3R3UA

Crystal structure of the fluoroacetate dehalogenase rpa1163 - wt/apo
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
304
structure length
304
Chain Sequence
b'GHMPDLADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHDRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIAQSAATPLDVWRKWASDVQGAPIESGHFLPEEAPDQTAEALVRFFSAAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fluoroacetate dehalogenase
molecule tags Hydrolase
source organism Rhodopseudomonas palustris
publication title Mapping the reaction coordinates of enzymatic defluorination.
pubmed doi rcsb
total genus 119
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r3uA00
4MQLA 3FLAA 3EIOA 1C4XA 5HF8A 5AKHA 2WIJA 4UBKA 4LHEA 3HSSA 1L7AA 1UKAA 3BF7A 3G0BA 3H2JA 2GBCA 1K4YA 5FKJA 4FWBA 4XVCA 3O9VA 2RAUA 1UWCA 4BVLA 4Q82A 5AKXA 5K3CA 1AGYA 3BJRA 2QVBA 1A8SA 1SCKA 3C6ZA 4HVTA 3STTA 4IQ4A 2BFNA 4K6GA 3WZLA 5JD6A 4L9AA 1CUDA 1IZ7A 3UUEA 3QPCA 2OLEA 3WJ1A 3WL6A 1BCRA 3V9AA 1EDDA 3I2GA 3ZLVA 4ROTA 4KAFA 5JAOA 2JIDA 1ACJA 4UFOA 4KJXA 3L1JA 5DWDA 5T4BA 2Y2UA 4QLAA 3C8HA 3IUQA 3GUUA 4DNFA 3FSGD 3I1YA 4F5ZA 2JGMA 5CT6A 4Y2UA 3PF9A 2V96A 3EBLA 3V1NA 5EIEA 2EDAA 3HABA 4B0OA 2FUKA 3IA2A 4H7IA 5LZ8A 2PUHA 4I4CA 2OAEA 2UZ0A 3KOOA 3ICWA 2WU4A 1DT5A 1DX6A 4QWMA 1QIHA 3FBWA 4H0CA 3DYIA 4CCYB 5KWJA 1R88A 2XUPA 5AH0A 1BCSA 5ALLA 3B3QA 4ZREA 1H22A 1IMJA 2ZSIA 1EB8A 2JBWA 3PICA 3ESCA 4Y7DA 1IUPA 1WB6A 5FRDA 1W6RA 1F6WA 3BL8A 4H7HA 3SX4A 4P9NA 2JGIA 5CURA 5ALNA 1XLWA 1VLQA 5K3AA 1WM1A 3FYTA 1G66A 1R4ZA 1Q0RA 4HRYA 5AK3A 4CCWA 1C7IA 2O2HA 1FFEA 2XQGA 4QDZA 4KAJA 5AJHA 2QMQA 4DGQA 1DX4A 3A2MA 2Z3ZA 3GFFA 1HBJA 1XZDA 3CCCA 3ZLUA 3EF3A 1JU4A 1QOZA 4TPKA 2VJCA 3TEJA 5AICA 5DNWA 1CUWA 1D07A 3IULA 1LPOA 4WY8A 3R0VA 2D0DA 5HFAA 2H7YA 4A16A 1IUNA 2JGJA 1XZFA 2CEKA 1JI3A 5LZ5A 3A2NA 4PW0A 4X85A 5ALMA 3O0DA 3ZPXA 4ZGBA 1TCAA 3GA7A 1CFJA 4PQEA 1XZLA 1XQVA 2XUQA 1ZIXA 5BV7A 5J3JA 2VJAA 2I78A 3FNBA 3H2GA 5LKRA 5K3EA 3DL7A 1CEXA 3NUZA 5BOVA 3G9XA 3FAKA 1E8NA 2OQIA 3I2KA 1THGA 3RM3A 2BCEA 2J4FA 2ACEA 4MYDA 5FXMA 4GHWA 1Z68A 4GLBA 5HZGA 4NZZA 3R3WA 3PUHA 3AIMA 5ALGA 4W1SA 4BCCA 5FOQA 2E3JA 3WWCA 1Y7IA 4BRZA 5ALXA 1VOTA 2PPLA 4X7BA 3G0GA 4EZIA 2GBIA 5A7HA 4DNQA 1VE7A 2OPHA 2QR5A 1TKRA 1LNSA 4CFSA 4A5SA 1CUEA 4DSAA 2LIPA 4DTCA 4S0XA 1X2EA 5DTJA 4FMPA 4H18A 3RKSA 4B6GA 1XLVA 5JALA 2AXEA 2GZSA 4DIUA 2PSJA 5AK5A 2CUTA 4HZGA 4JEIA 4FDMA 1QFMA 1OILA 5HQ3A 4OYLA 4RE6A 5D7BA 4KACA 2WUGA 1T4MA 4P93A 3W9BA 3IVMA 4Y2SA 3M82A 5CH5A 4DSZA 3K2IA 1TCBA 1EH5A 3HRHA 2DCMA 5HQ3B 4OUKX 4KE7A 2WG2A 5JANA 4KRXA 5A7GA 3WL5A 5JARA 3FYUC 3DNMA 4HAIA 4BRSA 3QVMA 3BJMA 4DMHA 1U65A 1L7QA 4IH4A 2R11A 1CUVA 3M3DA 1H2WA 4XWGA 3WIOA 4PF1A 2HIHA 1QIDA 1ISPA 5HF6A 1P0PA 2WUDA 1LPAB 3IURA 1N5RA 1QGED 4X71A 3WL7A 3OG9A 3QMMA 5DYYA 3C6YA 1MO2A 1CQZA 3DYVA 2ONCA 4BTLA 4KAAA 1MU0A 3SWWA 2J3DA 1CUCA 1ORVA 4J0CA 3HLKA 1SCQA 2QTBA 4BATA 1XLUA 4UBJA 1C7JA 4G4JA 4RGYA 2O7VA 5DLPA 2HFJA 2CKMA 1CVLA 1VKHA 3ESAA 4BZWA 1F8UA 1CUGA 1BN7A 2Z3WA 2RIPA 5D6OA 2V98A 5HFNA 2OQVA 1R1DA 2XT0A 5CH8A 4QDOA 3WJ2A 2XUDA 4FBMA 1BROA 2PM8A 4QWWA 2EEPA 1R50A 1DQYA 4HS9A 3DEAA 1CUYA 2BKLA 3ILSA 3RARA 1FJ2A 5AI6A 4PSUA 5ALJA 5A2GA 2O2IA 2I03A 4L0CA 4Y2PA 3G9ZA 1OXMA 3IUJA 3WK7A 2HM7A 2Y6UA 3WKEA 5LIPA 2VSQA 4OCZA 3R3YA 5LZ7A 2JEYA 3D2CA 3PFBA 4E14A 3D4LA 4AXBA 2B4KA 4BP9A 2B20A 3FOBA 1SCIA 2QUBA 1GPLA 4AO6A 3E3AA 5I9IA 2OGTA 1PV1A 4XIIA 1TAHA 4UBOA 2ZJFA 1YSCA 1U4NA 5EI5A 1CUAA 2QKYA 3O9MA 5K3BA 3DOHA 1Q84A 3DL4A 2XMZA 3Q0TA 2PSFA 2W6CX 1B41A 3IDAA 4K6HA 1EXWA 3A70A 2FJ0A 3EQ9A 1UFOA 3AJAA 1XZHA 5JIBA 3F98A 1KEZA 4BCDA 3G8YA 4ITVA 2XQJA 2BGNA 2XUAA 3QMVA 1QE3A 1R3DA 4M0EA 4X6UA 3H2IA 4AMZA 4NS4A 3FCYA 4FOLA 4B9EA 4P92A 3A2LA 1NU8A 4BYMA 4X94A 1ZI9A 5EIAA 1LPSA 1ZD3A 1CUXA 5C7YA 5ALKA 2DSNA 4DMKA 1VZ2A 1JMYA 2G5PA 1YR2A 5FUMA 3OM8A 1N8SA 1NX9A 3O4JA 1TK3A 1EDBA 1XZBA 3QPAA 4ZXFA 3STVA 1GKKA 3I2JA 4JH0A 1HKHA 4LYDA 3DJYA 4Y2YA 4HTAA 2Q0XA 2YYSA 5FP0A 3MUNA 4W1PA 3O4HA 4B80A 4OB6A 2WG0A 2WJ4A 5AM5A 3WK6A 5ALOA 4OPMA 2C0QA 3WWPA 2WFLA 2C4HA 4J0GA 4LIPD 4X93A 2XLBA 5AKJA 1QIFA 1CUBA 2JGFA 4H7EA 4Y2RA 1QIKA 4AB1A 5IVDA 4U2CA 4CCYA 3G9TA 4FNMA 1FFCA 2P8SA 5I8PA 4Y2XA 4A23A 4EY5A 4DNOA 3VXKA 1AX9A 4Y2VA 4PSCA 3K6KA 4N5HX 1O6FA 2ACKA 1ACLA 1DU4A 3O4IA 5AKGA 3ZLTA 4JNCA 5AHXA 2QJRA 1BS9A 2NW6A 4XX1A 4D9JA 3LIIA 1BRTA 1WCYA 4W1RA 4MXDA 3W06A 5FPPA 4AZ3A 1WPRA 3QH4A 1WPXA 2XMCA 1UK6A 3F9CA 1RP1A 3I2FA 4EBBA 2HA7A 1R9NA 4KEAA 4X91A 4H35A 3G9UA 2JEZA 2VATA 4B0PA 2C5FA 3E0XA 5E4JA 5ALUA 5CW2A 3FCXA 4E15A 4C6HA 5E4TA 5JAHA 3HACA 2ZYRA 5FV4A 4LYEA 1XRPA 2BJHA 3WMRA 1XZCA 2C0PA 2G63A 3R41A 4JYPA 4J0JA 4C4ZA 3TRDA 1GQRA 1LPBB 1E5TA 5KREA 5C8XA 1THTA 4DMCA 4Q3KA 1EK2A 3QITA 1YS1X 5CH3A 2HU8A 2XUGA 2WUEA 3W9UA 4C01A 3GZJA 1AKNA 3UMJA 1WHTA 3PE6A 4L3WA 3H1AA 4OB8A 4NMWA 2K2QB 5CT5A 3VJLA 1KU0A 3LP5A 1XZJA 2WU3A 2HA4A 3DKKA 2D5LA 4YX9A 2GBFA 4UHFA 3L1HA 1CR6A 3I6ZA 5JZSA 4GBGA 5HKBA 1ZD5A 2ZYSA 4UBIA 2DHDA 3D3NA 1DWPA 4J0KA 5E4YA 3JYHA 2WKWA 1O6GA 1YB6A 4BVKA 1W4LA 1LPMA 3WYDA 4DM7A 5CXXA 4CIAA 4W1QA 5AIAA 5AKIA 1JU3A 1FFDA 2HA0A 3Q8WA 2IX9A 2XMBA 4RPCA 3WI7A 3GELA 5D3KA 3WIBA 1TCCA 2FX5A 4BB0A 2W22A 3C45A 4X92A 4EY7A 5IVKA 4H77A 1P0MA 4J03A 4E46A 4OYYA 1WHSA 1G4HA 3ESBA 2OAGA 1EK1A 2X76A 5ALWA 3AZPA 1U2EA 3EQ7A 1QJ4A 3MGAA 3FVTA 4C4XA 5AKLA 3D2BA 1Y37A 2DQZA 3KWFA 5A7FA 1UZAA 1DWOA 5JYCA 4WFJA 3WWOA 2PBLA 3QM1A 4X90A 4G9EA 3H17A 4HXEB 3X3HA 2PL5A 5IKXA 3VVLA 4K5QA 4GWLA 1JFRA 1H2ZA 4OU5A 3BWXA 4WJLA 1R9MA 4Q1VA 1VXRA 1JJBA 1U8EA 1H2XA 1HPLA 4O08A 2BUBA 1WOMA 1CUIA 2QZPA 4OU4A 1XZMA 4GEGA 4AN0A 5HCUA 3WA6A 1GPNA 3FYUA 5AM2A 4HXGA 1K63A 2DFPA 1TIBA 1CUUA 1DQZA 1E8DA 3G7NA 1BN6A 3R40A 3B12A 2PKYX 2WIFA 2WHPB 4GDMA 3FLEA 4JYMA 2EDCA 2PSDA 2VT6A 2ZJ7A 1H23A 4ARAA 1CUSA 4BTVA 2FJPA 4GI1A 2Y1KA 3WK9A 1JT2A 1GXSA 3GBSA 3ZWQA 4KYVA 2RHWA 2BAGA 2C5GA 3K9BA 2H1IA 5CT8A 2ZYIA 5AI5A 3AFIA 2VAVA 2AJCA 1IZ8A 3VDXA 2BUCA 5CXUA 5KBYA 3IUMA 1SFRA 4QA9A 2PSEA 2GYUA 4Y2JA 1J1IA 3H2KA 1ZICA 4M0MA 2Y2VA 3ZV7A 1QIIA 3C43A 1XROA 1VA4A 3AILA 2XUJA 1TQHA 1NU6A 3D0KA 5CT9A 4J0IA 4PSDA 3AUKA 2O2GA 4FBLA 2GYWA 3DDUA 1XQWA 3CCBA 4EUSA 3G0CA 1AURA 1L7RA 3DD5A 1YAJA 1USWA 1ZGCA 3V1MA 2DR0A 4Y2TA 2ZSHA 1FFBA 3I2IA 1CQWA 2VT7A 3CN7A 4B9AA 5DNUA 3S8YA 1EB9A 1HL7A 5JAUA 1RYYA 4CI9A 1XZKA 3VJKA 2XDWA 3OTQA 2XUHA 7YASA 1X2BA 4U2GA 4FNGA 5T4FA 2RHTA 3WK4A 4YASA 2HRQA 1F0NA 1XFDA 4IO0A 3OC0A 2QXTA 1FFAA 1QZ3A 4XJVA 3AIOA 2CB9A 4EHBA 3FYUB 4HRXA 3QYJA 3R3XA 1MNQA 2WTNA 2OCLA 4UBNA 4QZVA 5DYTA 3WQHA 2GYVA 2G5TA 2IITA 3I28A 4EA6A 5AM0A 4UUQA 2XUKA 4Q3LA 1FSSA 4B82A 1CUJA 4U2DA 4WDQA 1Q83A 3IB3A 2HHAA 5BWCA 5JATA 3HC7A 1QTRA 1GPKA 1J06A 2WFLB 5IVHA 2IIVA 4FTWA 5ALTA 1QFSA 1EINA 3PF8A 3WKDA 4H7KA 1DINA 1G42A 2ZVDA 1XZEA 2OG1A 3H04A 5AKEA 2H9YA 4G1FA 3C87A 1VE6A 3HYSA 3V1KA 5A62A 3U0VA 1GKLA 1QIEA 1E89A 4G8CA 5ALFA 1X70A 5JZ9A 4N5IX 1E3QA 4BE4A 1UOOA 3TJMA 1MX1A 5I7UA 1EVEA 4UFPA 1MPXA 2YXPX 1AUOA 2WQZA 4Q34A 1BEEA 1EX9A 3H19A 4UHHA 5FLKA 2HU7A 2OGSA 2WIDA 4B7ZA 3WKBA 4ZRDA 4AO7A 4BP8A 2ORYA 4WDRA 1OCEA 2XMRA 4Z49A 4OD0A 4FFWA 1CV2A 4FFVA 2VJBA 2VQ6A 3BDVA 2H7CA 2AJ8A 2ZYHA 2DHEA 2ROQA 1UK7A 5AI9A 1A7UA 5C8ZA 1UOPA 2VF2A 4B81A 2G4LA 1AC5A 4K2AA 4KE6A 4L72A 4X00A 3AIKA 4I19A 2PSHA 3KSRA 4RNCA 5IVIA 4IHAA 1MAAA 5DYWA 4MJ3A 4QDTA 4QE3A 4BAUA 1ZJ5A 2Z8ZA 2QUAA 4C89A 1QLWA 1EHYA 1H2YA 3H0CA 3O95A 5CMLA 4ETWA 4KE9A 4YPVA 2JF0A 3JWEA 3HEAA 4BAZA 1ZGBA 1ZD2P 3ESDA 1GGVA 2VTVA 2HFKA 2XQKA 5LZ9A 1LLFA 2VAXA 1N5MA 4MWTA 1IUOA 5AKZA 5ISMA 4Y9SA 4X6XA 4QLOA 5AO9A 1VXOA 2QRUA 3C5WP 5CTAA 2OCGA 2AJLI 3FWHA 3U1TA 4RE5A 3AZOA 1HLGA 1Y7HA 2JGLA 1HQDA 4AMYA 4QNNA 4F60A 4J3JA 3C5VA 1PJAA 1UKCA 2XMQA 3JW8A 3STWA 4J7AA 4X97A 2WSLA 3WWEA 1XQYA 2WFMA 4BBZA 3E4DA 5H3HA 1QIJA 3QMWA 2OGZA 2HRRA 5K3DA 3DLTA 1M33A 3D7RA 4F21A 2WG1A 3H2HA 3LLCA 1GT6A 3BDIA 1UXOA 1ZD4A 1P0IA 2HU5A 3KDAA 3VISA 4C4YA 4X3CA 4UHDA 5ALDA 4DLNA 4UHCA 1XKTA 5AM3A 5HKAA 3KD2A 3KXPA 1QONA 4WFKA 2HA5A 4GW3A 2YASA 1JKMA 1B6GA 3D59A 4ZV7A 2X8BA 2PX6A 2WJ3A 3RLIA 3V48A 2HA3A 5IH7A 5C8VA 3L1IA 4BDSA 2WJ6A 4MWSA 3IIIA 4BAGA 5AOAA 3M81A 1AMNA 1ZI8A 4H7JA 5EHNA 5HK8A 1K5PA 1MX9A 1MTZA 3H1BA 3OOSA 4G8DA 1QO9A 4BDTA 5LYYA 1LGYA 2I3DA 5LP1A 2WHQA 3NOXA 1KU6A 5E2IA 4GXNA 3LCRA 2V9ZA 1EA5A 2PUJA 4C87A 3MUOA 4Q3OA 1ODTC 2XQFA 3WA7A 4AZ0A 3I6YA 2RGUA 2QJWA 1LZKA 1ZI6A 5ESRA 2CMFA 4UBMA 4BE9A 2Z5GA 3STUA 5LKAA 1XRRA 5SYMA 2XQIA 1YASA 1ODSA 3F67A 3DQZA 3C70A 1YA4A 1MAHA 1UOQA 2XB6A 4W63A 4AN1A 1JJFA 5LZ4A 2XI4A 5CBKA 2PU7A 4YK7A 5LZ2A 1QIGA 4G4GA 1LZLA 1MN6A 4N8EA 2WUFA 4DYHA 1RWQA 5T4EA 3D2AA 2ZJ6A 1T2NA 3R3VA 4TGLA 2BUAA 3QBJA 3OPMA 5AKKA 1W52X 5C81A 3D5EA 5EGNA 1W1IA 5ALZA 2OXEA 4NVRA 3WYNA 5DJ5A 5HF5A 1XRQA 2O7RA 4UHBA 4ZI5A 1WB4A 2QOEA 5F4ZA 2QXUA 3I6MA 2CZQA 4G5XA 2BGRA 4MQMA 4CIBA 4H7DA 4PO3X 4BZZA 4B83A 3ICVA 4PV7A 2JGKA 4FLMA 5JZBA 1J07A 4ZWNA 2HDWA 5AK6A 5AOBA 3LS2A 3QZUA 5K3FA 1A8QA 3H18A 2QM0A 2XUFA 2HL6A 4FLFA 5K5EA 4ARBA 1XKLA 5AI4A 3G0IA 4FHZA 3FVRA 3DOIA 4LXHA 1YB7A 1DT3A 4K6KA 3FLBA 5ALQA 1YS2X 5JD4A 3G0DA 1CUZA 2HADA 4OSEA 1K8QA 1WB5A 3WL8A 4FLEA 3W2TA 4KRYA 5JADA 1UKBA 2XLCA 1I6WA 1LBTA 1CLEA 5DTIA 3N2ZB 2V97A 5ALYA 3BF8A 3O4GA 4G4IA 3YASA 5A71A 2DHCA 5JD5A 4GECA 3VKFA 1A8UA 4MEBA 3GROA 5FDFA 2JGEA 5KWIA 4P08A 1DWQA 3RK4A 5DNVA 3CN9A 4OB7A 5AI8A 3WKCA 5ALPA 3WKAA 4C88A 1LBSA 1ODCA 4U2EA 4TVKA 1YAHA 3R3ZA 5HF9A 5D3ZA 4QEKA 2VEOA 3BXPA 4EB0A 2RONA 1BE0A 2ECFA 4UPDA 2VA9A 4MEAA 2HA2A 1F0PA 5EHZA 1GZ7A 1W76A 2WM2A 3CXUA 3DCNA 3KWJA 3IBTA 5ALIA 1VZ3A 5EHXA 2RI6A 1LPPA 1HDEA 1JJIA 3I1IA 4BVJA 2CBGA 4F0JA 1VJ5A 1XZIA 4UFNA 3R3UA 3EQ8A 3HI4A 3B5EA 1QIMA 2C58A 4X95A 1MT3A 1EI9A 4CG1A 3DS8A 4DNPA 1XRLA 3WLAA 5JASA 4BC1A 3LIPA 3ZI7A 1QO7A 1CIJA 2YH2A 3P2MA 5JAPA 3G02A 4G9GA 2B61A 4B85A 6YASA 1UT6A 1ETHA 2WILA 4M0FA 4U2FA 1CUHA 5EFZA 3N0TA 1GQSA 2XUOA 4J0DA 4J0HA 4AQDA 3W04A 1AZWA 3STYA 1W75A 3SK0A 2XMSA 1VA5A 5SYNA 1BU8A 2Z8XA 2Y6VA 2QT9A 2I3ZA 4EY6A 1XRMA 2ES4A 3WK5A 1E66A 3VVMA 5K3FB 3IUNA 1ZJ4A 3F97A 1XQXA 1XRNA 4UHEA 5EIHA 4EY8A 2J4CA 2HA6A 4JUIA 2WTMA 1QTIA 2QS9A 3NWOA 4H7FA 2OCKA 3BIWA 4U2BA 2CJPA 4X6YA 1XZGA 3SC2A 5YASA 3ANTA 5BWBA 5A6VA 4KR0A 1G5FA 5ALVA 5HK9A 5AKYA 4W9RA 3ANSA 2WFZA 5AK4A 4V2IA 1CUFA 2WHRA 5AOCA 1E8MA 1P0QA 1ZOIA 1LPNA 3S2ZA 3TGLA 1SC9A 4Q05A 2WIKA 3V1LA 1XZAA 4ZV9A 1Q0ZA 4EY4A 5CT4A 2WIGA 3WZMA 4FKBA 2XE4A 2XUIA 2WHPA 2B9VA 5AM1A 3E1GA 5AIBA 3STXA 3HXKA 3F8SA 4CG2A 4LXGA 5LLSA 2PVSA 3A6ZA 3NGMA 2GBGA 2GZRA 2VJDA 3PUIA 2OCIA 3QPDA 1MNAA 3WWDA 1EVQA 3WK8A 3HJUA 5EHQA 3FSGA 4IH1A 3C8DA 1YCDA 2J3QA 3ED1A 4INZA 3OURA 3T4UA 1UK8A 1SOMA 4QDXA 1PFQA 5AP9A 1IVYA 2H7XA 2R8BA 3HZOA 2DQYA 5ALSA 1CPYA 1UK9A 4QDUA 4BCBA 4Y2QA 3M83A 1CRLA 3BIXA 3I2HA 5CRIA 4KE8A 1A88A 1ZIYA 4LXIA 4CG3A 3C6XA 3MVEA 4LKOA 5FPQA 4DMFA 2XMGA 1BEZA 4AX4A 4WCVA 2AJDA 5ALRA 2WLSA 2PU5A 5ALHA 4E11A 1K6EA 3C6BA 2XMDA 3UUFA 4UBLA 1ORWA 2C7BA 1EDEA 2AJBA 4N8SA 4WFIA 4IH9A 5ALEA 4BC0A 5AI0A 4I3FA 3W05A 3PI6A 4MYSA 1YA8A 1DTEA 4HXFB 3VJMA 3PDCA 5T4HA 3PFCA 1N1MA 1TRHA 1MJ5A 1S8OA 1MX5A 3AINA 1J2EA 2X5XA 4N8DA 3T52A 1JMKC 3AZQA 4AO8A 4B84A 3BE8A 4PNZA 3F96A 4WY5A 4G8BA 3DKRA 5AM4A 1AQLA
chains in the Genus database with same CATH superfamily
1C5KA 3FLAA 3LYAA 3QVUA 4D97A 3BH6A 2VDPB 2I4RA 1PJ4A 4OHCA 1W0KA 3ENNA 4BLQA 2JAPA 2WZDA 4N47A 2HKIA 1DQRA 1CKEA 3UXHA 3VNUA 4DLYA 3EFBA 5C8YA 5AKHA 3ZWCA 1KY2A 1SCUB 2V45A 3HPQA 4JODA 4U7PB 2QYOA 3QBVA 1SWVA 4L95C 1V1MA 2WIJA 3BMNB 3GB9A 5BWNA 1DADA 3L0SA 5JTTA 4J1SA 4LHEA 1RPNA 3BG5A 4RYLA 2GEKA 2H9AA 3FDIA 2IYRA 1UKAA 4KIJA 3HRKA 3TPZA 4E7OA 3Q2KA 4HNSA 4ZZ0A 4IFEA 4UU8A 1PR6A 3FF4A 1FNSA 3ZK8A 3N8DA 1USIA 1KORA 3H9QA 4HF7A 1XVVA 4IGEA 1TZKA 2CL5A 4RYDA 2FDCA 1WA5A 3EA5A 5DXFA 3L8MA 1B6TA 4GI3A 4FWBA 4WFQA 4FINA 4EB6B 1W85A 4OFWA 3JZFA 4HX5A 4OHWA 2GXQA 5IN5A 3W77A 5JXWA 2NXJA 4MKXA 1GSHA 3F2VA 1JDVA 3QI7A 4EDHA 4BVLA 1HEYA 3FTQA 1GUYA 1KJZA 1KJYA 2YHAA 3C7TA 2VDMB 3RAGA 1G17A 3G8BA 4M8NE 4CMBA 3EQZA 4FDUA 1G16A 4NU8X 1M34E 1CNFA 1T0UA 3HJNA 3DVRX 4JLSA 2PX4A 3E9NA 3BMCB 2GETA 3HCBA 1T3HA 4YIHA 4QOGA 3IDSA 3VR6A 3A32A 5K20A 2IBTA 1OZAA 4QO8A 1SUAA 5FF9A 3QE0A 3WO0A 3ZTTA 1A4XA 4J4BA 1I24A 3CVXA 5LNK1 1LQUA 4IQ4A 2BFNA 1WU8A 1XHFA 3D0OA 3JYNA 3AH8A 4CIXA 1EP9A 2ZJ8A 5I4BA 1QCYA 3LT0A 3A1EA 3UM9A 1GXSB 3WJ1A 1U0GA 1O97D 2CB0A 3WL6A 3D6AA 1V7QA 3T1QA 5HDBB 2CLKB 4JLOA 1S01A 3U19A 4GZ3A 3OEHA 1TTTA 4KAFA 5T6MA 5JAOA 2JIDA 1TQDA 3EXAA 8AT1A 3OLXA 2P9QA 4Q3NA 4RZIA 3MWYW 3BA1A 1NQXA 1NUPA 1LB1B 2J9ZB 4HB4A 5D1HA 1GYQA 1KZGB 3B3AA 4BKQA 3ONEA 4QLAA 1KDRA 5EPUA 1EGVB 2EOAA 4PZEA 3JTEA 4URHA 3RSZA 3HVRA 1XV5A 1R4MA 2VP9A 3R3SA 1N2OA 4I9UA 2WF5A 4IY1A 4MLDA 3FKSD 3RCBA 3VZQA 3PNKA 3CRRA 3CO5A 5EAIA 5CT6A 3HS3A 4LECA 4F5ZA 5IBCA 4CWAA 4HFNA 4DDVA 4Q9AA 2V96A 3EBLA 2LDBA 2BGUA 4YA6A 3KSDO 5CG2A 1QLHA 3V1NA 5KJ6A 5E2AA 1H0KA 3HABA 4UD6A 4CG0A 3EXG2 3OIYA 2FUKA 3IODA 1DZ3A 2ZUDA 3UV7A 4A4DA 4C0BA 1ZR2A 4K81B 3LVRE 5DASA 2PUHA 2Q5EA 2OAEA 1U7TA 2PKQP 2QPTA 3KOOA 3LPAA 2D6FA 2QU8A 2NSJA 3ICWA 3OA2A 3QQPA 1T5DX 1Y9DA 1KGSA 2GAOA 2VRCD 3TW8A 4D5GA 3GRKA 3IQFA 1GCOA 3L77A 2OXRA 3RRXA 3VTZA 4EPYA 3DYIA 5L3QB 1M83A 1Q7TA 5DX8A 3R20A 5CGZA 3H4VA 3VZDA 3FRJA 3UWPA 1E61A 3D6NB 1R88A 2XUPA 3OOYA 5DMXA 1WXHA 3LT5A 3TG2A 3WJ7A 3ZBTA 3UG6A 2BFWA 4O33A 5ALLA 3B3QA 4CMEC 1D6NA 4OTZA 1SKMA 1KK0A 3OO1A 1E2MA 4AKIA 2O0LA 3UBMA 2OHHA 3EDRA 3L6OO 3FDJA 4HEA1 3ZD9A 5GONA 4BNHA 5EQJB 1YR9A 1RBQA 3IDQA 1A9OA 3K9HA 4HZUA 4OXRA 4I4IA 1Z3CA 3G0HA 4L8WB 2J3LA 2QD4A 2GWRA 2PFKA 4P1ZA 1G20E 1OIWA 2XRYA 4GZ6A 2R00A 3HHEA 3UHOA 1LTKA 1Y6FA 1WB6A 5CDFA 2WF9A 2AHOA 4M1QA 1YUNA 3BL8A 3D3WA 3O73A 5ECWA 3P9NA 2X2EA 4IMJB 1L3CA 1J56A 2JGIA 1NXXA 3EPPA 4G97A 3KHUA 2EJWA 1RYDA 3AHHA 3ELYA 5JSZB 1DJOA 4OOFA 2DH6A 4BJ5A 5EE9A 4DC1A 1LRJA 1W4RA 1G66A 4GX1A 3WBBA 1R4ZA 3QWBA 1UBTS 1HLDA 4K9DA 5EUBA 4KK3A 4DCOA 2RMKA 4C6SA 1J22A 1Q0RA 3CBGA 4HRYA 1U8UA 4JQZA 1P6UA 1Z0SA 2QRVA 4HO1X 1JA0A 2AUMA 5D84A 1UP4A 5JZOA 4CMEA 4L07A 4DW8A 2W6QA 4QPPA 1BJKA 3RVNA 2O20A 3PEVA 3S1AA 1AIPA 3L4JA 1LX6A 3EEFA 3IOEA 4CT0A 2HIAA 1P9OA 5FOUA 1O9BA 3CCCA 4GF5A 4RSHA 4M38A 4D8VA 3T3MB 3K16A 5TS3A 5TVKA 3QTTA 2ID4A 4TPKA 4XM1A 4PCLA 4G0OA 1N1EA 4EFLA 4OJNA 4F9GA 4O3MA 3OZVA 4GXTA 3N74A 3K6JA 3TEJA 3UT6A 4OHVA 5H68A 5LFAA 3RPEA 3DBHB 3MNFA 3EFEA 3PFHA 2IYTA 5CHYA 5A3QA 2C83A 1M1YB 2M98A 2XDYA 4PPNA 3SC3A 3VYSB 5IRCD 1IOLA 2XA9A 1IQ0A 2MSNA 4OQEA 1FYXA 1N6KA 2H63A 1G64A 3S2EA 3RWOA 5BMVB 2D0DA 4OMCA 2HSJA 2H7YA 4PZYA 2GN9A 4C5AA 2F3PA 1YE5A 2JGJA 1Q3TA 5HE8A 4EJ2A 5AVVA 4FYJA 5CDGA 4PW0A 4U8GA 1L5YA 4X85A 5DM1A 2EBUA 3NHKA 3EMBA 4XIJA 1DAMA 1GUBA 1XTVA 2F3QA 3O0DA 1BQ4A 3O2NA 1N3YA 5K51A 2Q2OA 3RVBA 1CFJA 2PMCA 2RAVA 2GVZC 4NWIA 4W9NA 2I7VA 4ALNA 3C2QA 3ZR4B 1QFYA 2UYQA 1YJXA 4YMHA 3FKQA 3MTJA 3ITKA 2JFOA 5H83A 1YIOA 2ZAGA 2W70A 4PM4A 2XXAB 1FSZA 1S7GA 4XGIA 1LQ2A 4ARSA 2NT4A 1JDTA 3DCYA 3KZ1E 4H1VA 4KRGA 2IYXA 3AI1A 3JD0A 1SUEA 2HCBA 3W5BA 2C3OA 3Q7PA 1DC4A 4NG5A 3FAKA 4LXYA 2OQIA 1R4MB 2PKEA 3OPVA 1DQNA 3GYGA 1MEJA 3GQBA 1QPGA 3FBGA 3ZHZA 4JT9A 1K98A 2BBTA 5B12A 2J4FA 2E4YA 1M74A 2ACEA 2I4TA 2ZUCA 4MYDA 4N3CA 5KU7A 4LS3A 4NV1A 5FXMA 3L07A 1NG9A 2XJ4A 1XJ5A 5AW8A 1LC3A 3FHLA 4C3OB 1F0YA 4B44A 4QX6A 3FAZA 5BVHA 4OM7A 3HZRA 2BLNA 5SY6A 4DILA 4DFDA 1E2BA 3N2GB 1K8ZB 3F78A 4MWBA 1T5OA 3IJPA 3WWCA 1M8JA 1ZK1A 3E9QA 1Y7IA 3DF9A 5IXYA 2RI0A 1NLZA 3GEDA 1DBRA 4MVJD 3OVMA 1G21A 3VR4A 3ZCUA 5FTLA 2DPGA 2PMWB 4KVGA 3WADA 4DS3A 1P2UA 4MV1A 1CD5A 2YCBA 1XEFA 4TS9A 5DX1A 4UE2A 2BEVB 2ETVA 2IKSA 3VO2A 4XAQA 4JLJA 2JGNA 2V0CA 3L4KA 1TMGE 3G0GA 4EZIA 3WTCA 4Y7CA 4QREA 1DAKA 4Z51A 1KS9A 4NBTA 4B71A 1TIPA 2RHDA 3RYIA 3GLFE 2O0JA 1L0BA 3J81k 1VE7A 1K1EA 2QR5A 3OOJA 1UT8A 3VU8A 1E3WA 1I5EA 4L4UA 4ABTA 1N2SA 2VF8A 4DSAA 4KXMA 1ARZA 2AD5A 1QHIA 3JVVA 4I6EA 4EVQA 3IHLA 3KKQA 4AZWA 2Q41A 1ZO8A 2H11A 2WVGA 1L4NA 4NNPA 4ZCSA 1I2CA 2N0SA 4RPKA 1UXHA 5CM2Z 3O84A 2NUBA 2CHEA 2KLBA 3A1VA 1HDYA 1P5HA 1QS0A 1SAYA 4AP6A 3BHMA 4QTYA 4EPTA 4YCJA 5IEBA 5JALA 2ODAA 2I1LA 4PU0A 4RACA 1E98A 1G5HA 4FB5A 3F46A 3FDZA 1M9NA 5F4BA 3RYFA 2OECA 4N49A 5AK5A 1PJSA 3HKDB 4WASA 4XR9A 1GAXA 3A06A 3NNNA 4JEIA 1Z37A 5D86A 3HSKA 3PXDA 3ZV3A 3G2MA 4QBFA 5AVTA 3KR0A 2EF0A 2A1UA 2YJ3A 3IAFA 2Q5QA 3DL0A 1DARA 1RS0A 1VYVA 1FQJA 2Z95A 4EUNA 4QL3A 4X8MA 3WMGA 4ARZA 3L7LA 3M4NA 4WNAA 3I64A 1N77A 4DR4B 4UTPA 1OWPA 5FAXA 3AHFA 4NOMA 1EFPB 1JECA 4BU0A 2RC6A 1WZUA 3GA0A 3T34A 1HFKA 3H0KA 1T4CA 4MQFB 2CXQA 3OQMA 2R9VA 4I14A 1HTTA 3DOFA 4KN6A 4PC2A 4Q1EA 3D6TB 5CH5A 3HADA 3IEIA 3EXHB 2SNIE 3HWX1 1J97A 5F64A 3HCRA 4B3MB 1PKXA 3HRHA 2YQ4A 5TS2A 2IOFK 1AV6A 2WINI 2P0EA 2BGKA 2PH3A 1U8AA 5HQ3B 1NNUA 4X8LA 2F1JA 2YY6A 1BE1A 5A7GA 3D7NA 1A4UA 2H18A 3F7NA 3G9QA 5DGHA 4GKVA 1AS0A 4X45A 4HDOB 1AY0A 1CJSA 4Q7LA 4BRSA 2RGCA 4HLQB 4F5YA 5AW7A 1SQ6A 1R8SA 4KLAA 3IAXA 3A9TA 1DIAA 3CR8A 2XTNA 4IO1A 1O9GA 5FPTA 2DKOA 1JVSA 1C1XA 5JFOA 1T2EA 2YRXA 1P2DA 4DE5A 4MZDA 5BOSA 4M1OA 4PF1A 1P8AA 2QTMA 3BHIA 1QIDA 1PS0A 5BN3A 3DO5A 4TX1A 4RL4A 1I2MA 2XHEA 3CE6A 2BSAA 3PVCA 1SJ9A 4Q9NA 1P0PA 2PGAA 1LPAB 2BEVA 1I13A 2WUDA 2P40A 2CC2A 5JD3A 4AVYA 4BO2A 1YIAA 4IJUA 1QGED 5MGBA 1Z6PA 3GLHB 3FYHA 5JY1A 2VYVD 4G5FA 4KNWA 1HZJA 3KAQA 4M98A 1XYYA 3LLMA 2OO3A 1MO2A 3A3PA 1J20A 1N9GB 3B1YA 3OM1A 3D5TA 3TQSA 3WO1A 2EFJA 2W11A 3RV3A 4BTLA 4KAAA 3FFXA 4NYJQ 4L5CA 3JAWB 4ZHSA 2HTFA 2BFFA 1ZU5A 3E58A 1ORVA 3LF2A 4KHPB 4JT4A 2ATCA 3L6BA 4MUKA 4C4TA 3AU8A 1QYCA 5IJ0B 1JWAB 2QTBA 1E4EB 1FNMA 3RSSA 4AJJA 3F6CA 4WLVA 4G4JA 4ZMSA 5JBIA 3UBTA 1T1EA 5K7SA 2PRZA 3KV1A 4N03A 3T4EA 5CHEA 3JQ7A 3GJRA 3QLJA 2I9KA 1GR1A 1VKHA 4FDTA 3VHXB 1G2PA 4UTZA 3FCAA 4EFMA 2XNDA 1X1BA 2OZEA 2PZFA 1K4KA 3K6RA 4ED9A 1K5DA 3IDFA 2OOSA 3L7NA 1VLZA 2D1FA 3WDMA 3AW9A 5D5PA 4KSBA 4DSTA 2RIPA 3VNAA 4CKCB 2OQVA 3C3EA 1E2JA 1TUBB 2K5UA 3CNHA 3NAMA 3K0HA 4GPAA 2FFHA 4Z7JA 3AP2A 4HDRB 1JPVA 1SWWA 5F7JA 5JDCC 4FR2A 2P62A 3B9PA 3GN2A 1OH5A 2KMLA 5EZYF 1TM4E 4M1EA 4A0SA 1OVMA 4QQRA 1DQYA 1GL3A 3WMFA 2DTEA 3S3TA 1URPA 3UV6A 4DDMA 2DAPA 3MD0A 3IERA 3HB0A 4N0QA 4KV9A 3RARA 1QGUB 2PGJA 4L75A 3GDGA 1F20A 2OBBA 3RVMA 1L5WA 3HCOA 3TTTA 4KMSA 5ALJA 4IFTA 4Y2PA 4Q9KA 4ACBA 3G9ZA 1OXMA 1TW3A 3CLTD 1ECPA 4S2UA 3MCAA 2I4MA 2QTFA 1OGJA 3OCVA 4KLNA 3E9EA 4YECA 4N6NA 3WKEA 4GPZA 3T9DA 4MW0A 3TAUA 3WLRA 9MHTA 2HU2A 1U99A 3AR8A 4BGEA 3UYKA 2VSQA 3EA4A 1KOJA 1OLSB 1RD4A 1RM3A 4KW7A 2B8EA 4OCZA 4PEVA 3R3YA 4KBFA 4LXQA 2YV3A 3PC4A 1DOZA 1WUYA 4CLXA 3L4BC 5LQJA 1YJ8A 1GGHA 4RVGA 1Y3IA 2B4KA 3HEMA 2O50A 4KYIB 4NENA 4BP9A 3R24A 1KOGA 1EU1A 3RSOA 2ZW9A 3SKVA 2I54A 2QUBA 1GPLA 1OI2A 1R12A 1VE9A 2H7VA 2RK6A 3MLBA 4RBNA 5HGJA 2IOQA 3E3AA 5I9IA 2BN4A 2OSVA 3GPDG 3MGCA 4S1VA 5G0TA 3N2IA 5I5EA 2Q5IA 3BILA 4IXTA 3A4LA 3GAFA 3OY2A 4YRTA 5K9ZA 2JPDA 3PQ8A 4R5HA 1AGRA 2QIPA 5FLEX 4F9TA 2FDRA 4DA7A 4UBOA 1UMDA 1NFFA 3K9NA 2ZJFA 2VHVA 1R0SA 4BEWA 1O8BA 4ZYVA 2JI8A 2PRKA 3GJ4A 3G2NA 3UJ8A 1GRQA 2W6ID 2CK3A 1CDOA 4GOJA 1KP3A 1ND6A 4GOLD 3ZVLA 3BUSA 3EIWA 1C0IA 3QVWA 4JK3A 4BO6A 4OFXA 3TIFA 2WJYA 4BFLA 4DLPA 1ZN8A 4H4CA 3PD0A 1NBIA 5KHAA 3E3MA 2BIFA 3GT3A 2P9BA 4EWLA 3NTQA 1KYYA 1P5FA 2DPXA 2QGNA 3PX3A 5ILGA 3WLMA 2OHGA 4PX3A 4RIIA 4MULA 2BZSA 2VK1A 4DRZA 3V4OA 2JVIA 4WE3A 1GQFA 4ER6A 3MXTA 5AVZA 4DKXA 4G65A 1YQDA 1NBHA 2ZJBA 4K6HA 1EXWA 1DAFA 1WZCA 2QD3A 1AE1A 2WTBA 1ZESA 1GWNA 1BW9B 2DPHA 3H5IA 1Z5OA 4NYJR 5FUBA 1MMFB 2IGTA 5HXAA 3AJAA 3REGA 3G7SA 3H5RA 1QZTA 1BXGA 2W93A 1POXA 3G7UA 1W88A 3HZZA 3K1AB 2C82A 3O8QB 1OFUA 4HVLA 1NA5A 2IXTA 2BYTA 1K3TA 2XD4A 3F98A 2NQ2C 3NHWA 2QJFA 5TPWB 3T9CA 3JZMA 2IW1A 4BJ1A 4BNYA 4UUOA 3ZJTA 2DUUA 2UVDA 4NS1A 1ZRSA 3UZUA 4BCDA 1JKFA 4BWGA 3G8YA 3IHKA 1FU8A 1CX9B 1VKRA 2XCUA 1CF9A 4KIUA 1B8OA 1PLLA 1IVNA 4LGVA 2I7CA 1VHQA 3QMVA 2Z4TA 4HZUB 4M0EA 4AYXA 1PR2A 2FWMX 4OP3A 4X6UA 1ETUA 5GGXA 3VKHA 1O94C 1KEWA 1OXBB 4UQPA 1PUXA 4YJ2F 3VZSA 3NTLA 2Y1OA 4WVFA 1QX3A 2VR1A 2ZQ5A 3H9EO 4BFXA 1QFZA 4TVOA 5HG0A 3RFXA 1DCTA 2O8DB 4TT3D 4CM9A 4YP6A 3OMXA 3KYDB 4P6VF 1Z88A 5GVRA 5GZ1A 4GBMA 3TW0A 1V6CA 5EIAA 2XVAA 1SVOA 1J8MF 2V7EA 1B0AA 3QLUC 3V6MA 1IBCA 4RTSA 5C7YA 2RDMA 4AECA 4M3NA 4H0FA 3TE6A 2AK2A 4F4DA 2C03A 2RAFA 1N34B 1WG8A 4UEWA 4R4JA 1E3JA 1MG5A 1VZ2A 2O14A 3KX2A 5JCOA 5TNXA 4QTXA 1OREA 4QUEA 2FZCA 2P3QA 2YN4A 3CX4A 4UE6A 1ZISA 5F77A 1NQOA 5BN5A 1KYWA 2NO9A 4RJKA 1QHFA 4UNIA 3HVUA 3U5TA 5G4LA 4LEIA 3N2EA 4QTUB 4KBGA 4EF4A 3OM8A 3TVTA 1NX9A 4ENSA 2SKCA 1WCIB 1GPDG 3GFQA 5FWXA 1YDMA 1FP4A 3E7DA 5DNDA 1PJ8A 2NO5A 3UB2A 2ECQA 4GH5A 5HZKA 4LC9A 1GKKA 2WEKA 2AJTA 1HKHA 3QOWA 3VMFA 3UAGA 2DWPA 1PJTA 3DJYA 4DABA 5KDDA 2ZTMA 4CDMA 1EXVA 4JI5B 1ECJA 1XIVA 1SUCA 1QH8B 1UZMA 4E70A 1M34B 1SUDA 1YQXA 3R77A 2J6BA 4J1QA 3MUNA 3E81A 4PFKA 4W1PA 4NHEA 3SC4A 3O4HA 2XV1A 2OPBA 5EIBD 1SQ0A 4BPBA 4I7EA 1NVTA 4WQMA 3FM9A 1V96A 3A4VA 4OPMA 2GB4A 2BFFB 5ALOA 1TJ5A 2WFLA 3T95A 2GPSA 1E96A 1G6OA 2VA8A 3BFVA 5BR8B 1GNSA 4B7UA 3JAMA 3OIDA 1RPZA 1GUZA 3LUPA 4FC7A 3B6EA 3UQZA 2H1OA 4J0GA 4KXYA 4N7BA 3ANNA 1QOPB 1R3UA 3BDAA 2HUNA 4G24A 1MXHA 1VIVA 3M5WA 1QP4A 2F1RA 1TX4B 2JH9A 2PNFA 1GQOA 2EKQA 4YI3A 1OLSA 1YMQA 2CNKA 4QFMA 4DC9A 1M0WA 4YAJA 4E5UA 1QIKA 5JEDA 2O7SA 1NW7A 2XEXA 4DT1A 3TZCA 5CNIA 3LO5A 2PT6A 4R9NA 3G9TA 5SYAA 4OLAA 1DGQA 1CB0A 4M89A 4JOSA 3IQGX 5T57A 1YR7A 1XNQB 2VEDA 1JHPA 3DMNA 5I8PA 4A6PA 3JR7A 4NV0A 3F73A 2DFKB 2GH1A 1ULAA 1EUQA 3GIWA 3NOQA 1VPDA 4JGBA 4Y9RA 2DFDA 3MTDA 1FLDA 2OWEA 4XGKA 1JKXA 5LYJA 1QR2A 3MEQA 3K6KA 3U80A 1WB9A 3OQBA 4N5HX 4Q7EA 4F2GA 1O6FA 3KXIA 3ADKA 3NALA 4HMPA 1JEYB 4ICIA 5F12A 4F3YA 1KQPA 3F1LA 5DHAA 3ZLTA 4A27A 5IK2D 2VJLA 4R54A 1FQWA 1GTZA 2PUFA 4CI0B 1JFFB 3GY0A 2JBHA 2PZKA 2QTRA 5FL7D 4IYRA 4ND8B 1DZIA 3JYQA 2GXUA 3OF3A 4RHEA 4UKDA 3G85A 4IICA 3TMYA 1FDWA 4O4HF 2WM9B 5A3SA 1P3Y1 2QVYX 1YI8A 4RZSA 4CTMA 1E9DA 1DCMA 1WCYA 3LCCA 3N87A 4YLYA 5REQB 3CPSA 1I7LA 2B2XA 2GD0A 2CUNA 3LBNA 3W06A 3L7IA 2P6NA 4AZ3A 5K09A 1HRDA 1U2ZA 2XMCA 1UK6A 5CX1B 1QGYA 2EF1A 4G81A 4PVCA 2MSCB 3LRTA 4RWEA 5AUNB 2HLDD 1UINA 4H4EA 1VG1A 3V7YA 4KXWA 4WV3A 3L92A 3VOSA 4LSGA 3ZNNA 6LDHA 3GQBB 1CERA 2V7QD 5K99A 1JILA 4X91A 1BMFD 5EWMA 1B74A 1VHJA 1EGHA 4XLZA 3KUXA 3B82A 1SA0B 3O1JC 1ZVKA 4P7GA 4YFYA 3FYCA 2C5FA 1T6XA 3E0XA 1XMIA 4GOMD 3NHSA 4OJYA 3WBJA 4KK4A 2V58A 4ZYWA 2QAJA 1SC3A 3OUUA 2EG5A 1GGEA 4L4ZA 2N75A 2PUVA 3FCXA 3QY9A 4JY7A 2D2VA 1L5MA 3V42A 5JAHA 4NZYA 3GJ0A 3A25A 3LSYA 3SG0A 3HACA 4CLHA 4I1PA 2ZYRA 4IWYA 3OFJA 1XRPA 3PGXA 1S8NA 4BQFA 3MT0A 1G6HA 4R8LA 4LJAA 2VJYA 4QUDA 4DMUB 2G63A 2B99A 3W4JA 4JYPA 4ZQEA 2C9YA 4K46A 4BNLA 3LGSA 3HR7A 2YWBA 1U5BA 3LWNA 4C4ZA 1Q1BA 2G6BA 1I30A 4MX8A 5ILOA 3BHNA 1E7YA 1MVOA 2O5EA 2PD6A 4AKSA 1ORHA 2QORA 3KXDA 3ZQKA 1EAMA 1XNGA 2DEUA 3PJRA 1KP2A 4WCFC 5G1NA 3T0FA 2HIMA 4GVXA 4L8GA 5AHRA 3GFPA 1FZTA 1PHPA 1RAFA 1T0IA 3PQCA 1G9SA 1MAVA 1HMYA 4TQ9A 4EHJA 3CT6A 3MF4A 1L5HA 2C1ZA 3KKOA 5I3CA 1THTA 4P4LA 1QXSA 4DMLA 4YR7A 1CY2A 4CLRA 1AB5A 4Q3KA 1NIPA 1C9YA 2OYSA 1GCIA 3C1OA 3JPWA 1NIJA 1IN8A 2GCPA 2VF5X 2VZ0A 4NYIR 3MWEA 4HQFA 4JVLA 3HXTA 4MKGA 1NT2A 2HU8A 2ODPA 5CH3A 2CXOA 2XUGA 2NVUB 1YR3A 3B5IA 3MJVA 4R1QA 3PNLA 4QHYA 5KVSA 1VE3A 3H8VA 2Q2QA 4UU1A 4C01A 2NU6B 3GLVA 2O52A 3GZJA 4CM7A 3PPVA 3NS7A 1TVKB 1WHTA 1RJGA 2FX3A 2R6HA 3PE6A 3H1AA 4X8OA 4R6XA 3PRHA 2QNBA 4TRJA 4U8HA 5DB4A 1GTVA 1Y3AA 2J0EA 4K87A 5CT5A 3ZY5A 5IZ4A 1KU0A 1ZL0A 2JCXA 4S12A 1XZJA 4FGJA 3RYFB 4I9GA 2JLWA 2OSBA 5G0UA 3TR5A 3DKKA 4JHXA 3QNWA 1TEHA 1INLA 4QHTA 4U7JA 3BD8A 3WIEA 5AW6A 2MMCA 1LFAA 2E1PA 3CS3A 1E5VA 4L22A 2AX3A 2JZCA 1KDOA 3ER9A 3JAKA 4YX9A 5HJ7A 5E6UA 2GBFA 5LDGA 5LMUB 1W5FA 2AH5A 4DJJA 2C9CA 4FX5A 5SY9A 2V59A 5EJ7A 4GYYA 5C1IA 3AF6A 5FT9A 4NFYA 1CR6A 5BOSB 4G0VA 1VJRA 4K03A 4GBGA 1CQPA 4H3SA 3AX6A 1J8VA 2R5FA 6CHYA 3GRVA 5JSFA 1LJLA 2OAP1 5KDOA 5I7AA 3OWHA 2DHDA 2RGEA 2W2VA 2X7JA 3PR3A 4PZUA 1LK7A 1XDWA 5L3ZA 2XDQA 3IJRA 4ADSG 4FWIB 1O6GA 1U0JA 1GARA 2V6IA 3A1FA 1NN0A 3JV7A 1YB6A 4EENA 2UYHA 1JEDA 1HT1E 3BGSA 4U1RA 4AN4A 1W4LA 1BDJA 1X1CA 5IF9A 2NUAB 1V6SA 2WDPA 1TYCA 5CXXA 2UUPA 2R8YA 1YRLA 3WC4A 4CIAA 3ABSB 4XLTA 4W1QA 5GOZA 4BMPB 4D0GA 2E1RA 3SQOA 3THYA 5CEJA 1FFDA 4ZMBA 3SFVA 4LK3A 4LJSA 3Q8WA 4YY3B 3EGWA 2OHOA 4GQIA 1UAYA 2Z5LA 4PIVA 4OP2A 2C9ZA 4PXSA 3WI7A 5KMGB 3GELA 1XNJA 4GL2A 2X8LA 3U4HA 1J5PA 1W0CA 5D3KA 2CJYA 3WIBA 2HJHA 1YBMA 3FUXA 3H5WA 2X19A 5L3QA 1YMVA 5E6RB 1ZIOA 4GFDA 2ZRKA 4UUNA 2RBGA 4BB0A 4I1YA 2JKZA 3S2IA 4YV0A 4KGZA 1J8DA 3VV2A 2F62A 4JGGA 4NCIA 3K71B 4WX2B 3L8EA 1XMOB 2NXNA 3FDZB 3H5OA 3KB8A 5IVKA 1V48A 1P0MA 4J03A 5GY7A 2AFHA 2H29A 2Z9CA 1FYFA 4PY2A 1N75A 4DCTA 4JI4B 3O1IC 4OYYA 2VYVA 4TKVB 3ZHVA 3CU5A 4QDKA 1SHKA 1VI6A 1E5DA 1VSTA 4E12A 2ZSEA 1EK1A 5ALWA 3AZPA 2OBNA 5JNRA 2YDYA 1QJ4A 1COZA 1K7SN 1M1YE 4C43A 1KWGA 1D5CA 2UUCB 1JTFA 1JLKA 3FVTA 4C4XA 4MGIR 1LDGA 4E2XA 1UEIA 5AKLA 4EG8A 1MBZA 2GFQA 4CEHB 2ZRMA 1Y7TA 3D2BA 3D8NA 4KR3A 1Y37A 3B51X 1CIVA 1OBHA 1DV1A 1VHLA 1AZTA 1TAGA 3EB9A 2FJUA 3QOFA 1UZAA 4J76A 4RKWA 1ISRA 5FULA 3ZKAA 3M7IA 3RHFA 4Q01A 4BLRA 3QFHA 3V7WA 5EESA 1NVVR 3LQFA 2ZDHA 1IHXA 3HKEA 4RY2A 3U62A 4CIWA 1PW5A 5ITWA 5E4FA 2YJGA 1DJQA 5GONB 1XCLA 1U90A 5DGCA 1HGXA 4M99A 4WBNA 5HUJA 2VP2A 1RHQA 2N3ZA 3X3HA 2AFIE 1OLUA 2PL5A 2W83A 2Y66A 3KEMA 4UEJA 4IIEA 1A8PA 1DB3A 5LB4A 1WSDA 3UCFA 3VVLA 4GWLA 4DLTA 4EYQA 3GVIA 1VPVA 3AVWA 3NRBA 4RFSA 3EW9A 3UAZA 3HBJA 4D82A 3V3KA 2IRWA 3LQKA 4WKBA 3FPSA 4IJ5A 2ZBUA 3AETA 1C3XA 1R9MA 1TZ2A 3KUDA 4X61A 1RMQA 5BRAA 5I7VA 3LT4A 1ZHOA 1BH2A 2X7XA 5DV9A 4HMOA 4IEFB 5E6SA 4ZEWA 3GVXA 1ZGGA 4Y6OA 2BUBA 3IP6A 4MWOA 4V1CI 3GWGA 1CUIA 4I50B 1NJ2A 5EIBC 3EYWA 1PT9A 2R1VA 4OU4A 3F49S 4CGZA 2O3TA 1H2EA 2C95A 3KWMA 2FPGA 3NIWA 4ODIA 5BYJA 5E8JA 3D8SA 3A1WA 1Z4MA 2WSBA 1E1CA 3T3GA 4YEDA 4QC2A 3HO1A 3ICQB 1TVKA 1WHTB 1DLJA 1AKRA 2O9JA 2XRZA 1K63A 1V8DA 4KX3A 3REQB 4G0NA 2DKFA 5E6RA 1Y9AA 1YHNA 5CDTA 1WNTA 4PG5A 2B37A 4Q4JB 4DV3B 4TWBA 1Q0HA 4RZ2A 3JD3A 3OOHA 3TUZC 2Z98A 3PFKA 2ZUSA 5HJ5A 1XJQA 1FUEA 4IVRA 1E0AA 4O29A 3T4XA 2WHPB 5H7XA 4UEQA 4BNKA 2QROA 4R7GA 1G8AA 1U80A 3E2PA 4JFAA 2EC5A 2QN7A 2XOEA 3OHMA 4IGAA 1XTQA 2NWQA 2XRFA 3AFGA 3RVQA 4D9NA 4DUPA 3RS8A 3W5AA 3AVTA 3PQ3A 1KI9A 3IV9A 4GI1A 4NZPA 5ED4A 4NCBA 2GBLA 1M54A 2R3SA 1YJCA 3HNPA 3OFVA 1CJMA 3DMGA 4KDEA 5DM4A 5TR9A 3TM5A 2IUYA 3ZXYA 2A0WA 4HOYA 5FI0B 1UPXA 4BJHB 1AQIA 4B6SA 4D4KA 2IYEA 4W6ZA 1GGJA 1RLUA 3QE3A 2RHWA 2XDQB 5B37A 4BIIA 3CH7A 1XMXA 5IASA 4CVNA 4FSDA 4CEIB 3KVNA 3TGWA 4WK0B 1G20A 1JHVA 1UAGA 5CT8A 2Z9DA 1T15A 2ZYIA 1EE1A 3B1JA 1V43A 1RI5A 4HRAA 2ZUFA 1TRKA 2WI8A 3G0OA 3KB6A 2VZ9A 3LWBA 4GWKA 2PRYA 1Z7WA 5BORA 4K9OA 1UMKA 2AJCA 1QGAA 1IZ8A 1T10A 1ZN9A 2XX3A 3MQ2A 1H6BA 2QT0A 3G88A 2Y0BA 1AJEA 2SHKA 1SURA 2QTAA 4MVCA 1A71A 2JZNA 5ER6A 1BJTA 1GPMA 1RHUA 3CA8A 4M60A 1M8PA 3R7DA 3X44A 3RYHA 2ZSUA 2NYAA 2YKGA 4Y2JA 1QM5A 3N8KA 5AVUA 1NN3A 4M1WA 4HGNA 1U3UA 3WGQA 3PC8C 4NONA 4PTZA 4LGCA 3INRA 2XXJA 2WU0A 4V3BA 3CZ4A 3DM5A 3Q40A 3H3JA 3U44A 2AQKA 1YU9A 1I8TA 4WXPA 4YCLA 3QX3A 1Z47A 3B48A 2ZIZA 3I6BA 3DWIA 4EKDA 3IEVA 2VPPA 5L9AA 3VM6A 1VSQA 4TTPA 5FFMA 5JRDS 2EJVA 2PBZA 2H1FA 4QTTB 3E5HA 4UC0A 1JVNA 2DBYA 3AUKA 3NBMA 3NFRA 3N39C 4MV8A 2WWGA 2A14A 3RG2A 3TLBA 4N3NA 4BFCA 3TEFA 4FBLA 2QDKA 4AT1A 3IALA 3DDUA 3NIDB 4QYIB 3UPDA 4BVFA 3LQ4A 5G0WA 3HXQA 1FS4A 3ENWA 3HHPA 3U5ZB 2C4WA 4Q4LA 5KUTA 1IB6A 1M0TA 3KAKA 3CCBA 5A4IS 2P75A 3WISA 4LNUB 5IN4A 4LZZA 4YO8A 3QU7A 3L8GA 4KIWA 1ECLA 1AURA 1RBYA 1U1DA 3F8WA 1Q92A 3IEXA 4XUGB 5IDYA 3ZQUA 4YUXA 3THXA 5GJBA 2WA1A 4UTXA 1V2GA 1YAJA 3QKWA 1ZGCA 4J3NA 2QM3A 4Y2TA 3I2IA 1PG5A 4TV8F 5BSWA 3AB8A 1YZFA 4OUDB 3S5JA 2R5NA 3EPJA 4I4LA 1CXZA 3RTBA 5LD2B 2R7MA 5DNUA 1WMEA 3IMKA 4RSGA 3Q8XB 3WGKA 3ZY6A 4WZBE 1EFDN 2QQEA 1C3OB 4TM8A 1UMBB 2A67A 1IWPB 3RSHA 2PIAA 1N5OX 2BL4A 4JP8A 3H83A 1ECCA 1W9HA 4RH1A 3ME5A 2JBAA 3IOMA 4NBWA 2HDHA 4B7CA 2EXXA 1X94A 3JQAD 3QOXA 3I0ZA 2YV1A 3RT7A 3I5MA 3DVAA 3VO8A 4XQCA 2QN9A 4UUBA 4XGQA 5LLTA 1CCWA 2IHTA 4YTEA 3CUUA 4ZVTA 2DHRA 3VYRB 3ABQB 3ADDA 2K87A 3PI7A 3ILYA 1PK7A 4RZXA 3WK4A 4YASA 3O26A 1MIOA 1ZA1A 3HB5X 2UYYA 4QYWA 3S99A 1P0FA 1U2GC 2Z2YA 4BKPA 1LSUA 1FIUA 2HOQA 3Q9UA 4AJEA 3D0QA 4LI0A 3K8YA 2JFFA 4WMLA 3BIFA 4PICA 2QTCA 2WYIA 4PC3A 1ML3A 1FFAA 2JD0A 3ELWA 4IS2A 1PT5A 3F0TA 4YMWA 2JJ1A 3IBYA 4NNOA 3T0GA 5E1DA 3X1YA 5C3MA 2AQHA 5AM2A 1FRNA 1YR8A 1YVDA 2V3VA 3CMCO 4EHBA 1XE3A 3E7FA 3Q4GA 1F7VA 9ABPA 3HP4A 3INYA 4ZHQA 1MNQA 2C2MA 3OEED 4BOYA 2QF7A 3BWEA 3ADBA 1F1JA 2A7XA 1MABA 2REBA 4B87A 3VYWA 2OCLA 5LP6A 1F5NA 3F9RA 2JCVA 4OHYA 3GNTA 2VKQA 5DLQC 3WQHA 3GNLA 3MELA 2O0HA 1YZGA 1NHWA 2IEYA 3WB9A 2ZWIA 2IITA 3EQ2A 3SIXA 3DEIA 1G3MA 4YYZA 3DUFB 3T94A 1NJ5A 2ZRFA 4AKTA 1EQ2A 3MJEA 5AM0A 4UUQA 1DKPA 3F5FA 2FZKA 2B7LA 2G83A 2XUKA 2IDZA 3EC7A 4Q3LA 2W00A 3ZDRA 5DN6A 3P4UA 1DBSA 4B2PA 1LRKA 1E99A 3C3WA 4WDQA 2GZ3A 2GM9A 4EAAA 3IB3A 5FCDA 3ZHRA 4O2LA 3DE5X 2GHRA 4AFNA 1WMDA 2ZJ3A 3LA6A 4HTFA 2FOLA 4KPGA 5DIFA 2P5SA 3W34A 5JAMA 1X9IA 1MVNA 1U3WA 4MB6A 4N39A 2O2XA 4A6EA 1FX0B 3OZEA 4IIXA 1D2MA 1NHGA 3L8HA 2WFLB 1Z5VA 3N2YA 5B53A 2JH3A 2IIVA 2WT9A 2Y93A 1QFSA 1QRRA 2OOKA 3NHYA 3VOBA 3T7IA 5EY5B 1P2BA 5K8JB 1EFHA 4JFRA 3D2LA 4CKBB 4MVJH 3ETGA 4H7KA 2B35A 3AEQA 3MINA 1E9VA 3U4AA 2AIRA 3L6DA 3O91A 5FUXA 1XZEA 3H04A 2OCAA 4CTJA 1O89A 1VE6A 3C87A 3GOHA 5ERGB 3SYKA 2GASA 2FRDC 2QY9A 3N76A 3DZFA 1UUFA 4PC6A 1KI8A 2HRZA 5JNLA 3FSJX 1QIEA 2Z08A 1NVXQ 4AS2A 1KH2A 1HE3A 5KTNA 5P21A 4G8CA 5T6BA 4CDNA 3R9XA 4YWHA 1P5RA 5ER9A 1T8YA 5BSRA 1FUUA 4N5IX 2IHVA 4S2EA 1WPQA 4NU6A 1TEVA 3U3MA 1VGQA 3HXPA 4FMCB 3BSSA 3M9LA 4I1OA 3AHGA 3LY5A 5G1PA 1LWOA 1V8OA 1AGXA 1C80A 2I1QA 2YXPX 4G3XA 1VRWA 2JKYA 1GVHA 3VUFA 1AH2A 3HJTA 3MCTA 4MCIA 3UK0A 2VDNB 1DUVG 1Z6ZA 2OT3B 4K8OA 4ZVOA 2SICE 2WDZA 3ETLA 4JLPA 3OH8A 2C20A 1HA3A 4NPCA 2JFVA 2FW9A 4DWWA 4ZVQA 3LWZA 1UDXA 2I2WA 5B7GA 1PFYA 2Y8EA 4TLDA 2Y0CA 4MAAA 3B5JA 4ZO4A 2WIDA 2WUVA 5CFRA 2X6RA 2C99A 5EMMA 3KJNA 4I1IA 2FFJA 2P1ZA 2V8OA 2BCGY 3M6IA 1B2LA 4FS8A 5IXJA 5EHGA 3H16A 1EWVA 3BTSA 3L6RA 3T7KA 3WLSA 4ESEA 4JUBA 2ORYA 1XPUA 5HVNA 3QXXA 2W6JA 2XMRA 5H3LA 1PR3A 1QV7A 3TN7A 4OD0A 4FFWA 4DDUA 5A1JA 4O2BB 3GD7A 2B0JA 2O5RA 3CZCA 3DZKA 4P4TA 2VQ6A 2JIOA 3E53A 3P20A 1PFKA 4KXUA 2H7CA 3C7CB 3IJ5A 5HCIA 1F1BA 2ROQA 4NH4A 4B6OA 4C06A 1RRVA 3H13A 1UOPA 2G1JA 3WL4A 3H9BA 1Q50A 1TCUA 4I0WB 1XVLA 1M8KA 2G4LA 4HX2A 3DKIA 3R75A 3OJOA 5JPCA 2IL1A 3K70C 4CKWB 4YRAA 2XF2A 1AC5A 4JLVA 4PYJA 5BPFA 5TQ0B 2G72A 1KBOA 1LWNA 2Q6VA 3B70A 3F47A 3HUFA 3OZCA 4K2AA 5IT0A 1JPNA 1W581 3P2IA 2JGDA 1HLPA 2YFHA 2VXOA 4YR9A 1BXGB 1G0OA 1QZXA 1G3IA 1K8XB 1XL0A 1Y8CA 2HXSA 3K1AA 4NFHA 5BV0A 1DBVO 2NTVA 2O59A 3NWBA 5U4XA 4KITB 4TS1A 4UPEA 3EIHA 2WJIA 1L5RA 2Y1CA 3ER6A 3PNSA 4UCXA 1CVIA 1I1OA 3NBUA 1D6JA 4MWCA 4WOBA 5BURA 2F43A 4EHLA 4QLBA 3F4KA 3A14A 4QE3A 3NTXA 4KLCA 1C0PA 1MO5A 1RMTA 1LVGA 1TJYA 4Z5XA 1TQ8A 1CDDA 1Z38A 3QVVA 1CQIB 4C89A 4FGLA 4OLFA 5F1YA 4BRWA 1H2YA 1KKLA 2YOFA 1GP2A 4XCXA 2Q28A 4RJLA 5HPYB 4C0QC 3UJDA 221PA 1NE2A 2JF0A 3JWEA 4MK4A 4R69A 5MFZA 1RAIA 3HEAA 4BAZA 1TAUA 1J2TA 3ESDA 1QAOA 1UJBA 2H17A 1UJCA 2JFNA 3CF2A 3G68A 1USUA 4J94A 1UMDB 1L5QA 4Q48A 4Q9JA 4CLOA 2D1TA 1TAQA 2HFKA 3MYYA 4XSVA 1KI1A 1IC6A 1N5MA 1ZPDA 2QP3A 5DO9A 3VR2A 3TOXA 1DPGA 2C2WA 1SBHA 1OD6A 5AW3A 5AKZA 1YVEI 4HDCA 3KLPX 5FEMA 5B3JC 4ZOCA 1XTBA 2A9VA 4NBLA 3N07A 4W7IA 4FMDF 4W9NC 5EP2A 4BNFA 4AULA 5F23A 1CYEA 5GZ6A 1W73A 3MINB 3ZIUA 4IF4A 2FEWB 4CLEA 2I1WA 3E9YA 4J8PA 1XVUA 2W6ZA 3P2YA 2AMFA 3PCTA 1VXOA 1HURA 4LRSB 1U02A 2H4WA 1H1DA 3ETHA 1NQAO 1R00A 4LHVA 5J47A 4IIJB 4Z4EA 4B4KA 2AJLI 3FWHA 3IE2A 5KQPA 1T4GA 4BO1A 1MB4A 2GN6A 4HNHA 2YL2A 3LHFA 2QG9A 5FBRB 2VPXA 1K97A 1JAHA 1C4KA 2ORWA 4JD5A 4LMPA 1M1UA 3ABRB 5E9WA 3WRYA 2F67A 1DTWB 1R0WA 3CFYA 4ND4A 1PEDA 1M34A 2H4HA 1OZFA 3IYLW 2ISSD 4FR0A 3SIWA 4HDMB 2IEDA 5CYFA 4FWTA 1Y6QA 4EYSA 1KI7A 1M10A 5DTMA 5IANA 1PG0A 2GI4A 1ZDMA 3FMIA 3STWA 5CB6A 4IP0A 1JSCA 1SOAA 4X97A 1OLXA 3PT9A 3E4DA 2HQ1A 2FEXA 2DYKA 1QIJA 3DQQA 1ZOOA 4LJYA 4QUJA 3R5SA 2CNLA 1UKYA 4QRDA 1KIAA 3JRXA 5EQDA 5HNKA 1P39A 3I9FA 3QU2A 1C4WA 3UUGA 5K3DA 1FJHA 2IOYA 5JWHA 2F1OA 4ZXPA 5KOIA 4LMRA 4QGGA 1EP3B 4F21A 3KTFA 5IX8A 2RHGB 3UK2A 3GGGA 4TROA 1YRAA 1GT6A 3RGWS 4ZIRA 1PQWA 1ZJWA 1W30A 1ZRHA 3EH2A 1UXOA 1ZRNA 3BPSA 1PD1A 2H31A 3TFWA 5BMVF 2OV8A 4X3CA 5FTWA 4JL6A 4PLCA 4UHDA 2PGDA 2JHPA 4M9XA 4BV2A 4DLNA 1QH0A 3EVFA 4Q1DA 3KD2A 1Z15A 2FP3A 3GUZA 2IV7A 3VU9B 2HA5A 3FPFA 5FLYA 3T54A 5J4VA 3C3CA 4FYIA 5F52A 1IOZA 4C0XA 2KHZA 4E31A 1T3TA 4X5OA 1ADCA 1EFAA 1I2AA 1DCKA 4IWXA 2PD3A 1P8JA 4Q4HA 2H5JA 2B1JA 4IMRA 4XTRA 3D59A 2ZS8A 3DSRA 3LCUA 3N1UA 1AB6A 1VJ1A 3P2KA 2ZBQA 2X8BA 1W4AA 1B73A 2PX6A 2XMPA 3FHJA 5CVEA 3PUXA 1K6XA 2AKAB 3ROMA 4G5OA 4XVUA 4YQZA 2PZBA 4P84A 4ZT3A 3JATB 3RLIA 2ZJOA 2BT4A 2IEAA 3N70A 4UMVA 4QU9A 3SSNA 3AOGA 3WDSA 5LOVA 5J23A 3N58A 1Y5NA 4NBKA 5DSTA 3L1IA 3P0HA 2QN6A 3KAJA 5JUWA 2Q3FA 1Q1ZA 1A0OA 3RYTC 3ZLBA 1MOSA 2C9DA 3OOEA 5EXEA 3RNOA 2PRIA 3MMPA 5AOAA 1ZH0A 3IPXA 1AMNA 1KERA 1ZI8A 1ZQ1A 1ZW6A 3K0CC 3TBFA 4H7JA 3TSWA 1AT1A 4C6RA 1K89A 3OI7A 4B33A 4HPWA 4WLOA 5HK8A 3W8DA 4XI9A 5JH7F 3AF1A 2P78A 2EKBA 2FN9A 2PR7A 2YJTD 3EPHA 4OAOA 1O5OA 4I6GA 4PWZA 4MRRA 4K40A 4QU0A 1MW9X 1AKEA 3LW7A 1B1AA 5AVKA 4TQGA 1E1LA 1QO9A 2G82A 2FZ5A 1JEEA 1N7HA 3IBSA 2I3DA 4OIFA 4X9XA 3B20A 4UU0A 5CK5A 4QUIA 5EE5B 2EP8A 4W99A 1B8UA 1GY8A 2WHQA 2Q4DA 4H27A 3S44A 5IG2A 5COAA 5CA1A 5TMPA 4CLRB 1JA1A 3S70A 2PT9A 3D6JA 3INTA 4TWRA 1UWVA 3HKDA 4HDNB 2OBYA 1J0XO 1MIHA 4C87A 1PX2A 3W8RA 1DBQA 3HDYA 3N2GA 3QJGA 1TT7A 4LVUA 2EJCA 1FYDA 1ODTC 1UM9A 3VKVA 1DI0A 2HEIA 5I9BA 3FPBA 2OYCA 1V11B 3BGVA 4G37A 4LRYA 3WA7A 4ZRNA 1N8NA 1VLJA 1O6BA 4DQLA 3KQWA 2OFXA 3MT8A 3SMQA 3BXXA 4X0EA 1BWQA 2AQIA 5BSGA 1IZ9A 2J31A 4ME6A 2VS1A 2X9QA 2R60A 4X7RA 4YJ3B 4ZCQA 1OBFO 4BLOA 3HZHA 5I7WA 2CVOA 4MVJM 1RIFA 1Y34E 4PAMA 4YRBA 1UEXC 2G9RA 4YT2A 2L82A 4KIFA 4ES6A 4RTLA 4KDFA 1M2JA 1R27A 1QHHA 4PG6A 4TL9A 2AFIB 1IHPA 2DERA 4YT8A 1AGNA 3TO5A 1PR4A 1U7DA 3EPKA 3HVJA 1UOQA 1QF6A 4W63A 2QQ0A 4BN4A 5LZ4A 5JSHA 7MDHA 3V3TA 1UMBA 3I1JA 4R1OA 4EVIA 4J91A 1OOEA 1L3BA 3GRFA 2IPXA 2A92A 3GFVA 3R7WA 3O1LA 4G4GA 1O95D 2IYSA 2TRSB 1PQ4A 2V7UA 3IKJA 4BVAA 1VPWA 3CNEA 3M6MD 1UXJA 1MN6A 4P5PA 4OQMA 1XA0A 1Z73A 1GAEO 1IFXA 1SU4A 3MSCA 3F3SA 4MKRA 3BBPA 3PQ5A 4XFDA 1FMTA 2F8TA 3VTAA 5IJZA 3RRZA 1FMLA 3DBVO 4RTOA 1JI0A 1M6HA 1KZ1A 1C3LA 1RWQA 2P9CA 3PDUA 4FFBA 1ADGA 2QLLA 3K73O 3D2AA 2GAJA 2ZJ6A 1T2NA 2BGJA 3L0PA 4O2BF 3KR1A 4ZT4A 2WP0A 3QBJA 5ADUS 5C1PA 3TYXA 5GMOA 4BO9A 3RS5A 2A30A 1QVVA 4PE5B 4YHBA 1AHNA 3UYLA 2XGMA 4KO8A 1W1IA 5FWDA 3TEMA 2FXVA 4TMWA 5JZMA 4ZGWA 5F5NA 1PJCA 1H6AA 5JW6A 4F2WA 2BFCB 5I9SA 1U98A 3PPIA 2QOEA 2BMVA 1CQXA 4V0KA 1W7AA 1IRIA 4NOJA 3W4IA 3B3JA 1C7FA 2B6HA 1AGPA 3PHBE 4FI3F 1FFHA 1MT0A 2V5UA 3DC7A 4QGSA 2VL7A 4C4AA 1T8UA 3O21A 3LC1O 4G5YA 4QYMA 4UDNA 1FFSA 4MQMA 1FVXA 2OZVA 5JCPA 4CIBA 1NXPA 1Z8NA 5MN4A 4KFTA 4H7DA 2IK8A 2X4GA 5CB8A 3U4IA 4M7PA 4WCFB 4B7XA 5I7OA 1XX6A 2R7NA 1VGRA 1K5GA 1DIBA 4MUBA 2OV4A 3E8SA 5T8KA 3PXEA 1PE0A 3KQPA 4NBSA 2J45A 1W1UA 1AHPA 2IE8A 1RCFA 1PN3A 1QWSA 4LA4A 1KY3A 4WINA 5EWLA 5FR2A 3T5AA 1M5UA 4E5NA 4I4TF 3RODA 1L4GA 5I4IA 3T7DA 1PT7A 2CBZA 1KSFX 1L4BA 2YRWA 3ZXIA 5LJLA 1CU1A 3TLXA 4LOLA 5G1OA 1Z2PX 5JCJA 1EKXA 1OUMA 1PBNA 3IEUA 3QBEA 5JZBA 1OAOA 3ABIA 4ZWNA 3V7NA 3W5HA 2A5FA 4DLVA 4NAVA 4OQPA 1L7PA 3W78A 2QM0A 3UIEA 3AJ9A 4DHEA 3A28A 3ECAA 4OGLA 3GJ5A 2HL6A 2QRLA 3MGKA 1QFJA 3C3PA 4YV1A 1ZRMA 2XYQA 4MKHA 1HDGO 4XTCS 2XGSA 1ZIPA 3G0IA 3HKEB 4IM7A 5A4MS 5JSYA 2W0SA 2G0AA 5B1EA 1OWLA 1E20A 1F60A 3CZQA 3EVEA 1ZMBA 5DLDA 3CMMA 4URYR 1T29A 3RSQA 1CIPA 1NBMA 4BE7B 1EJ2A 3OU6A 1DT3A 3WSVA 2X5KO 3KETA 1HF3A 2JHAA 4FFMA 3WGZA 3FLBA 4Z86A 8ABPA 1RQPA 2PMKA 3VKUA 1PWZA 1TVEA 4RF3A 5WRFA 4JI6B 4A8JA 5JD4A 2ERCA 2XCQA 3HP1A 5BV1A 3R8FA 2PYDA 2DUNA 4FNOA 3AUFA 1CUZA 3H11A 1XPOA 3A36A 3WLJA 4TTSA 1WB5A 4JI2B 4X63A 5JQGA 1GDDA 2BPOA 3LKVA 4HH4A 4UXIA 3SN6A 2CY0A 4BFZA 5FTJA 4RTKA 5C32A 1E2QA 4CM4B 2CD7A 3ZW8A 2PX0A 5JADA 5BN5B 2PH5A 4IQGA 3H1FA 2G7MC 1U9JA 4RD2A 1DKOA 4RKRA 5LUBA 4G8JA 4KXXA 3RGGA 3IKTA 3FB1A 1P17A 1I6WA 1M8FA 2RHLA 1A2OA 2VBFA 1CLEA 2XLCA 3KLOA 3PXXA 4IDFA 1OAKA 5JBQA 4NIMA 3K2QA 4M8LA 2VWQA 5ALYA 2DU8A 3BF8A 1QQ6A 1NMZA 1QYVA 2ZR0A 3Q9NA 3V8NA 2OK8A 5DM60 4O1IA 5A71A 1JR3A 1RJWA 2GPBA 2WYOA 3GDHA 4LQCA 4BZPA 1IBMB 5JD5A 1LC0A 2FUEA 1OX4A 4ZEOA 2ORIA 1NW3A 4IVNA 5TIIA 1K7FB 2JGEA 1RNLA 2IZOA 5F3RA 1KQFA 5C5IA 1EBUA 4LJ6A 2IYUA 4OHOA 1Z4QA 3QKSA 2JARA 4I50A 5KOJA 4RZQA 2UU9B 1VDZA 2G08A 2LIVA 1SNYA 2NZ2A 5F51A 4P34A 1O9HA 2AYYA 2PFGA 4L15A 4LWOA 3CN9A 5C80A 5EJEA 5AI8A 1A27A 3I0MA 2Y71A 3WKCA 2O2CA 3H9UA 1G21B 5ALPA 4CBVA 2D8MA 4MAMA 4WN9B 3WKAA 2J9FA 6NULA 2JRCA 3H84A 4EVSA 1JYFA 2B8WA 3L6CA 2OM6A 4HB0A 2UUAB 5HKKA 1QUEA 5KC9A 1D4OA 2YIJA 3ISVA 2I2DA 2HI0A 4K0KB 1QG6A 4TVKA 1BHSA 4FPXA 3WYFA 1UBGA 2RK3A 1E5XA 3QYAA 4IUCS 3UKDA 5KVAA 5A4JA 5D3ZA 4EQ6A 4KDRA 2FWJA 2QAIA 5BMVA 3RS9A 1XAHA 4F92B 2RONA 2XR1A 3BQ9A 4AS3A 1BIFA 3MK31 1KEKA 3NHJA 2YN0A 1PFVA 4LBYA 4ONEA 4D9CA 1F9EA 2WNHA 1M73E 4R2IA 4UPDA 1EUZA 4K86A 3TZ6A 2TMYA 4QFCA 2Q8QA 5IWCA 3VDRA 4CKEA 2ZCVA 1D6SA 4ZQBA 2I7XA 3UFXB 2VH1A 2R1TB 1I6MA 4D4HA 4MWEA 2GJAA 1GZ7A 1W76A 2IYWA 2WM2A 3A6FA 3PIRA 4JNKA 2C88A 2H4JA 3H65A 4LF8B 2OO5C 5ALIA 5IKOA 3V8QA 4YH1A 1XFAA 2F1HA 4D92A 1H2BA 1ZIDA 2RI6A 3SJBA 5I7FA 4FE4A 1B6SA 1LA2A 4EYOA 4LOAA 4KNYA 1E2NA 2X86A 3TCXB 2BFOA 4KQGA 3RFVA 1TFUA 3JU3A 2X40A 3T3HA 2GTPA 3IQWA 2XSZD 2WAAA 4M9UA 2DPYA 3MBKA 5EKXA 3OCZA 1U8YA 1WF6A 3VNBA 3B5EA 3GFGA 4XQEA 4ILKA 3NWJA 3T7TA 5C7IO 1KSGA 4UQLA 1MT3A 1EI9A 1PWHA 4L78A 1FF9A 1KZ6A 1BDIA 2ZZKA 2I4LA 1IBSA 4CUZA 3WLAA 4JLAA 2NUTA 1BCSB 4BU1A 4K6CA 1U2RA 5TQ0A 1OB2A 1B0UA 2W71A 2VRWA 3RTEA 4LFBB 2P90A 3UT5A 3PQ6A 5EJ9A 4NBVA 4C9BA 1G2IA 1Z4PX 3I04M 1T9DA 1ZGHA 4GS5A 4AY5A 3F7OA 5KJCA 5M3BA 3ZI7A 2EFEB 1SCDA 5EINA 4TRNA 3LD9A 5B57C 1QE5A 4PQGA 4D3XA 4OJQA 3CIFA 3G02A 1B6RA 1CJTC 5DH9A 3SVLA 1LDYA 3C3YA 4QJ5A 4D4IA 4ACAA 1UH5A 2BDTA 4OATA 1ETHA 5F3DA 1E1MA 1CZHA 1JEJA 3CEHA 4O2AB 1K7XB 3DD1A 1CUHA 2VJQA 3G49A 2OCDA 4RESA 1PZFA 2JFQA 3DXXA 5F21A 3FJYA 3MFYA 4Q66C 3FUCA 3HDVA 3ZTWA 3FKSA 1OLXB 3M0EA 4WI1A 3R7SA 4DV2B 4DV7B 2XUOA 3C6KA 3D1JA 4J0DA 2NACA 5FOSA 4AQDA 3U13A 2ZQZA 2WYVA 3VR3D 1J8YF 4D9HA 1WMBA 1IHUA 4KR9A 3AG5A 2VAPA 4MQFA 2C7PA 2JAUA 1P4SA 3HN7A 4N5LA 4LZLA 3STYA 3E9CA 2Z1MA 1O1YA 3VHXA 1ZM4A 3HVIA 3ABZA 2W2TA 2JKVA 4BUJA 3TGPA 4JLNA 4DIKA 4EX6A 3EZ9A 3AT1A 3CRMA 2Z8XA 3NATA 3NIBA 2Y6VA 2VJPA 4L8YA 4ZODA 2FCAA 2Q4TA 2QT9A 1E3TA 2HQSA 1OTHA 3DAOA 3FPJA 3GIDA 3IVAA 3THRA 9ATCA 1UKVY 2AXNA 4EY6A 1KO4A 4FYPA 4MVJF 2ES4A 1EJ0A 2CHVA 2C8KA 3SJCA 2PMBA 4MJ7A 4HS4A 2X0KA 2H1LA 3L0ZA 1VL8A 3IUNA 4ZA2A 3SKYA 4D43A 4Y1GA 1GPBA 4URXR 5K4HA 2Z56A 2G1PA 1XQXA 1XRNA 1Z39A 2B25A 3SR4A 621PA 4CU2A 2J07A 2MJLA 3AYXB 1ONSA 4LC1A 3HCFA 4BKOA 2C57A 3IBGA 2IC5A 2WTMA 2Y4OA 1ZM3A 5EJ8A 4IXWA 1ESNA 5KI6A 3RF7A 2JFYA 1PIWA 5J2TF 3BIWA 4FEAA 3OP1A 1G8SA 4FZVA 4X6YA 2FPPB 5LBUA 3PCRB 1UAAA 1XZGA 2X41A 1B42A 2FEKA 3MJSA 2VH5R 4P22A 3KPUA 3FF1A 1M3SA 4INJA 1YWGO 4DKJA 3ER8A 3RUFA 3O90A 1RCUA 1IJBA 3OE4A 5CM8B 3W4KA 1IATA 3UUWA 4HEA6 1E2LA 3LYHA 2AXQA 1YI0A 5I9LA 4C0HA 2VBGA 5KEIA 3GMSA 2I80A 3PLRA 4N65A 3RSLA 4E09A 4FHDA 3N7TA 3U9SA 4BY9E 3NV7A 3VU0A 3GH1A 1FXWA 3IT3A 3QIAA 4P5DA 3FZGA 1C50A 5AK4A 1O4VA 4L57A 4V2IA 3IV6A 5EIXA 4UAGA 4PQYA 3W6ZA 5AOCA 1E8MA 1P0QA 2A5LA 3BMOA 5TJHA 4COOA 4MW9A 4RLFA 1LPNA 3I6IA 4DQ0A 2I4IA 3QNMA 4OQNA 1TU4A 4LQLA 1QR6A 1YV9A 4TL8A 1XA4A 1SC9A 2RFLA 3EY4A 2WIKA 4M76B 3DKVA 4WAUA 3V1LA 4BNDA 1IY9A 3OPYI 2RB4A 1I5RA 4Q00A 4HLUA 3IO5A 4AAYA 1WABA 5KTYA 3MOSA 2KWIA 3RW9A 2QM8A 3P2JA 4Q03A 4KVFA 4DVJA 3L05A 4ZICA 1J0CA 2P30A 2P5TB 3VSCA 1YIDA 4A7PA 4EGSA 1O8CA 2MYTA 3HCPA 3TRIA 1Q7CA 4FE3A 4L0MA 5CFMA 1RKBA 1OC2A 4UTNA 3NYRA 4FSHA 3HXKA 3FWKA 2Q3MA 3E4CA 4ZU3A 3ESRA 1HG1A 2ZRPA 4IIGA 4KC0A 1L7DA 2GZRA 2OCIA 4LOIA 4C0SA 3DZHA 4ASUD 4MAFA 1YRWA 2GAFA 3WWDA 2P3OA 3U7QA 5CCBA 3FA2A 4MR7A 4AP9A 3FD8A 4EFDA 3COYA 3PZRA 2AFIA 4N4AA 4UREA 3WLLA 1DV2A 1XLTA 5HOQA 3C8DA 3M1AA 4INZA 1EESA 1WKBA 3A31A 4XDHA 3PLNA 2O2YA 3L6EA 3TTXA 1W25A 3P9PA 4JBWA 1E9SA 2HK9A 2WW8A 4GMHA 2O8CB 1SUFA 5GJVC 2G7ZA 1C8VB 2MIIA 3P9SA 1PFQA 3KR9A 1IVYA 1HWYA 4L9WA 1XU7A 5CXSA 1KAQA 4IDHA 3HZOA 3NM5A 2SBTA 3L40A 3ROEA 2JBAB 4BUZA 2IYOA 1OR8A 5LB2A 1BGVA 5FOVA 2XAAA 4Y1FA 1MO4A 5CA0B 1UK9A 3Q98A 2Y99A 3FR8A 2XOXA 2G8LA 1H2AS 4YDRA 1B2RA 3M83A 4KKXB 3R44A 2XB4A 2FWBA 3QRWA 1WMAA 1Z13A 3F5MA 4KZPA 2FRVA 3BQMB 4Z0HO 1NN1A 1HFWA 1L7XA 3OP4A 4LXIA 2QBYA 2D2EA 1GPUA 2O1EA 3MVEA 1A9SA 5DBHX 4DMFA 1FNBA 2JDID 2YJZA 5DBIA 4QJ3A 4JWTA 3BRWD 5AW0A 3L8CA 4PFSA 4H31A 1FXUA 3TL6A 1NYTA 1QYDA 1G5QA 2WLSA 1VJDA 4XXHA 1ZCAA 1EFVB 3A1NA 3OQ1A 1TLFA 3T6KA 2XMDA 1UQUA 4HUQA 4UBLA 4MR8B 1YS9A 3KJHA 1R8XA 4E5KA 5CDYA 2C31A 4H3HB 3OQJA 1YBAA<