3R3UA

Crystal structure of the fluoroacetate dehalogenase rpa1163 - wt/apo
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
304
structure length
304
Chain Sequence
GHMPDLADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHDRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIAQSAATPLDVWRKWASDVQGAPIESGHFLPEEAPDQTAEALVRFFSAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Fluoroacetate dehalogenase
publication title Mapping the reaction coordinates of enzymatic defluorination.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
total genus 119
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r3uA00
4PSCA 4M0EA 3EQ7A 1XZEA 2AXEA 3D0KA 3WA6A 4FLFA 1MNQA 1EXWA 1JJBA 4G1FA 4BTLA 2GYWA 2C5FA 2GYUA 1SOMA 1JI3A 5K3FA 1FFEA 2B4KA 3H18A 1ZOIA 5AKZA 4Q3LA 4PF1A 2PSJA 4U2EA 5EHQA 2ZYIA 3I2JA 4P9NA 4WCVA 4DNOA 1DWOA 4AN0A 1ISPA 5JATA 4B81A 2VT7A 3FSGD 3IIIA 4H7FA 3WK6A 2WG1A 2C4HA 4UBLA 4BAGA 4BP8A 2Z5GA 3G0IA 4Y9SA 4OU5A 2WJ4A 5JAUA 4AO6A 4UPDA 1ZGBA 4UHDA 4U2CA 2LIPA 3G0BA 3HLKA 3WWPA 3I6ZA 4JUIA 4J0HA 3ZPXA 5DJ5A 3IUJA 2XUDA 3I1YA 4F0JA 4ZGBA 3WKEA 2VJAA 3FOBA 1BCSA 1I6WA 3AIKA 2QZPA 4BP9A 3C43A 4OPMA 2ZJ6A 3AZPA 4WDQA 4KE7A 5IVHA 5AM4A 3O0DA 4Y2SA 2ZYSA 3C6BA 2XUHA 1T2NA 5IKXA 4OD0A 3WMRA 4BAZA 1XRMA 3QMVA 2H9YA 2WUEA 2Y6UA 4V2IA 1BN6A 3QMWA 2VSQA 1GQRA 1ZI8A 3GELA 4G8BA 2CMFA 3BJRA 4UFOA 3G7NA 2OAEA 2RI6A 5EI5A 1A88A 5K3EA 3O4GA 1KU0A 4J03A 4C87A 3KXPA 1TQHA 2I3ZA 3GROA 1W1IA 4HRYA 4FKBA 1AGYA 1G5FA 1JFRA 1JMYA 3G0GA 3QYJA 4E15A 2GBGA 1ZI6A 4K2AA 1SCKA 1DINA 4E11A 1JMKC 5FPPA 5FXMA 3HABA 4H35A 2H7XA 4Y2QA 3HJUA 1MX5A 1BE0A 1N8SA 2BUCA 4WFIA 2XQGA 2QUBA 1UKBA 3P2MA 1DTEA 1FFCA 2XMRA 4I3FA 4GBGA 2ORYA 4A16A 2QXTA 1ZICA 1J1IA 3D4LA 4NMWA 1E8DA 1AURA 3ED1A 3QZUA 1VXOA 1H2ZA 1XKTA 4BVLA 4PW0A 5LP1A 1RWQA 4AMZA 4YK7A 3H2JA 5BOVA 4QLOA 5A7GA 4EY7A 4Q82A 5I8PA 3G8YA 3N0TA 1XZJA 3IURA 3AFIA 2BUAA 2AJDA 3QITA 1FJ2A 2XT0A 2QJWA 5JZSA 1VE7A 2VJDA 4KRXA 3JYHA 1CUHA 1CQWA 4X94A 4IO0A 2Y6VA 4F21A 5ALMA 4LHEA 2WFLB 5ALWA 1LPSA 5CH8A 1MX9A 4MEAA 5ALUA 1DX6A 2OPHA 3SC2A 4AO8A 1R4ZA 1NX9A 1UT6A 1VLQA 5FRDA 4JEIA 4B0PA 3ICVA 1OCEA 1A7UA 3WL6A 1Y7IA 1MAHA 3A2MA 4QEKA 3U0VA 3C70A 5FKJA 1AUOA 1MNAA 4GEGA 1JT2A 2X8BA 4G8CA 3IA2A 1AC5A 1WM1A 5ALXA 1BRTA 3IULA 4Y2JA 1EDDA 3ZLTA 5CMLA 5ALQA 3W9UA 2WFLA 4EY8A 3PFCA 5AIBA 1IUPA 1EX9A 4J0JA 3PUHA 1SCIA 5AKXA 1E89A 4C88A 1MTZA 4BC0A 4CG3A 4PQEA 4INZA 5EHNA 1ODCA 5DYTA 1HKHA 1UZAA 1W75A 4W9RA 1XZBA 2CJPA 4UHHA 2JF0A 5I7UA 4EY6A 3A6ZA 3FWHA 3DEAA 4JYPA 5DTJA 2DSNA 3WK8A 5AIAA 5AM2A 2CKMA 4BCCA 3V1LA 4L0CA 5T4BA 3DCNA 2HFKA 3ICWA 2WHPB 3TJMA 2E3JA 3WJ2A 3WYNA 1U65A 1LPMA 5LZ7A 1X2EA 3KOOA 4W1QA 3QMMA 5JARA 1F0PA 4I19A 1F0NA 4U2FA 1ACLA 2EDCA 3WLAA 4OSEA 2XUKA 1YSCA 3R3WA 3ESBA 4HTAA 4BRZA 3C5VA 3PI6A 1XQYA 1PJAA 4J7AA 4M0FA 2AJBA 2O2GA 1WB5A 1BU8A 3A70A 1ZGCA 4N5HX 3FVTA 3L1IA 1MT3A 1CFJA 2HFJA 3QBJA 1EVQA 4WDRA 4N8EA 3LLCA 1TCAA 1LZLA 1VOTA 4KYVA 3STVA 1W6RA 1YAJA 5I9IA 4MEBA 1R9MA 2YYSA 4QE3A 3QH4A 2ZJFA 5AKIA 4J0CA 2OCGA 2CBGA 2PUJA 1BN7A 3MVEA 2JGFA 4DSZA 1K8QA 5CH3A 1P0QA 1E8MA 1TRHA 3EF3A 3OTQA 2I78A 3D2BA 3W9BA 2JIDA 3M81A 3CCCA 2O2IA 2C5GA 2PSEA 3H1AA 1JU3A 1EA5A 2WIKA 5ALKA 3O9VA 1XRRA 1XRLA 1BEZA 1XZMA 4ZWNA 4RNCA 5AM1A 3F67A 5HF8A 3WWOA 4OB8A 4MYDA 5ALVA 5IH7A 5AM5A 2XUIA 3AJAA 1X2BA 2UZ0A 5AI8A 3DOIA 2OCLA 2HA3A 5AK4A 4W63A 2VAVA 5T4FA 5A2GA 4Q3OA 3G0CA 1W76A 5CXUA 2HADA 3K6KA 5HZGA 2BCEA 5AM3A 3NOXA 2J4CA 1UOOA 3IDAA 5E4JA 1EDBA 1LZKA 4C4ZA 3QVMA 2ONCA 5T4HA 2Y2VA 3K9BA 3BWXA 4BE4A 5D6OA 4X90A 4H77A 2WJ3A 4M0MA 5AM0A 4Y7DA 2PPLA 3IB3A 5CT8A 3M83A 2P8SA 5AKHA 3S8YA 5JALA 1J06A 1VZ3A 4FDMA 5BV7A 2HA2A 4B82A 3WWCA 2HRQA 4G4GA 1W4LA 3VJLA 2XUQA 2OAGA 2D5LA 1QIFA 3FYUC 3KSRA 4PNZA 4BAUA 1GPLA 4ARAA 3H2IA 1VKHA 4XWGA 1BCRA 3KWFA 5CRIA 4GXNA 4FFVA 3STTA 1P0IA 5E2IA 4ARBA 4P08A 4QZVA 5KWIA 1XZKA 4HZGA 1MO2A 3KDAA 3H2GA 4JH0A 4DSAA 3B12A 4UHEA 1CRLA 4N8DA 3CN7A 3WK7A 1F6WA 3FVRA 1GT6A 3QPCA 5AP9A 2WLSA 3A2LA 2R8BA 3VJMA 3F98A 1H2XA 5ALSA 4PV7A 3WKBA 5T4EA 4HAIA 5AO9A 4CFSA 4GI1A 2WFMA 1N5MA 3STXA 3PICA 3I28A 3C6ZA 1TCCA 1WPXA 4DIUA 3ZWQA 1K63A 1TCBA 5ALHA 5JZ9A 2V98A 5AKEA 2X76A 4TGLA 2Z3WA 2PKYX 3AINA 3DL4A 2O7VA 4CI9A 3T4UA 5ALFA 2JGLA 1LPAB 3R3XA 5JD4A 2ES4A 4BYMA 3MUOA 1GPKA 4GHWA 1D07A 2QM0A 2HHAA 4C6HA 2HIHA 2QR5A 2JGIA 2OLEA 3R3VA 2YXPX 2DHEA 4DM7A 3NUZA 4L72A 1WPRA 1QIHA 3RKSA 2WUFA 4WFJA 2WSLA 4LYDA 2VQ6A 4OB6A 5AJHA 3E1GA 4J0GA 2WTMA 4C89A 1QJ4A 4X95A 4B85A 3V1KA 3WQHA 1L7QA 5SYMA 3DKRA 3YASA 2H7YA 5LYYA 1XZFA 3E3AA 4FWBA 4C01A 1XZDA 2GBCA 3VVMA 3TRDA 2XE4A 4LXIA 2XUPA 2HA0A 4UBJA 4DTCA 1BEEA 2VTVA 2BGNA 1VA5A 2QKYA 5AKGA 3Q8WA 4KE9A 4LXHA 1UOPA 1TK3A 4BTVA 2XI4A 1EI9A 3WK5A 2IIVA 4LKOA 4KE8A 1IUOA 3EQ9A 1MPXA 3F9CA 4GLBA 1U2EA 5DNWA 2I03A 4BC1A 4CIBA 1CUCA 2CZQA 5K5EA 1LPPA 2YH2A 2JEYA 3UUEA 4HXGA 3H17A 3ESAA 5EIEA 2BUBA 4HRXA 2WTNA 5AHXA 2YASA 1P0MA 3DL7A 2OGTA 1UWCA 5CURA 5H3HA 4L3WA 5DNUA 2W6CX 1EH5A 3C5WP 2XUFA 4DNPA 5HK8A 1MN6A 1O6GA 4G4IA 2ROQA 5A7HA 5A62A 3WWDA 4X97A 3GUUA 1XZLA 3C87A 3W2TA 3DS8A 1QO7A 3ZV7A 1T4MA 1DQZA 2J3DA 1EB8A 1A8UA 3LP5A 4ZREA 5HKBA 3SWWA 4EB0A 2G5PA 2ZJ7A 4LIPD 4BATA 2WG2A 5C7YA 1XZHA 5LZ5A 1ZIYA 4B80A 2V97A 4MQLA 4I4CA 3HEAA 4H0CA 1XROA 1UOQA 1Y7HA 4BRSA 1JJFA 2WUDA 3STUA 4Y2VA 4W1RA 1QIMA 1VXRA 1IUNA 2JGMA 3Q0TA 3OURA 5HCUA 5F4ZA 5DNVA 2CEKA 3C6XA 3ZI7A 1E5TA 1G42A 1UFOA 4QDUA 5HF5A 4KAFA 1L7RA 2AJLI 4H18A 2HU5A 1EHYA 2HL6A 2WHRA 3WKDA 4FMPA 2DQZA 4ROTA 1ZIXA 5AOAA 1QE3A 3LIIA 1JJIA 2RHTA 1K5PA 1U4NA 2QMQA 1C7IA 4QLAA 4S0XA 1WB6A 2QXUA 5FOQA 4GECA 4CG1A 4AZ0A 5ALOA 2Z8XA 3ZLVA 1QO9A 4TVKA 1XQVA 3FYUB 3G9TA 3DYVA 2JEZA 5KBYA 3NGMA 3WKCA 2VEOA 4HS9A 4EA6A 4BBZA 3DOHA 4A23A 2ZYRA 1R1DA 3O4IA 4O08A 5IVDA 1XRNA 1USWA 1THGA 3H19A 3RM3A 3IUNA 4J0DA 5SYNA 2VA9A 3R40A 4CIAA 4D9JA 3E4DA 3IVMA 2OQIA 4DMFA 1HL7A 1QTRA 3DD5A 2DHCA 2RHWA 1XRPA 4BZZA 2QUAA 4BVKA 1U8EA 3VXKA 2XLBA 3QM1A 1H2YA 2GYVA 1YCDA 1SC9A 3FYUA 1GXSA 1KEZA 4OCZA 5CW2A 2G5TA 1ORVA 4N5IX 4AMYA 1AQLA 2FX5A 3R3YA 4DGQA 5ALIA 1W52X 1IZ7A 4UBIA 5HKAA 5ALRA 2V9ZA 2XB6A 2H1IA 1YA8A 1ZD4A 3O95A 4WJLA 4IH1A 2OQVA 3CXUA 1ZJ4A 3R0VA 4OU4A 5EHZA 1OXMA 3VDXA 4G5XA 2IX9A 3VVLA 2RAUA 3OPMA 2VAXA 4RGYA 2PL5A 3WK9A 3C6YA 1XLUA 2HA6A 3G02A 2XMSA 3FLEA 2WM2A 1F8UA 5FP0A 4GDMA 1EB9A 2WHPA 2OXEA 4AQDA 3JW8A 2RGUA 5EIAA 1XQXA 5ALNA 5HQ3B 4X00A 3AIOA 3B3QA 1KU6A 5LKAA 5A7FA 5FPQA 4KRYA 4Y2RA 3DYIA 1LLFA 4X6UA 4ZV7A 3WI7A 1WHTA 2FJ0A 1FSSA 3F97A 1EK1A 5HF9A 1ZI9A 2VATA 1P0PA 5EIHA 1CUGA 1ETHA 1SFRA 3FYTA 3OC0A 4UHCA 4X7BA 4FBMA 1IMJA 2WQZA 3WZMA 4X93A 1B41A 4ETWA 3DDUA 1YAHA 2WFZA 2BFNA 5A6VA 1H2WA 1J07A 1BS9A 2XDWA 1ZD5A 3F96A 1CUBA 4UFNA 1NU8A 3GA7A 2ACEA 1TKRA 1QIEA 5HQ3A 4X71A 5K3BA 4KAAA 1Q0ZA 4FFWA 5LIPA 4IHAA 4MQMA 3HSSA 1IZ8A 3FLAA 3PDCA 2XQKA 1TAHA 4BCBA 4X3CA 3BXPA 5JIBA 1R50A 2XMQA 5DTIA 2VT6A 5JD5A 1AMNA 4QDTA 5IVIA 2CB9A 4FLEA 1FFDA 2VF2A 3H2KA 1PFQA 3FCXA 1LBTA 3H2HA 1VA4A 4ZRDA 2XUAA 3D2AA 2GBFA 3OG9A 3X3HA 4FHZA 3TEJA 3M82A 4IH9A 4H7HA 1YS1X 1J2EA 1OILA 4B9EA 5AICA 2XMDA 2DCMA 3EBLA 3M3DA 4YX9A 5AI4A 1CUUA 3WA7A 1Z68A 4QWWA 3VISA 1GQSA 3A2NA 1A8QA 4B0OA 1DT3A 2V96A 4XVCA 3PFBA 1E8NA 2Y2UA 4H7IA 2RONA 2DHDA 5ISMA 1ODSA 3WJ1A 4EZIA 2QJRA 1EVEA 2C0QA 5LKRA 4KAJA 5AKJA 1QOZA 2XQFA 4CCWA 3VJKA 5E4YA 1THTA 2EEPA 4Q1VA 4E14A 1QONA 3G9UA 4K6GA 4CG2A 4MWSA 2HA7A 3WK4A 1E66A 1K4YA 3IBTA 4DMKA 1Q83A 4QNNA 2C0PA 4F60A 2W22A 2QS9A 5FV4A 4P93A 5EGNA 3O4JA 4MWTA 2HDWA 4X91A 4LXGA 1NU6A 3FBWA 4J0IA 4YASA 5AKLA 5BWCA 3WL5A 2X5XA 3SX4A 4Y2YA 3W05A 2XMCA 1EINA 3SK0A 1MAAA 4X85A 5HFNA 3QPDA 1ORWA 2HA5A 3ANSA 3BIXA 2R11A 2VJBA 5CTAA 3V48A 4UFPA 4KACA 1CUJA 2J3QA 5LZ9A 1MX1A 5DYYA 5LZ8A 3AZOA 3BE8A 4OYYA 4AB1A 5HK9A 5YASA 3BDIA 2WJ6A 1WOMA 2WIGA 5ALPA 2FUKA 1DQYA 3W06A 1CPYA 4G9GA 4H7DA 4Y2TA 1JU4A 4J3JA 1DWPA 2QVBA 3EIOA 1WB4A 4BE9A 5JYCA 4G8DA 2PM8A 3OM8A 4JNCA 2PSFA 4EUSA 3K2IA 4QWMA 5JADA 2JGKA 2WIDA 4B9AA 1YASA 1EK2A 2XQJA 4Q34A 3OOSA 1X70A 2WIJA 3CN9A 2WHQA 2GZRA 5AK5A 3E0XA 5JD6A 1LNSA 3DNMA 1UK8A 4GWLA 3MGAA 3L1JA 4DYHA 2PSDA 1XQWA 2PUHA 3BL8A 1ZJ5A 2BJHA 1DT5A 4K5QA 4J0KA 3IUMA 1GPNA 4ITVA 3WL8A 2AJ8A 5LLSA 4QDOA 2Z3ZA 5JANA 3GFFA 3I6MA 3BDVA 2GBIA 1GKLA 1CVLA 2ZSHA 4AX4A 2O7RA 1K6EA 3I1IA 1QIKA 1WHSA 3HRHA 5IVKA 1CUEA 1RP1A 2G4LA 4DMCA 1C4XA 2XQIA 2JBWA 4Q05A 1QIJA 2RIPA 4PO3X 4UBOA 2OG1A 3TGLA 1CIJA 3G9XA 1LGYA 4W1PA 3ILSA 3FAKA 2HM7A 4WY5A 3B5EA 2DQYA 3H04A 2O2HA 3STWA 4C4XA 5AKYA 5EFZA 5AKKA 5ALEA 1XZGA 4AZ3A 3F8SA 3I2GA 4DMHA 4FBLA 2HA4A 4Z49A 5CT6A 4Y2XA 3C45A 1IVYA 1YR2A 2QTBA 1VZ2A 3DJYA 1MU0A 4QA9A 1Q84A 4N8SA 4BZWA 3I2FA 1S8OA 4F5ZA 3MUNA 2FJPA 3H0CA 2BGRA 1QZ3A 4BVJA 1CUVA 5K3DA 3HC7A 4AO7A 1ZD2P 2HRRA 3FNBA 5AI9A 3R3UA 1CLEA 3CCBA 4HXEB 2QOEA 1H22A 4EHBA 1CUXA 1VJ5A 1QIDA 5AK3A 4FTWA 4OYLA 3UMJA 5ESRA 1CUDA 1XRQA 2ACKA 2NW6A 4IQ4A 3WWEA 4HVTA 4RE5A 4AXBA 5K3AA 2B9VA 5D3KA 3KD2A 2CUTA 5C8ZA 1CUZA 3W04A 4G4JA 4U2GA 2H7CA 1AZWA 2G63A 3D5EA 1YA4A 2PBLA 2ZVDA 5CT5A 4PSDA 4ZXFA 4UHBA 1XLVA 2WU4A 3EQ8A 2ECFA 2WKWA 4QDXA 1HBJA 3ESDA 1AX9A 3HI4A 2EDAA 4FNMA 1DX4A 3HACA 3WIBA 1CUWA 1PV1A 4B7ZA 3NWOA 1XLWA 4FNGA 1YB7A 4LYEA 2PX6A 1M33A 4DNQA 3D59A 1H23A 4W1SA 2K2QB 4XX1A 1JKMA 3G0DA 3LCRA 3PUIA 2WU3A 5DLPA 3JWEA 4DNFA 1B6GA 5KREA 4OB7A 4RE6A 3BF8A 3AZQA 4XIIA 2Q0XA 4UUQA 3I2KA 5C81A 3PF9A 3WKAA 5AOCA 1L7AA 3UUFA 4K6KA 4CCYB 2ZYHA 1YS2X 2Z8ZA 4BDTA 1FFBA 3GZJA 3DKKA 3S2ZA 3V1MA 3FCYA 1HPLA 3AILA 3RLIA 2PVSA 3LS2A 2AJCA 3R41A 2IITA 4BB0A 3HYSA 2XMZA 2PSHA 1N5RA 3BIWA 4PSUA 4WY8A 5JAPA 5C8XA 1N1MA 1QTIA 5E4TA 3AUKA 4H7JA 3IUQA 2XUJA 1XZCA 1LPBB 1C7JA 1UK7A 3AIMA 3FSGA 1CEXA 5CT9A 1XZIA 5DWDA 1R3DA 1EDEA 3V9AA 4JYMA 1BROA 1GZ7A 5FLKA 2Y1KA 2XUOA 2J4FA 4CCYA 3BJMA 1QFSA 7YASA 5KWJA 3V1NA 3R3ZA 4XJVA 4X92A 2XUGA 5FDFA 2OGZA 3H1BA 1HDEA 3QPAA 4IH4A 5D3ZA 3DQZA 5EHXA 5LZ2A 1FFAA 5DYWA 3VKFA 3T52A 3PE6A 5HF6A 4KE6A 5HFAA 1CUSA 2D0DA 2DR0A 4L9AA 1A8SA 2JGEA 2B20A 1LBSA 2C7BA 4HXFB 4B6GA 4NZZA 1R9NA 1MJ5A 4X6YA 5D7BA 1UKCA 1QGED 3ESCA 1CQZA 1G4HA 1UKAA 3STYA 5J3JA 4KEAA 2XMGA 4FLMA 2C58A 2PU7A 1LPNA 4P92A 4EBBA 4U2DA 4X6XA 3RK4A 3I2HA 2JGJA 5C8VA 3LIPA 4H7EA 1RYYA 4Y2UA 3O4HA 4KJXA 2XLCA 5JAHA 1CUFA 5JZBA 5ALJA 1O6FA 3DLTA 1DU4A 3BF7A 4ZV9A 4BCDA 4EY4A 3GBSA 4OUKX 2HU7A 1Y37A 4KR0A 1UXOA 3RARA 2OCIA 3N2ZB 1GKKA 4AN1A 3FLBA 1UK6A 4RPCA 4B84A 3KWJA 3PF8A 5ALLA 1QIIA 2I3DA 4EY5A 5AH0A 1R88A 2QRUA 1HQDA 3G9ZA 2BKLA 1AKNA 3HZOA 4TPKA 3ZLUA 5ALDA 4WFKA 2WUGA 5AOBA 4K6HA 3WIOA 5FUMA 1TIBA 1CUIA 1XFDA 1QIGA 1CUAA 4UBMA 5AI0A 4MXDA 1DWQA 2GZSA 6YASA 1YB6A 1LPOA 1GGVA 1ZD3A 3C8HA 1QLWA 2B61A 4BDSA 1CUYA 4UBNA 3O9MA 4UHFA 5JASA 1XKLA 1Q0RA 5CXXA 3ANTA 4GW3A 5ALGA 2VJCA 3HXKA 2DFPA 1VE6A 2WIFA 4NVRA 1XZAA 4YPVA 4E46A 4NS4A 3I2IA 2WILA 1ODTC 5AI6A 4B83A 2XMBA 3D3NA 4DLNA 5AI5A 2BAGA 3WYDA 5A71A 1E3QA 3U1TA 4A5SA 4UBKA 1CV2A 1HLGA 1CR6A 4MJ3A 2OGSA 4Y2PA 5LZ4A 1WCYA 5ALTA 2OCKA 4G9EA 1SCQA 3L1HA 4C4YA 5K3FB 4FOLA 5CT4A 2HU8A 4H7KA 5AK6A 5ALYA 3D2CA 5CH5A 4ZI5A 1ACJA 5CBKA 1QFMA 4U2BA 1G66A 3C8DA 2QT9A 4MYSA 5ALZA 2PU5A 5JAOA 4QDZA 2WG0A 4Q3KA 5K3CA 1UK9A 5BWBA 3D7RA 3I6YA 2ZSIA 3WL7A 3WZLA
chains in the Genus database with same CATH superfamily
4PSCA 3LM8A 4DV4B 2QUHA 2BGUA 4Q1BA 5JSYA 4EB3A 2KSQA 1QG6A 3OY7A 4EUFA 4BQSA 1RJ9A 1XZEA 5B1SA 3TW8B 2W42A 4FDTA 5HKKD 4QHSA 2IYQA 1Q6ZA 2Z1NA 5LMNB 2A9OA 4QEZA 3WJ7A 4C6SA 1P72A 3J7AC 3SR4A 1UXJA 4RTPA 3M6XA 4QNMA 4R8MA 1DRJA 3FSRA 3KSMA 1G8MA 4L7VA 4CETA 3O3OB 4F8EA 3EGWA 3C8UA 5K3FA 2QYOA 4S3MA 4YMHA 3PD0A 3FOCA 3H18A 1PJBA 4FXOA 3N2LA 5LLDA 3WBKA 2QGFA 1KAEA 2R4UA 2QN3A 2ZQYA 3PUXA 5AVOA 1JHRA 1U7OA 3KVOA 4WAUA 1OT3A 3OZXA 2ZB7A 2GF0A 2Y0BA 2R96A 4L2IB 1OBOA 4Q3LA 2QV7A 2VHQA 1A5AB 1GNLA 3E81A 2I7TA 4PZPA 4QTXA 2XF8A 5EHQA 3ZK7A 5BN4A 1EDZA 4ERXA 1JDBB 4WHMA 1OKKD 2AG6A 4P9NA 4RYDA 4WCVA 4BLPA 3FH0A 4Q19A 4X1IA 3HUDA 2J0UB 1O3YA 3EWIA 1H65A 4XGRA 2NZYA 4JC0A 4AN0A 2YCLA 2OAP1 3FFAA 4LBZA 3TG2A 1PUJA 2QPAA 1RSZA 3SM9A 1KVSA 2Q8PA 3I9FA 4IIYA 3MK31 5KNBA 1EFVA 2E85A 4LG1A 3WK6A 1TO1E 2R6R1 4EUKA 1V11B 2G88A 1LTKA 1RHQA 2PWYA 3FPAA 4UBLA 4P32A 1OI3A 4W99A 4UHJA 4BAGA 4BFCA 2PUDA 4TL6A 3L4BC 5DTMA 2YOHA 3CLVA 3WDMA 2EYQA 3HZRA 3GF4A 1F6DA 5TEVA 5CW1A 2RK4A 1H2FA 7REQA 2J9YB 1RNLA 2NAFA 2WEKA 2Z1DA 4HZIA 4BKUA 5BVHB 4UPDA 4QLBA 1BTOA 4KI0A 3MMPA 2EHDA 3ZDYB 2H5IA 5FLYA 1P4SA 1V3VA 2W2NA 1RS0A 1VYTA 3L6EA 3UZUA 3HLKA 4J7CA 4K05A 3I6ZA 3AKEA 2G9VA 2AUNA 3WRWA 1FFSA 4CF4A 1CK4A 4RULA 3O9ZA 2PGOA 2VHCA 4J0HA 3KZVA 2H31A 2WLTA 1E1KA 3I8XA 3B51X 3SEQA 4D98A 9ATCA 3C7DB 3N05A 1T2AA 2UZIR 5DJ5A 5K09A 2O0KA 2IS1A 3JQFC 1Z4OA 1FY2A 4ITRC 4FGSA 1JLHA 3WKEA 3O03A 2QSUA 2X9NA 3PPVA 3R09A 4NABA 1DRWA 3I5XA 4MDEA 2GHQA 1BCSA 3FOBA 1F4PA 3HJAA 3ZDCA 1RCUA 3G79A 2D3WA 3AIKA 1E7MA 3I6BA 1SU8A 3RVSA 3A4LA 4OPMA 3IAHA 3O8OB 3AZPA 3SJZA 1QFZA 2AMVA 4HLUA 4G0OA 2HJRA 3D8NA 1AS2A 1N0IA 1K68A 1F1BA 1W8IA 1TA0A 1GRVA 3FOZA 4R5MA 3TRIA 1V1MB 2JGDA 1JXAA 3SN6A 2E87A 4C0JA 2QTFA 4D9NA 4ZQGA 5EMHA 1C3VA 2Y77A 2ZYSA 4MVWA 4Z0HO 3GJYA 3O2JA 3ITDA 3C4QA 2VKQA 1XE3A 2BPOA 4BAZA 4JJIA 1RHRA 1XRMA 3R1IA 4L4SA 3QMVA 1JJAA 1X7XA 2ZYTX 1RFGE 2PKQP 5KMGA 1UMDA 3JR7A 2QX7A 3K09A 3L7AA 1ZWLA 4RZIA 4Z0TA 4AZTA 4V2IA 3QY9A 3H8JA 4R9RA 4ZVNA 1EM6A 1BN6A 1I5EA 2NO5A 5JBQA 3LPAA 5JSZB 2H4XA 3WOHA 2YVUA 5KHOC 3OZTA 2PGIA 4YMVA 4OHMA 2X7HA 1Q50A 2AC4A 3PJFA 4UDOA 4HN2A 3RSHA 1FSZA 1WSBA 4FD2A 3WDSA 4CDMA 4HNHA 1EGQA 2H08A 1B6SA 3N28A 4UTVA 3U3DA 3D43A 1E32A 5LMCA 4Q1EA 2IXDA 2ONKA 4ZOLA 2YWJA 4RKEA 3FR7A 1XA4A 1IXSB 4YT4A 1AGNA 3K4QA 1YRHA 3RKRA 4UZEA 1E1DA 4HR7A 1U7TA 3TO5A 3UANA 1BHSA 1E7YA 1O89A 1RC0A 2WU1A 3WHLA 3WMXA 4LTDA 1GIAA 1PI3A 2P6NA 3KXPA 1T3GA 5IEBA 5LQMA 3JTMA 4IKEA 2Q3LA 3DE5X 3HCAA 4D57A 1F2DA 1B00A 4MZDA 4OQZA 4B74A 3MWEB 2VDOB 4YP7A 1SOUA 1A69A 4G85A 3RSQA 1TMKA 3GPBA 4M1KA 4IXTA 1AK2A 3FR8A 4V38A 2OBFA 4C1BA 2ZWOA 1A1VA 2C98A 4CMGA 3OE1A 3B6IA 1AGYA 2DZDA 2W5UA 1VRWA 4MUBA 3HP1A 4F92B 3TNLA 3QYJA 1Y5MA 3VR3D 4ER7A 2G1KA 1H94A 1QGUB 4K2AA 1ISRA 2W8BA 1TQ6A 2OD9A 1BAPA 1N9KA 3JYQA 3LVBA 3ND6A 1DINA 3EQ6A 4HAXA 3Q7PA 2ATEA 2B37A 2HZBA 3MXOA 3W5VA 1Y4SA 3TUZC 4RCZA 3D2LA 3ITKA 3VPAA 1KDTA 4OQEA 5FNZA 1WZ2A 3HABA 4JDPA 1W47A 1PP4A 3P8ZA 4AZVA 4Y2QA 4E5KA 1FC0A 1M2OA 4BNHA 2KPOA 2MYNA 1DNPA 1Z45A 5F9FA 3V2GA 2AG5A 2BUCA 1XTQA 1ZMBA 4ZHQF 2GD1O 4MKGA 4Z6KA 4TXLA 4AI6A 4FN4A 5JISA 2QUBA 4P3PA 1UKBA 3ZK8A 1ESCA 4Y2HA 4ZIRA 3P2MA 3HV0A 3LCJA 1IXKA 4K81B 1XXHB 1BD3A 3JQGB 4KRGA 4I3FA 4QGBA 3NI2A 3ORRA 4GBGA 3ZE2B 1L5HA 4XFDA 2ORYA 4QL3A 4S1VA 4NMXB 4IUBS 2Z83A 3NETA 1IN7A 1JA1A 2NVBA 3RSLA 5CB0A 3GP3A 2WICA 4MV7A 4Q9AA 1CS0B 3TRKA 1TC1A 4JI3B 1E8DA 5AVJA 1ZCZA 2QL7A 4ZQHA 4LDJA 1VXOA 3A1VA 2OV2A 2QVYX 4E13A 1X87A 3UAGA 1RXIA 5KYWA 4CEIB 4YRRA 1K9VF 3RU2A 2BMVA 4PPYA 4NJOA 2X6QA 1VBKA 3H2JA 3RYHA 3SC2B 1J42A 3R7WB 4OTZA 4QLOA 5DM60 5JSFA 3L6OO 1K0UA 5I8PA 3G8YA 1R64A 4EUEA 2FSVC 4E51A 3ZGLA 2QE7D 4RCYA 1L4NA 4TV9F 1B6RA 5A1JA 3RU7A 1HORA 1Y8QA 2FPPB 3HMKA 3NUQA 1GTVA 3QITA 3KALA 1T34A 2GOYA 4DV7B 3K20A 3GPCA 5EUMA 4DBLE 2WMYA 3H9CA 3SEFA 1VE7A 4AIIA 3RSSA 4YCCA 3PL5A 1XAHA 3EVBA 2AFHB 3PPXA 5HA5A 3U44A 1DKLA 1J33A 3F5QA 3AUFA 3GRRA 4JJ6A 5EWJA 1XJCA 1QNLA 1K3UB 4LXUA 2GPJA 4YBRA 1F17A 2QY9A 1VMDA 3GLIE 3BWVA 3NGXA 2IYVA 2CLIB 1QYRA 2JI9A 3TAUA 4O1MA 3PNQA 4EGFA 1PNRA 1Y0BA 1R9GA 1RYNA 3L6RA 1U7UA 3ZI4A 4AZSA 1XMXA 1STOA 3T54A 4ZT2A 1PFVA 4CUKA 2PEZA 4D3YA 1GTG1 2F7SA 1XPRA 2QMHA 1SQ5A 5ALWA 4R1SA 3ROKA 4KK4A 1CNEA 3HY3A 2YQ4A 1G7CA 5CH8A 1QU3A 4PRYA 5HZMA 1JIUA 2PUCA 4DDTA 4G8JA 5JNSA 3NBFA 5GZ3A 1GLVA 5TQ0A 1AM4D 2XTNA 1ONNA 3BMNB 1YF3A 1PWHA 3T1OA 1DX6A 4GM4A 4UXHA 4IHJA 3V8QA 4ZKEA 3PJDA 1R4ZA 4XX0A 5CP8A 2NU9B 1NX9A 3K0HA 4ZZ0A 4TX1A 4D7AA 2BTQA 1OJLA 1UT6A 4JLPA 4KMSA 1XF1A 3BWEA 4DEXA 1U4SA 5K4GA 3F1KA 1Q7BA 4M8NE 4B0PA 2EGHA 2FP4B 3ICVA 2VYVA 3FPKA 4CKEB 3PG5A 4QELA 1KSGA 3QG5A 3WG9A 2QD1A 1VHQA 1Y7IA 2RGGA 1KGDA 2YVKA 3OPYA 4FVTA 3PVZA 5A71A 2BFCB 3WYCA 1U3VA 5F64A 2GT1A 1HQKA 1EUDB 2Q4OA 4J8PA 3VC7A 1N6PA 1VI5A 1CZRA 1RMQA 2IEBA 4MCAA 4D9GA 5BN1A 1MGPA 2UZAA 4MLDA 4OBXA 4RD2A 2DFDA 4TLCA 4DRZA 1A9XA 1QPZA 1DSSG 2IKSA 5EA2A 3INYA 621PA 2R6DA 3DP9A 5FA5A 1WTAA 4RMGA 3VI4B 4IIBA 3L0CA 3FPSA 5IZ4A 4E5SA 2Q3JA 4NYIR 1FBNA 5KQLA 1ULAA 1RM5A 1PF7E 1PW5A 3HB4X 2NGRA 5ALXA 1Z7BA 2HWWA 2W2VA 3NKVA 4Y2GA 1C9NA 3SR0A 3CUKA 4BVFA 2CV0A 3DZHA 2HWYA 3AVQA 3H84A 1F14A 1VGQA 1H9BA 1RQ2A 2YWGA 1DUVG 1O9BA 2AUMA 3R6DA 4FHDA 5CMLA 4YUVA 2Y4NA 4N39A 4IKOA 1W29A 4E12A 1PT5A 5A4IS 1YI8A 3DDHA 3U31A 1HKUA 2X5KO 1VYVA 2VWPA 2F1HA 1SCIA 3PUHA 4RXUA 5AKXA 2HCFA 2G3YA 3AJRA 5FL3A 1MTZA 5T57A 4C0BA 5K0TA 1D2MA 3HV2A 4D41A 5M2QA 4IJQA 5C2JB 4M22A 4ZT6A 4PQEA 2R79A 4QXOA 4INZA 4PN3A 1ONOA 1R12A 1UPFA 4W7HA 3KD3A 3BQ9A 2VBIA 4H15A 5K0BA 1UZAA 3TZLA 2XEDA 4ARCA 1GILA 1SVLA 2GEDA 4H6WA 3DT8A 1XWIA 4K40A 4DIMA 3ESYA 3T5TA 4UHHA 3SNKA 5GONA 3A4VA 1XP8A 2XEXA 3F7TA 5I7UA 3A6ZA 2FPGA 2ZITA 2ZSFA 4TYNA 3VYUB 5DW0A 5DTJA 2DSNA 4EQZA 2ZJ5A 3SJCA 1IOZA 4FD3A 1T4DA 4S2EA 5AIAA 4TM8A 5A3VA 5DCUA 1OH8A 3SEZA 1LC0A 2QTVA 3SWWA 4M98A 3V1LA 4L0CA 3A9TA 1M1YE 1ZIDA 2BWJA 2DUWA 1Y3DE 4KXWA 4EL0A 2ZB8A 3SSMA 1QP7A 2HFKA 3F4KA 2A9QA 5B55A 2PUAA 5ENZA 4HPXB 3EZXA 2GN0A 1TF5A 3SZUA 3AERB 4INAA 1XVVA 2R00C 2QQGA 4UUNA 2C2GA 3AU8A 4PO9A 4YJHB 4XASA 4DBZA 2ZI4A 4D3XA 1X1SA 2BBWA 1GSOA 3M6IA 3AHDA 4HQ6A 1M66A 4ACAA 4B7XA 5AHRA 5H1YA 1DHRA 1Z6QA 2Q4DA 3HYTA 2FZKA 2NU7B 4F4HA 4RF4A 1Q21A 1TTPB 3MINB 4KJZA 2A88A 4M9CA 4PC3A 4QBKA 4GVLA 4CM4A 1LDGA 4ENWA 2YMQA 2EL9A 4QYXA 4IXNA 1Z07A 4HQKA 2BHRA 2HIGA 4XOIA 3U9SA 2ZIZA 4QBHA 4ZICA 1YZFA 1P91A 5EJGA 4D5EA 4JI0B 4FJ0A 4JVMA 3DT9A 4F2DA 1H4SA 2C5SA 3OFSA 5DSTA 4G67A 1UXIA 4GPAA 4K6CA 5EWLB 5C35A 3PI6A 1XQYA 2C9OA 2Y05A 4UUPA 4HX2A 3VPGA 3L01A 4IKPA 4C0QC 4BQFA 4WNYA 5KYXA 2AJBA 2HJSA 1MVOA 1WB5A 1BU8A 4MUGA 1ZGCA 3W6UA 3FVTA 2I2XB 4PPQA 4MVXA 3PVSA 3VR4D 3C3EA 4MWBA 5ELXA 3D4BA 2HFJA 2WP8J 1EVQA 3W3ZB 5CLGA 2JKYA 1NOIA 1UC4B 2V1UA 3BGWA 4N8EA 3SICE 1XSEA 3O74A 5AW3A 2HWXA 2FMHA 1USIA 1QZTA 5IP5A 3OT5A 5FLEX 2TRSB 1L8AA 4FMCB 5D3MB 4F4IA 5GVSA 2O6LA 1W6RA 1E3WB 2R4QA 3KLOA 4MEBA 5IBQA 2JARA 1R6VA 3QKRB 2ZIXA 4JBHA 2YYSA 4C3ZA 5HWSA 3OZSA 1OY1A 1FP4B 2NQTA 1A5SB 1OD6A 1SR8A 1U2RA 3FTCA 3JQAD 1RYBA 2GSDA 1K75A 1DLIA 1GPH1 1M2HA 3KSUA 3N8IA 2PUJA 1L5GB 1T8TA 1OC2A 3PQ6A 4LRQA 4U6SA 4DSZA 1OB5A 4XPIB 3JR3A 3T9EA 3GLGB 2EJBA 2EFDB 5JYBA 4CCSA 4YV1A 3KLNA 1N2BA 3OETA 5HMLA 4CU2A 2CNDA 3K2BA 1FYFA 2I78A 3LQYA 5IN4A 2OZPA 3W9BA 3B89A 1X74A 2XAAA 3R2JA 1QOQB 1L1EA 3IEXA 4D9HA 1LS6A 2QM3A 1O54A 1AY0A 3S1AB 2DBRA 1EXDA 4IF4A 4JT4A 4EY3A 3GLFE 2WF7A 4MUHA 4XSHA 1NVAA 3UJBA 3ZK9A 3OF2A 2YW2A 3H0KA 4EVRA 1KXZA 4MP6A 2O2JA 2PMKA 1EA5A 3KB8A 3FNEA 5DVZA 2IHYA 5A4KA 2CXNA 3VU8A 3NDPA 3D7SA 5ALKA 3O9VA 1J9ZA 1LSOA 2WJYA 1XRRA 5LA6B 1VE5A 1XZMA 3W8EA 1KE1A 4ZWNA 3NEJA 3A3KA 4M0CA 2H0QA 3M4ZA 2P4HX 3BRSA 1X8KA 5AM1A 4GQIA 4EELA 4FCCA 2N3ZA 4OEHA 2OFFA 1J00A 2EBHX 2G6BA 1ZBDA 3NTRA 3VTZA 2O9JA 2F8TA 4BNYA 2L0XA 3RRNA 2GTIA 4GR9A 3CF6R 3BXGA 3WGQA 3WWOA 1ZNQO 2J3MA 4MSUA 3AEQB 1U2ZA 3GLTA 5E95A 3OZRA 2G17A 2FYTA 2JASA 3JVUA 5DP2A 5J59A 4PHTA 1Q7RA 4NV0A 5JAIA 1FTSA 4Z7NB 3DDWA 5IH7A 1DTWA 2WJGA 2GN1A 1P2FA 4PLYA 3DF9A 1X2BA 1TADA 3HJCA 2Y9PB 1NXXA 5AI8A 3DA8A 2W6NA 4G1CA 2FZGA 2Q45A 3P20A 3A3PA 2C2XA 4WBSA 5A6SA 1G8KA 3ZJ4A 2P30A 3A6KA 2IBMA 4ZJYA 2JIBA 4I1PA 4Q3OA 4DCPA 1JDUA 3FDIA 3IXLA 3TS1A 3OQMA 3U81A 3VR2A 1PD0A 1Z13A 2YICA 3SCZA 3JQQA 4L78A 3IAUA 4DRXB 5MFZA 1ZCJA 5T64A 2GR9A 4RFVA 4U39A 1FFXB 2G5GX 3JWGA 2XZPA 3S40A 5FTKA 3O90A 5CIWA 3FOEC 4GYKA 2QRQA 2XR1A 5IAGA 4YHHB 3F3KA 1EDBA 3NEAA 1LZKA 2EP8A 3L7JA 4R98A 2V03A 3KZ1E 4DM4A 2G1PA 1Y42X 2ONCA 4KYTA 1MBZA 1RAGA 1F20A 1R27A 4DZRA 3QP9A 1V45E 2C2MA 3BXXA 4I2NA 4AG3A 2O0LA 2BI8A 3BWXA 3QWFA 4LWPA 5A9RA 3WYAA 4U6NA 1TAQA 4L4UA 2QNBA 4AQ7A 2YXBA 4X90A 4URXR 4KIJA 3MQFA 4ZOEA 4M0MA 2QB5A 2X0RA 4H1TA 5DU2A 5L51A 3QBDA 5JEDA 1GYRA 2PPLA 3IB3A 1J8FA 4LVNA 4D3SA 1U7WA 3BXOA 3KJGA 5FL7A 5FADA 4LFCB 1CR1A 1EVYA 2UZ1B 5AKHA 3TH5A 4BO7A 4KO4S 4LY3A 2B3TA 1VZ3A 5DF1A 1I4EB 1JV2B 2FQ1A 1QK3A 2AVNA 1KAHA 1BNCA 4AJLA 1C8BA 1R0WA 3H13A 1EBUA 1FRZA 1F06A 4TL8A 3KQLA 1R18A 2G83A 2HRQA 3EEFA 2CMDA 1ZEJA 3IXMA 1FDTA 4G4GA 2PMFA 2PKXA 3CT6A 1AA6A 3WQRA 4NBSA 2OAGA 4CLRA 5KNDD 4PG8A 3EAGA 2A30A 1W19A 3KSRA 4GSLA 4R1QA 4R84A 4HYYA 4M9RA 7ADHA 3CUVA 4B5LA 3ZGZA 4AKSA 2F43A 2PZJA 3GXBA 1CQIA 4WOBA 5PGMA 5DYNA 4B1FA 3VNVA 1CWUA 2HKIA 2R9VA 3CZPA 4Q5IA 1P80A 3GJRA 3CM0A 1YS6A 5AWFC 2H8GA 4RTNA 2XAUA 4CLOA 1J4AA 3ISJA 2IA5A 1Y6GA 3DHYA 1U0EA 4NJMA 4WADA 2FW9A 1X9HA 4FFVA 2J5BA 2O3RA 4NENB 2A1TR 3DVSX 1U2GA 1G9SA 3STTA 3TXAA 4D0SA 3JV7A 1U0FA 1CDEA 1UL1X 1FFYA 4P08A 1QV9A 1MKYA 3SLRA 1RD4A 2R60A 3GNQA 3P5BA 1BSVA 3AB3A 1C7FA 1YNOA 1XZKA 4HZGA 1MO2A 4EUNA 3H2GA 4JC5A 4L6IA 1T9CA 4Y3UA 1OX4A 5G4LA 1A5BB 4C6TB 1E77A 1F5SA 3AG5A 2O2CA 1A4UA 1N1EA 4N3AA 3OPVA 1QU2A 2VRBA 3A4YA 3TTUA 3CN7A 3H1GA 5HRCA 8ABPA 4FOTA 4PC1A 3PENA 3V8NA 3VTAA 4UQOA 2I6TA 1D2NA 3QPCA 4P58A 3VH2A 5JROA 3S27A 2HH9A 2PXCA 1PV2A 3WE7A 1NMXA 2FZCA 2VK1A 2X0JA 1KKUA 4R69A 5AP9A 5BWNA 2Q5FA 3A2LA 4XIGS 4FWTA 4MDYA 4CHTA 2AKYA 4TT8A 2W4MA 3QXHA 1JH9A 4PV7A 1LBHA 3PCRB 1YRLA 2POCA 2FEOA 2W98A 3S2FA 4XGQA 2FPIB 1T13A 1ZK2A 2WFMA 3JARA 1TNDA 5BW5A 1GQYA 2XVMA 2IIBA 2CVOA 3DCYA 5CVVA 4YAIA 1GYPA 2PS0A 1SHJA 3DJFA 2VWQA 3I28A 1GZ4A 3C6ZA 1SULA 1TCCA 1WPXA 1KK2A 1G8GA 1LB1B 5I5GA 1U0RA 1TCBA 2O20A 5ALHA 2Q1SA 1BW9B 3A27A 4BKPA 2I71A 1AUXA 3OZDA 2V98A 1AZSC 1U04A 2X76A 1QHSA 2QPTA 4NNPA 3V4SA 2X15A 3RVPA 3ZZMA 3PLAE 1XVLA 3GJ5A 2V0CA 4F6CA 1RABA 3SZLA 5CFNA 4C2TA 2PKYX 3AINA 3ZBPA 1NLZA 5KO2A 1X39A 1ZSVA 4JEUA 3KK0A 3FUWA 4EPYA 1NSFA 3H6HA 1D0IA 1Q20A 2DY1A 2IYZA 2UU9B 3KJEA 2GK6A 4AM8A 3CH5A 3ZNOA 5JRDS 2V9CA 2OC9A 1O94D 1ZRMA 1ZN2A 4F11A 5JD4A 1KYYA 4XQ0A 2XWBF 4OLJA 1Z5NA 3RANA 1Z34A 3UJAA 1GKUB 1PO7A 4L73A 1GPKA 4A7PA 1RLMA 1T5SA 1YUBA 3F7NA 3W77A 1D07A 1MTOA 2QM0A 3ZWVA 1JDPA 2HHAA 3DWGA 4TKMA 4RAOA 3ZWMA 5MDHA 4IIUA 3U7FB 2D7DA 3UAVA 2FQQA 1PD1A 2OLEA 3BCUA 4J2TA 5H02A 4C7MA 1GV1A 1W2HA 3PEYA 1FTNA 3W1VA 1GGFA 4IIHA 3R3VA 1K8RA 4Q9HA 4G09A 2QW8A 2F6RA 4N0PA 3IAFA 4L72A 1FYXA 5F5XA 3MUFA 4U3JA 5DASA 3DM9B 1CYEA 1CTQA 1QIHA 1QR6A 4QASA 4UNSA 4B3CA 3M49A 4LVUA 4PFSA 3E8MA 4GMXA 4WFJA 2SKCA 2WMOB 2Q07A 3AB8A 3FWYA 2GAFA 5FPTA 4CCAA 3L0ZA 2CC2A 5EUBA 2HB6A 3PEWA 1DL5A 2N47A 1D6NA 5AJHA 5JPDA 1OYOA 2R65A 1BWPA 1N2OA 3BB3A 3MJFA 4QBIA 5JS8A 3QEAZ 2YIDA 4J0GA 1FUEA 1TU0A 3K0CC 3LCUA 1QH1B 4EMSA 3LQQA 3TDKA 5EKDA 2Z6VA 1NVTA 4RPGA 1NASA 5AJZA 3MD9A 3R7DA 1UJ4A 2BHNA 4PZEA 1C3OA 3R5SA 4PINA 3TDMA 4MQ6A 3V1KA 3EG5A 2AD5A 3VSDA 3WGUA 2LUOA 1L7QA 5EZ5A 3WQHA 3IQHX 4CKWA 3L8ZA 4FB4A 4MQFA 2BEWA 3JQBC 1A7AA 1HE3A 3MTAA 5J47A 4ZYVA 4EGAA 3LC2O 4GX1A 4C01A 1XZDA 2GBCA 1T26A 3M6LA 3P2KA 3FKJA 3WNZA 2PLRA 1ECBA 1NZJA 3CIFA 4GT1A 3ZV5A 4PHFA 3PITA 4TL7A 2H11A 1PZGA 3DHWC 4FZ5A 3S8MA 3WLFA 4DTCA 4ZGGA 1KDOA 2FW0A 3DAHA 3GLVA 4ETNA 2ORIA 4NHEA 1F8GA 4P54A 1WTCA 5MGNA 1DXOA 4HYTA 3Q8WA 4GX5A 4MDHA 2COEA 4KE9A 4LXHA 2F4NA 1TK3A 2VYCA 4BTVA 1EBFA 1JZTA 3KYCB 1E1NA 4K8RB 1EZ4A 3H7AA 1EI9A 1A8IA 1SWVA 5EJ9A 3VNRA 4LKOA 1T8PA 4KE8A 4WOJA 1I7PA 1OBFO 1HZJA 1K8XB 1W2GA 2JAPA 4GLBA 3FLMA 1U2EA 3IAAA 5DNWA 4WE3A 4H6VA 4M4SA 5H59A 1CUCA 4UEKA 4XDYA 5SY6A 3PGA1 2AEFA 3A1UA 1Q44A 1L4FA 2HT6A 2V65A 1CVIA 2W43A 3P9YA 2LP4Y 4N03A 4HXGA 5CB4A 1HZZA 3LWZA 1WZCA 4HP8A 5EIEA 2BJVA 1UBUS 4WZAA 4YV0A 1D7OA 2CVHA 5C5IA 1KBQA 1KIAA 2PQ6A 2WTNA 5COBA 5AHXA 4CKCB 1RCTE 3W1WA 2H57A 4KLRA 2IJGX 4PZDA 3QNUA 1N33B 1J1UA 3MRVA 1TM4E 3N5KA 2VF4X 5DHUA 2QBYA 1AGXA 1K3TA 1AHHA 4LE0A 1KJYA 3EQZA 5J2UA 2JLXA 1BE1A 5DNUA 2BVNA 5FI5A 2V5AA 2W6CX 4UCWA 4V02A 1XRSB 3WNDA 4L85A 4ZA2A 1YCFA 3O4VA 2XNJA 4IEEA 1BWRA 3BICA 3UO8B 4HFNA 1CZUA 4UDYX 3PHIA 4YAOA 4D9IA 3LOQA 1G3MA 5HJ7A 1WXHA 2CD9A 1TUBA 4LK2A 2G09A 4Q02A 3LX6A 2ARKA 2C2WA 2RCYA 2WKRA 2ZRDA 3C85A 1OWLA 3W2EA 5EE9A 1IE3A 5JXJA 4NKRA 2H2HA 3MT8A 3B2EA 5CIQA 3MBOA 3TRHA 4CMAA 1OH6A 1VHDA 3AQ4A 2B82A 2P35A 4CWAA 4DTIA 2VAWA 3EZLA 4JBLA 4E94A 2VVTA 4IIFA 2V7TA 3Q3IA 2YV2A 1NQXA 3UBTA 1UMCA 1G21B 5JJBA 4WJKB 1A8UA 2PCLA 4XKJA 4B09A 3LP5A 2JJYA 4FNAA 3ADDA 4NEHB 1ESEA 3SDBA 5TXGA 5KOIA 3RVJA 1Z37A 4EB0A 2GJ8A 1WW3A 3I72A 5BRNA 4BATA 1SG9A 4GVXA 4Y6SA 2V0NA 5C7YA 2H8KA 3IR7A 1S0UA 4I4LA 3VQTA 4KPUA 1JXOA 2GVZC 2PX2A 1K88A 3D3EA 3JAWB 3WSTA 1EPUA 4HQRA 2CV2A 1RYEA 3FRHA 4YAFA 3M9LA 3QFHA 2DX7A 3HEAA 1PFWA 3IUSA 4G86A 3TLCA 5ARCA 2QRPA 4BRSA 2GZ3A 3D1JA 3C1UA 1RI1A 1DI0A 3ABQB 1XNHA 1ZH2A 4DB2A 4XDGA 4A91A 4BJ5A 2HMTA 4M21A 1ADJA 2QG4A 2V58A 4RKYA 3C24A 2C5LA 4WN9B 4E7OA 2GCNA 2UYYA 1RE1A 1OOEA 2JJQA 2YJ5A 4I4IA 4PG6A 2UVDA 5IYZF 4ZQCB 1HE8B 1AN0A 3AHFA 3DM5A 4HFRA 1CSEE 1XDBA 3IMGA 3P2YA 4HGQA 4C4PA 5JT1A 2C9MA 3FM9A 3FZGA 3CSSA 4JCOA 2Q6LA 3WV5A 5HSGA 1Y4UA 5BQFA 4BV9A 3ICQB 5FOUA 3COPA 3DBHB 3K9CA 4GMGA 4PS0A 4I50A 5F4ZA 1T8SA 1O0BA 3K5IA 1KK0A 5FB3A 3C6XA 2IHTA 2HO5A 3EGOA 1L3IA 3ED5A 3WX0A 4QDUA 2W2OA 4IBOA 1BS2A 1AF7A 2ZRIA 5HF5A 4XM2A 2BFOA 3OEHD 1IB0A 1N2EA 3T9BA 2O48X 2MINA 1NT4A 1T3LA 1KRHA 4WZZA 5IKPA 4MV1A 5K7SA 4XSVA 2HU5A 1XMJA 4ACBA 3CCFA 2IP1A 1T9DA 3MG9A 3P27A 2WHRA 3T5GA 3UJ3X 2JIRA 3CQ9A 1Y9EA 4L8WB 4U0KA 2G36A 5KYYB 1FYVA 5GAJA 1ZD9A 3GMIA 3QI7A 4Q16A 3HEBA 4G1EB 1KO8A 4GGPA 5JVDF 2EKBA 1MUUA 1ZK4A 2WD7A 1UKYA 5AXCA 3SDZA 4LRYA 4DCOA 2V6FA 3QYPA 1THMA 1ZH0A 4UTPA 4JA2A 1QCCA 2RHTA 4BLRA 4BE7B 1I0ZA 3HVKA 4J94A 4WESA 1GNTA 1T36B 2Z08A 4NXMB 1V39A 4HBGA 3EGEA 4S0XA 1SVMA 1U7HA 2VPQA 1S2DA 4AG6A 2QXUA 4HHEA 2BDUA 1AOXA 5FOQA 4IR7A 1OXXK 4GECA 2FG6C 2GDJA 4CG1A 1J97A 1Y8CA 3NM6B 3BIOA 3CEMA 2EF1A 3MZ0A 2DUUA 2Z8XA 2OR3A 3PC3A 4J90A 4R4JA 1QO9A 3CWQA 5KYUA 1XRJA 4TVKA 3LGAA 1V6AA 3RDPA 1SD2A 2QZZA 3B9QA 3G9TA 3NOOA 3U48A 3LK6A 4UM9B 1G59A 2JEZA 4L8YA 4QOFA 1WCIA 4BEJA 4JQYA 3WGYA 3H42B 5ER6A 5HBGA 3NGMA 3WKCA 1U8UA 1YFZA 3OCZA 3K0FB 4MRVA 2FDRA 4EA6A 2PMBA 3C7AA 3CLRD 3GEPA 3I04M 1ESMA 4P4GA 4EW6A 1W36D 1FJXA 2IS6A 2CHEA 1R0YA 3P9QA 5K20A 3MWGA 1JBKA 1L7PA 3WRXC 5F76A 3ELWA 1P7VA 2RI0A 3ZIAD 3VO8A 3KBBA 4L5YA 2YHSA 2Q7OE 4X66B 1PR4A 3FBGA 2P9QA 2I6UA 1B15A 3PGKA 1V37A 1RYDA 2CL0X 2I4NA 4MWCA 1EFAA 2CV1A 1X1CA 3E4DA 1E6LA 2VPXA 1XG5A 2C4TA 2QE6A 3CBQA 4DUPA 4UMVA 3OFNA 4GKBA 2OESA 2J0QA 4FHCA 1Y81A 3OQOA 1G41A 1LK5A 3CUUA 4BB9A 1HL7A 1ORDA 2VHTA 3G6WA 4OI2A 1YOVA 2IUEA 2RHWA 4RY9A 1B7GO 4GLOA 5K4HA 1J5XA 1C50A 3Q6NA 3A6FA 1EJ6A 4Q3BA 3G2OA 4XI9A 2F90A 1LK0A 1U2DC 2QT0A 1Z2CA 4I9HA 3UM9A 4RDHA 3VXKA 3ULKA 4YUAA 2NLOA 4D1YA 4E3WA 5HNKA 3A05A 2EG9A 4TOIA 3OWXA 1IYZA 4FFNA 1SC9A 2D1QA 3FYUA 1E1QA 1F12A 1IHPA 1GXSA 4U63A 3VKVA 1GLGA 1RRPA 2DUNA 3B1XA 4IIJF 3DB2A 3KVVA 3WISA 2AWNA 4AQYB 1MC8A 4BXOA 3HCCA 4CEJB 3ROTA 2HYDA 1YIOA 3OQIB 2G5TA 2DT5A 3BMXA 1ESDA 3FI0A 5KDOA 4LWQA 3ESRA 4N5IX 4PY2A 2WA1A 4UU7A 3T34A 2RH9B 4RF5A 2W2PA 3T94A 3HKCA 3HFJA 2AJTA 3W8RA 1O1YA 4OOFA 2VDPB 4GICA 3FOFC 1SKAA 1Z5GA 1Y5IA 4K9OA 1ENPA 2WUWE 3DBRA 1VB3A 1JPJA 1YTLA 3FMPB 1W52X 3GUCA 1ONBA 3QOXA 4LMRA 1GYQA 1Z38A 2QK4A 2GCOB 3QVTA 4P4SB 3IT1A 3O31A 3D6MA 4EITA 2VAMA 3S68A 2KLBA 4LJYA 4UBIA 3IP3A 1W9MA 1NVVR 2PD4A 3EZ7A 2V9ZA 2QD5A 2XB6A 5K8TA 3VUFA 1XQ1A 3OQ1A 4B6FA 4RMIA 1UODA 4N7MA 3HUTA 3THSA 5ESDA 4DDUA 4OHUA 2RH4A 3EZ2A 5KWEA 2YXLA 3B3FA 2DBVO 2X4GA 5CA1B 5KNLA 4EG7A 3CRVA 2HX1A 3BD7A 2CNNA 2PTHA 1VSQA 1XTUA 3CISA 4AP6A 1ZGJA 1RWBA 4D99A 1IOVA 4OSOA 3ETLA 2ID8A 1TGVA 4UVDA 3WLRA 3ICEA 4X6LA 4KP7A 4NNJA 4PYKA 2AZTA 2XDQA 2EF0A 4UNNA 3AC0A 3CXUA 2ZIGA 3R0VA 5LBIA 1RXSA 4AKTA 4H6XA 3HH8A 3R77A 1Z26A 4HCJA 4EI8A 8AT1A 3MOGA 1OXMA 4RSRA 3RIXA 1QRSA 3DOEA 4K6MA 1M34A 1U02A 5HEKA 5C18A 5A3QA 1A7KA 4XLTA 4CQMD 1EBBA 3PCXA 3WTCA 2Y1CA 5H9WA 3DFFA 1ATZA 3AL3A 3IMCA 4GI2A 4Q9DA 4QQNA 5F51A 1PSDA 3RYFA 3C3CA 4O02B 3LRTA 3RYIB 2ZZMA 1L1FA 4MVJG 1MJNA 1RLOA 4HRVA 4TUYF 3WK9A 4YRAA 4EG3A 2HA6A 2YC4C 1QB8A 3G02A 3ZKAA 2XNCA 4TLEA 4A2WA 3THWB 2QD2A 4ZVPA 1OPRA 3JASB 3T0GA 4E5VA 1NBME 5EAIA 5KU1A 1SQGA 1FFGA 1EWKA 3REGA 3TXXA 4FILA 2AFIB 2CXXA 2ZE5A 4IGEA 3HY4A 5IVPA 4PU0A 1NXTA 1SRQA 2AK2A 2FMKA 2WJJA 4MKXA 1EUYA 1P77A 5DGTA 5TJHA 2OXEA 4AQDA 3UT0A 4HTFB 3WNVA 3TIVA 1XQXA 3T7KA 1M2KA 1V8ZA 5C9ZA 3NHLA 3RVRA 3A1WA 1FDSA 1LJLA 2ZB4A 2FVXA 3F49S 4I81A 5F78A 1LV7A 2P90A 5F2NA 4QGFA 1NI3A 3IIJA 1PZNA 3Q85A 2G08A 3R9XB 3LFTA 3F9IA 4MLCA 5K6TA 3ZBTA 5LKAA 1L8LA 3EIHA 3OTIA 3I58A 1Y4DE 3J81A 2EJUA 3UOGA 3CLTD 4EPRA 2OO7A 1LI4A 2WC1A 5G1OA 2O8BA 1R8SA 1NA5A 2A14A 1DC4A 1MA0A 1IWPB 4KR9A 1WF3A 3ACCA 4MTLA 3B6EA 2UVPB 1YVUA 3MBKA 4X6UA 3RJ5A 1GG9A 4HLDA 2FJ0A 3G2KA 1UDRA 3BZBA 4J91A 1EFDN 4UEWA 5CNIA 3ZXIA 4WLOA 1P4AA 2QTMA 5HF9A 2BMAA 2VATA 2DFLA 1M10A 3C4VA 1JEQA 3FYTA 4IJ5A 3CW8X 4X7BA 3FCOA 3FN4A 2GF2A 2WKQA 2IPNA 3F74A 3JY6A 4S1OA 2O8EB 4HS4A 1OXUA 1OZFA 3F4LA 5ICFA 1R0ZA 3GT4A 4JI6B 3KUUA 4BMYA 3IOYA 3DZJA 5DMXA 3PJRA 1AH2A 3HPRA 1Y82A 3MBIA 4DJTA 4L74A 4RY0A 5G0TA 6ADHA 1NZDA 3HBAA 3LVFO 2JIZD 2MYTA 1H2WA 1DMRA 4FGZA 1J07A 1L5NA 1BS9A 1E9BA 5T6MA 1V7CA 1ZD5A 1GZVA 4B4KA 2I8AA 5KWVA 3EVEA 4TYPA 2IGTA 4CRWB 5K0JA 3JRXA 1LLUA 1RHUA 4J6FA 4JLOA 4YB8A 3ISVA 1M5UA 5MHTA 3GA7A 5EXEA 2C99A 3TTXA 3ZVRA 1I4OA 2VJLA 4ZVKA 1Q0ZA 1O0SA 3GD7A 3VR5H 2PMDA 5EZQA 1SQ0A 3RF6A 1KOGA 3LI2A 1U0GA 1VI6A 1V8PA 1XV5A 2ZGVA 3HSSA 5EPUA 5G1NA 5LQKA 1VIVA 2YOFA 2F9FA 3PXGA 2ZAOA 1U6JA 1KO4A 3PDCA 1MRNA 1P3JA 5KAPA 4Z4FA 1R37A 3AGPA 4Z7OB 4BCBA 4YJFA 3SXUA 1JLSA 3AFNA 3D1VA 1YR8A 3GNTA 4A2PA 4L3VA 1QV6A 2VT6A 3EUEA 5DTIA 1BVHA 4LXQA 4EPTA 1V6SA 1ZLXA 3TCXB 3O4FA 4FLEA 2ZIWB 4CKYA 3A11A 4A0QA 1AKEA 3RT9A 4CF5A 1Q2UA 3IP9A 1FFDA 1W5SA 3GH3A 3ELYA 4B6EA 5LWHA 1OZ0A 3OQNA 1I3LA 1Q1EA 3H2KA 4NE7A 5CDTA 3SZGA 2R2AA 3EXIB 3H1PA 4NQZA 1D5WA 2P6MA 2CDRA 3G5TA 2IEDA 3BD9A 3BPSA 1N3BA 3TIIA 1KJNA 1XHFA 4EHDA 4PRZA 5BY2A 1L9KA 4F85A 1E2UA 3PQ7A 1MXHA 1UMKA 1NBWB 4KWTA 1YRYE 3SPXA 2FMTA 5FNVB 4ND5A 2BEVA 2Q50A 3EQ2A 4COOA 2J48A 1D6JA 2YWRA 3AIIA 4XWAA 5EG5A 1I32A 4RTQA 2RHCA 2Y9MB 3AETA 1FK8A 3CE6A 4TVSA 3PXXA 3QTBA 4GGMX 4DBLC 3CZMA 1GNQA 4IWYA 1J2EA 1E1RA 1W87A 2HHCA 2R7NA 1AKQA 1LW7A 2OFPA 1VDZA 4DIEA 4CDRA 3MMNA 3PFWO 4OQ4A 2WVGA 3Q0IA 2HLHA 1OC4A 3DL2A 3TLAA 4PX2A 3RYCA 4Z9FA 3N1UA 3Q9UA 4LRUA 3GLSA 1OLUB 4TYQA 4IDDA 3CUWA 2I1QA 2NUBA 3HM9A 3BRWA 1U6IA 3H5IA 4HGYA 1GAEO 4LBYA 3RIGA 3SJ7A 2SCUB 4DS3A 3TLYA 1DT3A 4DC9A 4HC4A 3IHWA 4TMTA 1B93A 1NQAO 5T8KC 1JHPA 1E8NA 1RZ3A 4E07A 3IUBA 4EARA 1H9CA 3TEFA 4WKNA 1HE1C 4RH3A 5HP4A 4UM5A 2B99A 2RONA 3BTSA 4XFKA 3TAXA 5ISMA 4OUDB 2FMUA 4GRDA 4IGIA 2NU8A 3WJ1A 1CDDA 1OZGA 5BQXA 1DWUA 5BN5A 3BC1A 1WKCA 2C0QA 4QOHA 5AKJA 1WB9A 1UFKA 1QOZA 2ZBRA 4LGYA 4ZZ3A 3LUGA 1VJRA 5FYQA 5E4YA 4YALA 1NY6A 4ZT7A 2QZ9A 4Q1VA 5JDIC 4JLKA 4ESVA 3RIYA 1HETA 4K6GA 2IXGA 1MEJA 1SUFA 3DZIA 4HOYA 3B6JA 4DAOA 2C59A 2EW2A 3DVAB 1E66A 2JG3A 1MOPA 4D9CA 2QRJA 121PA 2AX4A 3NP7A 2AHOA 3QHQA 1I9GA 3ZDFA 1K4YA 3MLEA 4V0MA 1SCNE 2R7MA 2EYUA 1W1WA 3PI7A 4C08A 1GUAA 3IBTA 3WLHA 2UVQA 3PX3A 1UANA 3PEEA 3KQYA 3W3AD 4QNNA 3CJQA 3LLSA 1KBOA 3KYDB 1PWEA 2RC5A 3BXEA 2QS9A 2XGMA 3EBOA 1F2TB 3JYPA 3QF4A 4GWKA 4O2AA 3USES 4CL0A 2YS6A 5JQGF 2IL1A 3T3NA 3DFKA 2YX1A 4YQYA 4ANFA 4EO7A 3BRQA 1BKSB 4MWTA 5JLAA 2YJZA 3UJ8A 3THYA 2E18A 4KFUA 1A9RA 4X91A 6NULA 4U6QA 3TI7A 4BECA 3FUVA 4ZAFA 3OI7A 2HTEA 4ER3A 2VJMB 1DRKA 5AKLA 5FI1B 1G1AA 1JTEA 5DI3A 2BGWA 4QT4A 1FS5A 3SX4A 2MDTA 3P1JA 4MP3A 1BEUB 4UCFA 4Y2YA 4Y8VA 3WGOA 1D1SA 5JZOA 2XMCA 5B3JA 2NXWA 5EZYA 1FJHA 3EIXA 3TZQA 3UAYA 3HTXA 4CLEA 4G5OA 4C7BA 1RTKA 1V26A 2JLSA 4OFWA 2B4QA 3U09A 3RUCA 3NTVA 1E3LA 5CD1A 2E89A 4F4JA 3QPDA 2YXEA 1BA3A 5CNJA 1G9XA 1CZHA 1JEDA 3P9RA 4RF3A 3LWDA 3VOSA 1SUIA 1Q11A 2TECE 3IX7A 1DG3A 4GNRA 2JFZA 4KC0A 4L8LA 4GX0A 1CULC 4MKZA 3ROGA 1OGJA 5IK2D 2JJ1D 2P78A 4EW1A 5JBNA 3GAAA 4I99A 1VP9A 4P83A 4CKBB 2IOFK 2VJBA 2MCFA 4UFPA 4ZCMA 4OLBA 4KACA 2R62A 4RZ2A 5IMSA 1HG1A 3OQ6A 2NXEA 1NAHA 2I4MA 1RPJA 1JNXX 3WLMA 4X1KA 3BDAA 1US8B 4I6EA 5EE1A 3TCKA 5A4MS 5KU7A 2DQSA 5CM8B 5DYYA 5E7IA 5KC8A 4BMVA 1I8TA 4MVJF 2J85A 3BE8A 4YRQA 1XIVA 4D79A 3CLSC 2XJ4A 3R3JA 5EEGA 3TFWA 4C2BA 2JFBA 1XLTA 5KTTA 5D5PA 2A9PA 4FMCF 1O5OA 2ZUVA 4PAMA 1E5DA 5GWXA 4C5CA 3VR1A 1ZOPA 5F5LA 1ML3A 3QVXA 1CPYA 2J8ZA 2AQHA 1HRKA 2VHVA 3EA5A 4X1YB 2R1TB 1DO0A 4YP5A 4J3JA 5AD1A 2R84A 1DWPA 1MPTA 2PXHA 4KL8S 1WDMA 4G8DA 1POXA 3U3KA 2X1LA 2GWHA 4KQCA 4RLHA 4D42A 3BIJA 3E5RA 4DWVA 3TVTA 2LXNA 3EX7C 2O8DA 3OM8A 2HMYB 3QTLA 1PHRA 3HB5X 4M83A 1S01A 2HJVA 4J4HA 5E6SA 4CM7A 2PX3A 4EUSA 5KI6A 5JADA 1KQOA 2C1XA 2WIBA 4W8OA 1XHLA 2BCGY 4BZPA 4B9AA 1J9GA 1I7NA 1N25A 3WLPA 1YASA 2OY0A 1P9LA 2DWPA 4BKOA 1CY1A 3IEKA 4EJFA 1NUHA 4GLLA 2IP2A 3U16A 3L93A 3OT1A 3HYNA 2QMYA 2LE0A 4B6QA 3ZDBA 3TDNA 4AFNA 4OH1A 2XSZD 1IK4A 4RLSA 3T5CA 4N41A 4TWRA 5C4GB 4GWGA 3FCEA 3T7RA 3ADKA 4GZ3A 4TSFD 5EESA 4UOEA 4O3MA 3EEYA 2P2SA 4Z54A 3ZU2A 5DHQA 1UBNA 2R1ZA 3OJCA 1Z36A 4AW9A 5J5CA 4HWPA 3ZEAA 2FDCA 2XOEA 5TGDA 4FQ5A 4I0WB 4JP3A 2CXRA 4PG5A 4EEXA 1JTFA 3RFTA 4O1HA 1EEHA 1CY6A 5BMOA 2Q5LA 1QGOA 4IL5A 2J5KA 2ZUUA 2YNMD 2C78A 2XOKA 3GWZA 4GOLD 4CXMA 2JAUA 3MB8A 1OE0A 1UP6A 1U8TA 3DD1A 3OJEA 3QNMA 1M8FA 3R75A 1VQ1A 4I3HA 1Q7CA 4LN1A 3I6MA 4OX9B 1L4UA 2ZSHA 3ILVA 4L15A 2HO4A 4R3WA 4AX4A 2IOFA 2DC1A 2L2QA 3DH0A 4D9FA 1WV1A 2D1RA 1EIWA 3HRHA 1E9EA 3G59A 3H9EO 3VR4H 1T6BY 4CIVA 1DIHA 3H9JA 4R8LA 4D46A 4Z4HA 3SR3A 1VYHA 2FZLA 2X0NA 5DXJA 4WVFA 4EB8A 3L6DA 4EIWA 1RP1A 3QWHA 3RO7A 1APBA 1C4XA 5BW4A 1SZPA 4Q05A 3TG8A 1DKOA 1QIJA 2F55A 1UKVY 2IEYA 3FA2A 2AT1A 1I1NA 3GDHA 4HBZA 4UBOA 1JNYA 1CIJA 1E5XA 4INJA 1LGYA 3AM1A 5ES3A 3GLQA 1UBEA 1P17A 3FAKA 3MD0A 3RS5A 1QVVA 2HMAA 3SXPA 3VNUA 4UATA 3KR1A 3STWA 2I22A 2K2WA 1VIDA 3JCZA 5BUZA 2HHJA 1NDHA 4ESEA 1QANA 1M6WA 1W0KD 3E7FA 9LDBA 5AKKA 2R751 3QJYA 1XZGA 1H1DA 4AZ3A 5LPNA 1NBMD 1KJ9A 4Z49A 1GV0A 3D3QA 4HGZA 3I37X 5CVEA 2EQAA 3RVNA 4FZ3A 3TPZA 2ET6A 4CQLB 1JIXA 1IY2A 3IQZA 2PMCA 3ZWDA 5IULC 2VDLB 5K8CA 2G7MC 1KP3A 2H3EA 3K05A 5IKMA 1DV1A 1Z4PX 1H85A 2ZAYA 1ZRHA 1QCZA 2QMUA 3D6VA 1Q84A 1H8ED 5TT1A 1KJQA 2BDTA 4BZWA 4WEOA 4JP2A 2VQSA 1X77A 4FEAA 4G41A 4RJ2A 4ZDKA 2QRZA 2Q3DA 1XN4A 5FJIA 1IZ0A 1FMFA 2ZK7A 4LGCA 3ETGA 3KOUA 5IAEA 5ARDA 4UNQA 5B4VA 3ZVNA 1M7BA 2VPWA 3LG2A 1QKKA 2P41A 3H5TA 5JSHA 4IIDA 1RWWA 4Y1FA 2R8PA 2IFTA 3AUYA 4ALIA 3NXKA 4AO7A 1L1QA 2B1JA 1YBMA 2R85A 4QM6A 3ZJTA 1C4WA 1YS4A 2HRRA 5AI9A 3ENNA 3NOQA 4EG5A 1ZNZA 3JWPA 1K89A 2LWIA 2YBEA 5I7EA 2QD3A 3ADCA 1U2PA 2AW3A 3ANLA 3PL1A 3TR5A 1NPDA 2IY9A 4REQB 5KYTA 1BG6A 1VCOA 4FS8A 3O1LA 1JXMA 3G17A 3PD1A 1CUXA 2CK3D 2G07A 4URFA 3REOA 2HNAA 4K9DA 1CR0A 3QVWA 4LJ4A 2UV8A 2EBUA 1NYQA 3OIUA 1H93A 3GDGA 3LQ1A 1CUDA 4OBWA 4TM7A 3ZHYA 2C42A 4X3OA 3ZKWA 2E7ZA 2NW6A 3WWEA 4BU1A 3FZEA 2R86A 3G2NA 3CX8A 1MCZA 4Y6PA 5HW0A 3EZNA 4XGNA 3CPHA 4RE5A 1GCAA 4AXBA 5K3AA 1XEFA 2ZJZA 3VTKA 4EVQA 2LPMA 1GVNB 1QGZA 4OJMX 5JY1A 1ESNA 1RWKA 3KD2A 5DHAA 1JE1A 4ZARA 2JCYA 4WBNA 5C8ZA 2CMKA 2IUYA 3W04A 1VPVA 1R2QA 1YD7A 3ZXYA 2B7BA 2QRNA 3DOCA 4GL4A 1C4OA 4AMVA 1KSHA 1C8KA 1XAIA 2ZUCA 3L7MA 1NG1A 1Y1SA 2IF0A 1CW2B 1WIWA 1YA4A 3PQ4A 4URWR 4R2XA 1NW9B 2RE8A 2GN8A 2OGWA 4J3FA 3CINA 5CT5A 2Z2YA 5F2KA 5L40A 1YE8A 5KTOA 3WGGA 4DA6A 3G89A 1CKEA 1VSBA 3BE4A 3JAKA 4UXJA 5DWVA 5DNAA 3ZW7A 2ZM5A 2B8WA 3LKBA 3S2UA 3CH6A 1NXSA 4FFLA 4DLUA 5I48A 2WU4A 5TVGA 1C9EA 5D85A 5CPBA 4MR7A 3S4YA 3J80A 1ZO8A 1TZCA 1Z4JA 2Y3IA 4QDXA 4H16A 1PUIA 3NAGA 4R2MA 4AT1A 1WDWB 2OVBA 4BNUA 1P9NA 1P31A 1K08A 4FNMA 4B3MB 2QM7A 1HNXB 4ND4A 3JZAA 1SVUA 1CRPA 4KQMA 3WIBA 3CUTA 3ZDEA 1CJMA 1OBCA 2FRVA 4ZU3A 4XDZA 5KNDH 4AS1A 1LF0A 1Y6RA 4GC5A 4K0KB 3RV4A 1CR2A 1XLWA 2ENWA 3JPWA 4MR9B 4I1OA 4W7SA 1YB7A 3UHAA 2X6RA 2XYRA 4LYEA 4MPPA 4E2WA 1ORHA 1ONPA 2QTAA 5J63A 3VR0A 1IY0A 1DFIA 5KVVA 4HB3A 2EFYA 1JKMA 3AV3A 2CKDA 4YJDA 1T9GR 2ZRQA 3MILA 1YB4A 4JASB 1B76A 3DDOA 1GGMA 3PUIA 4MI3A 3PKIA 4EKIA 4PYRA 4AWBA 2H0AA 1BDHA 2ZT6A 5C8YB 4KPEC 5H83A 2R6ZA 2ZR0A 5LOVF 2Q0XA 3HKBB 3OMXA 1N32B 3P52A 2VBFA 2PVPA 4EHLA 3INGA 1JFFA 4LXTA 4Y67A 5BV0A 1RLUA 1SZDA 4IO1A 2RKBA 3B1WA 3C15C 3H99A 3L9XA 5JXGA 1JFLA 3EOBI 3MNFA 4M3NA 3UUFA 4KV9A 2O07A 3L9WA 5DPMA 1GDHA 3HCBA 4F2HA 2AVDA 2AW5A 4CCYB 4WZ6A 3OF5A 3T15A 2VDRB 3PNVA 4PQRA 4RELA 3QE3A 3QKSB 5REQA 1YS2X 1B3RA 2XUZA 3PDIB 3I3OA 4HWSA 4QPJC 4X24A 1WEHA 1GRCA 4IWNA 3UGKA 4B6OA 1FFBA 2VXCA 3PNSA 3DKKA 1M34E 1UT5A 2Q5OA 3G8BA 5KX5A 3OSUA 3DV0A 3V1MA 2BFFA 5A05A 1HPLA 1S4QA 1N2HA 1H05A 5E0KB 1ND5A 5FA6A 1GR0A 4QXQA 1BXRA 2PVSA 3KB2A 2AJCA 2O7SA 4ZVUA 2GPAA 3UFXA 3RHSA 4HLUC 4BB0A 4A6PA 2XMZA 3C3KA 1EQAA 1TIPA 2PSHA 4FZRA 1YRWA 2D8MA 5D00A 1KARA 1N5RA 1PN3A 1TJPB 1Y9ZA 3E58A 3I12A 3BIWA 5FWXA 4UPEA 3CZQA 3K0BA 1NXQA 4I55B 3KKMA 4RL4A 3LYHA 3WGHA 5IDYA 4K2HA 1N1MA 1KEEB 2NYUA 2YXDA 1MG0A 1OLSB 3LTEA 4I4TB 2HW8A 5I4BA 4XYEA 1VJ0A 2Q2WA 4MUMA 3V3TA 2XUJA 3EYWA 4AL4A 4Q21A 4HF7A 4DJFC 4Q9NA 2A6PA 3GFPA 3DVLA 1ESZA 5EZSA 5SZHB 4EMBA 3K09C 4Q7QA 3NO4A 4URVR 1WD5A 2VP2A 3HWSA 3KAKA 3QA3E 3TCNA 5CT9A 3OIWA 3ZH2A 2I4OA 2CMHA 3N6RA 1EDEA 3V9AA 1CYDA 4RHFA 4PM4A 3S70A 3E2MA 4TVOA 4D02A 1GZUA 2WYHA 3PDHA 2BFPA 1OU4A 5FBVB 2Y66A 2O7QA 3AM5A 2H85A 2VP9A 3HRKA 4XJVA 2TMGA 3TXYA 4JC8A 1G3RA 3PR1A 4F5WA 5FDFA 1YKSA 2OGZA 3V2IA 5IPFA 2Y67A 4MV5A 1GQFA 2WTBA 3BMQA 3CJRA 4BASA 5IKEA 1NUQA 1T2FA 1HNWB 3V8VA 3QPAA 3SS8A 1V1RA 3UEOA 1BDIA 4NPCA 5DYWA 3AEZA 4HUQA 1NE7A 1EKXA 3RKUA 2X14A 2C2KA 1AV7A 1KH3A 1CY0A 3EXG1 3LWBA 4GS5A 2QD4A 3T52A 2E5LB 2ALJA 1MIOA 5K8IA 2FN4A 3GV0A 1ZM2A 2NZWA 1OV4A 1PVVA 4MRAA 4CIDA 4KXFB 1CUSA 2D0DA 2CL5A 1G2PA 1GEEA 1JDSA 1T6XA 1ULUA 2OXIA 3EDMA 3GJSA 3RFXA 4EM6A 1T10A 1K86A 4B6GA 1MEEA 3K6SA 1AHIA 3WXMA 3DHVA 2WYUA 3VYVA 2H00A 3HCRA 4XEHA 4ZPJA 4HV4A 3MLBA 1DEHA 2XTZA 3AOEA 2WWXA 2RJOA 4P5PA 3DO5A 5L3SA 4MHSA 5JTTA 4O2BA 1VLLA 3JQCA 3QYFA 1YVDA 2Q21A 4ND8A 4EMTA 1KERA 2Q1UA 5CAEB 1FNNA 3RC3A 1MT0A 4YJ3A 4KLZA 1H4VB 2GM4A 4WOPA 5J3JA 1S5PA 5DHTA 3O1JC 1T8YA 4MGYR 1YQDA 2XMGA 2GEBA 2R3SA 3GVXA 1U8CB 4FLMA 1RLJA 4CLHA 4E1BA 1JF8A 4HI0E 4ZO9A 3DTNA 3NWPA 1EGAA 2IWHA 4FYYA 4U2DA 2A2ZA 3IPRA 5FD8A 3R8FA 4RGVA 5A9SB 3T1HB 4CM8B 4ZRNA 5LBTA 3I2HA 4X3PA 4FNOA 1PL0A 2ZTVA 1RYYA 3KP1A 5JNTA 1QP0A 2BONA 4R2JA 1T0IA 2QQ0A 4Y2UA 2XYQA 4EW2A 2JBAA 2OHGA 5HM8A 3LHFA 4NAUA 4O5OA 2IX3A 1NJ8A 5EYPA 3NDRA 1IY9A 5TGTA 1JSCA 2OWDA 1T9KA 3FFWA 3AVTA 4FXPA 3OFJA 5JZBA 2I0FA 1OIWA 5ENDA 1L3BA 1OLOA 4OHXA 4C4TA 1H1LA 5BV8A 3UMGA 2O0MA 3LX4A 3TYXA 5EJ7A 2XZDA 2VQFB 5FI3A 3DLTA 3PWZA 4ZV9A 2IXTA 4BO6A 1WWKA 5CG1A 3ILYA 4LRXA 2JFFA 4BNDB 1VDMA 1JMVA 1ZK3A 2ZBPA 2MMGA 1PL6A 2HU7A 2A86A 3LDAA 1GFWA 4KR0A 4HPWA 3C3PA 3K73O 5EL0A 3ZYZA 1PQYA 1I9CA 1GG5A 2JNWA 4Q3EA 4R1MA 4NBUA 2C94A 2P6OA 2AR9A 3L18A 4AN1A 1UK6A 3L0OA 3LZDA 1CIVA 3Q6IA 5JH7B 1OJ7A 1YR7A 4JA0A 5IKOA 4GKAA 3LKZA 4TL9A 2P7IA 5HM6A 1QIIA 1EZZA 3LU1A 4LOAA 4FYVA 2DM6A 1FTWA 2WDPA 3AKZA 5AH0A 3W5CA 4Y0AA 1JLRA 4GXTA 1VJGA 1KZHA 4HH4A 4AJEA 2B1QA 3FZQA 3MIZA 4HMPA 1Q1AA 1OYWA 1KNQA 3UHPA 2XRFA 1JHDA 2QMEA 1O95D 1QH8A 1XOIA 2J45A 1I6LA 2DWQA 5BYJA 4HMQA 2JJ2D 1JQDA 1PFUA 2GPSA 5AOBA 5KYVA 3ZZUA 3WIOA 3AY3A 4DDMA 1LQUA 3MFQA 1CUIA 1XFDA 1UBGA 5BSKA 1TUIA 1YB5A 4B6JA 2JLVA 2W48A 3PQEA 5AI0A 1AB6A 4P5EA 3ZU5A 4BO2A 2ZRJA 2GHIA 4AUKA 5BR7A 4KPYA 2Q99A 4HYQA 4F3NA 1JZQA 4UOZA 3K7EA 4MV3A 3QOFA 4Q00A 2AUTA 3T7IA 1M1UA 3JXEA 1LPOA 10MHA 2BLLA 2FFRA 2GNPA 1W2WB 4AY3A 5JCOA 5HVNA 1QLWA 2I6XA 3ZZ0A 3B1VA 4TQUS 2XCSB 4CR6A 4Z53A 2PUBA 2JANA 2XHZA 1OFGA 3FY4A 4PGAA 2ZR7A 3VH4A 1F60A 3UTCA 4AUEA 1IVNA 1IDN1 2Q41A 1KOLA 4L0MA 3AM3A 3BX1A 5COAA 5ICGA 4GBMA 3SE7A 4H2DA 2ACVA 2AL7A 2FGJA 1XKLA 2ZRKA 3DZBA 3NH6A 4G37A 5EMKA 2P4UA 4BFTA 4D0GA 2DPXA 3T5PA 4GW3A 5B1DA 3ONNA 4OJKA 5ALGA 1PZEA 3RHTA 3N9IA 1FX0A 1RT9A 1ZUIA 2ZCVA 3NAZA 1FP6A 4D3DA 2FP3A 4K9LA 1CX9B 1LDYA 3B8HA 1I5OA 1DCKA 1II8B 2WIFA 3MW8A 2JATA 4QOGA 4W6ZA 5AXAA 3UYKA 2WWHA 5J4KA 1RCFA 4S05A 4E46A 4H0FA 2AFRA 4I14A 4EAAA 2VDWA 3N75A 2Z9BA 5BV1A 2PDAA 3I2IA 5DN9A 3VKGA 1JR3E 1ODTC 1WA5A 3GUYA 4PQYA 3UN1A 4B83A 5DX0A 5ITZB 1E6WA 1T1JA 3Q8KA 3MTDA 2BAGA 4CNQA 2I4IA 4B3XA 1P5RA 1PS9A 4R0MA 3KSAC 1E3QA 1IAQA 4ASUD 2VNSA 3U1TA 4MRMA 4RJJA 5DHSA 3EK2A 5CLQA 5CFZA 3F8TA 3HKDA 3VBEA 2X0KA 2X3UA 3LL4A 1Z8HA 4F4DA 2VFAA 1DE0A 4EX7A 3BZWA 2QVCA 1CV2A 4KZPA 1HLGA 1R6BX 1X80B 3DMTA 3OAAA 3TE6A 3W34A 1CR6A 1ZXLA 2WA2A 3UAZA 3HXOA 1I2DA 4Z9AA 4Y2PA 4N76A 1LEHA 1HWYA 1XTZA 3KEFA 2B6HA 3BB4A 1RJ9B 4TZ6A 4Z0PA 1Q17A 2WM8A 1BMDA 2P6PA 3W1EA 2VQ3A 3GW8A 4F38A 3A25A 1QC5A 1XTKA 3I45A 1SCQA 3L1HA 2RB4A 2ZSJA 5K3FB 4C4YA 3ICCA 4BNWA 1TVEA 4DADA 5CA1F 1R0KA 2HU8A 4KSCA 3DEJA 4H7KA 2QLNA 1YDHA 5JCZA 1IOWA 4HDOB 5ALYA 3ZWCA 1QH0A 3KSZO 3QEJA 5FAXA 2BFEA 2BZ0A 4UTOA 3JVVA 1LS1A 3UG7A 5BN4B 5CBKA 4MV8A 1PIWA 1DKUA 3EJWA 4GO1A 1BVRA 5G53C 4DSUA 3EEOA 4MW4A 1SOWA 4NHOA 4X1IB 2GCIA 2WG0A 5KNCD 2ZJ1A 1IBSA</