7A 1V97A 2IZVB 2DX5B 2QMTA 3R2TA 4S17A 1OGWA 2WXQA 3SFDB 2RDHA 2QCZA 2L7RA 3ZNHB 2KFKB 4WWOA 3EC8A 3FILB 4OVZA 1K52A 1J7BA 1TKEA 1TS3A 2D11A 1RFAA 1OQQA 1IGDA 4FJZA 3WAPA 5D94A 5G5HA 1STEA 2KZRA 3A9JB 1NI2A 3NVWA 3JSVB 1SE2A 2KLCA 4RM8A 1XLQA 2D10A 3TL5A 1C9FA 1TYGB 1L2NA 1PDXA 1Y8RC 5L83A 3CMMB 3W9CB 3P4PB 2LASA 4RM9A 4EFOA 3NHEB 2RD0A 4MT5A 2H89B 1XO3A 2PVGC 1UH6A 3AEFB 3T8MA 2KX0A 1PUTA 4RGNA 3AE9B 4O1NA 4AJWA 1BUIC 4DXFA 3RT3B 1UELA 4IM3A 2M0XA 4KKJA 5C1ZA 3ZQ4A 1TZ1A 1J7CA 4P7IA 1KM7A 2HDEA 2J53A 1VZ6A 2DZMA 5J17A 2NMQA 1BXTA 3BINA 4HVBA 2JWUA 4ZHOA 2G4SA 2INPE 1TIFA 5EE1A 2RSUA 1YIWA 2N0SB 2IDYA 2KLGA 2QHOA 4BKGA 4QAYA 5H92C 4HPPA 3A9KB 3PS6A 2BPSA 4GU2A 3OG5A 4DXAB 1TS5A 2CJNA 5DPRA 3RNGC 1N63A 2FUHB 1SE4A 2KAJA 2YEPB 2QJLA 4YWGG 5CTRC 1KJTA 4W9HA 2M4NA 2CU3A 3PRPB 3UQAA 2PW9A 3PRMB 2D3CA 2H88B 1YJIA 2HE7A 3QC8B 3PTFC 1GPXA 1C1YB 1V80A 2WDVB 2MWSB 2IPKD 2ZCBA 3VUWA 1FCCC 1GNUA 3H8HA 4GMVA 4C00A 1FMAD 2WDTB 1DOIA 1LGRA 4CYEA 2N9LA 3PO0A 3Q3MC 5J2RA 2FNJB 1XF5L 2CHZA 3NVVA 1I4QA 4NJCA 2C9WB 2OEDA 3PGEA 4NJ6A 3UF8A 3D32A 1KOTA 3AXCA 3VQIA 1TY0A 3AE5B 3ONSA 2O6VD 1SF0A 3N20C 1ROEA 4EUTA 3C0RB 4NAWB 3DWGC 1TBEA 2HJ1A 4JWUC 4KGRA 4M8NA 3Q8FA 1XCTL 1C76A 1UGJA 2V3SA 5JH5C 4WWPA 2MEKA 4LNNA 3V05A 2HD5B 4E74A 4K7SA 4HROA 5AZHA 2WQYB 5LXIB 4LK0M 4RNAA 4DHZB 3AU4A 1YJJA 4KSKC 5HI1A 3EECA 2LJ5A 1TS4A 2CS4A 4MSQB 1TKGA 3FILA 1AW7A 1RRBA 4XDCA 4WWNA 4G50A 5DPSA 2JRHA 4C7YA 3B2GA 4ZRJA 3T9LA 2L00B 5BMGA 2FAZA 5EE3A 2ZEQA 3VRAB 1GAQB 2KJHB 1PFDA 3H7SA 1Q10A 4REZA 2JY6A 4FHJA 1OFFA 3B9JA 1WJ6A 4HJKA 1EWYC 1IBXB 4XX5A 2RDBC 3VVWB 3N9YC 4BVUC 3AULA 2JYTA 5LXHA 4FLHA 3HM3A 1ZP0B 3ECIA 3VR9B 3PZ7A 1WR1A 2XEWA 4NAMA 4LDTB 4YSXB 1V9JA 1N60A 3VDZA 1E10A 4DDID 3DHHC 2PLPA 2ZNVC 3DBSA 2V3NA 3R7QA 1L4ZB 2LFIA 4CHKA 2BWES 1IBXA 2WGSA 4AP4C 2L76A 3BK1A 4EE2A 2ON8A 4ZRQA 1SJED 2KTRB 3RULA 3FC4A 4EKUA 1LXDA 2VZKB 4LNOA 3EFCA 3TEYA 4WJNA 2WXLA 2OJWA 3H9DA 2NVUI 2KYWA 4TKNA 4ANUA 2YVCA 1V8CA 2JZ3B 2LGYA 3QA8A 3WAOA 1IP9A 5TR5A 4DQOC 3M63B 4DHZE 2LVOA 4GOCA 3Q6BA 2B3AA 3HIZA 2BWFA 3N32A 4P6VF 2KO3A 3K9OB 3MC8A 1TT5B 1FXTB 4M8MA 1FEHA 1RFKA 5EDSA 1E9MA 4WJPA 1F2RI 3M3JA 3VHTC 1WFYA 2BGFA 3KW5B 1WZ3A 1FNUA 5IN7A 5HHDG 4BFRA 3V61A 2DZJA 3AE1B 4URKA 2XBBC 4GXBA 4ZRKA 3T3NA 3SDLC 4P1CC 2KFJA 1WI0A 4W9IA 2K5PA 4B0MA 4RF1A 1VR9A 1WRIA 2KQ4X 3FAHA 4HDQA 4G3XB 2I1JA 2K9XA 3ML9A 4WJQA 1UGMA 4IUMB 5AEKB 2J0MA 2NPTB 3TJPA 5DPTA 3BZDB 2CJOA 2CKHB 1XLOA 1WR6E 4TV3A 3DBRB 1YN4A 1Q1OA 2JT4B 3BVZA 3Q3OC 3X23A 4P16A 1E8XA 2KKCA 4RGTA 2J7QB 1C78A 1N61A 1B1ZA 2K25A 3NZSA 1ZE3D 2IYDB 2V4IB 3LYYA 3N1XC 1G6JA 4L1BA 1R4NB 3AE6B 3IBEA 4MSMB 1L5PA 2EKIA 3UINB 1E6EB 3NY5A 4LNFA 1WWTA 3C8YA 4JIOU 1HQRD 2MSED 2J0JA 1XXGA 1F1HA 2KN5A 4RH6A 1TTNA 4EEWA 1V5TA 2LVPA 3N30A 1PGXA 1AARA 4M02A 3TUOA 3P4QB 1J19A 1SXTA 2WX1A 3PT2B 3M62B 2NCNA 4GB9A 2RPVA 2KC1A 4ACFA 1V2YA 1VJKA 2WXRA 3IG3A 1P9DU 2FIDA 3PSEB 3P42A 2GRIA 4CQNA 1ESFA 2K1FA 5DPWA 4ZDVA 5L95C 3NZUA 1ZGUB 2LUEA 1EF5A 2A4ZA 3TMPB 5FR6A 1OQRA 2Y5BB 2Y5CA 2IO2B 5GMVA 2QSDA 2WXJA 2MP2B 4GLSC 2J0KA 1MFWA 3GZNI 1OEYJ 2LGXA 2KTRA 4F7ZA 3NG0A 1GB1A 1WGKA 3HM6X 3HRDD 3DBHB 4AJYB 1SBBB 1S1QB 4KZCA 2K22A 4K1RB 4M01A 4J6IA 2M17A 3CWIA 2L0TA 2CHWA 3DDCB 2XN9C 3NZ3A 1VZ7A 4BOZB 1D5XC 2LGSA 2AQ2B 3QCAA
chains in the Genus database with same CATH topology
3N3KB 4KDIC 3ZNZB 2N9PC 1J0GA 4IWOA 1PQSA 4A20A 2LASA 5E6NA 4RM9A 2MCNB 5IA7A 3AU5A 1WGYA 5D7GA 3NHEB 4EFOA 2RD0A 3ZNGC 3R7RA 3HK0A 4IWQA 2DAFA 2IY0B 4FJVB 1UH6A 3O65B 3PPAA 3LDZE 3T8MA 3ZTCA 2KX0A 1C3TA 2KXJA 3L0WB 4AJWA 3RT3B 1UELA 3GOEA 3RCZA 2KHWB 4IM3A 3UQBA 2M0XA 1UZXB 4W9EA 3DBHI 5C1ZA 4YL8A 1TZ1A 3OLMD 2FCMA 3QQ8B 4PS8A 4W9GA 4AOFA 4IWPA 4P7IA 1XD3B 1KM7A 3DVGY 1E7VA 3ML8A 3QX1A 2ZVNA 3ZTDA 2DZMA 5J17A 3NS8A 2MX2A 2O6VA 3BINA 3WA0A 4G11A 4HVBA 2YLMA 4N9F4 3B1LX 2G4SA 2FCNA 3R66C 2RSUA 3ALBA 1YIWA 3L54A 2A5UA 2KLGA 3ZW3A 2MBOA 2QHOA 1RAXA 3HHMA 2V1YA 5JHBA 4W9FA 4BKGA 3KYCD 3EHVA 3A9KB 4DDGD 2NBWB 2RPQA 4OVVA 3APFA 3PS6A 2BPSA 4GU2A 1LM8B 1GC7A 1XT9B 2DHZA 2GBJA 4DXAB 3H7PA 5AZGA 5DPRA 3RZFA 5C23A 2ZNVB 3V6CB 1VCBA 2FUHB 2C7MB 3JW0X 5D2MB 4MELA 2OOBB 3KUZA 5CTRC 5JZEB 1P0RA 2R2QA 4IG7B 3WALA 4FHKA 1KJTA 1JRUA 2WWZA 1LFDA 4W9HA 2M4NA 3PRPB 3U8ZA 3UQAA 1WE6A 3PRMB 3QWZB 2NS5A 4B95A 4MJSA 3QC8B 2HE7A 4TUUA 3ZO5B 1V5OA 3PTFC 2JWZA 1C1YB 2MW5A 5D6JB 1V80A 2KC2A 5CX3A 2KQSA 2MWSB 4EZJA 1ZKHA 4GIVA 1L7YA 2ZCBA 4AWJA 4MGIE 3VUWA 4NY0A 4W9KA 2NBVB 1GNUA 3DBRI 4GMVA 3DCGA 4X57B 2WDTB 2AEHA 4W9CA 2PE9A 1ZW7A 2RR9A 4FADA 4CO7A 1GJZA 1WGGA 3PVLA 4CYEA 4GDKB 5J2RA 4W9LA 3KYDD 2XK5A 2GBMA 4OVUA 2FNJB 3MJWA 4G0NB 4E3CA 2BYVE 2CHZA 2JZZA 2LXCA 4HPLB 2C9WB 3PGEA 1HE8A 4NJ6A 3UF8A 3D32A 3W1SC 4EOYA 1R4MI 1KOTA 3AXCA 1WX9A 2GBNA 3VQIA 3DVNU 3ONSA 2K8HA 2O6VD 2Z59B 2ZPYA 4XZ4A 1R4NI 2KQ7A 3R3MA 1TGZB 2KVRA 3UIPB 2VRRB 1WM3A 4EUTA 3C0RB 1V6EA 3QJZA 4BKSD 4NAWB 4FJYA 4DWFA 1TBEA 2LI5A 3S2AA 4M8NA 4NPNA 1WJUA 3V6EB 1GC6A 3ENEA 3IVFA 4JQWC 4HLEA 1M94A 4LJOB 2EMTA 2UYZB 4GDKA 2V3SA 5JH5C 1KLVA 4WWPA 3WIMA 4E74A 2HD5B 1EUVB 3LJ3A 3PHWB 4K7SA 3SHQA 5AZHA 1NDDA 1Q5WB 4DBGA 4IM0A 2DENB 1Z5SB 4JLCA 2N9XA 1WGRA 3A33B 4BKSA 5LXIB 4DHZB 2L05A 3AU4A 4KIKB 1V86A 4KSKC 2G45B 3EECA 2LJ5A 2CS4A 4MSQB 4ZRIA 3B0AA 2KDBA 5CHWA 1RRBA 3PLUA 4PS7A 4MH0E 4WWNA 1UBIA 4G50A 5DPSA 2JRHA 3KH0A 3QARA 3A4SC 3ZNID 1WM2A 2IO1B 4ZRJA 3T9LA 2L00B 1Q0WB 2AL6A 4EZLA 3VTUA 2FAZA 3L16A 3L17A 2KD0A 2ZEQA 4WAAA 1D3ZA 2KJHB 3DQVA 2K8CA 1P98A 2R2OA 3H7SA 3W1YA 2JY6A 2HJ8A 2N9EB 4TQ0A 4NQLB 5G55A 2EKEC 2NBUA 4FHJA 2WX0A 3ZLZA 1J8CA 1WJ6A 4HJKA 1E8WA 4FULA 4NNJB 3U7DA 4MEMA 2N1WA 4XX5A 2I1KA 3TIXA 2G3QB 4LDTD 3VVWB 3BY4B 2KJ6A 4LCDE 4PS3A 4BVUC 2AWTA 2K8BA 3AULA 4ICUA 2L3ZA 3JYUA 4KSLC 4MGKE 5LXHA 2BYFA 2JUOA 3DVGX 4A3OA 3VFKA 4FLHA 3HM3A 2IY1B 3ECIA 4E71A 4ICVA 4MGZE 2KFKA 1WR1A 3X0WA 2XEWA 3VTWA 4LDTB 3Q3JA 2BYEA 1UBQA 1V9JA 2LGDA 2KANA 4GDLB 2KWCA 4RMAA 3RYTA 2FIFA 3VDZA 4DDID 3OJ4B 2GBRA 2K6QA 2ZNVC 3MTNB 4FBJB 1WJNA 2Z0EB 3DBSA 2LRUA 3AI5A 4I6NB 1T0YA 3R7QA 2C5LC 2NR2A 4CHKA 3RUIB 2BWES 4EZKA 3PZDA 3QHTA 2BF8B 4AP4C 2DZIA 2L76A 4F1SA 1I35A 2JVCA 2KTRB 3A9JA 3RULA 4B6WA 3UIOB 2O2VA 1WIAA 2FCSA 4EKUA 1LXDA 3QIJA 1EO6A 4HWIB 4KV2A 2LRWA 4WJNA 2REXA 3VH3B 1WRDB 2JRIB 3RZWC 3H9DA 1E8YA 1WMHB 2K6DB 2NVUI 3L08A 4I6LB 4TKNA 4ANUA 3SU8X 2YVCA 2ZJDA 1IPGA 2C60A 2JZ3B 1WJ4A 5AZFA 3TCAA 1WX7A 2LGYA 2FCQA 3QA8A 4MDKE 3WAOA 3EFUA 5TR5A 3ZRCA 5HKHA 1IP9A 3M63B 4DHZE 2LVOA 1V81A 2UWQA 3JSVA 4GOCA 3VUYA 1Z2MA 2XK5B 4HDOA 2LVQA 2B3AA 2GOWA 3QAQA 3HIZA 2AYOB 2BWFA 1WXVA 3N32A 1OEYA 2KO3A 2BKRB 4BKTA 3K9OB 2MRPA 1WF9A 4HXDA 4NAWA 1FXTB 4II3B 1UD7A 1WX8A 1YX6B 3A1QB 1E8ZA 3L10B 4M8MA 3OJ3A 5EDSA 1E7UA 3APDA 4WJPA 3M3JA 3VHTC 3CF6E 2M1MA 1IYFA 1WFYA 3U30A 4DHJB 2BGFA 1YQBA 2KMAA 3KW5B 4I6PA 2JPHA 4KZ0A 2CU1A 3P2BA 1WZ3A 2DYMA 2MQJA 3KVFB 2KDIA 3Q3FA 2RGFA 4MGYE 4BFRA 3ZRFA 3V61A 2DZJA 2PE6B 4HCNB 1E90A 3DBLI 2KX3A 1SE9A 3CSFA 2LWPA 1OQYA 4PYUA 4URKA 2DYOA 2XBBC 4PYZA 4M0WB 4GXBA 3B08A 4ZRKA 1WH3A 4MJSB 4MM3A 3SDLC 2DAJA 3KUDB 2KFJA 4KIKA 1WI0A 4W9IA 3DVNV 1WE7A 1LQBA 4F8CB 1WMHA 3A1QA 3IHPC 2KWVB 3ZDTA 1CMXB 1WY8A 4HDQA 3A4RA 4G3XB 3W1SA 2WYQA 4GDLA 2I1JA 2O6VB 3ML9A 1UGMA 2JXXA 2MP2A 4WJQA 3VAWA 3ZVVA 1U4AA 4IUMB 5AEKB 2J0MA 2NPTB 3TJPA 1I42A 1E5WA 5DPTA 2GMIC 2D3GA 1MG8A 5E6PA 5KHQA 2MLBA 2N7DA 2PPHA 2KTFA 2CKHB 3V62A 3PLVA 2ZPNA 4HPMB 2LXAA 1WR6E 4TV3A 2PJHA 4HK2A 2D07B 2KOXA 2C7HA 1Q1OA 2JT4B 2CHXA 3X23A 1K8RB 2N4FA 3UGBB 3VH4B 3MHSD 1E8XA 1WGDA 2C7NB 1EF1A 2KKCA 4XC2A 4ZYNA 1H4RA 2HTHA 4ASWC 1A5RA 2MA9B 2K39A 2J7QB 2L0FA 3PREA 1XQQA 3H7PB 3ZIMA 2KJRA 4B9KA 2MBBB 3KUCB 2CR5A 2PEAA 2K25A 3NOBA 3NZSA 2IYDB 1S3SG 5JHAA 5KHOA 1YJ1A 1VD2A 3RD2A 1G6JA 5IAAC 4LJPB 4A3PA 2N7EA 2IO0B 4NQKE 4W9JA 3V60A 4BBNF 3IBEA 4MSMB 3DOWA 2M8SA 3IFWB 3UINB 2N1VA 4GGQA 4KDLB 3NY5A 1YX5B 1RLFA 3H1UA 4GSWA 1GUAB 4JIOU 1WYWB 2DZKA 2L8JA 2MSED 2ZCCA 5J18A 3VTVA 4FN2A 3VXWA 1WXMA 1ISNA 2J0JA 1H8CA 3CSTA 2MBEA 2ZZPB 3PRZA 3ZDMC 4K7WA 2D2QA 2KMCA 2KN5A 3I3TB 3WAMA 4ANWA 2MBHA 3WANA 2Z0DB 1TTNA 4EEWA 1V5TA 1WGHA 2LVPA 3N30A 4W9DA 4KVGB 1AARA 3ZUNA 3DPDA 4JL9A 1J19A 3VUXA 1GG3A 4IW0A 4TQ1A 2WX1A 3PT2B 3PV1A 2KDEB 4K81A 2IBIB 3M62B 1OTRB 2NCNA 2G4DB 4GB9A 5BO4B 4IC7B 2GBKA 3PHXB 2KC1A 4DHJD 2NPTA 4NJ7A 2IZVB 2DX5B 1SIFA 2KWUB 3JVZX 3QK0A 1V2YA 2V4LA 1OGWA 1P1AA 3IG3A 1P9DU 2FIDA 3PSEB 3M95A 2L7RA 5CHFA 5DCNA 3ZNHB 2KFKB 4FA6A 2O2VB 4WWOA 1QZEA 1WXAA 2K1FA 2LZ6A 3APCA 3EC8A 5DPWA 4ZDVA 5L95C 3L13A 1X1MA 4BOSC 1NBFC 3H6NA 1ZGUB 3NZUA 2LUEA 3A9KA 5LLIA 1EF5A 2A4ZA 4GN1A 2KDFB 4K7UA 5FR6A 3TMPB 4BBNC 3OAWA 4JGHB 2MBQA 2Y5BB 2IO2B 2D11A 5GMVA 1WZ0A 1YD8U 1F9JA 2OJRA 4WJOA 2KK8A 4II2B 1RFAA 1V49A 2MP2B 2ZVOA 2ASQA 2J0KA 4FJZA 3GZNI 5E6OA 4AUQC 1OEYJ 3WAPA 5D94A 2LGXA 2KZRA 2KTRA 3A9JB 1P3QU 2LD9A 2W9NA 4F7ZA 1NI2A 3HM6X 4AJYB 3JSVB 4ANVA 2KLCA 5CHVC 2EMSA 3TBLD 1BT0A 4RM8A 4WQOB 1S1QB 4KZCA 4ANXA 2D10A 2BKFA 3ZKJC 4DK5A 4K1RB 3TL5A 2IO3B 2M17A 4J6IA 5G2NA 2AL3A 2L0TA 3K9PB 1SGHA 2CHWA 1L2NA 3DDCB 3SD5A 2DYBA 1Y8RC 5L83A 1WXSA 2KNBA 4IM2A 4HCPB 4BOZB 3CMMB 2JF5A 3QCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N3K B;  4KDI C;  3ZNZ B;  2N9P C;  1J0G A;  4IWO A;  1PQS A;  4A20 A;  2LAS A;  5E6N A;  4RM9 A;  2MCN B;  5IA7 A;  3AU5 A;  1WGY A;  5D7G A;  3NHE B;  4EFO A;  2RD0 A;  3ZNG C;  3R7R A;  3HK0 A;  4IWQ A;  2DAF A;  2IY0 B;  4FJV B;  1UH6 A;  3O65 B;  3PPA A;  3LDZ E;  3T8M A;  3ZTC A;  2KX0 A;  1C3T A;  2KXJ A;  3L0W B;  4AJW A;  3RT3 B;  1UEL A;  3GOE A;  3RCZ A;  2KHW B;  4IM3 A;  3UQB A;  2M0X A;  1UZX B;  4W9E A;  3DBH I;  5C1Z A;  4YL8 A;  1TZ1 A;  3OLM D;  2FCM A;  3QQ8 B;  4PS8 A;  4W9G A;  4AOF A;  4IWP A;  4P7I A;  1XD3 B;  1KM7 A;  3DVG Y;  1E7V A;  3ML8 A;  3QX1 A;  2ZVN A;  3ZTD A;  2DZM A;  5J17 A;  3NS8 A;  2MX2 A;  2O6V A;  3BIN A;  3WA0 A;  4G11 A;  4HVB A;  2YLM A;  4N9F 4;  3B1L X;  2G4S A;  2FCN A;  3R66 C;  2RSU A;  3ALB A;  1YIW A;  3L54 A;  2A5U A;  2KLG A;  3ZW3 A;  2MBO A;  2QHO A;  1RAX A;  3HHM A;  2V1Y A;  5JHB A;  4W9F A;  4BKG A;  3KYC D;  3EHV A;  3A9K B;  4DDG D;  2NBW B;  2RPQ A;  4OVV A;  3APF A;  3PS6 A;  2BPS A;  4GU2 A;  1LM8 B;  1GC7 A;  1XT9 B;  2DHZ A;  2GBJ A;  4DXA B;  3H7P A;  5AZG A;  5DPR A;  3RZF A;  5C23 A;  2ZNV B;  3V6C B;  1VCB A;  2FUH B;  2C7M B;  3JW0 X;  5D2M B;  4MEL A;  2OOB B;  3KUZ A;  5CTR C;  5JZE B;  1P0R A;  2R2Q A;  4IG7 B;  3WAL A;  4FHK A;  1KJT A;  1JRU A;  2WWZ A;  1LFD A;  4W9H A;  2M4N A;  3PRP B;  3U8Z A;  3UQA A;  1WE6 A;  3PRM B;  3QWZ B;  2NS5 A;  4B95 A;  4MJS A;  3QC8 B;  2HE7 A;  4TUU A;  3ZO5 B;  1V5O A;  3PTF C;  2JWZ A;  1C1Y B;  2MW5 A;  5D6J B;  1V80 A;  2KC2 A;  5CX3 A;  2KQS A;  2MWS B;  4EZJ A;  1ZKH A;  4GIV A;  1L7Y A;  2ZCB A;  4AWJ A;  4MGI E;  3VUW A;  4NY0 A;  4W9K A;  2NBV B;  1GNU A;  3DBR I;  4GMV A;  3DCG A;  4X57 B;  2WDT B;  2AEH A;  4W9C A;  2PE9 A;  1ZW7 A;  2RR9 A;  4FAD A;  4CO7 A;  1GJZ A;  1WGG A;  3PVL A;  4CYE A;  4GDK B;  5J2R A;  4W9L A;  3KYD D;  2XK5 A;  2GBM A;  4OVU A;  2FNJ B;  3MJW A;  4G0N B;  4E3C A;  2BYV E;  2CHZ A;  2JZZ A;  2LXC A;  4HPL B;  2C9W B;  3PGE A;  1HE8 A;  4NJ6 A;  3UF8 A;  3D32 A;  3W1S C;  4EOY A;  1R4M I;  1KOT A;  3AXC A;  1WX9 A;  2GBN A;  3VQI A;  3DVN U;  3ONS A;  2K8H A;  2O6V D;  2Z59 B;  2ZPY A;  4XZ4 A;  1R4N I;  2KQ7 A;  3R3M A;  1TGZ B;  2KVR A;  3UIP B;  2VRR B;  1WM3 A;  4EUT A;  3C0R B;  1V6E A;  3QJZ A;  4BKS D;  4NAW B;  4FJY A;  4DWF A;  1TBE A;  2LI5 A;  3S2A A;  4M8N A;  4NPN A;  1WJU A;  3V6E B;  1GC6 A;  3ENE A;  3IVF A;  4JQW C;  4HLE A;  1M94 A;  4LJO B;  2EMT A;  2UYZ B;  4GDK A;  2V3S A;  5JH5 C;  1KLV A;  4WWP A;  3WIM A;  4E74 A;  2HD5 B;  1EUV B;  3LJ3 A;  3PHW B;  4K7S A;  3SHQ A;  5AZH A;  1NDD A;  1Q5W B;  4DBG A;  4IM0 A;  2DEN B;  1Z5S B;  4JLC A;  2N9X A;  1WGR A;  3A33 B;  4BKS A;  5LXI B;  4DHZ B;  2L05 A;  3AU4 A;  4KIK B;  1V86 A;  4KSK C;  2G45 B;  3EEC A;  2LJ5 A;  2CS4 A;  4MSQ B;  4ZRI A;  3B0A A;  2KDB A;  5CHW A;  1RRB A;  3PLU A;  4PS7 A;  4MH0 E;  4WWN A;  1UBI A;  4G50 A;  5DPS A;  2JRH A;  3KH0 A;  3QAR A;  3A4S C;  3ZNI D;  1WM2 A;  2IO1 B;  4ZRJ A;  3T9L A;  2L00 B;  1Q0W B;  2AL6 A;  4EZL A;  3VTU A;  2FAZ A;  3L16 A;  3L17 A;  2KD0 A;  2ZEQ A;  4WAA A;  1D3Z A;  2KJH B;  3DQV A;  2K8C A;  1P98 A;  2R2O A;  3H7S A;  3W1Y A;  2JY6 A;  2HJ8 A;  2N9E B;  4TQ0 A;  4NQL B;  5G55 A;  2EKE C;  2NBU A;  4FHJ A;  2WX0 A;  3ZLZ A;  1J8C A;  1WJ6 A;  4HJK A;  1E8W A;  4FUL A;  4NNJ B;  3U7D A;  4MEM A;  2N1W A;  4XX5 A;  2I1K A;  3TIX A;  2G3Q B;  4LDT D;  3VVW B;  3BY4 B;  2KJ6 A;  4LCD E;  4PS3 A;  4BVU C;  2AWT A;  2K8B A;  3AUL A;  4ICU A;  2L3Z A;  3JYU A;  4KSL C;  4MGK E;  5LXH A;  2BYF A;  2JUO A;  3DVG X;  4A3O A;  3VFK A;  4FLH A;  3HM3 A;  2IY1 B;  3ECI A;  4E71 A;  4ICV A;  4MGZ E;  2KFK A;  1WR1 A;  3X0W A;  2XEW A;  3VTW A;  4LDT B;  3Q3J A;  2BYE A;  1UBQ A;  1V9J A;  2LGD A;  2KAN A;  4GDL B;  2KWC A;  4RMA A;  3RYT A;  2FIF A;  3VDZ A;  4DDI D;  3OJ4 B;  2GBR A;  2K6Q A;  2ZNV C;  3MTN B;  4FBJ B;  1WJN A;  2Z0E B;  3DBS A;  2LRU A;  3AI5 A;  4I6N B;  1T0Y A;  3R7Q A;  2C5L C;  2NR2 A;  4CHK A;  3RUI B;  2BWE S;  4EZK A;  3PZD A;  3QHT A;  2BF8 B;  4AP4 C;  2DZI A;  2L76 A;  4F1S A;  1I35 A;  2JVC A;  2KTR B;  3A9J A;  3RUL A;  4B6W A;  3UIO B;  2O2V A;  1WIA A;  2FCS A;  4EKU A;  1LXD A;  3QIJ A;  1EO6 A;  4HWI B;  4KV2 A;  2LRW A;  4WJN A;  2REX A;  3VH3 B;  1WRD B;  2JRI B;  3RZW C;  3H9D A;  1E8Y A;  1WMH B;  2K6D B;  2NVU I;  3L08 A;  4I6L B;  4TKN A;  4ANU A;  3SU8 X;  2YVC A;  2ZJD A;  1IPG A;  2C60 A;  2JZ3 B;  1WJ4 A;  5AZF A;  3TCA A;  1WX7 A;  2LGY A;  2FCQ A;  3QA8 A;  4MDK E;  3WAO A;  3EFU A;  5TR5 A;  3ZRC A;  5HKH A;  1IP9 A;  3M63 B;  4DHZ E;  2LVO A;  1V81 A;  2UWQ A;  3JSV A;  4GOC A;  3VUY A;  1Z2M A;  2XK5 B;  4HDO A;  2LVQ A;  2B3A A;  2GOW A;  3QAQ A;  3HIZ A;  2AYO B;  2BWF A;  1WXV A;  3N32 A;  1OEY A;  2KO3 A;  2BKR B;  4BKT A;  3K9O B;  2MRP A;  1WF9 A;  4HXD A;  4NAW A;  1FXT B;  4II3 B;  1UD7 A;  1WX8 A;  1YX6 B;  3A1Q B;  1E8Z A;  3L10 B;  4M8M A;  3OJ3 A;  5EDS A;  1E7U A;  3APD A;  4WJP A;  3M3J A;  3VHT C;  3CF6 E;  2M1M A;  1IYF A;  1WFY A;  3U30 A;  4DHJ B;  2BGF A;  1YQB A;  2KMA A;  3KW5 B;  4I6P A;  2JPH A;  4KZ0 A;  2CU1 A;  3P2B A;  1WZ3 A;  2DYM A;  2MQJ A;  3KVF B;  2KDI A;  3Q3F A;  2RGF A;  4MGY E;  4BFR A;  3ZRF A;  3V61 A;  2DZJ A;  2PE6 B;  4HCN B;  1E90 A;  3DBL I;  2KX3 A;  1SE9 A;  3CSF A;  2LWP A;  1OQY A;  4PYU A;  4URK A;  2DYO A;  2XBB C;  4PYZ A;  4M0W B;  4GXB A;  3B08 A;  4ZRK A;  1WH3 A;  4MJS B;  4MM3 A;  3SDL C;  2DAJ A;  3KUD B;  2KFJ A;  4KIK A;  1WI0 A;  4W9I A;  3DVN V;  1WE7 A;  1LQB A;  4F8C B;  1WMH A;  3A1Q A;  3IHP C;  2KWV B;  3ZDT A;  1CMX B;  1WY8 A;  4HDQ A;  3A4R A;  4G3X B;  3W1S A;  2WYQ A;  4GDL A;  2I1J A;  2O6V B;  3ML9 A;  1UGM A;  2JXX A;  2MP2 A;  4WJQ A;  3VAW A;  3ZVV A;  1U4A A;  4IUM B;  5AEK B;  2J0M A;  2NPT B;  3TJP A;  1I42 A;  1E5W A;  5DPT A;  2GMI C;  2D3G A;  1MG8 A;  5E6P A;  5KHQ A;  2MLB A;  2N7D A;  2PPH A;  2KTF A;  2CKH B;  3V62 A;  3PLV A;  2ZPN A;  4HPM B;  2LXA A;  1WR6 E;  4TV3 A;  2PJH A;  4HK2 A;  2D07 B;  2KOX A;  2C7H A;  1Q1O A;  2JT4 B;  2CHX A;  3X23 A;  1K8R B;  2N4F A;  3UGB B;  3VH4 B;  3MHS D;  1E8X A;  1WGD A;  2C7N B;  1EF1 A;  2KKC A;  4XC2 A;  4ZYN A;  1H4R A;  2HTH A;  4ASW C;  1A5R A;  2MA9 B;  2K39 A;  2J7Q B;  2L0F A;  3PRE A;  1XQQ A;  3H7P B;  3ZIM A;  2KJR A;  4B9K A;  2MBB B;  3KUC B;  2CR5 A;  2PEA A;  2K25 A;  3NOB A;  3NZS A;  2IYD B;  1S3S G;  5JHA A;  5KHO A;  1YJ1 A;  1VD2 A;  3RD2 A;  1G6J A;  5IAA C;  4LJP B;  4A3P A;  2N7E A;  2IO0 B;  4NQK E;  4W9J A;  3V60 A;  4BBN F;  3IBE A;  4MSM B;  3DOW A;  2M8S A;  3IFW B;  3UIN B;  2N1V A;  4GGQ A;  4KDL B;  3NY5 A;  1YX5 B;  1RLF A;  3H1U A;  4GSW A;  1GUA B;  4JIO U;  1WYW B;  2DZK A;  2L8J A;  2MSE D;  2ZCC A;  5J18 A;  3VTV A;  4FN2 A;  3VXW A;  1WXM A;  1ISN A;  2J0J A;  1H8C A;  3CST A;  2MBE A;  2ZZP B;  3PRZ A;  3ZDM C;  4K7W A;  2D2Q A;  2KMC A;  2KN5 A;  3I3T B;  3WAM A;  4ANW A;  2MBH A;  3WAN A;  2Z0D B;  1TTN A;  4EEW A;  1V5T A;  1WGH A;  2LVP A;  3N30 A;  4W9D A;  4KVG B;  1AAR A;  3ZUN A;  3DPD A;  4JL9 A;  1J19 A;  3VUX A;  1GG3 A;  4IW0 A;  4TQ1 A;  2WX1 A;  3PT2 B;  3PV1 A;  2KDE B;  4K81 A;  2IBI B;  3M62 B;  1OTR B;  2NCN A;  2G4D B;  4GB9 A;  5BO4 B;  4IC7 B;  2GBK A;  3PHX B;  2KC1 A;  4DHJ D;  2NPT A;  4NJ7 A;  2IZV B;  2DX5 B;  1SIF A;  2KWU B;  3JVZ X;  3QK0 A;  1V2Y A;  2V4L A;  1OGW A;  1P1A A;  3IG3 A;  1P9D U;  2FID A;  3PSE B;  3M95 A;  2L7R A;  5CHF A;  5DCN A;  3ZNH B;  2KFK B;  4FA6 A;  2O2V B;  4WWO A;  1QZE A;  1WXA A;  2K1F A;  2LZ6 A;  3APC A;  3EC8 A;  5DPW A;  4ZDV A;  5L95 C;  3L13 A;  1X1M A;  4BOS C;  1NBF C;  3H6N A;  1ZGU B;  3NZU A;  2LUE A;  3A9K A;  5LLI A;  1EF5 A;  2A4Z A;  4GN1 A;  2KDF B;  4K7U A;  5FR6 A;  3TMP B;  4BBN C;  3OAW A;  4JGH B;  2MBQ A;  2Y5B B;  2IO2 B;  2D11 A;  5GMV A;  1WZ0 A;  1YD8 U;  1F9J A;  2OJR A;  4WJO A;  2KK8 A;  4II2 B;  1RFA A;  1V49 A;  2MP2 B;  2ZVO A;  2ASQ A;  2J0K A;  4FJZ A;  3GZN I;  5E6O A;  4AUQ C;  1OEY J;  3WAP A;  5D94 A;  2LGX A;  2KZR A;  2KTR A;  3A9J B;  1P3Q U;  2LD9 A;  2W9N A;  4F7Z A;  1NI2 A;  3HM6 X;  4AJY B;  3JSV B;  4ANV A;  2KLC A;  5CHV C;  2EMS A;  3TBL D;  1BT0 A;  4RM8 A;  4WQO B;  1S1Q B;  4KZC A;  4ANX A;  2D10 A;  2BKF A;  3ZKJ C;  4DK5 A;  4K1R B;  3TL5 A;  2IO3 B;  2M17 A;  4J6I A;  5G2N A;  2AL3 A;  2L0T A;  3K9P B;  1SGH A;  2CHW A;  1L2N A;  3DDC B;  3SD5 A;  2DYB A;  1Y8R C;  5L83 A;  1WXS A;  2KNB A;  4IM2 A;  4HCP B;  4BOZ B;  3CMM B;  2JF5 A;  3QCA A; 
#chains in the Genus database with same CATH topology
 4LNK A;  2N9P C;  1MPE A;  4A20 A;  1K50 A;  5E6N A;  2V3P A;  5IA7 A;  3AU5 A;  3U2S C;  3RFZ B;  3R7R A;  4ZOH C;  2DAF A;  2WHI A;  2NTS A;  2IJ0 A;  4AS1 A;  1JWB D;  1DGJ A;  3L0W B;  4L23 A;  1KH0 A;  1RWS A;  1FIQ A;  4W9E A;  2N7J A;  3IAM 1;  4YL8 A;  1P7F A;  2FCM A;  4W9G A;  4XGA B;  1XD3 B;  1E7V A;  4KGT A;  2ZVN A;  5FKA C;  3ZTD A;  1QOG A;  3NS8 A;  4YTN B;  2WXI A;  3ZW3 A;  1C77 A;  3HHM A;  2V1Y A;  2NTT A;  3VRB B;  3EHV A;  2NBW B;  4HJG E;  4OZC A;  2WXH A;  4OVV A;  2GBJ A;  3RZF A;  1KFY B;  3V3X A;  2X38 A;  5EE9 A;  4MEL A;  3KUZ A;  5BYQ A;  2XNA C;  4L2Y A;  4RCO A;  2WWZ A;  3QWZ B;  4B95 A;  2BB6 A;  4MJS A;  2QEJ C;  4TUU A;  1AWD A;  2MW5 A;  5D6J B;  4US8 A;  5CX3 A;  3NS1 A;  1FFV A;  1ZKH A;  4AWJ A;  3Q69 A;  4FXC A;  3AEC B;  4BZA A;  2RR9 A;  4CO7 A;  3ETR A;  2PVO D;  3Q2A C;  4YXD B;  1QLB B;  2PMV A;  4GDK B;  3KYD D;  1C4C A;  3MJW A;  2BYV E;  2BS2 B;  2JZZ A;  3DWM A;  3W1S C;  2BB5 A;  3IAS 1;  3ZGZ A;  2GBN A;  3DVN U;  2K8H A;  2Z59 B;  4XZ4 A;  2ZPY A;  4K3B A;  4KGS A;  1TGZ B;  1V6E A;  1N6Z A;  4FJY A;  2LI5 A;  3S2A A;  3V6E B;  3IVF A;  2JQR B;  1TKY A;  4LJO B;  2EMT A;  4GDK A;  2WP9 B;  1E7P B;  1KLV A;  3O13 A;  1MI0 A;  1EUV B;  1Q5W B;  4DBG A;  4XWW A;  2KWD A;  3A33 B;  4BKS A;  2L05 A;  1TS2 A;  2AX5 A;  3TEZ A;  2D3A A;  3MHZ A;  2MJE A;  3PLU A;  3HVZ A;  2BVC A;  1UBI A;  1JRO A;  4R3D A;  3QAR A;  2UU7 A;  3ZJT A;  1DOY A;  4EZL A;  2AL6 A;  3RNB C;  1D3Z A;  1P98 A;  1SEB D;  4NQL B;  3ZLZ A;  1E8W A;  4FUL A;  1BML C;  4MEM A;  2N1W A;  2DLB A;  2I1K A;  1I4P A;  2G3Q B;  3BY4 B;  2KAC A;  3PZ8 A;  2K8B A;  3AH7 A;  4ICU A;  4A8X C;  4M00 A;  3JYU A;  4KSL C;  4MGK E;  3DVG X;  3BYT B;  4ICV A;  4MGZ E;  3X0W A;  1UBQ A;  2KAN A;  4RMA A;  3RPF C;  2K6Q A;  2OHF A;  4FBJ B;  1WJN A;  2LRU A;  3AI5 A;  4I6N B;  2LGI A;  1A70 A;  2C5L C;  4IDI A;  3RUI B;  3PZD A;  3AN1 A;  4F1S A;  1SSN A;  4A9A A;  3URY A;  3T3O A;  2LHE A;  1HXY D;  1WYG A;  3Q8B A;  3QIJ A;  1EO6 A;  2QIL A;  4HWI B;  3Q8A A;  4KV2 A;  2REX A;  1WRD B;  1WSP A;  3RZW C;  1B9R A;  1E8Y A;  2ZJD A;  1IPG A;  2C60 A;  2G1E A;  1KLU D;  4MDK E;  4LTU A;  1FXA A;  5AUK A;  2VZK D;  1HZ5 A;  3JSV A;  3VUY A;  1I4G A;  3QAQ A;  3U52 E;  3BII D;  2BKR B;  3Q8C A;  4BKT A;  4MAC A;  1YX6 B;  2L83 A;  3MC0 B;  4WWM A;  1N5X A;  3OJ3 A;  1HTO A;  1P7E A;  4JX1 C;  3CF6 E;  3L4P A;  1QKZ A;  1HTQ A;  2IND C;  4DHJ B;  2KMA A;  4KZ0 A;  1D6E C;  1XEE A;  3P2B A;  2DYM A;  5IKC M;  3KVF B;  2JXT A;  2RGF A;  4MGY E;  1ZPS A;  4JPS A;  1E90 A;  2KX3 A;  1SE9 A;  2WXF A;  1OQY A;  4PYU A;  2INN E;  2WXM A;  4MJS B;  1VRA B;  2DAJ A;  3TEW A;  1MHX A;  4YSZ B;  1K51 A;  2L32 A;  4H2A A;  1LQB A;  2WXK A;  4F8C B;  5LNK 1;  3IHP C;  2M0A A;  2KWV B;  3BVM A;  1D5M C;  3W1S A;  2WYQ A;  3ZVV A;  2JXX A;  3VAW A;  1U4A A;  1DOX A;  1I42 A;  2IGG A;  4USA A;  5E6P A;  5KHQ A;  2MLB A;  2PPH A;  1F2R C;  3V62 A;  4OZA A;  2ZW0 A;  2MH7 A;  4HK2 A;  1L0V B;  3C19 A;  3VH4 B;  2C7N B;  5FR3 A;  1H4R A;  1LO5 D;  1A5R A;  1YNT E;  5GXG B;  3PRE A;  2LMC A;  2KJR A;  4D2K A;  1YJ1 A;  4LJP B;  1QQR A;  4NQK E;  3DOW A;  5HG2 A;  4PK1 A;  2M8S A;  4GGQ A;  1I4R A;  1EU3 A;  5BYS A;  2DZK A;  2GI9 A;  3VXW A;  1WXM A;  1ISN A;  1H8C A;  2MBE A;  2ZZP B;  4ARI A;  1JQ4 A;  3GE8 C;  3WAM A;  4ANW A;  2MBH A;  3WAN A;  4W9D A;  3ZUN A;  3DPD A;  4IW0 A;  4US9 A;  1D5Z C;  1WXQ A;  3PV1 A;  4XWT A;  2KDE B;  2IBI B;  2MHJ A;  5BO4 B;  2GBK A;  1FXI A;  1C4P A;  1VZ8 A;  3NRZ A;  1T6B X;  3JVZ X;  2DWQ A;  2V4L A;  2SAK A;  1JWM D;  1P1A A;  3ZJV A;  5IO9 A;  2BW2 A;  5CHF A;  4FA6 A;  2O2V B;  4YSY B;  2BT6 A;  2LZ6 A;  3APC A;  3L13 A;  1X1M A;  1I4H A;  4BOS C;  1NBF C;  3H6N A;  3BWU D;  2KDF B;  4BBN C;  3OAW A;  2TSS A;  1WZ0 A;  4WJO A;  3KLS X;  1GB4 A;  4II2 B;  3Q14 C;  3RI7 C;  2E6X A;  2RDG A;  5E6O A;  4AUQ C;  1P3Q U;  2LD9 A;  2W9N A;  1NI3 A;  2EMS A;  4C4V A;  4WQO B;  3ZKJ C;  2MJD A;  3R8B A;  1SGH A;  5D3D A;  1ZDV A;  2DYB A;  3BYY B;  4HEA 1;  1JAL A;  1WXS A;  2KNB A;  4IM2 A;  4HCP B;  1FCL A;  2PIA A;  1QOB A;  3ZNZ B;  3AE2 B;  1D4B A;  5IP4 D;  1J7A A;  1YMH E;  4ZHP A;  4BAX A;  2V9H A;  2WXG A;  4FJV B;  1UF0 A;  1MHH E;  3ZTC A;  4WAF A;  2W3R A;  3AED B;  4RGM A;  3AEG B;  1F0Z A;  2KHW B;  4YT0 B;  4PS8 A;  4YTM B;  1DYQ A;  3DVG Y;  1IUE A;  1KRH A;  2KN4 A;  3ML8 A;  1YOV B;  1L0X B;  4C56 C;  2O6V A;  2Q5W D;  3WA0 A;  4G11 A;  4N9F 4;  1TZO A;  2GB1 A;  3R66 C;  3ALB A;  3L54 A;  2A5U A;  1F77 A;  2MBO A;  4W9F A;  3U7Z A;  4C7Z A;  2IGD A;  2RPQ A;  3P63 A;  2QIE B;  2WNM A;  1LM8 B;  1GC7 A;  1XT9 B;  2DHZ A;  2INC C;  3H7P A;  3E56 A;  2R61 A;  3BK2 A;  5AZG A;  5C23 A;  3V6C B;  3W5U B;  4A6Q A;  1YN3 A;  1VCB A;  2C7M B;  1FD6 A;  4IG7 B;  4FHK A;  3U8Z A;  2BQQ A;  1WE6 A;  1NYQ A;  2NS5 A;  2L1A A;  1SE3 A;  3ZO5 B;  1ET9 A;  1T5X D;  2I2Y A;  2KC2 A;  1FNV A;  4EZJ A;  1L7Y A;  2MJ3 A;  4MGI E;  3DBR I;  3DCG A;  1JWS D;  4X57 B;  2VH1 A;  2WDQ B;  1GJZ A;  3E9S A;  3PVL A;  4N58 A;  3FKY A;  4E3C A;  2LXC A;  4HPL B;  2FUG 1;  4RFB A;  1I7H A;  4EOY A;  3TSS A;  1WX9 A;  2W54 A;  1R4N I;  5MPO A;  1C79 A;  1EWC A;  3R3M A;  2KVR A;  4WQM A;  3UIP B;  1F52 A;  2D5G A;  1WJU A;  1VDV A;  4P1B C;  2M56 B;  2AQ3 B;  3P1M A;  2V0G A;  2WU2 B;  2BYT A;  3W5V B;  2M19 A;  3WIM A;  1JW9 D;  3LJ3 A;  3RNF C;  1NDD A;  2W3S A;  4IM0 A;  2N9X A;  4HRS A;  3OWE B;  4KIK B;  3GS2 A;  2G45 B;  2IGH A;  4RGO S;  1L4D B;  3B0A A;  1Y56 A;  2B76 B;  4MH0 E;  4S0R A;  3KH0 A;  1WM2 A;  2IO1 B;  2ZW1 A;  1Q0W B;  2WXN A;  3L16 A;  1UNS A;  3L17 A;  2KD0 A;  2WS3 B;  4WAA A;  5C2T B;  3W1Y A;  2N9E B;  4TQ0 A;  4TMA B;  4OZB A;  2EKE C;  5G55 A;  1J8C A;  3EGR A;  3Q3N C;  3ABV B;  3TIX A;  4NZL B;  2KJ6 A;  4PS3 A;  1UUP A;  2AWT A;  4RF0 A;  2L3Z A;  3NUH B;  2BS4 B;  4A3O A;  2IY1 B;  4A90 A;  4E71 A;  1AYF A;  3Q3J A;  4GDL B;  2FIF A;  3OJ4 B;  2GBR A;  1FPY A;  3MTN B;  3P4R B;  1T0Y A;  1I35 A;  2JVC A;  3U4E G;  1JWA D;  2JRI B;  2K6D B;  4I6L B;  3SU8 X;  4WH4 A;  3BVG A;  3TEX A;  1WJ4 A;  1E0Z A;  1WX7 A;  1HZ6 A;  2FCQ A;  3ZRC A;  3KWV A;  2UWQ A;  4WUR A;  3EA6 A;  1Z2M A;  4OW0 A;  2XK5 B;  3AE8 B;  2AYO B;  1FRD A;  1JRP A;  1PYW D;  3IXS A;  1WF9 A;  4HXD A;  4II3 B;  3A1Q B;  1E8Z A;  3IT6 B;  4JWS C;  4XDD A;  3RNA C;  3APD A;  1K53 A;  3U30 A;  1YQB A;  2KT7 A;  4I6P A;  4XYC A;  4AQ7 A;  2CU1 A;  2MQJ A;  3Q3F A;  3ZRF A;  4ITK A;  2PE6 B;  4HCN B;  3DBL I;  3RMK C;  2N9K A;  3CSF A;  1CJE A;  1AN8 A;  2DYO A;  3B08 A;  4MM3 A;  1SJH D;  2E3T A;  4ZYS A;  1FO4 A;  3AE4 B;  4KIK A;  3I57 A;  1WE7 A;  1IGC A;  1WMH A;  2YEP F;  3A4R A;  1XLN A;  2MP2 A;  2HTM E;  1CZP A;  1E5W A;  2D3G A;  2KTF A;  3SEB A;  2LJI A;  1ZDX A;  3PLV A;  4HPM B;  2BS3 B;  2LXA A;  2CHX A;  1QIL A;  2N4F A;  1N5W A;  3UGB B;  2WXO A;  1WGD A;  1EF1 A;  1TJE A;  2J4X A;  4ASW C;  2HTH A;  2MA9 B;  2K39 A;  2L0F A;  1XQQ A;  3ZIM A;  4B9K A;  2MBB B;  1N62 A;  1L6U A;  5JHA A;  3NOB A;  1S3S G;  1VD2 A;  1T0Q C;  2PTL A;  3RD2 A;  2LUM A;  5IAA C;  5H8Y E;  4A3P A;  2N7E A;  3V60 A;  4BBN F;  2J52 A;  4OHJ A;  3IFW B;  2N1V A;  4C4V B;  1XLP A;  1YX5 B;  3MP9 A;  1RLF A;  3H1U A;  4GSW A;  5EE0 A;  1EM7 A;  1QOF A;  1HEZ E;  1WYW B;  5J18 A;  4WIP A;  4LNI A;  4K7W A;  2D2Q A;  3I3T B;  2Z0D B;  1MG4 A;  5IOI A;  1GG3 A;  2JZP A;  4TQ1 A;  4TSS A;  4K81 A;  3MC9 A;  1OTR B;  1T0R C;  2G4D B;  3RNE C;  3PHX B;  3KQ4 A;  4DHJ D;  5C3J B;  1SIF A;  2KWU B;  3QK0 A;  2BTE A;  5T8I A;  4HKQ A;  3P4S B;  1GOZ A;  3DBL B;  2W82 A;  3M95 A;  3N1Z C;  5DCN A;  1QZE A;  1WXA A;  3R2I A;  2GLS A;  3CIR B;  3A9K A;  5LLI A;  4GN1 A;  4K7U A;  2KMM A;  4JGH B;  2MBQ A;  1YD8 U;  1F9J A;  2OJR A;  1SB3 C;  2ONQ A;  2KK8 A;  1V49 A;  2ZVO A;  2ASQ A;  3Q8E A;  3MFG A;  3MJ5 A;  3I9V 1;  5BYR A;  3IT4 B;  4ANV A;  5CHV C;  3TBL D;  2I38 A;  1BT0 A;  1YQ4 B;  4ANX A;  2BKF A;  4DK5 A;  2IO3 B;  5G2N A;  1FFU A;  2AL3 A;  3K9P B;  3SD5 A;  4A55 A;  3ZJU A;  1FRR A;  2BBC A;  2AQ1 B;  3RN9 C;  2FBW B;  2JF5 A;  3N3K B;  4KDI C;  1NVI D;  3WCQ A;  1J0G A;  4IWO A;  1PQS A;  2MCN B;  1L0Y B;  1WGY A;  5D7G A;  4YTP B;  3ZNG C;  1R4M B;  3LB8 C;  3HK0 A;  4IWQ A;  2IY0 B;  3GE3 C;  2RMM A;  3O65 B;  1V1O A;  3PPA A;  3LDZ E;  1C3T A;  1PGA A;  2KXJ A;  2JYE A;  3GOE A;  3HUI A;  3RCZ A;  3UQB A;  1UZX B;  3DBH I;  3OLM D;  3QQ8 B;  3AEA B;  4AOF A;  4IWP A;  3QX1 A;  3N1Y C;  2G9H D;  2MX2 A;  2YLM A;  2WDR B;  1SIJ A;  3B1L X;  2FCN A;  3W2D A;  1NEK B;  4MM3 B;  5JHB A;  1RAX A;  4K3C A;  3KYC D;  4DDG D;  3APF A;  1NEN B;  1ENF A;  4IOI E;  2QDF A;  2ZNV B;  3JW0 X;  1JCK B;  5D2M B;  2WLB A;  4PT5 A;  2OOB B;  5JZE B;  1P0R A;  2R2Q A;  4MH8 A;  3WAL A;  1I4X A;  2KDM A;  3I5J C;  1JRU A;  1LFD A;  4C80 A;  1V5O A;  2JWZ A;  2KQS A;  4GIV A;  3NVZ A;  4NY0 A;  4W9K A;  2NBV B;  2WU5 B;  5G5G A;  1KF6 B;  3AEE B;  1PGB A;  2AEH A;  4W9C A;  2PE9 A;  1ZW7 A;  4FAD A;  1WGG A;  1ZXI A;  4W9L A;  2XK5 A;  5HFY A;  2GBM A;  4OVU A;  5BMI A;  4G0N B;  3RNC C;  3AM9 A;  1HE8 A;  4KKI A;  1R4M I;  1QF6 A;  2PKO A;  3ZXV A;  3AMZ A;  2KQ7 A;  2L52 A;  2VRR B;  1WM3 A;  3QJZ A;  4BKS D;  4DWF A;  4HKZ E;  2QC8 A;  4NPN A;  3B2F A;  1GC6 A;  3AE7 B;  3ENE A;  4JQW C;  4HLE A;  1M94 A;  1ZOY B;  2UYZ B;  4ARC A;  3PHW B;  4M0W A;  3SHQ A;  2DEN B;  3LXF A;  1Z5S B;  1JML A;  4JLC A;  1KTK A;  1WGR A;  4LLG M;  1V86 A;  4ZRI A;  2KDB A;  5CHW A;  5E6J A;  4PS7 A;  1FNW A;  5FK9 C;  3A4S C;  3ZNI D;  2LHD A;  5JXV A;  3VTU A;  3DQV A;  2K8C A;  2R2O A;  2HJ8 A;  2NBU A;  2EEL A;  2WX0 A;  3AEB B;  5I4D A;  4NNJ B;  3U7D A;  2Y5P A;  4LDT D;  2ICI A;  4LCD E;  4XE0 A;  3VR8 B;  1ZUD 2;  1VLB A;  2BYF A;  2JUO A;  3GZN B;  3VFK A;  1TY2 A;  2FE8 A;  2ACZ B;  2KFK A;  2WXP A;  3VTW A;  3DHG C;  2BYE A;  2D3B A;  2LGD A;  3SR6 A;  2KWC A;  3RYT A;  1V1P B;  2Z0E B;  2NR2 A;  4EZK A;  3QHT A;  2BF8 B;  2DZI A;  4J3O D;  3A9J A;  4B6W A;  3UIO B;  1M4V A;  2O2V A;  1WIA A;  2FCS A;  1MVK A;  4ZRP A;  2LRW A;  3VH3 B;  3I63 C;  1WMH B;  3L08 A;  1QOA A;  5AZF A;  3TCA A;  1KLG D;  1V1P A;  5HKH A;  3EFU A;  1V81 A;  3EUB 2;  2JU6 X;  4HDO A;  2LVQ A;  1T3Q A;  2GOW A;  3SFE B;  1WXV A;  1OEY A;  1QT9 A;  2MRP A;  1XCQ L;  4NAW A;  1HA5 A;  1UD7 A;  1WX8 A;  3L10 B;  1MJD A;  4B0E A;  2JX5 A;  3AB5 A;  1E7U A;  2M1M A;  1IYF A;  1ZXH A;  2JPH A;  1YN5 A;  3NJT A;  2KDI A;  1JWU D;  3KWL A;  1L6V A;  1UWX A;  2SEB D;  4JE3 B;  2LWP A;  4PYZ A;  4M0W B;  2JSV X;  1WH3 A;  3KUD B;  3UI3 A;  5AUI A;  3DVN V;  4Q2J A;  3A1Q A;  2LEK A;  3ZDT A;  4DXG A;  1CMX B;  4UDU C;  1WY8 A;  3ZYY X;  1ET6 A;  4GDL A;  2O6V B;  2DNF A;  1CQV A;  2J42 A;  3GB1 A;  2GMI C;  3DHI C;  1MG8 A;  3ZXR A;  2N7D A;  1RM6 C;  1CK1 A;  2ZPN A;  4N59 A;  2PJH A;  2D07 B;  2KOX A;  2C7H A;  2DBY A;  5BMH A;  1K8R B;  3MHS D;  1C4A A;  4XC2 A;  4ZYN A;  1UWM A;  4N6E B;  1ACC A;  3H7P B;  3GP7 A;  3KUC B;  1T0S C;  2CR5 A;  2PEA A;  2VH2 A;  2K0P A;  5KHO A;  2KVZ A;  5TSS A;  2IO0 B;  4W9J A;  4IKG A;  1NYR A;  2W55 A;  2X8X X;  5D3I B;  4KDL B;  3AV8 A;  2Y3A A;  3NVY A;  3HVD A;  1FM0 D;  3AE3 B;  1GUA B;  4KX6 B;  2L8J A;  2ZCC A;  3VTV A;  4FN2 A;  3CST A;  1R7S A;  3PRZ A;  3ZDM C;  2KMC A;  3J9C A;  1WGH A;  4KVG B;  2Z8L A;  4JL9 A;  1RYJ A;  3VUX A;  1YQ3 B;  2K3U A;  4IC7 B;  1EU4 A;  2NPT A;  4NJ7 A;  1V97 A;  2IZV B;  2DX5 B;  2QMT A;  3R2T A;  4S17 A;  1OGW A;  2WXQ A;  3SFD B;  2RDH A;  2QCZ A;  2L7R A;  3ZNH B;  2KFK B;  4WWO A;  3EC8 A;  3FIL B;  4OVZ A;  1K52 A;  1J7B A;  1TKE A;  1TS3 A;  2D11 A;  1RFA A;  1OQQ A;  1IGD A;  4FJZ A;  3WAP A;  5D94 A;  5G5H A;  1STE A;  2KZR A;  3A9J B;  1NI2 A;  3NVW A;  3JSV B;  1SE2 A;  2KLC A;  4RM8 A;  1XLQ A;  2D10 A;  3TL5 A;  1C9F A;  1TYG B;  1L2N A;  1PDX A;  1Y8R C;  5L83 A;  3CMM B;  3W9C B;  3P4P B;  2LAS A;  4RM9 A;  4EFO A;  3NHE B;  2RD0 A;  4MT5 A;  2H89 B;  1XO3 A;  2PVG C;  1UH6 A;  3AEF B;  3T8M A;  2KX0 A;  1PUT A;  4RGN A;  3AE9 B;  4O1N A;  4AJW A;  1BUI C;  4DXF A;  3RT3 B;  1UEL A;  4IM3 A;  2M0X A;  4KKJ A;  5C1Z A;  3ZQ4 A;  1TZ1 A;  1J7C A;  4P7I A;  1KM7 A;  2HDE A;  2J53 A;  1VZ6 A;  2DZM A;  5J17 A;  2NMQ A;  1BXT A;  3BIN A;  4HVB A;  2JWU A;  4ZHO A;  2G4S A;  2INP E;  1TIF A;  5EE1 A;  2RSU A;  1YIW A;  2N0S B;  2IDY A;  2KLG A;  2QHO A;  4BKG A;  4QAY A;  5H92 C;  4HPP A;  3A9K B;  3PS6 A;  2BPS A;  4GU2 A;  3OG5 A;  4DXA B;  1TS5 A;  2CJN A;  5DPR A;  3RNG C;  1N63 A;  2FUH B;  1SE4 A;  2KAJ A;  2YEP B;  2QJL A;  4YWG G;  5CTR C;  1KJT A;  4W9H A;  2M4N A;  2CU3 A;  3PRP B;  3UQA A;  2PW9 A;  3PRM B;  2D3C A;  2H88 B;  1YJI A;  2HE7 A;  3QC8 B;  3PTF C;  1GPX A;  1C1Y B;  1V80 A;  2WDV B;  2MWS B;  2IPK D;  2ZCB A;  3VUW A;  1FCC C;  1GNU A;  3H8H A;  4GMV A;  4C00 A;  1FMA D;  2WDT B;  1DOI A;  1LGR A;  4CYE A;  2N9L A;  3PO0 A;  3Q3M C;  5J2R A;  2FNJ B;  1XF5 L;  2CHZ A;  3NVV A;  1I4Q A;  4NJC A;  2C9W B;  2OED A;  3PGE A;  4NJ6 A;  3UF8 A;  3D32 A;  1KOT A;  3AXC A;  3VQI A;  1TY0 A;  3AE5 B;  3ONS A;  2O6V D;  1SF0 A;  3N20 C;  1ROE A;  4EUT A;  3C0R B;  4NAW B;  3DWG C;  1TBE A;  2HJ1 A;  4JWU C;  4KGR A;  4M8N A;  3Q8F A;  1XCT L;  1C76 A;  1UGJ A;  2V3S A;  5JH5 C;  4WWP A;  2MEK A;  4LNN A;  3V05 A;  2HD5 B;  4E74 A;  4K7S A;  4HRO A;  5AZH A;  2WQY B;  5LXI B;  4LK0 M;  4RNA A;  4DHZ B;  3AU4 A;  1YJJ A;  4KSK C;  5HI1 A;  3EEC A;  2LJ5 A;  1TS4 A;  2CS4 A;  4MSQ B;  1TKG A;  3FIL A;  1AW7 A;  1RRB A;  4XDC A;  4WWN A;  4G50 A;  5DPS A;  2JRH A;  4C7Y A;  3B2G A;  4ZRJ A;  3T9L A;  2L00 B;  5BMG A;  2FAZ A;  5EE3 A;  2ZEQ A;  3VRA B;  1GAQ B;  2KJH B;  1PFD A;  3H7S A;  1Q10 A;  4REZ A;  2JY6 A;  4FHJ A;  1OFF A;  3B9J A;  1WJ6 A;  4HJK A;  1EWY C;  1IBX B;  4XX5 A;  2RDB C;  3VVW B;  3N9Y C;  4BVU C;  3AUL A;  2JYT A;  5LXH A;  4FLH A;  3HM3 A;  1ZP0 B;  3ECI A;  3VR9 B;  3PZ7 A;  1WR1 A;  2XEW A;  4NAM A;  4LDT B;  4YSX B;  1V9J A;  1N60 A;  3VDZ A;  1E10 A;  4DDI D;  3DHH C;  2PLP A;  2ZNV C;  3DBS A;  2V3N A;  3R7Q A;  1L4Z B;  2LFI A;  4CHK A;  2BWE S;  1IBX A;  2WGS A;  4AP4 C;  2L76 A;  3BK1 A;  4EE2 A;  2ON8 A;  4ZRQ A;  1SJE D;  2KTR B;  3RUL A;  3FC4 A;  4EKU A;  1LXD A;  2VZK B;  4LNO A;  3EFC A;  3TEY A;  4WJN A;  2WXL A;  2OJW A;  3H9D A;  2NVU I;  2KYW A;  4TKN A;  4ANU A;  2YVC A;  1V8C A;  2JZ3 B;  2LGY A;  3QA8 A;  3WAO A;  1IP9 A;  5TR5 A;  4DQO C;  3M63 B;  4DHZ E;  2LVO A;  4GOC A;  3Q6B A;  2B3A A;  3HIZ A;  2BWF A;  3N32 A;  4P6V F;  2KO3 A;  3K9O B;  3MC8 A;  1TT5 B;  1FXT B;  4M8M A;  1FEH A;  1RFK A;  5EDS A;  1E9M A;  4WJP A;  1F2R I;  3M3J A;  3VHT C;  1WFY A;  2BGF A;  3KW5 B;  1WZ3 A;  1FNU A;  5IN7 A;  5HHD G;  4BFR A;  3V61 A;  2DZJ A;  3AE1 B;  4URK A;  2XBB C;  4GXB A;  4ZRK A;  3T3N A;  3SDL C;  4P1C C;  2KFJ A;  1WI0 A;  4W9I A;  2K5P A;  4B0M A;  4RF1 A;  1VR9 A;  1WRI A;  2KQ4 X;  3FAH A;  4HDQ A;  4G3X B;  2I1J A;  2K9X A;  3ML9 A;  4WJQ A;  1UGM A;  4IUM B;  5AEK B;  2J0M A;  2NPT B;  3TJP A;  5DPT A;  3BZD B;  2CJO A;  2CKH B;  1XLO A;  1WR6 E;  4TV3 A;  3DBR B;  1YN4 A;  1Q1O A;  2JT4 B;  3BVZ A;  3Q3O C;  3X23 A;  4P16 A;  1E8X A;  2KKC A;  4RGT A;  2J7Q B;  1C78 A;  1N61 A;  1B1Z A;  2K25 A;  3NZS A;  1ZE3 D;  2IYD B;  2V4I B;  3LYY A;  3N1X C;  1G6J A;  4L1B A;  1R4N B;  3AE6 B;  3IBE A;  4MSM B;  1L5P A;  2EKI A;  3UIN B;  1E6E B;  3NY5 A;  4LNF A;  1WWT A;  3C8Y A;  4JIO U;  1HQR D;  2MSE D;  2J0J A;  1XXG A;  1F1H A;  2KN5 A;  4RH6 A;  1TTN A;  4EEW A;  1V5T A;  2LVP A;  3N30 A;  1PGX A;  1AAR A;  4M02 A;  3TUO A;  3P4Q B;  1J19 A;  1SXT A;  2WX1 A;  3PT2 B;  3M62 B;  2NCN A;  4GB9 A;  2RPV A;  2KC1 A;  4ACF A;  1V2Y A;  1VJK A;  2WXR A;  3IG3 A;  1P9D U;  2FID A;  3PSE B;  3P42 A;  2GRI A;  4CQN A;  1ESF A;  2K1F A;  5DPW A;  4ZDV A;  5L95 C;  3NZU A;  1ZGU B;  2LUE A;  1EF5 A;  2A4Z A;  3TMP B;  5FR6 A;  1OQR A;  2Y5B B;  2Y5C A;  2IO2 B;  5GMV A;  2QSD A;  2WXJ A;  2MP2 B;  4GLS C;  2J0K A;  1MFW A;  3GZN I;  1OEY J;  2LGX A;  2KTR A;  4F7Z A;  3NG0 A;  1GB1 A;  1WGK A;  3HM6 X;  3HRD D;  3DBH B;  4AJY B;  1SBB B;  1S1Q B;  4KZC A;  2K22 A;  4K1R B;  4M01 A;  4J6I A;  2M17 A;  3CWI A;  2L0T A;  2CHW A;  3DDC B;  2XN9 C;  3NZ3 A;  1VZ7 A;  4BOZ B;  1D5X C;  2LGS A;  2AQ2 B;  3QCA A; 
#chains in the Genus database with same CATH homology
 3N3K B;  4KDI C;  3ZNZ B;  2N9P C;  1J0G A;  4IWO A;  1PQS A;  4A20 A;  2LAS A;  5E6N A;  4RM9 A;  2MCN B;  5IA7 A;  3AU5 A;  1WGY A;  5D7G A;  3NHE B;  4EFO A;  2RD0 A;  3ZNG C;  3R7R A;  3HK0 A;  4IWQ A;  2DAF A;  2IY0 B;  4FJV B;  1UH6 A;  3O65 B;  3PPA A;  3LDZ E;  3T8M A;  3ZTC A;  2KX0 A;  1C3T A;  2KXJ A;  3L0W B;  4AJW A;  3RT3 B;  1UEL A;  3GOE A;  3RCZ A;  2KHW B;  4IM3 A;  3UQB A;  2M0X A;  1UZX B;  4W9E A;  3DBH I;  5C1Z A;  4YL8 A;  1TZ1 A;  3OLM D;  2FCM A;  3QQ8 B;  4PS8 A;  4W9G A;  4AOF A;  4IWP A;  4P7I A;  1XD3 B;  1KM7 A;  3DVG Y;  1E7V A;  3ML8 A;  3QX1 A;  2ZVN A;  3ZTD A;  2DZM A;  5J17 A;  3NS8 A;  2MX2 A;  2O6V A;  3BIN A;  3WA0 A;  4G11 A;  4HVB A;  2YLM A;  4N9F 4;  3B1L X;  2G4S A;  2FCN A;  3R66 C;  2RSU A;  3ALB A;  1YIW A;  3L54 A;  2A5U A;  2KLG A;  3ZW3 A;  2MBO A;  2QHO A;  1RAX A;  3HHM A;  2V1Y A;  5JHB A;  4W9F A;  4BKG A;  3KYC D;  3EHV A;  3A9K B;  4DDG D;  2NBW B;  2RPQ A;  4OVV A;  3APF A;  3PS6 A;  2BPS A;  4GU2 A;  1LM8 B;  1GC7 A;  1XT9 B;  2DHZ A;  2GBJ A;  4DXA B;  3H7P A;  5AZG A;  5DPR A;  3RZF A;  5C23 A;  2ZNV B;  3V6C B;  1VCB A;  2FUH B;  2C7M B;  3JW0 X;  5D2M B;  4MEL A;  2OOB B;  3KUZ A;  5CTR C;  5JZE B;  1P0R A;  2R2Q A;  4IG7 B;  3WAL A;  4FHK A;  1KJT A;  1JRU A;  2WWZ A;  1LFD A;  4W9H A;  2M4N A;  3PRP B;  3U8Z A;  3UQA A;  1WE6 A;  3PRM B;  3QWZ B;  2NS5 A;  4B95 A;  4MJS A;  3QC8 B;  2HE7 A;  4TUU A;  3ZO5 B;  1V5O A;  3PTF C;  2JWZ A;  1C1Y B;  2MW5 A;  5D6J B;  1V80 A;  2KC2 A;  5CX3 A;  2KQS A;  2MWS B;  4EZJ A;  1ZKH A;  4GIV A;  1L7Y A;  2ZCB A;  4AWJ A;  4MGI E;  3VUW A;  4NY0 A;  4W9K A;  2NBV B;  1GNU A;  3DBR I;  4GMV A;  3DCG A;  4X57 B;  2WDT B;  2AEH A;  4W9C A;  2PE9 A;  1ZW7 A;  2RR9 A;  4FAD A;  4CO7 A;  1GJZ A;  1WGG A;  3PVL A;  4CYE A;  4GDK B;  5J2R A;  4W9L A;  3KYD D;  2XK5 A;  2GBM A;  4OVU A;  2FNJ B;  3MJW A;  4G0N B;  4E3C A;  2BYV E;  2CHZ A;  2JZZ A;  2LXC A;  4HPL B;  2C9W B;  3PGE A;  1HE8 A;  4NJ6 A;  3UF8 A;  3D32 A;  3W1S C;  4EOY A;  1R4M I;  1KOT A;  3AXC A;  1WX9 A;  2GBN A;  3VQI A;  3DVN U;  3ONS A;  2K8H A;  2O6V D;  2Z59 B;  2ZPY A;  4XZ4 A;  1R4N I;  2KQ7 A;  3R3M A;  1TGZ B;  2KVR A;  3UIP B;  2VRR B;  1WM3 A;  4EUT A;  3C0R B;  1V6E A;  3QJZ A;  4BKS D;  4NAW B;  4FJY A;  4DWF A;  1TBE A;  2LI5 A;  3S2A A;  4M8N A;  4NPN A;  1WJU A;  3V6E B;  1GC6 A;  3ENE A;  3IVF A;  4JQW C;  4HLE A;  1M94 A;  4LJO B;  2EMT A;  2UYZ B;  4GDK A;  2V3S A;  5JH5 C;  1KLV A;  4WWP A;  3WIM A;  4E74 A;  2HD5 B;  1EUV B;  3LJ3 A;  3PHW B;  4K7S A;  3SHQ A;  5AZH A;  1NDD A;  1Q5W B;  4DBG A;  4IM0 A;  2DEN B;  1Z5S B;  4JLC A;  2N9X A;  1WGR A;  3A33 B;  4BKS A;  5LXI B;  4DHZ B;  2L05 A;  3AU4 A;  4KIK B;  1V86 A;  4KSK C;  2G45 B;  3EEC A;  2LJ5 A;  2CS4 A;  4MSQ B;  4ZRI A;  3B0A A;  2KDB A;  5CHW A;  1RRB A;  3PLU A;  4PS7 A;  4MH0 E;  4WWN A;  1UBI A;  4G50 A;  5DPS A;  2JRH A;  3KH0 A;  3QAR A;  3A4S C;  3ZNI D;  1WM2 A;  2IO1 B;  4ZRJ A;  3T9L A;  2L00 B;  1Q0W B;  2AL6 A;  4EZL A;  3VTU A;  2FAZ A;  3L16 A;  3L17 A;  2KD0 A;  2ZEQ A;  4WAA A;  1D3Z A;  2KJH B;  3DQV A;  2K8C A;  1P98 A;  2R2O A;  3H7S A;  3W1Y A;  2JY6 A;  2HJ8 A;  2N9E B;  4TQ0 A;  4NQL B;  5G55 A;  2EKE C;  2NBU A;  4FHJ A;  2WX0 A;  3ZLZ A;  1J8C A;  1WJ6 A;  4HJK A;  1E8W A;  4FUL A;  4NNJ B;  3U7D A;  4MEM A;  2N1W A;  4XX5 A;  2I1K A;  3TIX A;  2G3Q B;  4LDT D;  3VVW B;  3BY4 B;  2KJ6 A;  4LCD E;  4PS3 A;  4BVU C;  2AWT A;  2K8B A;  3AUL A;  4ICU A;  2L3Z A;  3JYU A;  4KSL C;  4MGK E;  5LXH A;  2BYF A;  2JUO A;  3DVG X;  4A3O A;  3VFK A;  4FLH A;  3HM3 A;  2IY1 B;  3ECI A;  4E71 A;  4ICV A;  4MGZ E;  2KFK A;  1WR1 A;  3X0W A;  2XEW A;  3VTW A;  4LDT B;  3Q3J A;  2BYE A;  1UBQ A;  1V9J A;  2LGD A;  2KAN A;  4GDL B;  2KWC A;  4RMA A;  3RYT A;  2FIF A;  3VDZ A;  4DDI D;  3OJ4 B;  2GBR A;  2K6Q A;  2ZNV C;  3MTN B;  4FBJ B;  1WJN A;  2Z0E B;  3DBS A;  2LRU A;  3AI5 A;  4I6N B;  1T0Y A;  3R7Q A;  2C5L C;  2NR2 A;  4CHK A;  3RUI B;  2BWE S;  4EZK A;  3PZD A;  3QHT A;  2BF8 B;  4AP4 C;  2DZI A;  2L76 A;  4F1S A;  1I35 A;  2JVC A;  2KTR B;  3A9J A;  3RUL A;  4B6W A;  3UIO B;  2O2V A;  1WIA A;  2FCS A;  4EKU A;  1LXD A;  3QIJ A;  1EO6 A;  4HWI B;  4KV2 A;  2LRW A;  4WJN A;  2REX A;  3VH3 B;  1WRD B;  2JRI B;  3RZW C;  3H9D A;  1E8Y A;  1WMH B;  2K6D B;  2NVU I;  3L08 A;  4I6L B;  4TKN A;  4ANU A;  3SU8 X;  2YVC A;  2ZJD A;  1IPG A;  2C60 A;  2JZ3 B;  1WJ4 A;  5AZF A;  3TCA A;  1WX7 A;  2LGY A;  2FCQ A;  3QA8 A;  4MDK E;  3WAO A;  3EFU A;  5TR5 A;  3ZRC A;  5HKH A;  1IP9 A;  3M63 B;  4DHZ E;  2LVO A;  1V81 A;  2UWQ A;  3JSV A;  4GOC A;  3VUY A;  1Z2M A;  2XK5 B;  4HDO A;  2LVQ A;  2B3A A;  2GOW A;  3QAQ A;  3HIZ A;  2AYO B;  2BWF A;  1WXV A;  3N32 A;  1OEY A;  2KO3 A;  2BKR B;  4BKT A;  3K9O B;  2MRP A;  1WF9 A;  4HXD A;  4NAW A;  1FXT B;  4II3 B;  1UD7 A;  1WX8 A;  1YX6 B;  3A1Q B;  1E8Z A;  3L10 B;  4M8M A;  3OJ3 A;  5EDS A;  1E7U A;  3APD A;  4WJP A;  3M3J A;  3VHT C;  3CF6 E;  2M1M A;  1IYF A;  1WFY A;  3U30 A;  4DHJ B;  2BGF A;  1YQB A;  2KMA A;  3KW5 B;  4I6P A;  2JPH A;  4KZ0 A;  2CU1 A;  3P2B A;  1WZ3 A;  2DYM A;  2MQJ A;  3KVF B;  2KDI A;  3Q3F A;  2RGF A;  4MGY E;  4BFR A;  3ZRF A;  3V61 A;  2DZJ A;  2PE6 B;  4HCN B;  1E90 A;  3DBL I;  2KX3 A;  1SE9 A;  3CSF A;  2LWP A;  1OQY A;  4PYU A;  4URK A;  2DYO A;  2XBB C;  4PYZ A;  4M0W B;  4GXB A;  3B08 A;  4ZRK A;  1WH3 A;  4MJS B;  4MM3 A;  3SDL C;  2DAJ A;  3KUD B;  2KFJ A;  4KIK A;  1WI0 A;  4W9I A;  3DVN V;  1WE7 A;  1LQB A;  4F8C B;  1WMH A;  3A1Q A;  3IHP C;  2KWV B;  3ZDT A;  1CMX B;  1WY8 A;  4HDQ A;  3A4R A;  4G3X B;  3W1S A;  2WYQ A;  4GDL A;  2I1J A;  2O6V B;  3ML9 A;  1UGM A;  2JXX A;  2MP2 A;  4WJQ A;  3VAW A;  3ZVV A;  1U4A A;  4IUM B;  5AEK B;  2J0M A;  2NPT B;  3TJP A;  1I42 A;  1E5W A;  5DPT A;  2GMI C;  2D3G A;  1MG8 A;  5E6P A;  5KHQ A;  2MLB A;  2N7D A;  2PPH A;  2KTF A;  2CKH B;  3V62 A;  3PLV A;  2ZPN A;  4HPM B;  2LXA A;  1WR6 E;  4TV3 A;  2PJH A;  4HK2 A;  2D07 B;  2KOX A;  2C7H A;  1Q1O A;  2JT4 B;  2CHX A;  3X23 A;  1K8R B;  2N4F A;  3UGB B;  3VH4 B;  3MHS D;  1E8X A;  1WGD A;  2C7N B;  1EF1 A;  2KKC A;  4XC2 A;  4ZYN A;  1H4R A;  2HTH A;  4ASW C;  1A5R A;  2MA9 B;  2K39 A;  2J7Q B;  2L0F A;  3PRE A;  1XQQ A;  3H7P B;  3ZIM A;  2KJR A;  4B9K A;  2MBB B;  3KUC B;  2CR5 A;  2PEA A;  2K25 A;  3NOB A;  3NZS A;  2IYD B;  1S3S G;  5JHA A;  5KHO A;  1YJ1 A;  1VD2 A;  3RD2 A;  1G6J A;  5IAA C;  4LJP B;  4A3P A;  2N7E A;  2IO0 B;  4NQK E;  4W9J A;  3V60 A;  4BBN F;  3IBE A;  4MSM B;  3DOW A;  2M8S A;  3IFW B;  3UIN B;  2N1V A;  4GGQ A;  4KDL B;  3NY5 A;  1YX5 B;  1RLF A;  3H1U A;  4GSW A;  1GUA B;  4JIO U;  1WYW B;  2DZK A;  2L8J A;  2MSE D;  2ZCC A;  5J18 A;  3VTV A;  4FN2 A;  3VXW A;  1WXM A;  1ISN A;  2J0J A;  1H8C A;  3CST A;  2MBE A;  2ZZP B;  3PRZ A;  3ZDM C;  4K7W A;  2D2Q A;  2KMC A;  2KN5 A;  3I3T B;  3WAM A;  4ANW A;  2MBH A;  3WAN A;  2Z0D B;  1TTN A;  4EEW A;  1V5T A;  1WGH A;  2LVP A;  3N30 A;  4W9D A;  4KVG B;  1AAR A;  3ZUN A;  3DPD A;  4JL9 A;  1J19 A;  3VUX A;  1GG3 A;  4IW0 A;  4TQ1 A;  2WX1 A;  3PT2 B;  3PV1 A;  2KDE B;  4K81 A;  2IBI B;  3M62 B;  1OTR B;  2NCN A;  2G4D B;  4GB9 A;  5BO4 B;  4IC7 B;  2GBK A;  3PHX B;  2KC1 A;  4DHJ D;  2NPT A;  4NJ7 A;  2IZV B;  2DX5 B;  1SIF A;  2KWU B;  3JVZ X;  3QK0 A;  1V2Y A;  2V4L A;  1OGW A;  1P1A A;  3IG3 A;  1P9D U;  2FID A;  3PSE B;  3M95 A;  2L7R A;  5CHF A;  5DCN A;  3ZNH B;  2KFK B;  4FA6 A;  2O2V B;  4WWO A;  1QZE A;  1WXA A;  2K1F A;  2LZ6 A;  3APC A;  3EC8 A;  5DPW A;  4ZDV A;  5L95 C;  3L13 A;  1X1M A;  4BOS C;  1NBF C;  3H6N A;  1ZGU B;  3NZU A;  2LUE A;  3A9K A;  5LLI A;  1EF5 A;  2A4Z A;  4GN1 A;  2KDF B;  4K7U A;  5FR6 A;  3TMP B;  4BBN C;  3OAW A;  4JGH B;  2MBQ A;  2Y5B B;  2IO2 B;  2D11 A;  5GMV A;  1WZ0 A;  1YD8 U;  1F9J A;  2OJR A;  4WJO A;  2KK8 A;  4II2 B;  1RFA A;  1V49 A;  2MP2 B;  2ZVO A;  2ASQ A;  2J0K A;  4FJZ A;  3GZN I;  5E6O A;  4AUQ C;  1OEY J;  3WAP A;  5D94 A;  2LGX A;  2KZR A;  2KTR A;  3A9J B;  1P3Q U;  2LD9 A;  2W9N A;  4F7Z A;  1NI2 A;  3HM6 X;  4AJY B;  3JSV B;  4ANV A;  2KLC A;  5CHV C;  2EMS A;  3TBL D;  1BT0 A;  4RM8 A;  4WQO B;  1S1Q B;  4KZC A;  4ANX A;  2D10 A;  2BKF A;  3ZKJ C;  4DK5 A;  4K1R B;  3TL5 A;  2IO3 B;  2M17 A;  4J6I A;  5G2N A;  2AL3 A;  2L0T A;  3K9P B;  1SGH A;  2CHW A;  1L2N A;  3DDC B;  3SD5 A;  2DYB A;  1Y8R C;  5L83 A;  1WXS A;  2KNB A;  4IM2 A;  4HCP B;  4BOZ B;  3CMM B;  2JF5 A;  3QCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...