3R3UA

Crystal structure of the fluoroacetate dehalogenase rpa1163 - wt/apo
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
304
structure length
304
Chain Sequence
GHMPDLADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHDRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIAQSAATPLDVWRKWASDVQGAPIESGHFLPEEAPDQTAEALVRFFSAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fluoroacetate dehalogenase
publication title Mapping the reaction coordinates of enzymatic defluorination.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Hydrolase
total genus 119
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r3uA00
2O7RA 3AINA 4B9AA 2RHWA 2WSLA 1VLQA 2EDCA 4MEAA 5FOQA 3IDAA 5JD6A 1E3QA 1GPLA 3UUFA 2WHPB 1GPNA 1LPNA 5AKKA 2C7BA 1YCDA 4E14A 1BRTA 1DINA 3H2IA 2XMCA 3HI4A 1LPBB 4ARBA 4BRSA 4Y2UA 1Q0ZA 4NZZA 1HL7A 1TKRA 5AI4A 2ZVDA 1BEZA 1DWQA 2OQIA 5HFNA 1XRNA 3FVTA 1UK6A 1ETHA 1W76A 2XMRA 1FFBA 1XZDA 5ALMA 2XUQA 4G8BA 1LPMA 1SCQA 1DTEA 3BL8A 4TGLA 2WFZA 5BOVA 2BCEA 3I2IA 1H22A 2XQIA 1QONA 1XZBA 1GKKA 3Q0TA 3PFCA 3H18A 4AB1A 1Y7IA 1UFOA 4G9GA 3UMJA 2OCKA 5LZ4A 4MWSA 2K2QB 5KWIA 5K3FA 5AKHA 5ALSA 3HLKA 1JKMA 4OB6A 4BB0A 2HA5A 4X91A 2RI6A 4C4YA 5ISMA 4Y2XA 4JYPA 1CUIA 2Z3WA 2Z5GA 1W52X 4J0CA 4KRYA 2AJDA 4OU4A 1RWQA 5DTJA 5HKAA 1ZGCA 2QR5A 4KE9A 4GHWA 3AILA 3ILSA 4L72A 1BE0A 4MJ3A 1THTA 3EF3A 4KEAA 3WK5A 4B84A 4JNCA 3WKBA 3CN9A 5HCUA 3H0CA 2VJAA 1IZ8A 1UK9A 4LKOA 4V2IA 4B9EA 4TVKA 2XUAA 4G4JA 4DSAA 2PU7A 2XDWA 4HS9A 3VKFA 3VJLA 1WHTA 1AUOA 2FUKA 3SK0A 1H2ZA 1XRPA 1CUHA 1E8NA 2WJ4A 5AI5A 5ALWA 4EHBA 1M33A 4ZXFA 5EHXA 3WK9A 3BF7A 2WHRA 5JZBA 3QZUA 2XLCA 2WTNA 3PF9A 3NUZA 1P0MA 1CEXA 1UKCA 2CZQA 2WQZA 5IH7A 5AM5A 3H2KA 3C6ZA 3HC7A 3BE8A 1AGYA 2VA9A 4DYHA 4ZV9A 3X3HA 1DX6A 3BWXA 3TEJA 2GZRA 3R41A 1ZJ5A 1P0IA 3O4JA 4KACA 4U2FA 2VQ6A 1K5PA 2ZYIA 5IKXA 4QDZA 1IMJA 3SX4A 4P93A 2QZPA 1QIEA 3GZJA 3G8YA 5A7HA 2OGTA 2HA0A 1LZKA 2EDAA 2WFMA 3D59A 2OCGA 3KSRA 1QTRA 2WIFA 1DX4A 2QXUA 5AKXA 4W1PA 1ZIYA 2XLBA 1YS1X 5DTIA 1HKHA 1R3DA 4MYSA 1VA4A 5AOBA 3D0KA 5ALGA 2DCMA 3IUMA 4UHHA 1SC9A 2JEZA 1JT2A 2FJ0A 2CJPA 4LYDA 2C0QA 1QJ4A 2Y2UA 1N1MA 1ZOIA 5AI6A 1R1DA 3C5WP 4DMKA 4F0JA 2H9YA 3V1LA 5K3FB 4EY4A 1BN6A 4BRZA 3AZPA 1YR2A 4PO3X 4B85A 1QFMA 1TK3A 2B9VA 5HZGA 5FPPA 3M3DA 3IUNA 2RHTA 1XZMA 1UWCA 5EI5A 5EIHA 3LIPA 4X95A 3RKSA 1CUJA 3HRHA 5IVDA 4P92A 5HQ3A 4FLEA 1EDEA 2WU4A 3O9VA 1MNQA 5FRDA 1PV1A 1QZ3A 4N5HX 1WB5A 3MGAA 1YAJA 2D5LA 5LP1A 4RGYA 5T4FA 1YASA 2I78A 3FLBA 4C4ZA 4U2GA 1EHYA 3WZMA 1VXOA 3RLIA 2QUAA 2H1IA 1UKBA 4G8DA 4QWMA 1J06A 1SFRA 5EGNA 3OPMA 2BUAA 1HDEA 3M82A 1AC5A 5ALEA 5I8PA 3WQHA 1YS2X 1U2EA 2G5TA 1VXRA 4K6GA 4KYVA 1W6RA 1XKLA 3DCNA 2JGJA 4BCDA 1Y37A 2NW6A 2B20A 3DEAA 3HSSA 3WJ2A 5HF8A 3K2IA 3W06A 3CXUA 4DMCA 2C5GA 5LIPA 3FSGA 4H7KA 4B0PA 1UKAA 1QLWA 3QMMA 1G4HA 5AICA 4PNZA 2QJRA 5AM4A 5AOAA 3L1HA 4UHDA 4X71A 5FPQA 1DT5A 4KAJA 3TGLA 5AI8A 4H7HA 4QEKA 1YSCA 4FOLA 5DYWA 1VA5A 5CT9A 1QIGA 2VJDA 1IUNA 1F0PA 3VJKA 3VVMA 5EIAA 1IUOA 4B7ZA 1UT6A 4INZA 1TAHA 3HZOA 5ALKA 1ZGBA 2Z8ZA 4G8CA 2ES4A 4BAZA 3EBLA 1W1IA 2HRRA 4E46A 5AKGA 2GBGA 1WPXA 2WIKA 5AKIA 4PSCA 3G9XA 3T52A 2ZJFA 1MX5A 5C7YA 3VXKA 3DYVA 4J0JA 1C7IA 1FSSA 1EINA 4MYDA 4B0OA 4E11A 2JIDA 4X7BA 2QOEA 3VDXA 2DQZA 5ALHA 3LIIA 5ALYA 7YASA 2YXPX 2HIHA 4H7FA 1QOZA 3LLCA 3EQ8A 1N5RA 3STXA 5CW2A 3WLAA 3G9TA 1LPSA 3GROA 4GEGA 2XUOA 4LXHA 1CV2A 1VKHA 1WCYA 3ESCA 5T4BA 1SCKA 5CH5A 3DDUA 4UHBA 3G7NA 1K8QA 2ZYSA 5I9IA 1EVQA 5D3KA 5HQ3B 4WFIA 3ZLUA 4BDTA 1EI9A 4FWBA 4ZREA 4WJLA 5C81A 3UUEA 4A23A 3AIMA 3AZQA 2Y6UA 5AIAA 1E8MA 2WUDA 3M83A 2VATA 4EZIA 4DGQA 3IVMA 2PKYX 5FXMA 2X76A 4JUIA 1JFRA 2BJHA 2XUGA 4H18A 5HF6A 3WYNA 4HTAA 3G0GA 3K6KA 1LPAB 4CG1A 1EK1A 3D2CA 4LHEA 3GA7A 3U0VA 1FFDA 5JARA 1TQHA 2WJ3A 4OYYA 2YH2A 2IX9A 3C87A 4FNMA 1LPOA 2P8SA 3OC0A 3DOIA 5IVKA 4Q3OA 2WIGA 5BWBA 2H7CA 5HK8A 2DHDA 2HRQA 4DNQA 1MAAA 1IVYA 3IUJA 2JGLA 1L7AA 2JBWA 3V1NA 1JU3A 2C5FA 1CUEA 1BROA 5SYMA 2OG1A 4BDSA 4BP9A 2HA2A 4K5QA 3QMWA 5A2GA 2CB9A 2AJLI 3C5VA 1CLEA 1DQZA 3G0CA 4H35A 3ED1A 3H2JA 5K5EA 3W9BA 3PF8A 5K3EA 1QE3A 3WK7A 2WUEA 1XLVA 2PL5A 3ESBA 1L7RA 2QT9A 5CXXA 4ROTA 1WOMA 3AJAA 3D2AA 5AKEA 2JF0A 2ZSIA 5FUMA 4UBNA 1CR6A 3L1JA 3ESAA 4UBOA 1UOQA 2OAGA 1XFDA 2ECFA 4UPDA 4J0IA 1EDDA 3ZWQA 3QITA 1QIMA 2WG0A 3FAKA 2WIJA 2XUIA 4CFSA 3STYA 2WFLA 4WDQA 1J07A 1XZIA 2PSJA 5IVHA 1U8EA 5DNVA 4L3WA 1CUWA 2HFJA 1AURA 3WIBA 4CG2A 4HVTA 1R4ZA 4MQLA 3FYTA 1IZ7A 3MVEA 4B80A 2HM7A 4MEBA 1I6WA 3D3NA 4H7DA 1GT6A 3KD2A 4ZGBA 4BAUA 3V1MA 1E89A 5HK9A 1P0QA 3PI6A 1CUYA 2RGUA 1VZ3A 2EEPA 3BDVA 4BYMA 1LBSA 4B81A 5EHNA 3DL4A 4C89A 3B12A 4BCCA 2XI4A 1CRLA 5DLPA 2JGFA 4J0DA 3O4GA 4Q34A 4F5ZA 5J3JA 5ALPA 2GBFA 3OG9A 1XRMA 1ACJA 2HU5A 4C01A 1H2XA 5A62A 1OILA 1XLWA 3FBWA 4FDMA 4ZRDA 3OOSA 2DSNA 2ZYRA 1NX9A 1ZD2P 2YYSA 5KREA 3L1IA 5AJHA 3A2MA 2O2IA 1WB4A 1XZLA 5ALQA 1Z68A 3WKEA 4XVCA 3FCYA 2HHAA 1MX1A 3QPAA 3ESDA 4UFNA 2XMQA 2OGZA 1S8OA 3KXPA 3EQ7A 5EFZA 1R50A 5AK3A 4G4IA 3MUNA 4F21A 4DLNA 3VJMA 3IB3A 4FLMA 2OPHA 4ITVA 3TJMA 5JAPA 1GPKA 4B6GA 1QIFA 3WJ1A 2WLSA 3A2LA 1KU0A 3IA2A 3WMRA 5CT8A 1VE6A 5ALOA 4OB8A 3V1KA 4CCYA 3BXPA 5D3ZA 5DYTA 5C8XA 1BS9A 2PVSA 4AXBA 4I4CA 3AIOA 3ZI7A 5HF9A 3QPCA 4BTLA 2OCLA 4UBMA 5HFAA 3F97A 2CKMA 2WTMA 2Y2VA 3T4UA 1XQVA 2WFLB 4YASA 2XMGA 2W6CX 2XUJA 4B82A 1AX9A 1FJ2A 3OM8A 2QMQA 3WL6A 4QLOA 3WK6A 2O2HA 1K4YA 2LIPA 3C43A 2IITA 5ALRA 5JALA 4RPCA 3QYJA 1DQYA 1EB9A 4AO6A 3NOXA 4HXGA 2PUHA 4M0FA 3HEAA 3FVRA 4H77A 2XQJA 3HJUA 1WM1A 1U4NA 3STVA 3WI7A 4BAGA 4WY5A 1JU4A 5E2IA 4J0GA 1SOMA 4DNOA 3C8DA 3F67A 1MNAA 3C8HA 5CURA 4AN0A 1ODSA 1NU8A 1NU6A 1EK2A 4GLBA 5AM2A 1TCCA 3NGMA 4C4XA 5JD4A 1HPLA 1QIHA 1VZ2A 3WWEA 5JAOA 2ACKA 3I2HA 2QJWA 4LXGA 2JGMA 2IIVA 3FSGD 2JGIA 2DFPA 5C8VA 4FKBA 4X94A 1MO2A 3F96A 5AKJA 4GI1A 1XKTA 3S8YA 2AXEA 1XZKA 3DLTA 3LS2A 1HQDA 4KAAA 5CBKA 3R3WA 4TPKA 3F9CA 4UHCA 1CUFA 4H7EA 2R8BA 4HRYA 4Y2YA 2DR0A 5AKZA 3DOHA 4W9RA 3BJRA 1TCAA 4QLAA 5DJ5A 2XUFA 3G02A 4N5IX 5LKAA 1AQLA 4FBMA 2PX6A 3ANTA 5D6OA 5AM3A 1EVEA 2V9ZA 4J7AA 3GELA 5LZ9A 2PSEA 4HZGA 3I6MA 1IUPA 4QDXA 1XZJA 2HDWA 1QIJA 2I3ZA 3KWFA 4QDOA 5ALNA 1ZD4A 4Y2JA 3WK4A 1P0PA 1PFQA 1F6WA 2OXEA 1MPXA 4Y2VA 5H3HA 4Y2QA 2AJBA 2W22A 4G1FA 2PM8A 3AZOA 6YASA 2GZSA 2X5XA 3WL7A 2VJCA 1W75A 1QGED 2BUCA 3FLAA 4DIUA 5JD5A 1BN7A 4DNFA 1DWOA 2HA7A 4X92A 4W63A 2BKLA 1JJBA 4KE6A 4PW0A 3FYUC 5ALZA 2R11A 1EX9A 5JASA 5E4YA 4BVLA 1LGYA 2HU8A 4P08A 4NS4A 3PFBA 5BV7A 4W1QA 2D0DA 4W1SA 5JATA 3WWPA 4IH4A 2XMSA 5DYYA 4MQMA 2QTBA 4GXNA 4XIIA 4QE3A 1XZFA 1XRLA 4QZVA 1CUCA 5CMLA 2PUJA 3WA7A 4X85A 3K9BA 3QBJA 1CUGA 1QO9A 5JADA 3O9MA 2J3DA 4FTWA 4KE8A 4PQEA 2OGSA 2WILA 3I2FA 4AO7A 5AIBA 1EDBA 3I2GA 3DNMA 3S2ZA 3N0TA 1H23A 3E3AA 3OURA 1QTIA 3C45A 4BATA 4ZI5A 3R3YA 3DKRA 4X6XA 5YASA 4QNNA 1X2EA 1YA8A 3SWWA 3C6YA 3KOOA 2VAVA 4U2DA 5FV4A 4NMWA 1MT3A 1KU6A 5HKBA 1E66A 1GQSA 3WKDA 1XQYA 2XUPA 4BTVA 3PUIA 2J3QA 5FLKA 4CI9A 1WB6A 3ICVA 5JAUA 3STUA 4RE5A 1CUAA 3R0VA 5K3BA 1BU8A 5ALUA 5ALXA 3FWHA 5ALVA 5IVIA 5AO9A 4AN1A 2AJCA 1TCBA 3E0XA 1PJAA 1X70A 2C0PA 4XWGA 3R3XA 2ZJ7A 3H2HA 5KWJA 1BEEA 3A2NA 3STTA 3RARA 3R3VA 3WL8A 4UFPA 5FKJA 4PV7A 2WUFA 4CG3A 1UZAA 4K2AA 2PBLA 1JMYA 3ZLVA 5E4TA 3VVLA 3QPDA 2ZJ6A 3D7RA 5LZ2A 1UOPA 4Y2TA 2QS9A 4MXDA 1CUSA 2HADA 3VISA 4Q1VA 2WHQA 2HU7A 5AM0A 5HF5A 3N2ZB 3G0DA 4BVKA 4GW3A 2RONA 2JGEA 4ARAA 1YA4A 3DYIA 5D7BA 1QIIA 3WWOA 4W1RA 2H7XA 3G0IA 3DL7A 1YB7A 4QA9A 4BZWA 4OPMA 1UOOA 5DNUA 3WIOA 3G9UA 4XJVA 4AMZA 2O2GA 5AI9A 4AZ0A 1VJ5A 4ETWA 5JAHA 1MJ5A 1MAHA 2XMZA 1TRHA 1GKLA 3R40A 2GYWA 4IH9A 1GGVA 4CIBA 3E4DA 4AMYA 2PSDA 1Q83A 1HBJA 4FMPA 3BJMA 1KEZA 1LZLA 2JGKA 3WA6A 4OCZA 4G4GA 1G42A 4Q3LA 2ZSHA 3SC2A 3D2BA 4BC0A 4U2EA 1ZI6A 1XZEA 2HA3A 1RP1A 4GECA 5ALLA 5CH8A 5AK6A 4EA6A 4RNCA 2XQFA 2QM0A 2VJBA 3HABA 4UHEA 4BE4A 1CIJA 3V9AA 1VE7A 3W04A 4XX1A 4UBIA 1JI3A 5AM1A 1DT3A 3HYSA 5ALIA 4KR0A 3WKAA 1O6FA 4J0KA 5ALTA 4J3JA 2G4LA 3O95A 4H7JA 3W05A 2VAXA 5C8ZA 4OYLA 1GXSA 2Z3ZA 5A7FA 1J2EA 1ODTC 4FBLA 3PE6A 2ROQA 2V98A 5LYYA 3D4LA 1C4XA 1O6GA 2QRUA 1U65A 3FCXA 4UUQA 3IUQA 4WDRA 2WIDA 1MTZA 5A71A 1Y7HA 4Y2RA 4WFJA 5AK4A 3WYDA 1XROA 1WPRA 2PPLA 3BIXA 1T4MA 3M81A 2WKWA 4EBBA 4AX4A 4B83A 3HACA 3NWOA 1D07A 1CVLA 1YAHA 4BZZA 5E4JA 2HA6A 2V96A 2ONCA 3A6ZA 4GWLA 4QDTA 2Q0XA 4YX9A 4IH1A 5K3CA 3IULA 3IBTA 4L9AA 1B6GA 4LXIA 2GYVA 3GBSA 1XZAA 4C88A 1H2YA 4DMHA 5JZSA 4JEIA 2O7VA 4OSEA 1ACLA 1LBTA 1EH5A 4FLFA 1G66A 4EY6A 2G5PA 3H17A 2CMFA 4AZ3A 1USWA 3BF8A 5LZ8A 1XQWA 2XQGA 3H2GA 1EB8A 1ZICA 3ICWA 3G0BA 5EIEA 4GBGA 4UFOA 5ALDA 1FFCA 5AOCA 3PICA 1J1IA 1N8SA 4YPVA 4U2BA 1XZHA 4BP8A 1UK7A 1JJIA 2BFNA 2WUGA 4DTCA 5K3DA 3STWA 3I2KA 1L7QA 2VSQA 4I3FA 4OUKX 5AKLA 1A8QA 3BDIA 5FP0A 3KWJA 3TRDA 4QDUA 3LP5A 4HRXA 2DHCA 4ZV7A 5FDFA 2BGRA 3V48A 1WHSA 2B4KA 3FYUA 4HAIA 3IURA 4UBKA 4IHAA 4K6HA 4Y2PA 3KDAA 3D5EA 2OCIA 5AP9A 2QUBA 3W9UA 3QMVA 3JWEA 1DWPA 2AJ8A 4QWWA 2XMDA 1ZD3A 3CCBA 2GBCA 4X90A 3GFFA 1T2NA 3U1TA 2XMBA 4DNPA 2OLEA 4E15A 4PSDA 4WFKA 1QFSA 1ZI8A 4J0HA 4A16A 4CIAA 5EHZA 3FLEA 4C87A 1A8UA 3RM3A 4P9NA 4AO8A 4OD0A 5CT4A 4L0CA 1YB6A 2WJ6A 2PU5A 2QVBA 4X3CA 5A6VA 3H19A 4KJXA 3R3UA 4EUSA 3DJYA 5K3AA 4AQDA 2CUTA 2FX5A 1CFJA 3OTQA 4CCWA 3C6XA 1X2BA 1QIDA 2YASA 4Q82A 2XUHA 3I1YA 5AI0A 1B41A 1ZIXA 3QVMA 3JYHA 1MX9A 4FFVA 1EA5A 5BWCA 4UBLA 1QIKA 3Q8WA 1CUUA 2I03A 5CRIA 2J4CA 3DKKA 3E1GA 3H04A 4KE7A 4N8DA 1K6EA 3DQZA 3C70A 2XT0A 3GUUA 2RAUA 2OAEA 3F8SA 2H7YA 5JYCA 2CEKA 4C6HA 1A7UA 4CCYB 1C7JA 2BUBA 1R88A 2QKYA 4N8SA 3HXKA 1MU0A 2E3JA 5CT5A 5ALJA 5T4EA 3ZV7A 5F4ZA 3EIOA 1SCIA 4UHFA 2HA4A 5AHXA 4BC1A 4U2CA 2C58A 1CUDA 4M0MA 4BBZA 1LLFA 2B61A 4GDMA 5DNWA 3WL5A 3F98A 3CCCA 3IIIA 1W4LA 3AUKA 1QO7A 2XE4A 2I3DA 1UK8A 4G9EA 4H7IA 4MWTA 3EQ9A 3PDCA 1FFAA 5DWDA 4BVJA 3AIKA 2ACEA 1XQXA 1XRRA 3H1BA 3LCRA 4A5SA 1JJFA 2WM2A 2VT6A 5CT6A 4X97A 2XUKA 5JZ9A 4WCVA 1JMKC 4K6KA 4OU5A 3FYUB 4JYMA 4JH0A 1BCRA 5AKYA 3O0DA 5CH3A 5I7UA 1A88A 3WWCA 3H1AA 4KRXA 4G5XA 4DSZA 1CUBA 2GBIA 5ALFA 1FFEA 2FJPA 4UBJA 3O4HA 4LYEA 4FHZA 1XLUA 4Y2SA 3AFIA 3QH4A 3YASA 1MN6A 2BAGA 1K63A 4DM7A 3ANSA 1GQRA 4PSUA 4X6UA 2WG2A 4X6YA 1TIBA 4YK7A 2PSFA 3I28A 2XUDA 3I6YA 4X93A 3B3QA 1LNSA 2VT7A 4LIPD 5T4HA 2G63A 3PUHA 2ORYA 1ORVA 1CUVA 1HLGA 2WHPA 4ZWNA 5EHQA 1Q0RA 2QXTA 3WK8A 1G5FA 1E5TA 2BGNA 1CUZA 4NVRA 3BIWA 1CPYA 5LZ5A 2VEOA 1F0NA 1A8SA 1VOTA 2ZYHA 4EY8A 1E8DA 2PSHA 3P2MA 2GYUA 1OXMA 3QM1A 1ZJ4A 4I19A 1GZ7A 2XB6A 4BE9A 4X00A 2WG1A 5LLSA 3C6BA 2HL6A 3ZLTA 1Q84A 3O4IA 1UXOA 2VTVA 4HXFB 2J4FA 5ESRA 1AMNA 1AZWA 2XQKA 5CTAA 5JANA 3FOBA 3WKCA 1DU4A 3B5EA 1AKNA 2OQVA 2Y6VA 5AK5A 4IO0A 2CBGA 4EY7A 1LPPA 5LZ7A 4BCBA 4J03A 4Q3KA 3R3ZA 5KBYA 4DMFA 1R9MA 3RK4A 1CUXA 4D9JA 2C4HA 3G9ZA 2V97A 4EB0A 3JW8A 3I1IA 1R9NA 4Q05A 5SYNA 1EXWA 1ZD5A 4FFWA 3W2TA 4EY5A 2DHEA 3I2JA 1N5MA 5JIBA 4N8EA 4PF1A 4KAFA 5CXUA 1CQZA 1RYYA 1XZGA 2HFKA 1ISPA 4F60A 2X8BA 3CN7A 4Z49A 1THGA 1CQWA 4IQ4A 2JEYA 5AH0A 3DD5A 3MUOA 2UZ0A 1OCEA 1ORWA 4Y9SA 4WY8A 1XRQA 4Y7DA 4O08A 2Y1KA 3WZLA 2RIPA 2DQYA 4OB7A 3DS8A 1BCSA 3FNBA 1F8UA 1ZI9A 3WWDA 1H2WA 2WU3A 1XZCA 2VF2A 4FNGA 3ZPXA 3I6ZA 4M0EA 4S0XA 3A70A 4RE6A 5LKRA 4H0CA 1ODCA 4HXEB 5A7GA 2Z8XA
chains in the Genus database with same CATH superfamily
2RBKA 1QOPB 5CJJA 1X9HA 3DV9A 3KAPA 1Z12A 3WBKA 3U5TA 2NNLD 4MSUA 1KO7A 2JGAA 3GJ4A 3ED5A 2FFQA 5AW3A 2P3SA 3OFSA 4MV4A 1YR9A 1N8TA 4CL0A 3EIEA 4QREA 3E9CA 1X7DA 4YT5A 3P7MA 4CKCA 4ZQHA 4QPPA 1RRCA 1YQEA 4BMZA 2AIRA 1GPLA 3TJRA 1UZMA 1SCDA 4FIZA 1J24A 3NHZA 5AKKA 4OK3A 1LPNA 1TMGE 2QW0X 1SRQA 2C7BA 3ITEA 3MTGA 4I9HA 3CUYA 1BRTA 3MBOA 2GBPA 3H2IA 1SXJE 4FMCF 4FSXA 5D7NA 2EJCA 5SY9A 4Y1RA 5TSDA 2GZ2A 4F9GA 1IB6A 3GJSA 2KYRA 5AJVB 4JFRA 2CNKA 4Y2UA 3K1YA 2QI9F 3SS8A 4LBVA 3S8EA 5HPYB 1J2YA 3WNQA 1DQRA 3TOSA 1XVTA 3W79A 4L02A 4E5VA 1DEXA 3GN1A 4U7WA 5BVGB 4E70A 3IQDB 4MQ5A 3M4JA 3EXG1 2OOKA 1C1DA 1KZYC 3HBNA 4HD8A 1OHHD 3AETB 2A35A 2JVJA 2OQIA 1QDEA 3EXHA 4L76A 4BO6A 4H0FA 1YUMA 1ZX1A 4DILA 4L5AA 5KQMA 1JG4A 1FFBA 1Z22A 1CLUA 1AG9A 2F90A 5FI3A 1T34A 5ALMA 3K1AA 4C78A 3I2YX 3EPRA 1JUDA 4I1IA 5E3JA 2AQHA 3AVOA 3HJCA 1KMHA 4MW5A 3D7MA 4RETA 2OUIA 5GGXA 4R8RA 1CF9A 3LI2A 3Q41A 5FO1A 2IEAA 2K7ZA 2EQAA 5K51A 3RRYA 4JSRA 1V1MA 5BQ3A 1DZIA 3EQ6A 2DU8A 1MABA 3C7AA 3BTUA 4M9UA 2YJ5A 1YZYA 4HQRA 4TGLA 4YRBA 3HJFA 4HPWA 3PGXA 5CX1B 5DV9A 1ULTA 1NUAA 4K28A 4IL5A 2V6BA 5E8JA 2LNDA 3RH0A 2NU6A 2V7QD 3W9SA 3ZWOA 2GHQA 4F7DA 4DCJA 4MQFB 1X8JA 1E9BA 3JAWB 4AFNA 3BD9A 3QK7A 3FUUA 1LJUA 4QBIA 4JVSB 2GD1O 1XDZA 1RQLA 2B8NA 3E2IA 2J6CA 1UAAA 2GF0A 3VR3D 4JZYA 2YVKA 4L6AA 2PZFA 1IWBB 4CIYA 1RWKA 2HWYA 1CS0A 2V7UA 3C5EA 1XT6A 4TVSA 1KAQA 3DMRA 2OZVA 1O6BA 5JXIA 2FAXA 5H68A 1JAXA 1KXJA 4LJ7A 4DLAA 2JFBA 3TE6A 1JKMA 4OB6A 4M7WA 4R01A 5AHKA 3FNHA 3UTDA 4A9AA 3D6JA 4H27A 1JEJA 1VBFA 5FTNA 3L02A 2F43A 3OE4A 5GOTA 5DI9A 5AVXA 4REQB 2F3RA 4C4YA 4YALA 4Y2XA 2B92A 4F96A 4JYPA 1EE2A 3OOWA 4NJMA 4O63O 4XQGA 3E70C 2XGGA 2Z5GA 2VPPA 4KRYA 4FJ0A 3WTCA 4JS0A 4MR8A 4OU4A 4W8GA 3ZKWB 1U8ZA 5DTJA 1GEEA 3KQYA 1T2CA 1DOAA 4PC7A 1ZGCA 2GASA 2M9MA 4KE9A 4W5JA 3HCWA 4GHWA 4HFJA 4D9EA 5E6UA 3ZQ6A 4UMVA 2O3SA 1BE0A 5JDCA 1L3IA 2UUCB 3RS0A 3DAFA 4FM9A 1RPAA 2P11A 4HNGA 2G72A 3L6RA 2HLDD 4U7PB 5CHEA 3O8QB 1A50B 3ZE9A 2EKLA 3BERA 1E64A 1XHEA 1ZJZA 3DGEC 1K7XB 1YRLA 5A4KA 1IY2A 3OQNA 3WK5A 3TM5A 3K0SA 4Z9AA 3D81A 4LJ6A 2FZVA 2AZTA 4RCYA 4FPXA 4RL4A 3ZUGA 4CKYA 4O6VA 3CN9A 4LDPA 2E87A 4RKEA 3AXTA 3IMFA 3V8EA 4ZCLA 1PD1A 1AK9A 5HCUA 5JH7A 1WU7A 4FMBB 3GLGB 1UP4A 3O74A 1RXIA 2P8JA 4JB2A 4MPPA 1UK9A 4OLJA 3CLRC 4CUJA 5KTMA 2DFNA 2REBA 1TL7C 1M6VA 4IDFA 3SYMA 5BR7A 4RTKA 1E0SA 4Z6KA 1ICIA 4W7IA 2V7EA 5D2CA 4DSAA 4BB9A 2IGBA 4YR9A 1VB3A 1KYIA 2XDWA 1M1XB 3P94A 3W90A 1PJ8A 3AR7A 3GJ8A 3Q8LA 3IAEA 2YWFA 3VKFA 1WW3A 5C51B 5F9FA 1LSJA 2HSZA 2X7XA 1DTWA 3IEKA 1AUOA 2H4YA 5BQFA 4QPDA 2H18A 4YAJA 1E2BA 3SK0A 4DARA 3A06A 5IJAA 5TIIA 2WM3A 5JW6A 2RH9B 4MJ7A 1UUFA 2P5TB 3NANA 1C2YA 4ZYYA 1DUSA 1NR1A 1L7BA 1DEKA 2VC2B 3AX6A 4NNOA 3BF7A 1FMFA 1MA0A 4Q66C 4EECA 3FCOA 1HE5A 1NI3A 4RLFA 2G28A 4O0LA 2WTNA 3RC3A 4WFQA 3SC2B 2HYIC 4HFNA 1GG8A 3ANMA 1J33A 4Q4LA 2XCOA 4IZHA 1JJ7A 2ZI9A 2B8JA 4IG9A 3RS8A 3TNDA 4HT3B 1HETA 4IIBA 4GOKA 5BQPA 1JEDA 1QVVA 2A59A 1WA5A 2Z83A 3BJIC 3HL0A 1OI7A 3QY9A 4FGLA 3N87A 4MUYA 2RARA 5TARA 4OUDB 4DWJA 1SQSA 2ZOSA 4I6JA 5IBQA 5A3RA 4KVZA 2IPLA 4LYGA 3GH3A 3IELA 1DQPA 3S1SA 3C4JA 4G5GA 2Q7OE 1OWNA 2G83A 4KZKA 3V46A 4M2LA 4B17A 4LWPA 3PWZA 4DJDC 2MYTA 2R1TA 2AB0A 5MN5A 3PVCA 3IOCA 4S1OA 3TOCA 5DM60 3OQIA 2FPGA 3CC8A 1EFPB 4N82A 3L5KA 4E5PA 1TUBB 5IKXA 3CGGA 4QDZA 3IR6A 1IMJA 3SX4A 1AGRA 3WGHA 2GAAA 5IJ0A 1ZCFA 4JP1A 3V4PB 2QZPA 3GZJA 4MKHA 4WWHA 4BQIA 4DMLA 1YQWA 5A7HA 3ABSB 5DBHX 2HA0A 1DJOA 1LZKA 2XZTA 4DE5A 2AKAB 3C3DA 3GVPA 4HZUB 1P4HA 2QAGC 1SVIA 5IN4A 4IIJA 2UZAA 3FYDA 4LDRA 4I50B 5J40A 3D59A 1I32A 1NJ5A 5IABA 1BGXT 5F51A 2ST1A 1P5RA 2JDIA 4NZYA 1ORHA 2PN1A 3W2IA 1QNFA 1L4GA 2ODPA 3GLRA 1P2DA 3IHLA 1X3LA 1ZIYA 2XLBA 2Q6KA 3UC5A 2CKDA 5K8TA 1HKHA 4BL5A 2WWYA 5CLLA 1ULZA 2W43A 2FFJA 4Z1OA 2MT9A 2OV2A 4MYSA 1P5ZB 3MQ4A 1LI5A 3OETA 5BR1A 2IEZA 3DV0A 1N6OA 4QO7A 1NFRA 2C3UA 4EY3A 5JZOA 1TTQB 4NG5A 1U1CA 2DCMA 3O21A 4L4RA 5D01A 3ZDFA 1J42A 3E3MA 4Q21A 3RU7A 5C37A 1FYFA 2BRUC 2F1OA 2ZATA 5JXHA 2I2DA 1N34B 3AB8A 3CNOA 4FWTA 2KBEA 2P9JA 1FYXA 3VM6A 4DCMA 5KYXA 5JY1A 1ZNXA 5MGNA 4U1RA 2Q3HA 2NZ8A 1QPBA 3UWSA 4C0JA 5BV8A 2W42A 2JLWA 1O5OA 2FYTA 4A82A 1L4NA 1WCXA 2J08A 3IQIX 4MRAA 2A1TR 3G5MA 1QJ4A 3IP6A 3M49A 1ZOIA 4MIKA 5JR3A 1LC0A 4ZYXA 4GGPA 1T3ZA 2OESA 3C5WP 4CI0B 2W6IA 2UUOA 4JL6A 3EODA 1NVDA 2HBRA 1NTOA 4GQBA 5AXCA 2JGRA 4CV1A 1PJ3A 3GFSA 1K7FB 1PDVA 3QUCA 5JSUA 2C7VA 3JWPA 1IQPA 2QTVA 4B3IA 1U2PA 4WVLA 1WZ2A 1VIAA 4C7KA 3AVWA 2NMVA 4HNAA 1KI4A 4GX1A 3TLGA 2A33A 3CH7A 3EMDA 4M9RA 3ER6A 1FU8A 2C29D 5BUSA 3T5PA 4Z9YA 3QU4A 3K0CA 1BXZA 1LK5A 2IE0A 4B85A 5ED0A 1QQ7A 3R1IA 4MA0A 5CDFA 4RTRA 3T4XA 1IDN1 3B6KA 5FEMA 5EZYA 4L2IA 4JP8A 5HZGA 2XW6A 3H16A 4WLFA 5AVUA 5IU6A 1FBTA 4OM8A 1P9RA 2EL9A 2BWJA 1HT1E 4S3MA 2GD2A 4UTPA 3DP9A 3LIPA 3DDOA 5JS2A 2CB0A 1ZMOA 1CUJA 1NUQA 2I54A 2VRNA 4G65A 4HDSB 2O2XA 4NZ9A 2RH5A 4TV9B 4Z3DA 4DXHA 1N57A 1C1XA 4FLEA 3LUKA 2NN3C 4EHJA 4F3RA 1YDEA 2FETA 4QOSA 5FRDA 1K8ZB 2B6HA 1HEUA 1DJQA 2WPNA 3LC2O 5FBKA 1EWKA 2EF1A 4TKVA 1WB5A 4PLHA 1VPWA 2KE5A 1V9CA 2BFWA 4RGYA 5C8DA 3AVTA 4E1VA 1BG6A 3KJNA 5G1OA 1NE7A 2N46A 1DBSA 5GM1A 1J4AA 4U2GA 4KR6A 1ESNA 3CKYA 4JUFA 3RLIA 2YWGA 1T6NA 4EQ6A 2M6LA 4A0HA 3AY7A 2CLFB 1E2PA 3PXBA 4ZVTA 2DPMA 3U16A 4DA0A 3R44A 1HE2A 4QWMA 3H11B 4P22A 3Q6MA 1SFRA 3RVJA 3TMKA 4DANA 3C3XA 5IDYA 5EGNA 2D0OB 1H0RA 4M0DA 2IF2A 4OL0A 2IU0A 2COKA 3DE6X 3DXXA 3PUWA 4AZ3B 1TU4A 4A2PA 5I8PA 1LSSA 1YV9A 4P2GA 3OECA 2IEBA 2JGDB 4PGAA 2BGUA 2NU9A 3ETLA 2R86A 3OM0A 4XZ3A 3ROTA 1WCIA 4D9HA 4W5RA 2ZG6A 2G5TA 4J1QA 2DFDA 4KYVA 1US8B 1YF3A 4F4HA 4FDLA 4WJKB 7MHTA 3A6HA 3UH1A 3UMGA 2YY7A 2H2GA 1NHWA 1RKUA 1Z37A 3OT1B 3D7LA 3HCEA 3E8XA 3FHCB 3WNZA 1ZH6A 4DLLA 4CEIA 3A8TA 3AEYA 3DEAA 1A1VA 3TOZA 1FSPA 3WJ2A 3PJDA 5HF8A 4HADA 3FDJA 3QIAA 4TL6A 3RFCA 1WEHA 4KBFA 1Y6QA 5BPHA 4URYR 2IBTA 4EDFA 2WV9A 2I22A 2YMMA 3FSGA 2PMBA 4BNIA 2GBLC 4DV6B 4HAOA 2I55A 1UKAA 4U8HA 1D09A 1A9RA 2ZUFA 5I7FA 4M1MA 4NONA 2CD7A 2NO1A 5DBEX 3V8PA 2XZOA 4B75A 3LBHA 3AV0B 3RHSA 3GJTA 4IX9A 3T8YA 5ED4A 4R0NA 2ZCJA 4M46A 4XFKA 4CT4B 1U3WA 3SLRA 1ESDA 2QUJA 3L1HA 4UHDA 1NVUQ 2IHUA 2JAXA 4X71A 4F4UA 5J2TA 2WQ6A 1HE3A 3JYPA 3TGLA 2IS2A 3IAS6 3CRNA 4QEKA 4TXHA 4M9ZA 5JMTA 4GPTA 4JLUA 3KQUA 2HY7A 4F1KA 1QIGA 1EE9A 3AOEC 5JWHA 1I5RA 1XTJA 2QMOA 1F0PA 3RVRA 1IY8A 1E9EA 4P58A 3VJKA 4NXNB 1T0UA 5C5EA 1NUPA 3GUYA 4J0QA 4O5AA 5E4FA 4YUZA 3EVCA 4KVFA 3MAAC 3CWQA 1IUOA 3GLHA 2W2PA 5DHFA 3DWEX 5EIAA 1UT6A 4MV6A 3V4VB 4EBFA 4E31A 5I51A 1PJSA 3HZOA 1JR4A 5P21A 4BX9A 1DARA 4ZHQF 1EUYA 1LJLA 4K6MA 5KWVA 1ZGBA 3RASA 2Z8ZA 1CDEA 4KZPA 3WGGA 1GHTA 1ZN2A 4HNHA 2ES4A 1GL9B 4PTYA 2Q99A 4ZGWA 2VDWB 2B94A 3LVBA 4HGPA 2PWAA 4ZZ3A 5CA1B 2P2SA 1CEYA 4ID9A 5JPCA 1Y98A 3GZTB 1EP3B 4E46A 5AKGA 5F2OA 3IA7A 5BNFA 5TF4A 1U1DA 2C5SA 1VPLA 4PSCA 4EEKA 1JSZA 2QY9A 4J94A 1UZLA 1ZA2A 5AQEA 3LPNA 3GMIA 4NESA 5GIPE 3WSWA 2GN6A 2NXWA 3GJQA 2DLNA 5C7YA 1P4AA 2XNKA 1ZD1A 4HWRA 5ENVA 2IH5A 4DLTA 1QG2A 4MAFA 1I2ZA 4NULA 1NF2A 5DHSA 2QTZA 3AKCA 3ER9A 2PYZA 1O1YA 2ZB2A 3ZXUB 4B0OA 3NMUF 3LCCA 1UMKA 3VTFA 2F1HA 3U0BA 3L7YA 2JD0A 1I7DA 1NXWA 2QOEA 5HILA 2DQZA 3J7AC 5ALHA 4D8XA 3B8EA 1DAIA 3LIIA 2VK1A 4DDWA 5ALYA 5JFGA 2OA0A 1U0HC 3GN2A 1L5KA 2HIHA 4B3SB 2X0IA 4K9LA 1BVUA 1T4CB 4MGZR 1L7MA 4B3BA 2PVCA 2DH6A 4TMFA 5L45A 5L4NA 3LLCA 1AE1A 4ALIA 1GUDA 4H4CA 4R3WA 4RJKA 3UNXA 2ONKA 4ZTBA 1KZ9A 1KI6B 1ZH8A 1H0SA 3WNDA 1KHHA 3M5WA 2HMTA 1K66A 4OBXA 2OHFA 4GEGA 4YRTA 4NE9A 2XUOA 3P0JA 2IXGA 2JH9A 3GGOA 1WCYA 2A0UA 3S5UA 3T4PA 3LPLA 2BHSA 2I4IA 1JWAB 3A26A 3BGDA 3PNVA 4UMEA 1TAQA 4ZCPA 2FDXA 4EABA 5I4BA 1VLVA 3UMCA 2YQ4A 1Y8ZA 1M1YB 1J2RA 1K8QA 5FJJA 2M2IA 3KQNA 4IS2A 1ZDMA 2XWSA 4RFSA 3KZ1E 1JEYB 1MF7A 1JHDA 3H8VA 4XIGS 1EVQA 1M2EA 2A9FA 3VHXB 4JI4B 4G0UA 1T4DA 2XKAA 3LQQA 3GGPA 3UK6A 1A5BB 4M7RA 1ESZA 1OLXB 4Y18A 4EITA 5DCWA 4O4LB 1EX7A 4IXDA 4PPFA 4G97A 3LBFA 3LY9A 1FUIA 4QNMA 1LC3A 1SJ9A 4PLTA 3ZV3A 5HSGA 3T1HB 3LWZA 4GWKA 1ZRHA 2EG5A 3MINA 4NCIA 3UUEA 5DT9A 3AZQA 2HK7A 3RIYA 3VTKA 4PZ0A 1O87A 2JKZA 1IQ0A 4GKKB 3M83A 2PZ8A 2WTXA 3GLIB 9GPBA 4H6VA 4ANFA 4H1VA 5EMJA 4FOPA 1SWWA 2AR9A 2OZLA 1JFRA 2BJHA 2YJGA 3DBLB 4RIGA 5LMNB 4H18A 2ACVA 4X61A 4BUCA 4UD2A 2GAOA 4NC9A 4HTAA 1ND5A 1SR8A 1E1YA 2COEA 5IC5A 3SZMA 5GOZA 1M10A 2EW8A 2P9CA 3EHEA 3H9GA 3PIDA 4UHKA 3DKPA 3H1EA 1UEJA 5LQCA 1WZEA 2OCPA 5B3AA 4KSBA 4LHEA 4ND1A 3U0VA 3CB2A 1TQHA 4F7WA 2WJ3A 4OYYA 4S12A 1VI2A 3WO1A 3NXSA 3M6FA 4UM5A 1VTKA 5GVSA 4P8RA 5DSXA 3F4LA 1C8BA 2AN5A 2VHVA 4ZO6A 1FVXA 1U7HA 1WUHS 3A4NA 4ZOLB 2FPIB 1D2CA 1T1IA 4NARA 1GRRA 3KVYA 3SHTA 2P7HA 1BXGB 3H5OA 4NPHA 4N3BA 4HX2A 3SZGA 2VYND 2X5NA 4YLYA 1O96B 3LL4A 5ICFA 5KAMA 1LPOA 4UPEA 4JP3A 2C4TA 4UXJA 2LWIA 3OC0A 821PA 4ECAA 2WVJA 3DOIA 4RV5A 2BDUA 4BNTA 1BJKA 1EWQA 1HEYA 1W19A 3A05A 2I6GA 4IHQA 4JLMA 3ZX5A 4M1WA 3ROPA 1GZHB 2IWHA 1NMXA 4DSNA 2QQGA 4XWYA 3PDWA 1Y7TA 1ZKMA 2V1UA 2PNJA 2VJMB 2IYAA 3WXBA 2EOAA 4BBAA 4YAIA 1YXMA 4DNQA 2P7IA 4CWAA 1IYZA 1UJCA 2Z95A 1QYCA 3DL0A 4MKFA 4I6GA 4UXHA 5BYKA 4WEQA 1VIYA 2JBWA 1OXSC 1WJGA 3LC7O 1JU3A 3OFNA 3TZCA 4IIGA 2YJ4A 5CXSA 4I0WB 5SYMA 1B74A 3GT7A 1RTKA 1LDGA 4GKBA 3GLSA 1KEPA 3H4MA 2CUZA 4BDSA 3M0EA 3H9QA 2JAQA 1OZAA 5FPYA 1UXKA 5CVEA 2HA2A 3Q6NA 2D0PB 4K5QA 3RRBA 1COZA 3WGNA 2XTAA 2O8FB 2IBSA 1HTBA 3QMWA 4ICIA 5CLIA 4IP0A 2H00A 3AOGA 3UPTA 4J7CA 1LRLA 3TTWA 2EJWA 4KIJA 5KOYA 1GPJA 2BVNA 1ZP6A 2EBFX 3G0CA 4QQRA 4ZYUA 3OPNA 1CJSA 3ED1A 1X87A 2AWOA 3KT0A 1V8ZA 3PGJA 5K5EA 4KTVE 2HMVA 3AP2A 5K3EA 4EGQA 3JQ8A 1QE3A 1NPDA 4GR4A 2J9GA 4L28A 3WK7A 1XNQB 1T1RA 1T43A 2DVMA 3ESBA 4M8IA 4MP3A 3U26A 3AEKA 2E1RA 3SBXA 4CEJB 2QT9A 3T7KA 5CXXA 3EGDA 1N3BA 1KS9A 4R84A 4N49A 4J29A 4BX0A 3CF6R 1YNOA 5FUMA 2IDKA 4TYNA 3EEQA 2AR0A 1L4FA 1X9IA 2FSVA 4HGQA 4IIXA 4KQXA 421PA 5FBZA 1WG8A 1UOQA 3LV8A 4UBOA 1CDOA 2OAGA 1WIWA 3CVOA 3UAOA 3PC8A 2G1UA 3OU6A 2QNIA 4ZI7A 1EDDA 3DFUA 4YJ3F 4Z8YA 4EPVA 2PKRA 3LUGA 4LISA 5FA6A 3FN4A 1PKEA 1KQFA 1H1LA 2YFKA 1QIMA 1EGAA 1L7VC 2PFKA 3VPBA 4OKSA 3HBJA 2XUIA 5FBQB 2J3HA 3ASZA 5K2OA 1M72A 2FMUA 2QLJA 5CIWA 4JV5B 3MPOA 3SQXA 4INPA 2OKCA 1JEQB 1ZVJA 3ZEIA 1EXNA 3HFSA 1J07A 1QS0B 2PSJA 3I73A 4HEA6 5FBRB 1GO2A 5DNVA 3AESB 1I2CA 4L3WA 4R71A 2JI8A 2OP0A 1E7RA 2CMHA 1EWVA 3HUEA 1J90A 5LU8A 2GCOA 1F20A 1MG5A 2FHPA 3VOBA 2X0FA 3K8ZA 3AP1A 3VYVA 3PEUA 1E6CA 4HVTA 2Y1WA 3GFQA 1K5GA 5CVUA 3R4VA 1PVVA 2XY4A 4U0KA 3TOXA 3ZDZB 4ASUD 2E5LB 1I3OA 2NV6A 2Q7XA 5B2FA 3FSEA 2FSSA 2WYWA 2XWBF 4QGAA 2BGGA 1JG2A 3H3XA 4GBED 1IZ7A 1CDZA 1IEXA 5GQSA 2QMEA 1WNFA 2G8NA 4RVOA 3VYTB 4ND3A 5JNWA 3OF2A 4ZJUA 3OCVA 4MEBA 1EIWA 2GAJA 1K4KA 1TK2A 3HPRA 4YDRA 2A7QA 4R3NA 2EP7A 5TVGA 1CULC 2LCIA 4JI0B 2JIZD 1GT6A 1XCOA 2ZKLA 1TRKA 3USES 4DVJA 4ZGBA 4M60A 3V1MA 3H8SA 3BB4A 2SKDA 5GZ3A 4HDNB 1OLUB 3E3OA 2CUNA 4BGEA 3JXEA 1G21A 3AUXA 3PI6A 3CYFA 1JE0A 3QLUC 4M1YA 5AVOA 5TLSA 2PH5A 4FU0A 3GUZA 3ZW7A 2A5GA 3EJWA 3LFTA 3EGVA 3P0HA 3QLTA 3TLEA 4BFUA 4TRNA 1P9NA 5TPZD 4BYMA 3D2LA 3L0CA 3DA8A 1TD1A 3KIPA 4PYMA 4FB4A 4DLBA 5BWMA 3PLRA 4FZRA 3SU8A 4X62B 3KEQA 3L82B 1G4AE 3NVDA 2XI4A 3KYCB 2YNMA 4QOEA 3UMBA 3S5JA 5DPMA 4P0PB 3U3XA 2JGFA 3HRIA 1A7JA 1R0LA 2QUIA 2WYUA 1Y4SA 4PVCA 2OB2A 5JSFA 1R8JA 1LI7A 1XEAA 2J59A 2C92A 4I50F 3UICA 5A6SB 2WINI 2ZRMA 3H7IA 1IRIA 2YOFA 2AFHA 4QODA 5IK2D 1ACJA 1NTRA 3LMKA 4OHUA 3NJRA 5C5DA 3RBXA 2ATVA 2WAAA 1G5IA 3HKCB 5A62A 3ZH2A 4YMIA 5DWQA 1XLWA 3IIEA 1HC7A 1KYYA 3HCBA 4R2HA 3U3MA 4QC2A 1RJGA 1Z3CA 3HP1A 4D4IA 2O1XA 2ZR9A 3GG2A 3Q2KA 1V5WA 3ILVA 1Z6PA 4Y98A 2PK3A 1VYUA 4JJZA 3FIUA 3EVBA 2GNOA 1OYYA 4P7KA 3OOSA 3FTCA 4BNYA 2BKVA 2VYCA 3DEHA 1WUYA 5EWLA 4BVHA 3FW1A 1AQ6A 1LWNA 1ZXXA 3AR6A 3MGKA 4MVJM 1CETA 3L1IA 4PLVA 2NQ2C 5KREA 3JQ9A 4NU6A 3JWHA 4M6WA 4XFDA 4Y7CA 2J5QA 4KO3S 1E0AA 1JLKA 4UUPA 5EP4A 5B3KA 5IJ9A 5LD2B 4FCWA 2DFVA 1EM8B 4QTTB 2O2IA 4TM8A 1I3LA 2FQYA 5ALQA 1ECGA 3WBBA 1Z68A 3RW9A 3TW0A 1U3TA 3JSAA 3RSQA 3DXFA 3BA1A 1Z4LA 3WAGA 3AF2A 4WLEA 4ZAWA 1FX0A 3QPAA 1MX1A 3AM3A 5GTDA 1MQSA 4LYYA 2I3AA 3GAFA 2A86A 3K0FA 2YC4C 3CE9A 2DUNA 3KXPA 1SXJB 2DULA 3CZAA 4FFRA 1NR7A 3NORA 4I6EA 4GAEA 3COJA 3KU4A 3SF0A 4OI0A 3V8RA 3WGIA 3EXIB 3MMXA 2WE8A 2WJIA 1N8KA 2HPAA 3QVGA 3UJ7A 5KDOA 1UMBB 1R50A 4J9VA 1NXQA 1SVUA 4B48A 5DNDA 3THSA 5COBA 4EGSA 3OJOA 4A10A 2NNWB 3W1VA 5E3IA 1TQDA 1TYBE 5LA6A 1BQ3A 4LX0A 3OZBA 4K3VA 3BMCA 2LBPA 1AUQA 2EFYA 5JV5A 1LBHA 3FZGA 4J4BA 2FKNA 4FE4A 1O94A 3CG0A 3IB3A 3KJIA 5JAPA 1NW3A 1U1EA 3PGKA 5FPSA 4PQYA 5JNUA 3ILYA 4B3DA 3WJ1A 2AG1A 1ZIDA 2B37A 3RRXA 1TO6A 3U2QA 5DOZA 4F04A 1IHOA 3RRZA 3F46A 2GUGA 4JJAA 1UEIA 3EEFA 2Y67A 3W3AD 1JYSA 1WXXA 4FUQA 5K0CA 4TV9F 1KU0A 3RB8A 3A0RB 3AUFA 4BMYA 2GJ4A 3HVRA 2GCGA 3KQMA 1J9EA 5CT8A 1BHQ1 1VE6A 4HPXB 4TZTA 5ALOA 4D44A 2W2TA 1KORA 1Q2XA 1C9MA 1DC5A 1EE1A 1YQXA 3V1KA 2PZEA 1PWHA 1JLMA 3PC2A 4TLCA 5DYTA 4K86A 2ZCUA 2H51A 2GYYA 4JT9A 4JUCA 1G8YA 5IP5A 3AIOA 4FYMA 4IO1A 1TC1A 4XSHA 2AE2A 2DWOA 3ENNA 2IP4A 2ZVQX 3ZI7A 1RI5A 4R1MA 3UCEA 1GILA 3G7SA 4BTLA 4DDMA 3KYJB 2GFQA 4OKIA 1OMOA 3LG2A 3Q8XB 4F1JA 1GGNA 2OCLA 4UBMA 1D3AA 1IC6A 4LS3A 1VHDA 2I66A 3F4KA 4FFPA 4U39A 2CKMA 5JS7A 5E95A 1H4SA 3DOEA 1XQVA 2WFLB 4MK4A 3KFLA 4RMNA 5G4KA 1H69A 2VXCA 1W5BA 2W5UA 4RQUA 3W2HA 1IJBA 2C88A 2GVZC 2VHZA 2W6CX 1VSVA 3PENA 2QG9A 4IDNA 4N12A 4HB3A 4P34A 3LBIA 4Q4AB 3VR3A 4ISCA 5C31A 3ZY5A 1WTAA 3EGXB 3TAUA 2BEVB 1NQWA 4CKEA 5DBIA 4NFYA 3V8MA 4MUEA 2EBWA 3P96A 4AUKA 2I7CA 1PBNA 2EVWX 3MPUA 2QZ4A 4Z0TA 2I3GA 1K4YA 1JR3A 3AFNA 2A88A 4MQBA 4JBHA 4MS3B 4RSMA 1G7TA 5E9QA 1V11B 2IITA 4BTEA 3QYJA 2G09A 3QYPA 5CPFA 1EB9A 4ALNA 4IGEA 3MIZA 1TM3E 2B7BA 2MIIA 4GMFA 1A5AB 1T9KA 2HU2A 2XE7A 3K4PA 4URUR 3N59A 4M0FA 3RV3A 4DC9A 1CRPA 1YU9A 3OOHA 5CNMA 4KH1A 4S2UA 5B53A 4TRMA 2BMVA 2B2CA 4QDKA 3U7GA 1EBUA 2FMIA 4URWR 1GUAA 3FM9A 4H77A 5KNLA 3LQ2A 4MQ4A 1KMIY 2AQIA 3WIDA 4Z7NB 1KY2A 4UEWA 2PT9A 4G5HA 2Z1NA 5KQGA 1OE0A 2V6MA 1EUQA 1UQTA 2HLDA 4BAGA 1DOHA 2ORVA 4R8KA 4DW8A 3T3OA 4EARA 3LPMA 5FBVB 3OFVA 1ML3A 3CWZA 3TFQA 4JQCA 4GX0A 2RB5A 1JI0A 1RQGA 3F67A 3MHTA 2VYFA 4U0JA 2YUTA 3C8HA 4FZJA 5CURA 3GFRA 1IHPA 3PUZA 1Q0QA 1O54A 3ANXA 1G3UA 2YCBA 3O2SB 1YB1A 2ZRCA 3G5UA 4QARA 2OCYC 2CW5A 3TQIA 2IU4A 4MVJG 1NVFA 3HJGA 3FBGA 4LK2A 1L5MA 5FI5A 2FPPB 1PW5A 3OP4A 4V02A 4B4UA 5JD4A 4L57A 4TYMA 4XGIA 2ZT7A 4YLGA 1VIDA 1CNEA 1MXFA 2N75A 2PX3A 5DXFA 1XA4A 3IO3A 2FOIA 2QX7A 4LK3A 3E53A 4IVQA 3WQQA 5EAIA 2FY8A 2EFDB 3AHGA 1ZG3A 4PONA 4QBTA 3FTFA 2X8LA 2BSQA 2DAPA 1HX7A 5KNBA 3WSVA 2HC9A 2R3SA 1DL5A 1E5QA 2RJOA 2OYSA 4W5OA 4FKBA 1ABFA 3LY8A 5K6TA 3BWCA 4RESA 1V4BA 3RS2A 4H60A 4UW9A 1DXYA 3GEDA 4I46A 3WLOA 3HCAA 1MO2A 4IQ0A 4BASA 5D00A 3HXMA 5B12A 1EXMA 4KDFA 3IALA 1QGYA 3F6PA 4RGQA 5U1PA 4G07A 1P17A 3W6ZA 1NIJA 4AJ2A 4UM7A 3UIEA 2IELA 1NXVA 4MYUA 4AMUA 1NYLA 1HZJA 3I61A 1IHDA 1MHTA 5HZHA 4DCSA 3AKYA 3HKEB 4KAAA 1I10A 1HQDA 1SWVA 1NBOA 4MW0A 4EKEA 3THWB 3MHPA 3C98A 3F9CA 1SA0A 1CUFA 1N75A 1DEAA 1JG6A 3Q5GA 3G5LA 4FW8A 2W6QA 1C0LA 1CQJB 5B1IA 3ADPA 1WY7A 3QHPA 4FE3A 4HRYA 3HA2A 2IA5A 2V9CA 2ODTX 4ER7A 1E58A 4H2DA 3MCZA 2PX5A 1OI3A 4QLAA 4G0MA 4F06A 3LK7A 1X7YA 3AVYA 4RV9A 3WLLA 4BWYA 1U2TA 2HSGA 2WSYB 2XUFA 4G0ZA 5CAEB 3TCNA 3VR6D 3RRFA 4M7PA 4LJAA 1Y5IA 3DNPA 4GXTA 3ME5A 4HS4A 4N5IX 4PLCA 1T29A 1P6XA 1X8XA 5LKAA 5DSZA 2D13A 4ZC1A 3KELA 3LUCA 4GR5A 1E2JA 2PX6A 4P3KA 3QF4B 5AM3A 1X7WB 5L6LB 1EVEA 2V9ZA 1XO1A 5JMWA 1MT0A 2EP8A 1YFZA 3IOBA 4HZGA 4LJ4A 3Q10A 4GOND 3H5AA 4JYAB 1LQUA 3REOA 4J4TA 3AKZA 4TYWA 4XRRA 4L4XA 2I7XA 1XZJA 1T2AA 1G2IA 4YN3A 2GSWA 4Q9DA 4YH1A 4FDVA 1DB3A 1V16B 5ALNA 3W8FA 4EKDA 4RTPA 4MAMA 3PFKA 4EJSA 5KPDA 1WP9A 4OHVA 1K1EA 2IUTA 1ZUD1 2II6A 2OXEA 3I1JA 1SUDA 2QG4A 3RS5A 1MPXA 4D46A 4Y2VA 1T3TA 3GLQA 4D4HA 2UYCA 1F4LA 3S28A 2XT9A 5JZMA 2AJBA 4G1FA 2PM8A 2ZRIA 2SCUA 2XMPA 4LF7B 3AZOA 5DTRA 1JG3A 4MULA 3LPDA 4PNHA 3WYBA 1Z0JA 3WL7A 4V03A 3I76A 1XDDA 2RHBA 2ZJ2A 1KMCA 2A0XA 2BUCA 2NU7B 1H9BA 3DZJA 2W4MA 3OZEA 3T6KA 1TCVA 3ZBTA 4B71A 1G6OA 1W34A 2NAPA 2P0AA 3B1VA 4E2WA 5KJFA 3MGGA 4MS4B 3WRYA 5IAEA 4ARUA 5B7QA 3JV7A 1DWOA 2ACWA 3RIXA 3TRHA 4X92A 3FF1A 2RJNA 2KPOA 4KOAA 4WZAE 4BO8A 5BW5A 3FYUC 2ZE6A 2NXNA 4YRPA 2BF4A 5G0UA 4AYWA 3AT1A 1VYTA 4Q9AA 4ZOLF 4K9RA 3T7RA 3WVNA 3UENA 3ZOKA 5K4HA 1BD4A 2QJTA 3WLEA 2HLPA 4XCXA 1Q0SA 3F5MA 3SXUA 4PS1A 3MQ2A 4BVEA 5JASA 4WBNA 1D6JA 5KKCA 5J4KA 5A5VA 1Y5RA 1VKRA 4PHTA 2HU8A 1KGSA 3E0QA 2J3IA 5L7YA 4C4SA 5BV7A 4GSLA 2FE1A 1LRJA 2V65A 3DDZX 3KBBA 4OP1A 4RJ2A 2IIPA 1M3SA 5GONA 4Z2AA 3CNQS 1MQ9A 2C1ZA 2NSLA 3ZHCA 1KBQA 1HQKA 1B0PA 3B48A 1FEZA 5DYYA 2JG3A 2QRLA 4LVCA 1NW7A 2WD7A 3E9QA 3GFGA 1RQ2A 4GXNA 4L4SA 4LV5B 1G55A 2ARKA 1DSSG 1QH1A 1U02A 1XJQA 2RGBA 3CISA 3GMSA 1L8LA 1Y7PA 4YUVA 3WGYA 4A0RA 4RHCA 1NUHA 4C3VA 4DXDA 1XKQA 4PICA 4HAXA 4YCBA 3SC3A 4DBLE 1V6SA 1CUCA 1R4MA 1LF5A 2O8NA 4D56A 3KZVA 1Z2PX 3REGA 3U09A 4MJLA 3P19A 3K9BA 5HM6A 3TIVA 3U5ZB 2X4IA 4EKNB 2OWEA 3D4IA 2WJYA 4RJTA 1TYEB 2QVXX 1Z6GA 1N5IA 4GQAA 1AXRA 2Q0QA 4KRGA 4F2HA 4M1SA 1EJBA 2ET6A 4K87A 3SY8A 2FLKA 5FNVB 3O3MB 4I66A 4NYMQ 4E21A 3NHKA 4DCOA 3GI1A 4BO5A 3KUCA 2HZBA 4E1AA 1YBVA 1PU2A 4JB0A 3N8GA 1OVGA 2W0SA 5EQJB 1L1RA 3WC4A 4CMIB 1M34B 3JD1A 2YJZA 3GB9A 4B3RB 2VYVA 4TTJA 5TGZA 5LNK6 5LXTA 3S2ZA 3AF1A 1Z9BA 1FB5A 4FW9A 4RIIA 1DIRA 3HCOA 5C7LO 5TQ0A 4WERA 4NDZA 4WPGA 1GZUA 3I4CA 4QSMA 4BUZA 4CKWB 2R6FA 1XZPA 1ZOSA 1ISHA 3NTXA 3R0IA 4QNNA 3HYTA 5H83A 2QLBA 3BD6A 2DLDA 5EC8A 1W4RA 1K86A 3ZZUA 3CZRA 1AF7A 2MR5A 1E9FA 4FJ2A 4U2DA 4E51A 3GXBA 2ZIFA 3AY6A 5K9ZA 3LUDA 2P4QA 3ST7A 1PJ4A 1M83A 4DIDA 3JPWA 3OF5A 2UVPA 4NMWA 4PYIA 5D3QA 1YCFA 4NOMA 5FHQA 4A73A 3JAMA 3ZWAA 3LJKA 1LA2A 5EHIA 4AI6A 1LDNA 1E66A 3OEED 4IILA 1GQSA 2J0SA 3OCXA 4L27A 4FNOA 5BN5B 1DADA 4UCFA 4L6CA 1P0CA 1U7ZA 3MGBA 5JJLA 4BTVA 3PUIA 2J3QA 1MOSA 1VIMA 3COPA 3L77A 5FLKA 5TRTA 4BGVA 3LBYA 3D6MA 4I5EA 4ND5A 4CLRB 1EU1A 5JAUA 1TU0A 2C3OA 4RVSA 5LD2C 3H5TA 2MMCA 1NSFA 3HJBA 5BSUA 2YJ6A 4RX1A 2W8BA 1NQVA 3SBEA 1AIPA 4YMGA 5I7RA 1ZCAA 1NXOA 3OZFA 3L4BC 2JLXA 5ALUA 5BVGA 1N5KA 2NZWA 4AIRA 1MFPA 3ITNA 4JLVA 2CCGA 5IVIA 3ZHTA 3AETA 1N36B 1FP6A 3IC5A 2P6UA 4Q4HB 2AR7A 1UXHA 2CNNA 2FW6A 3QEOA 4Z1MD 4PXYA 1A9QA 1TTPB 4WK4B 2XBLA 3IR7A 1G64A 2CF6A 2Y76A 4Q5IA 3E0XA 1QB7A 3ABIA 4OA5A 1FTNA 5JC8A 2GN8A 2C0PA 3IJEB 2Z2IA 4XGQA 5G0VA 3ZYCA 3RSZA 3DZBA 3EUFA 3DTVB 3NPAA 4XWGA 5JS1A 1SKBA 3KE8A 4IDPA 4Q3AA 2EFEB 1L4UA 1JZQA 1BEEA 3KSBC 1F12A 2XPCA 4XB1A 5TEVA 3VU0A 2ONJA 4L0DA 4OHRA 4OQFA 1K6JA 4D79A 4N5MA 1O8CA 2KS6A 3R2JA 4BX3A 4Y2HA 5A3VA 4PV7A 4BFZA 3JAWA 4XRGA 4G0OA 1IK6A 3C14C 4FP9A 1YKFA 1DQSA 1P74A 4UEQA 2CJWA 2LPMA 4I4LA 4NYMR 2G36A 2ERCA 4X3OA 4K2AA 3LH5A 3U39A 4N4AA 1QRTA 4YGYA 3S2IA 3D8RA 3DQPA 4IHJF 3LA6A 4YREA 4BOYA 4D8VA 2QP4A 4H3VA 4D99A 1DKUA 4AROA 3L8MA 4RZSA 2X1HA 1E2KA 3E9RA 2NUPA 1PQ4A 2I80A 5CLFA 4BFWA 3OH8A 4YJ2B 4RD0A 3QPDA 1J1ZA 2G4VA 2WF5A 1M0SA 2ZJ6A 3QKUA 4HYTA 1FRFS 3H3JA 4D45A 5LZ2A 1P1KA 1UOPA 3TBHA 4CTJA 2XZLA 1MOPA 2AD5A 3FTPA 4ZT2A 4H3SA 1H4QA 1U1IA 1BMDA 3C8MA 2IBMA 2WIAA 2G0AA 2PTGA 1P80A 2H9IA 1ISJA 1XTTA 2ZJ8A 3AHJA 4RJLA 1OU0A 2GPNA 4GDFA 2H6EA 8ATCA 3A27A 5IYZF 1SBNE 1X9GA 1T13A 2HU7A 5HF5A 3V4OA 2JW5A 1PHPA 3Q7RA 3T7IA 1V7CA 3ICCA 3TDKA 2EV9A 4EJ0A 2D2XA 3MLBA 4TKUA 1D1SA 3OVMA 3NTUA 3PWTA 4G26A 2CLLB 5KC8A 3LTNC 4F72A 1AS0A 4GW3A 1E69A 1ZM2A 2OOSA 1JHUA 3N3BC 1JNXX 2XAAA 4CF7A 1E7WA 1QIIA 3WWOA 4NP6A 3UMYA 1GKYA 1JS1X 3DL7A 1M2WA 1V4VA 3PITA 4V24A 1ZITA 4YJDA 3VI3B 5C52B 3A2KA 3DPSA 3H8JA 3RWOA 3WIOA 3QUQA 4L8YA 5CHYA 1L8AA 1UIRA 4EG6A 3CW9A 4I1OA 1W4CA 3WYFA 3GLGA 5FNZA 1PR4A 2E4UA 3DAOA 1YRYE 3QMPA 1F7VA 1YDHA 1FP4B 5AT1A 1CY1A 1PR6A 1TJYA 3DD1A 1BTOA 3B6MA 3HA7A 2VHUA 5A4IS 4GNRA 3HLTA 4FK8A 1MJ5A 2XMZA 3USCS 1EXDA 4BNDA 1A71A 1Q44A 3I34X 3NHAA 4P35A 3QIVA 4XX0B 3R40A 1TO2E 2GYWA 3VOTA 2AHOA 5E9AA 1XRJA 2OCXA 4H17A 4Z4FA 5J5VA 2JLSA 4LCEA 3TUIC 3WRXC 2DUMA 3FBTA 5KB3A 1X39A 2CFTA 5LJIA 2BKEA 1NDUA 1Y6FA 1DKMA 2I8CA 4JB8A 2PGJA 2QL6A 2FQWA 5IMBA 2ILTA 2CNBA 4OHBA 4RZHA 1EHCA 2RHJA 3PPYA 5CNKA 1OBOA 1O0SA 3UM9A 1NT2A 3NGLA 4QDJA 4LVOA 5ERYA 1LZLA 3W7BA 5I3ZA 3OUTA 5KS2A 2GT1A 3CLTC 2UZ4A 1G42A 2AEMA 1DKNA 4K2HA 1IJKA 3FROA 5L40A 4XXHA 1ECJA 1WR8A 4JT8A 3RNLA 3SC2A 4QYWA 1QUEA 4GSKA 4PEVA 5L3RA 3D2BA 3SEQA 4D02A 1R66A 2JB9A 4C7XA 3B78A 3HDJA 2VZEA 4LMRA 1E4VA 1GLGA 1D4OA 4ITRC 2GSDA 1XZEA 5CK4A 1E4YA 3SP1A 3CSDA 4OUDA 4A6XA 2RGYA 5FAKA 3NHLA 5F5LA 3EZLA 4GUAA 1HDGO 3KYIB 1A77A 5B1SA 1XZNA 3KB8A 1VJGA 4QQNA 2QM0A 1KTVA 5LP6B 2DR3A 5DGTA 3O83A 4IEEA 2GHRA 3VZCA 1IUKA 2ZUDA 3C2QA 1EFPA 2NUTA 3W04A 1L5OA 4XX1A 4TVBA 3B38A 1A82A 2B78A 2O9JA 1YRQA 2OXTA 1JI3A 2QTAA 5AM1A 1DT3A 2FCAA 4PM4A 4XWAA 5AHOA 4KR0A 3G5AA 3IEXA 4HMOA 4QATA 3BICA 4PG5A 2NPOA 3ILXA 3QOYA 2WK1A 4J0KA 5HYVA 4N3NA 2P3QA 4YBZA 4MLPA 5EIBC 4JQOA 1EVLA 4HZUA 5ALTA 1KO5A 2GARA 2G4LA 1QP4A 1SK9A 2AD1A 3MWEB 4L8FA 4RLQA 4I4IA 5E7MA 1OFHA 3OIFA 4JD5A 4H7JA 3WYEA 3EASA 3PZRA 4R6WA 3W05A 1U31A 4U9IS 1VL2A 1N2ZA 1TB4A 5C8ZA 4OYLA 2XCRB 3GPBA 3BKWA 4J1SA 1M74A 2IYZA 4NR0A 5H3CA 3V2GA 3WP1B 3CVVA 3NT5A 2ZSAA 2QUKA 5E7JA 1UL1X 4FBLA 2OHGA 2CYAA 1V7PC 1GPUA 2F62A 3HHPA 3N6VA 4FYYA 3P5SA 3UJDA 1PG5A 4HQNA 5LYYA 3RVDA 4JYZA 1QDUA 1E6UA 1K3UB 4E12A 3EK2A 3P5BA 3THXB 4QX6A 5KKAA 5TQVA 1FRNA 1RR6A 1U65A 1Z3IX 5JJCA 1D5CA 4OKNA 2FWBA 2HXGA 3L7KA 2GR9A 3TSOA 1O9HA 3IT1A 1EUCB 3OM9A 3FVWA 5ICGA 1DKPA 3Q9NA 1W5FA 2WIDA 1MTZA 2O06A 4NXMB 1TA4A 2QN2A 4M1EA 4WFJA 1SC3A 1HEIA 1QHXA 2F9FA 2FH5B 4LZJA 5DNYB 1KEEB 1M8JA 2ASVA 4PQRA 3REQA 1YMQA 4UVIA 1K88A 2VL7A 3WYDA 2Z8YA 3ZE1B 3WOHA 5EPEA 3MJHA 2HEIA 5KDLA 3RLFA 2PPLA 3F3MA 4KVAA 2V45A 1TECE 3QG1A 1ATIA 3B7GA 4I3GA 3CT4A 3M81A 1ECFA 4AY5A 2YL2A 4JU9A 3L6EA 5KTSA 4PU0A 4GL2A 1VMAA 2JI6A 1RM3A 1SVLA 3L8EA 3STHA 3R9IA 4R8MA 1YZGA 3RRMA 5AVZA 1BD3A 3HMQA 3NIBA 4HDKB 2WWFA 1J8VA 3ZK7A 4AQ7A 4O3FA 2XB4A 1ZM9A 2HA6A 2YFHA 3UPDA 4AXXA 2APJA 1V8PA 4BZZA 4F11A 2F17A 4QM6A 2V96A 1RIIA 2ONCA 2RGAA 2Q8PA 4EUEA 2ATEA 4EG8A 5BSFA 1GRVA 2MINA 1CY4A 1NXTA 3WDMA 1PWXA 1WD7A 1PNTA 5GWXA 2B1IA 1JEAA 3OQPA 2FF5A 4UPVA 1RXEA 4GUDA 2J48A 5IARA 1W94A 2YWJA 1E7MA 3HYRA 5JBQA 4DXAA 3O93A 1SHZA 1Z63A 5J58A 1EESA 2GYVA 3CKKA 3SI7A 4PYLA 3GBSA 1YRAA 1V0JA 4N0DA 1GSIA 1XZAA 2CYCA 3NFYA 4XTRA 3BL6A 3R6GA 2J30A 3ZGXA 5FR2A 4FGZA 5JT1A 5DGXA 1JHMA 2O7VA 2FDCA 1V1RA 1E6WA 3VSDA 2GTIA 2JCYA 2P6PA 2EX1A 4I2VA 1LBTA 2BMDA 3DGFC 3I1FA 3TW8B 3WMGA 1CR1A 3FJOA 1ZOLA 4EG0A 1BKYA 4KAXA 1EH5A 4LY0A 1PG0A 4MI1A 3H11A 3QVKA 1SO8A 1KVUA 4KXMA 2QTTA 1IY9A 2HEGA 3W5HA 4EA7A 2Q1YA 3HO1A 4K9SA 5CGQB 2FWNA 2Q50A 1F2UB 1YZFA 3H17A 4A3SA 2CMFA 1OLOA 2PAFA 4LXTA 1ENPA 1USWA 3TVTA 4AZ3A 4LJKA 3S2EA 3S29A 4MVWA 1EAMA 3AJ8A 3FPFA 3L1VA 3SFZA 3H2ZA 2ZGVA 4MW4A 1WXDA 2C98A 4BWFB 3G0BA 3SEZA 3TEFA 4KWEA 2NSYA 3OT1A 4DCUA 3DFMA 1TKCA 2P1RA 2WR8A 2WVAA 2J31A 4TUYF 1N7IA 4UFOA 5AOCA 5IK2A 3VR5D 2RFLA 2J8ZA 3CNLA 1P4SA 3PX2A 1NMYA 2RHRA 5JYBA 1NFFA 4XQCA 2ONYA 1DUVG 1E2GA 3OCJA 5KHLB 1XCPA 1O95C 1IAVA 1CERA 3JZFA 1DJMA 2VIIA 2TMKA 2WTAA 1TYZA 2XNHA 1IZ0A 2HUPA 4CR8A 4CEHB 1DHTA 4HXYA 2X3YA 3B6EA 3AR4A 4HDQB 4B73A 1J0XO 3LP8A 3HXTA 3ZU2A 1E32A 3NC1C 1OR8A 1U0LA 1X92A 1AA6A 1RXSA 3OE1A 3WLQA 1KFBB 2XB8A 4ZOCA 1KDRA 2N1BA 4G5YA 1JFFB 1L7QA 1G2QA 2VSQA 3ISVA 1GWNA 3LYUA 1A95A 4P80A 3BCSA 4G67A 4GVXA 4MB2A 1Q20A 3NAMA 3WRVA 1W8DA 1I7LA 5FP0A 3WQHA 1PJLA 3F74A 3KWJA 1VHJA 3OOJA 5AI0A 3G2IA 3KSAC 3K70B 1AA9A 3KM0A 1H8EA 1E59A 2H85A 3IO5A 3BEOA 1RRGA 4HRXA 3PIIA 1LK0A 4OHKA 4WAUA 3SEAA 3TEMA 1J2TA 4JR0A 1UFQA 2WB2A 1JKIA 1V39A 1KQPA 2HQSA 4POAA 3NHRA 1WHSA 3C0KA 4EELA 3TBKA 3M6WA 3IURA 4C08A 1LNQA 3ZR4B 3ZGYA 1P3JA 1PKXA 3DTVD 1U0BB 3DMGA 1KMMA 5IS2A 1P2GA 4I5DA 4Y2PA 3AVXA 3KDAA 1T2DA 2VDWA 1DFHA 4LQDA 2OCIA 3KQSA 5CA1A 5CDTA 3QX9A 2OFWA 3JWEA 4KBGA 2X0NA 3FI9A 3RYCA 4A1OA 1Q7RA 3OLYA 1UANA 2OILA 4B7UA 3K05A 5AK0A 4N7RA 4A26A 4EPWA 1N6RA 3SBOA 3U1TA 4OI2A 3IH5A 1E2FA 1Q1NA 4WOPA 3E2MA 3EZNA 3RVBA 1UDWA 4MV9A 1IHYA 1KP9A 1LDEA 2QTGA 1O58A 3HR8A 2DJ5A 3KQTA 4ZT6A 3RHZA 3GVXA 3ZWBA 5BWLA 3GJRA 2YHSA 4XYBA 1PV4A 3T95A 3T54A 1DG1G 2XA9A 5KWEA 5BMOA 4CIAA 3EVTA 1SCBA 3FLEA 4R9RA 4C87A 3EUAA 1P75A 1X0VA 4C7JA 3IQWA 1FFGA 1P1CA 3U6KA 4OD0A 1NLZA 1EMDA 1N0VC 4KO4S 2NQTA 5F35A 3W1WA 3HM9A 3SZ3A 2QTWB 5M04A 1YB6A 5JCOA 1GJRA 3K15A 1T4CA 5A5GA 1IM8A 1F4PA 2N3ZA 3EH1A 3EZ7A 4JGGA 4X3CA 2PT5A 1IE3A 4TRRA 1D1PA 5FNVF 2QM8A 5JHGB 3IKTA 1A8HA 1VSUA 4KJXA 1N8NA 1RKBA 2JEOA 3ZHBA 3AR5A 4EUSA 1KI6A 2PTHA 3B6ZA 3LHDA 3Q3GE 1TE2A 4UJ5A 2O4UX 1CFJA 1OFIA 4JMPA 5DWVA 5K0FA 5A3SA 3CZ9A 2NTEA 3LOUA 3C48A 1USIA 4IXMA 3H84A 1U1GA 2GXUA 4KN5A 4L4UA 4NU5A 4FVTA 4DOMA 2J9FB 3DZFA 4QRDA 4M0KA 5KX5B 3QU9A 3R09A 3W2FA 1MX9A 2PUEA 4PG4A 5EMKA 2P27A 4D4MA 2HWUA 4B4OA 4LE2A 3C41J 1L4YA 2F59A 5HGXA 1IXRC 1T0JB 1POWA 4G1BA 5CRIA 1JDTA 1DX9A 2V9PA 4XIJA 4H1HA 2QM7A 5I9BA 5A0FA 3VHXA 1F06A 3H04A 1V3TA 2ZLBA 2H4FA 1EFRA 4EI8A 2X19A 3CNNA 1GL7A 3K09C 5D3MA 1T5OA 1FP1D 2FEOA 4O4LA 1YI1A 4YO8A 1NNEA 1P6UA 2YR0A 1WPQA 3GNLA 3PNPA 1YZKA 3BH6A 5EUQB 3AL2A 3JWIA 4HG2A 2ZAIA 4INOA 4RMHA 2PLWA 1DLJA 2XT0A 4LDJA 3TKYA 1DI0A 1W8IA 5DF1A 1IN8A 2QTRA 5AJZA 5AUPB 3EUEA 1Q1GA 3GRZA 2ZSJA 4V38A 3KEFA 2RAUA 1RM0A 3FPGA 4FEYA 3VR4D 2JNWA 2OAEA 2R7KA 1T0PA 2IYYA 3C5CA 3PX3A 3GLIA 2CEKA 2ZWOA 4Q7EA 3T35A 1RMTA 1AQNA 4B4VA 1L5QA 2BFOA 3BA6A 4ARIA 1MX3A 1SKQA 2FNAA 2IXEA 5A5DA 1OROA 4F93B 2CXTA 2AOXA 1EFCA 3FHTA 1JLHA 2BI8A 1S2GA 1GAQA 1OYOA 2HIAA 3AR8A 1VLZA 4B6PA 3NP7A 2C95A 3RHFA 4FB5A 4JVNA 5ALJA 5AW0A 3ORQA 3UFXA 3ZV7A 3GWZA 5KVSA 1SCIA 2KQUA 4UHFA 3Q11A 4P4UA 3ZHUA 3HK2A 2G0TA 2Z4RA 3OJ0A 4BC1A 3ZV5A 1D2HA 4U2CA 4BEWA 3IPAA 5T8KC 3R5XA 4E22A 4MW6A 4XEUA 1BXGA 3CX3A 3WY9A 3D8UA 4W5TA 3HJAA 4LZNA 2CVQA 4ZQFA 2AZMA 1G4UR 4M0LA 4C7VA 1LLFA 3VJRA 5LMCA 1CD5A 1RI2A 2LKCA 5FOUA 5MFZA 4LVUA 1DC4A 3QTTA 4P53A 3ZQUA 5DNWA 3DEFA 4RIHA 3LC1O 3IE1A 3WL5A 5KSYA 2QDXA 4BX8A 3ZD9A 2A9KA 2HTFA 3B82A 3CX7A 1QO7A 2AZDA 2XE4A 4IDGA 4QXOA 1N0UA 1UK8A 4CMHA 4GKJB 4G9EA 2VJMA 4ZCSA 3GNSA 2B2XA 3T7SA 3DB2A 4LV8B 1C80A 4LOIA 1ZN8A 4DQUA 3EAQA 3F7MA 2XZDA 3NGXA 3ZVLA 1MEOA 4MAAA 1CZHA 5L3QA 1QYDA 3PA8A 3QE2A 2OT3B 1D0SA 2BD0A 4TXLA 1NR5A 4HH4A 3O6VA 5PNTA 3EQ9A 3PDCA 1QRAA 1ZC4A 3FSJX 4I81A 5JSHA 4OMFG 3F1KA 3BSFA 4FCCA 1VJDA 3DB1A 3AIKA 4YJ2F 3ZXIA 3N70A 5C5IA 1IY0A 5KOHA 3H1BA 1QZTA 1ZK2A 4I9GA 4F6RB 4ZJYA 1KEVA 2P9BA 3OJCA 2WM2A 2VT6A 4H6PA 4DM4A 3PFNA 5K03A 1JIUA 2FGJA 4RHEA 2G07A 3RANA 1JMKC 1U8YA 4C30A 3Q1LA 1MO4A 4X44A 1YHNA 4E5YA 4XSGA 1P5FA 5AKYA 4ARCA 1T0BA 3T06B 2IYUA 1AHHA 2ENWA 3D6VA 3D8BA 2NADA 3MEQA 4GNKA 5CH3A 2ETVA 3K0KA 2PZLA 1G2PA 1YIOA 4AC9A 1NURA 1OIWA 3IJPA 5IXSA 3HEMA 4KYUA 3QE0A 3ZGOA 2X1VA 1NE2A 3MJDA 2QRJA 4F46A 3FUTA 4Q4JB 4NFHA 1I4EB 2QAIA 1I1OA 1CUBA 3MTEA 4N9QA 1JVNA 2H08A 2FJPA 2P0EA 3NBXX 4UZFA 1LW6E 2NQ8A 4KWTA 4WT7A 3WL3A 1HTWA 2VPZA 1H0KA 1RPTA 2FUEA 2ID8A 2P67A 3HCCA 3CUSA 3O4VA 3E2PA 4FHFA 4YP9A 4ZVQA 4AF8A 1D5WA 3MTAA 1NBME 1G8PA 3QH4A 5JI2E 2JLUA 2IYNA 4O4IA 4NBSA 5JMOA 2XNDD 2FMTA 3ZE8A 5FHRA 3W1EA 3ZGVA 3RAPR 1XOIA 2ZYUX 4CZ2A 3KE9A 3SDZA 4P33A 1X1TA 3DVLA 1JEQA 2B82A 1YRHA 1SUCA 2WG2A 5BNTA 3LDGA 1QS0A 1TIBA 3O8BA 4QGGA 4A92A 5KYVA 2INGX 4CETA 1DKLA 3ZY3A 1OH8A 5HBRA 1YZ3A 2OBLA 3I6YA 2HOQA 1U6KA 1LNSA 1USKA 3B3QA 4V0KA 4MA5A 3S4YA 1PIWA 1S9DA 3FCEA 2O0JA 4CV0A 1FFXB 2N0SA 4HDCA 2P9HA 2ZIVB 4WZAB 2VPQA 5HIAA 2G63A 1JHXA 2BW0A 2BZ0A 4CMAA 4ZWNA 4EUFA 4O8ZA 4FFOA 4XDZA 2VBIA 4AKSA 3IAXA 4UAGA 1PT5A 1E5TA 4H08A 2BGNA 2KM1A 3RVKA 1ZUHA 3CURA 1DDOA 2CNDA 2PZAA 3USZA 2QNBA 4F5YA 4H1WA 1CUZA 1CG6A 4EKIA 2NTYC 1UMDB 2ZRKA 4UUMA 2NUAB 2W6MA 2B1RA 3RVMA 2VXBA 4RK7A 1G38A 1I01A 4FSDA 4CM8B 3ECSA 2YINC 3GLHE 1C9NA 5DNAA 2BR3A 3VYRB 3QPBA 1RYNA 4X1KB 3TPCA 2F1KA 1VHWA 2NLOA 3L0ZA 3SQOA 4B3FX 3QKWA 3MJRA 1KO4A 1RPJA 2ZYHA 1E60A 2XECA 3KAJA 3T3DA 2YW9A 3ZW9A 4ZAZA 3UJ9A 7ABPA 5A1TA 2QJFA 4BZPA 2PSHA 2FG5A 4HDNA 3CVXA 1OLUA 2H1LA 1QFXA 3RU9A 2PKCA 1L7NA 1QFJA 4LGCA 2OK7A 1OXMA 4N41A 5LP6F 4J2HA 3BWYA 2C54A 2BEWB 4DLXA 1Z2CA 1V96A 4H1TA 4V0SA 3AJ9A 1Y33E 1PZGA 1V8OA 3RAGA 1PR3A 3COZA 2WG1A 4XLLA 1C3EA 1KEWA 1P44A 2FPKA 5LLSA 4LC9A 2R8XA 2HL6A 3ZLTA 4BO7A 2OBYA 1Q84A 3O4IA 4IMIB 5EXXA 3S0JA 5B1EA 5DOVA 3DBRB 4JA0A 1XG5A 1J22A 1GU7A 3TYXA 4RVUA 4FOSA 1JQ3A 2X6TA 4ND6A 2C3PA 3WQRA 3EX7C 1YS6A 1R10A 1G98A 3ZYZA 2AA3A 5A6SA 3TQOA 1L6RA 2CK3D 1EFKA 2ECKA 4UNPA 4C21A 1V8BA 1QKJA 3K8QA 2Y71A 4CLEA 3JQGB 3COWA 1VJ1A 4JSTA 1PQUA 2O7QA 3WKCA 4AG5A 1CK4A 4Q15A 5KYKA 3NDPA 1AKNA 3M5PA 3OSUA 3ZBPA 2FPRA 3BDAA 2KW5A 2VH1A 3COSA 3HU3A 4N1AA 5CLJA 2X8JB 4BCBA 3D4OA 4CTKA 1SOWA 5IT4A 1Y1RA 3EVAA 1D0VA 1GU1A 3KG2A 2Y0EA 3R3ZA 4PBSA 5DW3A 3VVBA 5H81A 1R9MA 4J1TA 1IWPB 4UOEA 1Z2OX 1G18A 1FTYA 1OYWA 2PD4A 5LLTA 1U11A 3A7EA 4EI9A 4AJKA 4BFCA 3FGOA 5G4LA 2C9OA 2OHVA 1YFKA 1UJBA 2D5AA 2D5IA 3LY5A 5TS2A 4AICA 4EG5A 2GPYA 4U7JA 5CBPA 3A0UA 2V97A 3NBQA 5JD3A 3JW8A 3C7CB 3OZAA 1EM8A 1VJCA 3OAAD 4JELA 4JSYA 4Q05A 3CJQA 4TLMB 2H4HA 1OX6A 3RUHA 5B4VA 3K70D 4HEA1 3W2TA 3LWBA 2AVNA 1Z0IA 3VO1A 1VYHA 1Y89A 1P6QA 2GK6A 1UAYA 3QU7A 3W9YA 1Z45A 1B8PA 2ZUVA 4TT3D 3K35A 3UHAA 1SXJA 2G88A 3KLOA 2F8TA 1Q15A 2X1LA 4G1MB 5CXUA 4J3FA 1CQZA 3A4YA 5EN4A 5FUWA 4UVGA 1KFKB 3SNKA 1HDYA 4UNNA 2HFKA 2NVBA 4IKOA 4KK4A 5ER9A 1XMOB 3F2VA 2BSAA 1H6DA 3CN7A 1VE5A 1B14A 1F48A 5AH0A 2G76A 3BGVA 5HWSA 1GUYA 2BIFA 1SMKA 3DKIA 3MFYA 3RQSA 1OIXA 1XN1A 4Y9SA 5NLLA 2BFEA 4C03A 1CJVC 2ZE7A 3NTQA 4AZVA 3RAEC 2VRCD 4MQ6A 4ERXA 3H2YA 4OQNA 3SFTA 5ARDA 1ZINA 3DMTA 4NJEA 5KNCD 4D96A 3LO5A 3GPIA 3DMYA 3NWBA 3PUXA 5K0EA 4OB7A 4U4AA 1L3CA 2H59A 3DE2X 4HK4A 1NSYA 4X1IA 4UQOA 5CLQA 4EOGA 5FL3A 4OJQA 1RE1A 4C0BA