3R3VA

Crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn/fluoroacetate
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
297
structure length
296
Chain Sequence
LADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHNRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIASAATPLDVWRKWASDVQGAPIESGHFLPEEAPDQTAEALVRFFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping the reaction coordinates of enzymatic defluorination.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Hydrolase
molecule keywords Fluoroacetate dehalogenase
total genus 113
structure length 296
sequence length 297
chains with identical sequence B
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r3vA00
4EY4A 3QM1A 1ETHA 3FBWA 4S0XA 2BJHA 4CG2A 5K3FB 2FJPA 4C88A 1CUWA 3WWCA 1T2NA 3A2LA 4X94A 1EDEA 1R3DA 1XLVA 4F21A 3H2HA 5ISMA 2QVBA 5I8PA 5K3CA 3WKCA 3JYHA 1G42A 4PF1A 3WYDA 3ZI7A 1CIJA 4FLMA 4X95A 3KDAA 1H2WA 4G5XA 3BDVA 3S8YA 2I3DA 3PF9A 1UT6A 1ORVA 5DWDA 3C43A 4B6GA 1W6RA 4GWLA 2HADA 1TKRA 5ALZA 3QZUA 1CUXA 5EIEA 4OCZA 4YK7A 5IVDA 1AX9A 3STUA 3M81A 1QGED 1G4HA 3FSGD 2WILA 2QXUA 4AZ0A 3SWWA 2OCIA 2VA9A 2ES4A 2RIPA 1XKLA 4N5HX 2WUDA 1H23A 5CXUA 4Y2PA 4F0JA 4ARAA 3V1MA 1DTEA 2VSQA 1CUJA 3L1HA 2ZYSA 1BRTA 3WWDA 2XE4A 2PU5A 2H9YA 1TIBA 3WIBA 2GBFA 3JW8A 4I19A 3W2TA 5JZBA 2CMFA 1CUIA 3VVMA 4I3FA 3WWEA 5KBYA 4BE4A 1UKBA 1EB9A 1FFAA 4X3CA 4U2DA 1U2EA 2J4FA 3MUOA 1BU8A 4QDXA 2OAGA 1CUEA 3EIOA 3L1JA 1K8QA 1CV2A 1R9MA 3C87A 4BCBA 3I2GA 2OGTA 3MGAA 2J4CA 3WQHA 1WHSA 2HRRA 2XQJA 3VJLA 3DJYA 1CRLA 1THTA 3QBJA 1VOTA 1B41A 1HLGA 5AICA 4G4JA 4PSDA 4X7BA 5EHZA 3QPDA 4FBLA 3RM3A 4BAGA 1AC5A 3WK5A 4MXDA 3PFCA 2WU3A 3BF8A 1UKCA 5ALWA 4RGYA 5ALJA 3D3NA 3V1LA 3DD5A 2JF0A 1F0NA 1RP1A 3BIXA 5JAHA 4M0EA 1LPMA 4RNCA 4GDMA 2XUAA 4KE7A 2ZJFA 2DR0A 4U2GA 5JZ9A 1FSSA 4W1QA 1QTRA 3G9XA 4B80A 3H1BA 4C87A 3U1TA 2EDAA 4BATA 3G9UA 5LZ9A 1EX9A 2C7BA 1GGVA 3BF7A 3F97A 3QMWA 4HVTA 1GQRA 1ZJ5A 4H7KA 1AGYA 4WDQA 4G8BA 2Z3ZA 3H2IA 2HA7A 3I2HA 5ALFA 3R3XA 3EQ7A 5AM3A 5HKAA 5AKKA 4G1FA 4KAFA 4CFSA 3C8HA 2ZJ6A 1QIDA 1GZ7A 3FSGA 3QH4A 4EBBA 4MWSA 1LZLA 3BXPA 1EK1A 1C7JA 1QO9A 4NZZA 1CUSA 1A7UA 2AJLI 4XWGA 5T4FA 2BKLA 2QR5A 2IITA 4RPCA 2PSJA 4KE9A 3D7RA 4PV7A 1MJ5A 3O4HA 4MJ3A 1DWPA 2Y1KA 5CTAA 2OXEA 1SCKA 1LGYA 5ALLA 1QFSA 5DLPA 1EDDA 2XMBA 2H7CA 1QIFA 2O2IA 4Y2JA 5DNUA 4B83A 4EZIA 1FFCA 2ONCA 2C4HA 4G8DA 5AP9A 4GXNA 3A6ZA 1X2EA 1P0QA 2BFNA 1KU0A 3WZMA 3HYSA 1YA4A 4KE6A 3PE6A 3FNBA 2YYSA 1JMKC 2PSFA 1CUGA 2WUGA 2WJ6A 3DKRA 1HDEA 1I6WA 2CEKA 2XUFA 3B3QA 3FLAA 3LP5A 1DQYA 4WDRA 5LKAA 1S8OA 2JEYA 1UXOA 2BGNA 1GPLA 4WCVA 3C6XA 3W9BA 1KU6A 4LYDA 5CT9A 4FMPA 4JEIA 1CUCA 3WLAA 2QJWA 4Y2QA 2HIHA 2XMCA 4BDSA 5AM5A 5E2IA 1UK6A 4EY6A 1ZD5A 1CPYA 1X70A 4OSEA 4DMCA 4W1RA 4K6GA 4NMWA 4PQEA 1ORWA 1QZ3A 5ALTA 2WLSA 3AUKA 1LPPA 4L72A 4KRYA 5AHXA 1E89A 4HRXA 4L3WA 2YASA 4LKOA 1FFBA 1EDBA 1LBSA 4GHWA 1EB8A 5A71A 5IVIA 5H3HA 4CCYB 3ZLTA 5AK3A 3LS2A 2G5PA 2G4LA 2WFLA 4J0KA 4YPVA 3ED1A 4OU5A 2Z3WA 2WU4A 2XUJA 1XQXA 4CIBA 2OQVA 1IVYA 4FFWA 2WM2A 2C5GA 5BWBA 5EGNA 2HFKA 3ANSA 3MUNA 1BCSA 1WHTA 1Y37A 1AURA 3DS8A 2WIKA 4BAZA 3D5EA 3ZLUA 4IH1A 2O7RA 3D59A 3RKSA 3VXKA 4QA9A 2W22A 5IVKA 4EY5A 2V97A 2VATA 5CRIA 4ETWA 1QIJA 4HXFB 5DNVA 5HFNA 2HA6A 1TCBA 1JT2A 4E14A 1KEZA 2PUJA 4BBZA 5EI5A 4UBKA 5FDFA 1EHYA 5AI4A 3AJAA 4IH9A 3SC2A 3M82A 4Y9SA 3F96A 1ISPA 1B6GA 1P0MA 1C7IA 2DFPA 2XQFA 3HJUA 1R88A 1JFRA 4BZWA 3IB3A 2W6CX 3R3WA 3F8SA 5C7YA 1ZI9A 1IZ8A 1LNSA 5FOQA 3WK4A 3AIKA 2I03A 5AIAA 2IX9A 3SX4A 2XUPA 3A2MA 3WKDA 5FUMA 2O2HA 3R40A 1IUNA 3BE8A 1YSCA 1G66A 4B9AA 3QPAA 3OOSA 5AH0A 3KXPA 5LYYA 3JWEA 1PV1A 3R3ZA 4F60A 4AO6A 2ZYHA 1DT5A 1XQYA 2AJDA 4L0CA 3WKAA 2JIDA 3WK9A 3WK6A 5HF8A 3D0KA 1P0IA 4XJVA 5YASA 4Y2TA 5T4EA 1T4MA 4C6HA 3IUNA 4U2BA 3WJ1A 2PKYX 4X71A 4WY8A 2OAEA 1UOOA 3HLKA 2GZRA 2RAUA 1SOMA 5I9IA 5AIBA 1QONA 2HA4A 2JGFA 1WOMA 1MNQA 3G9TA 1LZKA 5EHXA 3GFFA 5FPQA 4X85A 1TCCA 5ESRA 1QIHA 5A7HA 1MTZA 2FUKA 3R3UA 1YS2X 3I6ZA 1CUAA 5CT5A 1AZWA 1EVEA 1QJ4A 3V9AA 3ESBA 1VA5A 1W75A 1NX9A 2BGRA 1QTIA 4KRXA 4BZZA 5AK4A 4QDTA 1XLUA 4QE3A 2AJBA 2QXTA 4AQDA 3FLEA 3HSSA 1SFRA 4CG3A 2P8SA 2JEZA 1UWCA 3OM8A 4QWMA 2GYVA 3STYA 4KEAA 2XMGA 4AX4A 1SCQA 4FFVA 2JGLA 1JJFA 3G8YA 3F9CA 4B7ZA 1Q0RA 5D3ZA 5AKJA 5C8VA 2OG1A 1VA4A 4X92A 3H2GA 1N8SA 4TVKA 4UHBA 1A88A 3W06A 1Y7HA 5C8ZA 4OYLA 3IVMA 3PUHA 1TK3A 3LIIA 3IA2A 1QFMA 3KOOA 3G7NA 4FDMA 4G9GA 3QMMA 5A7FA 4BVKA 4AXBA 5SYMA 3FVRA 4BP9A 2PL5A 2HU5A 3ESAA 5AOCA 4FNGA 4KAAA 2DHEA 4X6UA 5ALEA 1ZD3A 2RHWA 3IUJA 2XUDA 4B81A 4J0HA 3S2ZA 4HAIA 4BB0A 3QVMA 1VXRA 4W9RA 3LCRA 4YX9A 1XRQA 2XI4A 1UK8A 4KYVA 4BVLA 2B4KA 3O0DA 2ACKA 3N0TA 3KSRA 3D2CA 3NGMA 4FKBA 5A2GA 5LZ8A 1ZD4A 1UZAA 1DWQA 2AJ8A 2VJDA 5DTIA 4H18A 5ALKA 1DWOA 4Z49A 4UFPA 5AKEA 2Y2UA 3CN9A 2Z8ZA 4P08A 5ALPA 1CUZA 3CXUA 1SC9A 3H04A 3IURA 5T4BA 3STWA 4B82A 7YASA 3IBTA 2CZQA 2BUBA 1CUYA 3ESCA 1JU4A 1K6EA 5F4ZA 3K2IA 1QIKA 4DMFA 1WB6A 4JNCA 2H7XA 1HPLA 3NUZA 4J0GA 5KREA 4BYMA 1LPNA 4UHEA 4B0PA 1A8QA 1MU0A 4ZREA 2WSLA 2PPLA 4WJLA 1VXOA 2OCLA 3C45A 4Y2VA 5ALUA 2Y6UA 2WIDA 3Q8WA 2WUFA 3C70A 3ICVA 3BJRA 1JJIA 1BE0A 1CUVA 3F67A 1HL7A 5EIAA 3WI7A 4UFNA 5AKHA 3WK8A 5CT6A 2VJBA 4B0OA 3AINA 1ZGBA 1MX1A 1XZJA 1XKTA 2QTBA 3C6BA 1UFOA 3AILA 1AUOA 5HFAA 3RK4A 5HK9A 4BDTA 5AKZA 2D0DA 3I2KA 3AZQA 4F5ZA 1MX5A 5K3BA 5AKIA 5IVHA 3TEJA 4DNQA 2WIJA 3PUIA 1ZJ4A 4HXEB 4G8CA 3DOIA 5D7BA 2LIPA 3MVEA 1BROA 1ZI6A 5C8XA 5I7UA 5AI5A 5K3EA 1NU6A 5FPPA 2HA0A 3WMRA 2QMQA 2YH2A 1HQDA 2X76A 1CQZA 1W52X 4J0DA 5CH8A 2ZJ7A 5IKXA 4OB7A 1J07A 2RHTA 3FYUC 2IIVA 3IDAA 2HFJA 1LPSA 2ZVDA 3AIMA 5D6OA 1CLEA 3E0XA 3I2JA 2H7YA 4K2AA 1N5MA 2XDWA 4W1SA 4O08A 4UBOA 5AM1A 1X2BA 2J3QA 2CB9A 5HF6A 1XQVA 4P93A 1J1IA 1QIEA 4GI1A 4JH0A 2VTVA 4IHAA 2PSEA 3G9ZA 1GT6A 4BC0A 2G63A 2Z8XA 3ICWA 5AO9A 2DSNA 4BCCA 2HL6A 1MNAA 2WHQA 1E3QA 3C8DA 5FKJA 4CIAA 4X91A 1XRNA 2H1IA 1BCRA 3ZWQA 1M33A 1ZI8A 4EHBA 5ALSA 2WTNA 1PJAA 2ACEA 4FTWA 4QZVA 4MYSA 1U8EA 4RE6A 3G0CA 4V2IA 2Q0XA 4FOLA 3T52A 1XZMA 3VDXA 4DSAA 5ALVA 4A5SA 3K6KA 3YASA 4UFOA 2GYUA 4OB8A 2AJCA 1P0PA 2XMSA 3RLIA 1U4NA 4X00A 2QOEA 5LZ7A 2ZSIA 1DX4A 1EVQA 4MQLA 4X90A 2GYWA 4BP8A 3WK7A 4B84A 2WFMA 2VEOA 2XLBA 4GECA 4OPMA 1UOQA 5ALGA 4BC1A 1VE7A 4QDZA 4DM7A 4XX1A 3NWOA 4FLFA 4DGQA 1XRLA 4EY8A 2VQ6A 3A70A 5DYYA 4DMHA 4U2CA 4WFKA 4X97A 4IQ4A 3I1IA 3QMVA 3U0VA 1EA5A 5AI9A 4C4YA 3R41A 5ALHA 2HA5A 3FAKA 5EIHA 4WFJA 2VJCA 2CUTA 2PBLA 5E4JA 4LXIA 4CCWA 2HA3A 3N2ZB 4QLOA 4Y2YA 2DQZA 4X93A 1ZD2P 4H0CA 1HKHA 3WA7A 5ALXA 4P9NA 1N1MA 1Q0ZA 1MN6A 2ECFA 1TQHA 1K4YA 3UUFA 4H7EA 4Y2RA 5FRDA 1GPNA 1XZHA 1Y7IA 4YASA 3DQZA 4L9AA 4ZV7A 4MQMA 1FJ2A 2XQIA 4BE9A 5JATA 4DLNA 2BUCA 4XVCA 5BWCA 1TCAA 3D4LA 4K6HA 1HBJA 3FVTA 1WB4A 3C6ZA 3ZV7A 4FHZA 2JGJA 5AKLA 4C4ZA 4MWTA 4B9EA 1MX9A 4PSCA 4ZXFA 1CFJA 3VJMA 3LLCA 1E5TA 4CCYA 4ROTA 4QEKA 4ZV9A 2YXPX 1YS1X 3H1AA 2Z5GA 1H2YA 1JMYA 3QPCA 3EF3A 3V48A 5AI0A 3SK0A 1VKHA 1XZLA 3DLTA 5J3JA 1MO2A 2B9VA 1XLWA 2G5TA 5CXXA 1A8UA 2XMDA 4DYHA 2D5LA 4BTLA 4AB1A 5C81A 4P92A 5AM4A 5A7GA 5CBKA 5HKBA 4XIIA 3STXA 4AMYA 2Y6VA 3M83A 3ANTA 1E66A 4U2FA 5AI8A 3O95A 1BS9A 1WM1A 1GQSA 5E4YA 3WYNA 5DJ5A 3DYIA 1GXSA 1J2EA 5KWIA 4KR0A 3DNMA 3I2IA 1VZ3A 1H2ZA 2XUGA 4UHFA 5AKXA 1GKKA 4UBJA 5K3AA 1LPBB 2C58A 2PSDA 3CN7A 4Q3LA 2O7VA 2R11A 5CW2A 4ITVA 3D2BA 4B85A 4FNMA 3VISA 5A62A 4DNOA 4OD0A 1UK9A 3UMJA 4J0JA 1LBTA 3IULA 3DEAA 2C5FA 1XQWA 3AZOA 3O4GA 3WA6A 5EFZA 3HI4A 6YASA 4J7AA 2XT0A 2QT9A 1QO7A 5JD6A 3DCNA 4KJXA 2PUHA 4J0CA 1BEEA 3EQ9A 4AN0A 3AZPA 1A8SA 3EQ8A 4GBGA 2ZYIA 3FOBA 1BN7A 1Z68A 2JGIA 5AM0A 2K2QB 3R3YA 3WJ2A 5FXMA 5LP1A 4HRYA 2ROQA 1CR6A 2V98A 4ZRDA 1RYYA 1LPAB 3STTA 3H2KA 3LIPA 2QRUA 3OPMA 1F6WA 4LXHA 4EUSA 2OGSA 3C5VA 4WY5A 4AMZA 3HC7A 3M3DA 1YCDA 3WL5A 4FBMA 1QIMA 2GZSA 2X5XA 4TGLA 1DU4A 1MPXA 1XZAA 4UBMA 4QLAA 4Q1VA 4DNFA 4QDUA 1YAHA 2O2GA 2HU7A 4TPKA 4N8EA 3T4UA 1VLQA 2CBGA 4BVJA 4DNPA 5JAPA 2WKWA 2DQYA 1XZBA 1FFEA 2QS9A 3IIIA 3AFIA 3FYTA 1J06A 5ALIA 2I3ZA 3FLBA 4AO7A 3GELA 2JGEA 4HTAA 5K3DA 3Q0TA 1ODTC 4C01A 5BOVA 3VVLA 5DYWA 3KD2A 1CUFA 2ORYA 2OLEA 5AOAA 1BN6A 4Q05A 2QUAA 1AMNA 2XUKA 2WHPA 2EDCA 3HXKA 5D3KA 1EH5A 2GBGA 3ZLVA 4E11A 2XMZA 4H7JA 1DT3A 2FX5A 3GUUA 4Y2SA 4NVRA 4BCDA 2V9ZA 4E46A 3DYVA 3PDCA 4FLEA 3I1YA 4PO3X 2HA2A 2PX6A 3WIOA 5LIPA 2WJ4A 2PM8A 2RI6A 3E3AA 3OC0A 3X3HA 2XQKA 5AKYA 5E4TA 1CEXA 4KE8A 1L7AA 2BAGA 3GBSA 4MYDA 2C0QA 1H2XA 2CJPA 3GROA 2WQZA 5AKGA 1QOZA 4X6XA 1ODSA 2DHDA 1Q84A 3WWPA 4J0IA 3I28A 1MAHA 4HXGA 5JADA 4Q3OA 5AI6A 1CUBA 1ODCA 4Y2UA 3WKBA 4MEAA 2QKYA 1F0PA 4FWBA 2XLCA 3DKKA 2CKMA 2R8BA 4W1PA 4D9JA 4JYPA 3QITA 3G0GA 5ALQA 2WFZA 2B61A 1E8NA 4EA6A 1L7QA 3B12A 5HCUA 1QLWA 4QWWA 2WTMA 1IZ7A 2WG1A 4J3JA 4ARBA 4ZGBA 3G02A 4ZI5A 5AOBA 5JALA 3H19A 2XUIA 4IO0A 3PICA 2GBIA 4H7HA 3DDUA 2QM0A 4NS4A 2WIGA 1JKMA 1O6GA 3OTQA 4LXGA 4DMKA 3F98A 5A6VA 3TGLA 1CVLA 4UHCA 1XZGA 5FP0A 4BRSA 4G9EA 4G4GA 5K5EA 4E15A 2PVSA 5BV7A 1TRHA 1IUOA 4JYMA 2E3JA 4EB0A 2RONA 3OG9A 1W76A 1O6FA 1N5RA 5JAOA 4HS9A 2XUOA 4G4IA 4Y7DA 2NW6A 4LHEA 1CUHA 2WG2A 2VF2A 4N8SA 1QIGA 4I4CA 1ACJA 3ILSA 5AJHA 4U2EA 4LIPD 1CQWA 4UHDA 1JJBA 1XZEA 3IUMA 5DTJA 2DHCA 3B5EA 5LLSA 3GZJA 1YA8A 3V1NA 3R0VA 1CUDA 1MT3A 5HK8A 3O9MA 4WFIA 5HZGA 2V96A 3V1KA 3FWHA 3WKEA 3PI6A 4KACA 3WWOA 5IH7A 5ALOA 2DCMA 4A23A 4CG1A 3R3VA 2OPHA 1XRPA 2XB6A 5FLKA 2WHPB 1G5FA 4PNZA 2BUAA 1UKAA 3L1IA 3BL8A 4C89A 1LLFA 2C0PA 1EINA 3BIWA 1XZKA 4LYEA 4BTVA 1WCYA 4UUQA 3W04A 4INZA 1OCEA 3WZLA 4W63A 5JZSA 3FYUB 1XZIA 1QE3A 4AZ3A 1VZ2A 4GLBA 3W05A 3WL7A 5ALDA 5CT8A 4UPDA 4OU4A 1Q83A 3ESDA 3I6MA 2XQGA 4OB6A 3D2AA 3WL8A 5ALNA 1F8UA 3WL6A 3O4JA 5DYTA 5ALMA 4OUKX 5HQ3A 1U65A 5LZ5A 1VJ5A 3HABA 3H18A 4DSZA 3BWXA 3FYUA 1YB6A 1ACLA 5AK5A 3O9VA 5CH3A 1XROA 1XFDA 4AN1A 3PF8A 1WPRA 1W4LA 3KWJA 4UBLA 2XMQA 5HQ3B 1IUPA 4BAUA 1ZIXA 1IMJA 3DL4A 4PW0A 2XMRA 4X6YA 2J3DA 2VT6A 3BDIA 1LPOA 4K6KA 4Q34A 1THGA 1MAAA 3G0BA 1NU8A 4K5QA 4H7DA 5FV4A 2XUQA 3DL7A 3H0CA 1GPKA 2OQIA 5JARA 4KAJA 5JYCA 3VJKA 3PFBA 1DINA 5JASA 5K3FA 2RGUA 1XZDA 1W1IA 1R1DA 3OURA 2OGZA 1WB5A 3P2MA 3HRHA 3IUQA 4UBNA 2JGKA 2WIFA 1GKLA 3E4DA 5CMLA 1WPXA 4N8DA 2VT7A 1H22A 4RE5A 2Y2VA 3H2JA 1XZCA 2VAXA 2HRQA 3A2NA 3HACA 3HZOA 2QJRA 3NOXA 2PSHA 1XRMA 4H77A 3ZPXA 1BEZA 2JGMA 4J03A 3GA7A 1QIIA 4CI9A 1EI9A 3FCXA 1SCIA 4DIUA 5JAUA 2WHRA 1EK2A 5T4HA 4QNNA 2JBWA 2WUEA 1ZICA 2PU7A 4IH4A 4EY7A 5EHQA 4H35A 1OXMA 1E8MA 3HEAA 4Q82A 1C4XA 4A16A 3FCYA 3DOHA 5LZ4A 2B20A 1K5PA 5CH5A 4AO8A 2ZYRA 5HF5A 2OCKA 1JU3A 2X8BA 2QZPA 4GW3A 5LKRA 1XZFA 5CURA 2HU8A 4ZWNA 5KWJA 4DTCA 1RWQA 2VJAA 5JANA 2ZSHA 3CCCA 3H17A 2XUHA 2QUBA 5CT4A 3G0DA 1YR2A 3TJMA 1UOPA 3C6YA 3UUEA 1AQLA 3I2FA 2FJ0A 2HHAA 1USWA 2BCEA 1AKNA 1OILA 2HM7A 4UBIA 4BRZA 2WJ3A 1ZIYA 1EXWA 3EBLA 4N5IX 2VAVA 3RARA 4GEGA 4OYYA 3G0IA 4M0FA 1E8DA 1PFQA 5LZ2A 1L7RA 5AK6A 3AIOA 3VKFA 1JI3A 4M0MA 2HDWA 3STVA 1TAHA 4HZGA 5ALYA 4Y2XA 1R50A 1YASA 2UZ0A 1D07A 5ALRA 1YAJA 2WFLB 5JD5A 2GBCA 3E1GA 5EHNA 4H7IA 4Q3KA 1VE6A 4C4XA 4MEBA 1CUUA 3W9UA 3BJMA 4JUIA 4H7FA 5AM2A 5HF9A 1K63A 5SYNA 1ZOIA 1YB7A 3TRDA 2I78A 3K9BA 1UK7A 3KWFA 3QYJA 2WG0A 2EEPA 1XRRA 1DX6A 5DNWA 3C5WP 2OCGA 4UHHA 5JD4A 3O4IA 1FFDA 1ZGCA 4PSUA 1DQZA 1R4ZA 1R9NA 3CCBA 4QDOA 5JIBA 2AXEA 3I6YA
chains in the Genus database with same CATH superfamily
5FEUA 3F5MA 3GUYA 4JIMA 1U8ZA 1W5BA 3IAS1 4LY6A 4US0R 1PG2A 1OW3B 3NKVA 4U5XA 4Q9HA 5DW3A 4C4PA 5JAZA 4JYAB 4YV7A 4DLAA 2VTDA 3CW8X 1XC7A 5KYNA 4C88A 4BMCA 4ALNA 3U81A 4F4UA 1FDIA 1U3FA 4U39A 1T2NA 2BW0A 5CEFA 3NJRA 4X94A 2I80A 3SQMA 1MIHA 4KWTA 5LOVB 1G5QA 1AQJA 3UQYS 4CGZA 1K98A 2HEIA 3VPDA 1UJ6A 3CPEA 2OXTA 2OD7A 5CBPA 4YTEA 2H31A 3NAZA 3O4RA 3P97A 4NIMA 5E1DA 1UZUA 3UAXA 4M9SA 1HA3A 4QBKA 4TZKA 3VH2A 4DDHA 4MGYR 4Z2YA 2QVBA 1GXSB 1EFPB 4QVGA 1Y3DE 1HY3A 1VIVA 4JI6B 1Y8CA 3D8SA 5K3CA 1EVLA 3OCCA 2JI9A 5HMLA 4A8TA 3UG6A 4PF1A 3WYDA 4C4AA 1E2EA 3ZI7A 3SEQA 1CIJA 1M6VB 5ECWA 1KYYA 1XVTA 2I2FA 4ER3A 3C1UA 2I55A 3GNSA 4ACBA 1O94A 5H81A 4QU0A 1A5SB 1NOKA 3IH5A 2VYFA 5FHRA 8OHMA 2WIAA 4G5XA 3RIHA 3I5YA 1FTSA 2Z9BA 3BDVA 1FSPA 3AGPA 2I3DA 2UYQA 4YCJA 2Q3HA 4EFLA 4Q7JB 3TL2A 1ORVA 4GWKA 5JO0A 3GBVA 4GVXA 2DX7A 5DWDA 4CIVA 3MPUA 3C43A 1PW7A 3FMIA 3D1LA 1W6RA 1E3SA 1PWXA 1TU3A 1TKRA 2QG6A 4DS3A 1Y4SA 5IYZF 1YB4A 2ZZMA 3NDJA 4A7PA 5J63A 1CUXA 2UUOA 4OQLA 3O90A 3WNDA 4DRZA 4OCZA 5HRUA 1KEUA 1U9IA 3B1XA 1KSGA 1Z4QA 4NPAA 4YK7A 4D3SA 3PNSA 2QRKA 3ZZNA 2NV6A 4UMVA 3U16A 2ZE7A 4GRDA 4DIMA 4HYQA 4MGHA 4KITB 2O0KA 3AKEA 1Z4NA 4JSRA 4Q4DA 3I01M 2C3MA 2E82A 4G5FA 1G4HA 4OLHA 5F5NA 5HKLA 2FFBA 3N0VA 3QK7A 2WILA 1W0KA 4EW1A 2C77A 3X1XA 4Q12A 1S2MA 1UJCA 3AM3A 4UU1A 2ZYDA 3OTOB 4DLYA 4ZMSA 3OHMA 5DF1A 2RIPA 3GD7A 3KJGA 1E1CB 1B14A 5ICCA 3RS8A 2WUDA 1L4EA 3GHHA 2P2LA 3OH8A 1LJUA 3KQMA 4GUAA 4ZOAA 3R1IA 4ARAA 4F0JA 5A3JA 4EKYA 1C1DA 4QOGA 2B30A 3ZY3A 1AUQA 4P7JA 3HM9A 4LK2A 1BRTA 1ZITA 2GVZC 1IDN1 4L9RA 2CBXA 5AUQA 3R9KA 3WWDA 3RBVA 4JEMA 4HWGA 3HY4A 1MW8X 4IDDA 4BVFA 3L0BA 4EGSA 2AC4A 2H9YA 4PYMA 5G4KA 4QICA 2OHGA 4A2CA 3BERA 1TIBA 5JSZB 3OQVA 3NHRA 3RFVA 7ABPA 2WU8A 3JW8A 5IT0A 4DF3A 1GT91 4I19A 2Q6OA 4OQNA 1C3EA 3JAWA 4JWTA 3W2TA 4ILKA 2ZETA 2D4AA 2Q7DA 1DLJA 3KTDA 1XHEA 3QKRA 4RD4A 2GBLA 3OJXA 1YE8A 2HN9A 5T3YA 3RGGA 3OD1A 4I3FA 5KBYA 2Z5FA 2VI5A 3AJRA 3GH3A 1UKBA 3R6LA 4G1VA 4PN3A 1OWMA 1QNLA 2ZB7A 3DH0A 4L4YA 1NX6A 1FFAA 2FMFA 3WHKA 2WAMA 3O7WA 5E7MA 1S2NA 1XJCA 3UPTA 4B7CA 5B7QA 1OFGA 1T5TA 5KWSA 4U2DA 1E98A 2FMHA 4TMKA 1PYDA 4DMGA 1EMDA 2V5AA 1X92A 4JVLA 5D86A 4K9DA 1P6UA 3EUFA 4FHCA 3DVLA 1CUEA 1DJPA 3N87A 4I55A 1WUKS 1E79A 3EIOA 1RRMA 3IVAA 2BHSA 3AUFA 3N6XA 1BWSA 1BWPA 2GT1A 5H4HA 3C87A 5HG0A 4E21A 2GJ4A 4RKWA 4F1JA 3IE2A 3GPDG 3W5AA 1CZOA 2IRWA 3MGAA 4L50A 3OZRA 1WHSA 1D1SA 1JPNA 2XQJA 4NV3A 3TR0A 1M2OA 1GFIA 3DJYA 1CRLA 4G81A 4I4TB 1VOTA 2EOAA 5DYIA 3ZDYB 4G5YA 2G8LA 4B75A 5FJIA 3V1YA 2FGKA 2GGSA 1WD5A 1JG6A 1QC5A 1XTSA 4G4JA 2GUGA 1QB7A 1X80B 3QPDA 3RM3A 5CVDA 1CQIA 3DEKA 4UOQA 2ZR7A 3K09A 4RK4A 3ZDAA 1L9XA 1E1MA 1M2HA 4ZI7B 1SUIA 3LT2A 3B3GA 1IY0A 2NU9B 5KKAA 3QXJA 1XTBA 1NRIA 3LQ4A 3ZHTA 5JUWA 1XMPA 3TMAA 1XRJA 1XOIA 4X1IB 3OEEA 3RC7A 3B60A 7MDHA 5CCXA 1FMTA 3LYUA 1PG5A 4DV1B 1N5DA 1EXVA 3D3NA 3FF1A 3DD5A 2BM9A 3GMSA 4YJFB 3EYWA 1I1HA 2H59A 1K0FA 2JF0A 1F0NA 4Y9TA 1YQGA 3K9FC 2RHJA 1AGPA 2XRMA 3QXSA 4ZYXA 5JAHA 1EEHA 1RWMA 3W2EA 2I29A 4AY6A 4NBSA 2EU8A 3ZZUA 1KH2A 1X42A 3PUWA 4ZICA 2HGSA 1TQ6A 1B3RA 2Y4NA 4NHOA 3G6WA 3O4FA 2WAAA 1T91A 4GC9A 2Y1FA 4MR7B 3GH1A 3K0BA 4P4GA 4W1QA 4IYJA 2Y77A 3H5AA 1ARZA 4B80A 3ZDDA 3FTFA 2VJQA 1ZMTA 4KBYA 3H1BA 4H2DA 1R15A 3THXA 2GEVA 1FRNA 3P2IA 4J91A 4KX3A 4ZOEA 1ZNXA 4B4KA 1KFJB 3HYNA 3PG5A 1RBYA 4BATA 1I2CA 2JH3A 5IHXA 5LZ9A 1EX9A 3QVWA 1IJFA 1DRJA 2V6GA 3H4VA 3BF7A 1JG4A 3QMWA 5FOSA 4XWAA 4MS3B 1C3OB 4JLPA 1Z8FA 2XCQA 1YDMA 1B6RA 3U3ZA 4YP5A 3CX6A 1S8NA 1YONA 1TEHA 2X41A 3CCFA 2A3NA 3L0PA 3QE4A 4LI3X 3RTBA 3OO1A 5JCXA 2A67A 3AHGA 4TMVA 2CF6A 4PEVA 3EISA 2VUUA 3ZJ5A 3A1DA 4E5KA 2H8KA 1NXVA 1RXSA 3GMIA 4KWIA 3UAYA 4XPIB 1Z4MA 4UTNA 3COJA 3R3XA 2GJ8A 2IPXA 1V45E 4D57A 4NEHB 4TSFD 4JMLA 3WGUA 1ACMA 1QQTA 2WM8A 2UZ3A 2O8VA 3H0EA 1E1YA 3F7NA 4D2IA 1Z5VA 1Z0AA 2IYVA 5AKKA 4G1FA 1FFXB 4HFNA 1FNDA 3OQBA 4KSCA 5LYJA 3E2PA 4A6XA 3DBLB 1NAHA 2FZVA 3VRHA 5KTSA 1NMQA 5KNCH 2JFUA 4PIVA 4B31A 2H11A 1G4AE 5A05A 1GZ7A 1QGUB 1LLDA 2BEWB 1Y34E 1GRRA 2JBHA 3EIFA 4KXQA 1XYGA 4LGCA 4Z9BA 3ZWAA 3N7UA 1WUIS 1NW5A 4JX9A 4MKFA 3OAAA 3V3KA 4EBBA 4LKRA 1N34B 1X86B 1K6XA 4CL2A 2JCBA 4PZAA 5C8YF 5MFPA 4NZZA 2M2IA 3BMNB 2B8EA 3PQ6A 4UNQA 5ICMA 4IVPA 1IEWA 4G0ZA 2L17A 4UMFA 4D3DA 5BVHA 1ZMOA 4RZ3A 2PWYA 2C7QA 2A5JA 2VL7A 3UXYA 2PSJA 1C30B 1WU8A 3IHKA 4XEHA 2BI4A 4YCCA 2DM6A 1OH5A 4N1AA 2E4AA 3D7RA 3WGIA 1W7AA 3BFPA 5K8JB 1MJ5A 3CRQA 1T4CB 2C2OA 3O4HA 1OV6A 4GGPA 4HT3B 1T43A 2PANA 4CHTA 1UDCA 4DSTA 2WB2A 3HJCA 4S1NA 1PW5A 1BDJA 1H6BA 2Y99A 4P7GA 3VVBA 2NG1A 3EXIA 5HS4A 2J67A 1DFGA 1RI1A 3CLUD 3CTMA 1N2HA 3E81A 3AB8A 3PJGA 2C59A 2OXEA 4LNUA 1ZFNA 1MKYA 2QE6A 3MINB 4G8JA 1VC2A 3TOSA 2GXSA 2YQ5A 3GF4A 3P2OA 4A0HA 2I2WA 2C4KA 1KARA 4H15A 4MVJP 1DE0A 2J3HA 2YVAA 3SYRA 1VGRA 3SJBA 3ULKA 4DWJA 5DNUA 4B83A 1FFCA 2Q46A 4DV5B 2X7JA 5THKA 1RI3A 4OM8A 1Z36A 3ZWBA 3EQ2A 1G7SA 1NTRA 2ADFA 5LNK1 3FDZB 2NZ2A 2ZUCA 3CINA 1Z7BA 3PE4A 5EZYF 1J2UA 2WVHA 4TMTA 4B09A 1MG5A 2JBAB 1SCAA 2ZBDA 4GOJA 4LPSA 2XHEA 5ILQA 4PYRA 4XX0B 4IMJB 1RVDA 3O6VA 4Z3OA 2RKBA 2Q3EA 2HV8A 4GH5A 5DCUA 1JMKC 3HMQA 1L4BA 2DKOA 3C0KA 3T95A 1YDWA 2Y1XA 1BHJA 4XOUA 2FDCA 3CV3A 4MYUA 1HDEA 1PFVA 3HCWA 5J47A 1C9MA 4MJXA 1DADA 1W93A 1WXFA 3FSRA 1A50B 3QGMA 4IMRA 4TTTS 1PJZA 3EB9A 4OHFA 3GY0A 4LWQA 3K7EA 4O2BA 5AW8A 3ZXUB 1CX9B 3QOXA 4MUMA 2Q4RA 1ZUIA 4XE5A 3VV2A 4YAEA 4R2WA 3EZNA 1S8OA 1RKVA 4NPCA 3W77A 1UXOA 2VTEA 4F3RA 1J9EA 4QGAA 1GPLA 2BI8A 3GVIA 3L4SO 1GZSA 4UNPA 4WCVA 2Z6AA 1UAGA 3GOQA 3W9BA 1P1CA 2QZSA 2ANCA 2XF8A 5H9VA 1TYDE 1QX3A 4DADA 4Y1RB 3T1VA 1OREA 2GZ1A 2YHAA 4FMPA 4LHZA 1BXGB 5JSHA 4G5SA 3JQBA 4GKJB 3I3SR 4ENPA 4Y2QA 4OYHA 1LRJA 2XMCA 2O8FA 4G0VA 1I13A 1O97D 4IY1A 4EABA 5KINB 1XVVA 2HXYA 3ROXA 3PEFA 1CPYA 4PGMA 3L4KA 3ERCA 3JAWB 1OE0A 1GLNA 2ESRA 4GR9A 2B37A 4Q3AA 1LVHA 1KEVA 5B53A 4EPRA 2A9OA 1WUYA 2B82A 1DO0A 1XWFA 3KLOA 2JKVA 4M22A 4YRLA 3CNNA 3DUFB 5BYBA 1Y1RA 5AVQA 4LDNA 4DCGA 4FDUA 1N1DA 1ODFA 3K8ZA 3HY3A 3LVQE 3PEYA 2FDRA 3NASA 3AUKA 4F72A 5F9HA 1EBUA 3KJHA 4I8DA 1CZNA 1OX6A 2PL1A 1E89A 3ND9A 4TTSA 2ZJ3A 3RRMA 4I1VA 4Z0TA 5EE0A 2VT3A 4RKEA 2FNAA 4IDHA 1GL9B 2LCFA 3ZE2B 3RO7A 5HXAA 2NAPA 1FFBA 2R8XA 3A10A 1EDBA 3OU6A 2H1WA 3B6KA 3WQRA 3O8BA 1K3FA 2V59A 4GMFA 3B1YA 5AQEA 2A9RA 1NVTA 1EB8A 2EJTA 5A71A 1JSLA 2X2OA 4NYIR 4KC0A 3T54A 4XCQA 3ZJ4A 4Q7QA 5JDCA 4X8HA 4BFUA 2AC2A 2COUA 3ZCXA 3DV2A 3ZLTA 2ZXUA 2RARA 4BPRA 4PAGA 4MIEA 2QEQA 4RULA 5HTOA 3GCZA 1ECLA 1L7VC 2WSBA 4P38A 3TCKA 1U3UA 3ED1A 2P6OA 2C4TA 4JCCA 5COQA 5EJ9A 2UYYA 3HFRA 3LJKA 1H66A 2CLSA 3KSUA 3V4OA 2PN1A 1B73A 3NBFA 4CKBB 1XDUA 2CL5A 3ZLJA 5C1OA 2GXQA 3VI4B 1J5XA 1FFXA 3S68A 1OASA 2O0HA 4CIBA 2MSKA 5KAMA 1T1GA 2Y9PB 3JYPA 1SXPA 3SSAA 2IXBA 1NV8A 1IVYA 4FFWA 1W25A 3E9ZA 1R00A 2R8EA 2RBGA 1QFZA 1TJNA 1WV0A 1QYRA 3MTQA 2WWWA 4WERA 2C5GA 2OORC 1KO8A 1MF7A 3DE2X 4QUJA 1E3DA 4DIEA 3HB5X 4M36A 1QHNA 1ID1A 4ERNA 2IYXA 2Z8YM 4TOIA 4WIAA 3T4PA 3ZK9A 1CVRA 1CR0A 1O5IA 1RMYA 4MR9A 4XJTA 3UC5A 3MUNA 2FMXA 2BISA 2I2BA 3F6BX 1S7GA 3UMFA 3LG2A 2D8MA 3V5NA 4IMIB 4D96A 3SQLA 4J7UA 1E1LA 1YBVA 2J3KA 4H4EA 4ZGGA 3ZU3A 2WIKA 1G3UA 2QNRA 1JEYA 3DHWC 4MB6A 1E2FA 1OIXA 2PKQO 1XA3A 2PKXA 4BAZA 4LV5B 4AMBA 2EKQA 4Z54A 3OLWA 4ZYLA 5JJBA 2J45A 2D1FA 2II6A 3V46A 1OAKA 4WN9B 3N8IA 5ICEA 2BFMA 4BNYA 3M4XA 3AVQA 5COAA 4H27A 5IUNC 1ZU4A 1T2AA 2I9PA 3PITA 4Y1GA 1SXQA 3ZD6A 3BXHA 3W5BA 3ZHYA 2W6NA 4MV6A 4QA9A 3SQOA 3CRNA 2W22A 4ZARA 3HVIA 2C92A 3QBEA 4S35A 3C5EA 1RXCA 3CE9A 1NJ1A 2VATA 2VR1A 3C3CA 4DA9A 1Q12A 2P0AA 1H5QA 2FWBA 1QP0A 4D3YA 3TG8A 1HSOA 2F3TA 1U0JA 3HBNA 4JQOA 4Q4JA 5DNVA 5CDHA 1NKTA 3QWIA 2D3WA 3OX2A 4DWVA 1JT2A 3LQ2A 5KDLA 3RVDA 3R0JA 1ZN2A 5I7SA 2A4MA 2PUJA 1MGOA 2QLFA 3SU8A 1TUEA 4BBZA 1KY4A 1P5ZB 3LNCA 3DUFA 4TS9A 4UBKA 3QY0A 5KQSA 2ZYAA 4FM9A 4Q15A 2GM5A 1D7AA 3PNBA 4N76A 2JAUA 5JJKA 4QOSA 4KGZA 4U00A 1P39A 1Z0JA 2QUZA 1Z45A 2XCLA 3M82A 3NANA 2PUWA 4Y9SA 4MS4B 3HXQA 3KHSA 4J4BA 3ZJUA 4KI0A 1U2RA 3HXPA 4ZYYA 4FGJA 2GM4A 3HJUA 2QV7A 1MA3A 1Y7TA 2HHLA 1P60A 1H0SA 3EBOA 3LHIA 4E2FA 1R88A 4TV8B 1XTPA 4HEQA 3M49A 2UV8A 4CJXA 1NWCA 2O2ZA 1C9DB 1JFRA 2DPGA 3EHEA 3FFTA 1UJ5A 4KQJA 4DYVA 3FD8A 4EHJA 2WWIA 3R3WA 2YINC 3Q85A 1Q7RA 1K92A 3ADPA 4C7XA 5FEMA 5TMEA 2R1VB 1ZI9A 4R1UA 3ZKWA 3AF3A 1UPUA 4A10A 3B1KA 4FIZA 2J9ZB 5DHQA 1ZUD1 4OK3A 2X9GA 2PA3A 4L15A 4F38A 1BMTA 5C5DA 3EEQA 2NUPA 4RIHA 3W0LB 2J9XB 5FOQA 5KJ6A 3LSTA 3MJEA 1VMDA 2V0GA 3AWIA 4QG3A 1N1GA 5AIAA 1ZR2A 3TI9A 2C9DA 1V9LA 2FWJA 3CLRC 3CUKA 3TO5A 2L82A 4EY3A 3SSMA 1Z29A 1T9AA 1RWKA 3USZA 1UFQA 1UKZA 1CG6A 3ZBUA 3G5AA 1I7NA 4P81A 4BUCA 4ECAA 3OJFA 2P2NA 4V0RA 1DTSA 3AL2A 1COWA 1JKFA 2CNNA 3KEMA 1JE0A 1IUNA 5JSKA 4ND3A 1TO6A 1YRWA 2AN4A 4PZCA 4Z7OB 3MCWA 3RSSA 2HOQA 3ORRA 3BE8A 4MCIA 1YSCA 1G66A 5AJUA 4IXWA 4TN1A 1NDQA 2OP1A 2P0EA 2V5VA 4NQRA 4E12A 8GPBA 3KB8A 2QJFA 2QRNA 3GL9A 2VYCA 1L4FA 3N74A 4QXRA 3RAJA 4QPPA 2DWCA 2QTNA 1EUYA 5E0KB 2QTCA 2BMEA 1KAOA 2QIPA 4DUGD 1WTCA 5C8DA 5LYYA 4XQ0A 4C7KA 3JWEA 4AO6A 3RYCB 3SZMA 3M6XA 2JFYA 5HPYB 1XQYA 2Y1DA 4N3NA 2AJDA 3V80A 3VR4H 1WVGA 4CDNA 4LHWA 3HWRA 1Z62A 2WP0A 2H17A 1J8QA 4WK4B 3ICPA 2I4MA 3K30A 3FFAA 2ISQA 3DB2A 3E9QA 4WVLA 2JJYA 1O9BA 4PZZA 4WJZA 3V00A 3FYHA 4XJVA 5DSZA 1GM5A 4CF6A 2O8DA 4LZOA 1W34A 3L8GA 5HDQA 3AI2A 1KRXA 4MRNA 1T0JB 3A1WA 3BHMA 1RYNA 4PANA 2V6MA 5L40A 3TTWA 3WJ1A 3K9LA 4ZU1X 1SHZA 4WY8A 1BS2A 4AF8A 3HSKA 2OK8A 3FA2A 4G09A 1LK7A 1GGMA 1ZHFA 2J5XA 2X6TA 1TJ5A 4HYEA 4DJDC 5IAAA 3U4QA 4NULA 4V1CA 2Y92A 1ISJA 5CHYA 3TMYA 2W2QA 3KPVA 3PQFA 2WWRA 3EK2A 4HYYA 5ERXA 1E3EA 2RAUA 1EUDA 2ZUBA 5EE5B 5I9IA 2HA4A 1IIBA 3UF0A 3ZDFA 1UPFA 2W2PA 1MNQA 2ONKA 3UENA 3SSNA 2JI4A 1WV1A 4OGLA 1J1ZA 3OEHD 1SQ5A 1BDMA 1KZ4A 2HK9A 2UYCA 1BGWA 5AVUA 1CP3A 4YH1A 3DLPX 3G9TA 2LD4A 1ZVMA 4NCKA 2Q1XA 5DNCA 2HCBA 5DIZA 3KOZA 1IH8A 2BEVB 2RI1A 5L3QA 1KGDA 2DHQA 2Q4EA 3OZDA 4V0ME 1PR6A 4TV9A 5JEDA 2ONJA 4KJZA 1RLJA 4DB4A 1TCCA 3L6CA 1T9CA 4TMZA 3B6JA 5HQTA 1V8PA 5DHTA 3RADC 4QPDA 5TGTA 3I6ZA 3WV5A 3OFSA 1KFEB 3OZCA 1TFRA 3PUKA 1JR2A 1EX7A 1FVFA 2ZJOA 4MULA 4H1VA 4QJBA 3UPUA 4YGYA 3VYWA 4JR2A 2WICA 2FVXA 1EVEA 4WWHA 4H16A 3TK1A 5CVJA 3C7TA 4WA8A 1QJ4A 2A7QA 5I7AA 1MDBA 3BTVA 3V9AA 1W75A 4EHFA 2LPMA 1RIIA 1QTIA 4H0NA 2AZ4A 3F3MA 4HGNA 1ADGA 1ZOPA 3NAGA 5EA2A 4E07A 4MRAA 2RJOA 1II9A 2X2EA 3KHUA 2RGDA 1N8TA 3ZQ4A 2AJBA 2V7BA 2FTKE 3AF1A 3AEYA 3HCDA 2ABWA 2Q4TA 3OEED 5A4MS 4PRKA 2PZLA 3FLEA 1REQB 2RK4A 5BQ3A 3KJQA 1OI4A 1SFRA 5JD3A 1DBIA 2O50A 3T35A 5BN1A 2AOUB 4EP1A 3CZ5A 3QHAA 2Q3MA 4FE3A 1ZW6A 1N32B 3BPSA 3DBOB 4BZPA 4YUYA 3JATA 5E1OA 4ARSA 1JG2A 1V47A 3IPCA 1ZESA 4RAQA 3KJIA 4ENVA 1JGTA 2YJNA 3KALA 1DCKA 4MX8A 2I67A 4LHSA 4WLFA 2H85A 1W36B 2XOXA 2I4RA 2GJAA 1KI7A 5JWHA 5HA5A 2VSOA 5D00A 5KVVA 4BQIA 3H75A 1JG1A 1H4VB 2HMVA 1KO5A 3WYBA 4C07A 3NZEA 3NNNA 2CXHA 3G8YA 2VDLB 1JW9B 2NTNA 3CRZA 3HLYA 3M1IA 1PF7E 2QLMA 9MHTA 3L6RA 1FS6A 4GOKA 1JYFA 3U5ZB 1JI0A 3P0JA 3DBHB 5DYNA 4YCBA 2IGTA 4P3OA 4AZWA 4FYMA 5IAOA 1Z37A 2CD7A 1IJEA 1JLHA 2Z9CA 3U7GA 3DQQA 4I8IA 2F6RA 5BOSA 4PLCA 1U3CA 2QSJA 4G4SO 4F46A 1ISHA 1ZN7A 2DH5A 5BWBA 1GNLA 5J1TB 1NJ6A 3DDCA 2VHUA 4FFSA 2V03A 4YJ2F 4ITRC 4UHBA 1LS1A 4N6GA 4LBVA 3DBIA 1D6MA 5JV5A 5JCOC 2R68A 2ZVQX 3P2EA 3PUHA 2EZ9A 3KELA 4IIGA 3IA2A 2I76A 4QGBA 4XM2A 3NHMA 4B6EA 5A0VA 3G9QA 3WGOA 2F9MA 2FVYA 3WFJA 2CSUA 2QLBA 4BNVA 2ZWOA 2W4IA 4HQLA 2A33A 2Q5HA 3F9RA 1SEPA 4AXBA 3FNGA 3PUYA 3TVYA 3LHKA 1Z13A 3UT5A 1TK9A 1QHHB 2BJVA 2WNHA 2PFKA 3RT1A 3TNJA 4CT0A 2VDRB 4GNRA 2B4TO 3EPJA 4BP9A 3IR6A 4ER7A 2R6ZA 1T8SA 2OAQ1 4XRGA 3OY7A 1YJAA 4KAAA 2MTBA 3ZGNA 1GQFA 2H2AA 2D74A 3NBZC 3C1OA 2RB4A 2YWGA 3QEBZ 1K8XB 3DAHA 5EVJA 4KSYA 4IZIA 1F0KA 4YO8A 1U28C 3SXJA 3O8OA 3E6AA 2I7CA 2VSFA 2Q2NA 2V1UA 1KMHA 1JPJA 2ODPA 5DM4A 1BAPA 1B8NA 4YMIA 10MHA 4LSZA 1XR3A 1I7PA 1Z4PX 2R8RA 2XUDA 3LLSA 1UZNA 4B81A 3QHPA 1TZKA 2UVPB 3HCNA 2REQA 5KYYB 3O3MB 5HQJA 3URMA 2J7PA 3O0TA 4B76A 2FAXA 4CLRB 1JHXA 2H8GA 2I2CA 4W9RA 4YX9A 3LCRA 5ICSA 1I2ZA 2SICE 3F49S 4P4TA 5T41A 4D9CA 1F48A 1LDNA 1PFYA 2R2AA 4IOMA 1I1OA 3B1FA 1QGYA 2FFJA 3O0DA 5BNIA 4KTVE 4A0GA 2VQEB 2XTMA 4MRSA 4KXUA 4MIYA 4PHGA 2QRGA 3UJPA 3DQPA 5D01A 4F56A 5A2GA 3SVLA 2P2ZA 4L51A 5GTDA 1CYDA 1V3UA 2P67A 4NV0A 4R2JA 3WY9A 3JATB 3C6QA 1DWQA 1XCGB 2GN9A 3K1TA 3FWZA 1L5KA 5CM9C 2BT4A 4EKDA 3E3NA 5LR6A 3AUAA 1VYVA 3M7IA 5LU9A 1DWOA 4IXDA 4Z49A 5IJ0A 5LMNB 2ZZKA 1QTNA 5AKEA 4X1KA 3S5JA 5JBIA 3KCNA 3CN9A 3UAOA 3GLFA 2ZUTA 3PR1A 2EWVA 7ADHA 3I6IA 3TB6A 4LS3A 5BQOA 3EXHC 4GU5A 2P79A 1NIPA 1XZNA 1U0EA 1PCXA 2INGX 4P0PB 2PYIA 3KQWA 1NVGA 4MMZB 4PWYA 1K7CA 3DCJA 5JC1A 3VKGA 1U7UA 2C97A 3C24A 3R5JA 3TE6A 4IGEA 1CUYA 1DIAA 3G2MA 1UT8A 1JEOA 3I64A 4Y6GB 5F3DA 4PM4A 3DAPA 2VNAA 1F38A 1QIKA 3FH0A 3KKKA 4JLBA 4R68A 2JL1A 2JFBA 3OJLA 4TX1A 3PU6A 4M8LA 1DXHA 3D64A 4RKYA 2EARA 4J7XA 3VPXA 3NH9A 4MQEB 2O0LA 1HWYA 2YHBA 3TRFA 5KREA 3ZE7A 2AKAB 1U3DA 1XN4A 2A0FA 4BB6A 3BMXA 2XWJI 3ZV3A 1HL3A 4RCZA 4FK8A 2F67A 4MP6A 2WSLA 4NRDA 1U4SA 1Y7LA 2HI0A 3G5MA 1A95A 3LBFA 5JPIA 4C7BA 3RYCA 2BTQA 2FUG1 1WUJS 2CHUA 2DECA 3MWDB 4BFWA 3P27A 4J16A 1D1TA 2VPYA 4BGEA 4G23A 2O5CA 4BBJA 1XT6A 1FJHA 3VPSA 4LVUA 4Y2VA 4PE5B 4UVGA 3PFNA 2YJ4A 4MKHA 2WIDA 4HNVA 4GS5A 3KXDA 1IXRC 3GEGA 3H7IA 4BRWA 1TA4A 1E3TA 3CGGA 1SXIA 3IAHA 3P32A 4A36A 3AUUA 2WUFA 1C80A 1WULS 3FHLA 4X7MA 4XD7D 3RVOA 4JDUA 3ICVA 2P4EA 4X20B 3EIXA 5KX5A 2ZQ5A 1JJIA 2ORIA 4CV0A 1C7ZA 3GRZA 2H1FA 2BE9A 4D45A 1J25A 2NACA 4QT4A 5LQRA 3LT4A 5AKHA 2A78A 2JASA 4EHNA 1IZYA 2C96A 2VJBA 1E1QA 4PICA 3VYRB 1YS9A 2BGLA 1CS0A 1XD9A 1ZGBA 1MX1A 1XZJA 2JANA 3AFGA 1BMQA 1XKTA 1K7SN 1J0CA 3TSYA 3AILA 4A8JB 3KKQA 2PMFA 5AKZA 2D0DA 3U4HA 3AB3A 5I9BA 3L0SA 4TTVA 1MX5A 2I66A 4FOOA 1WKBA 4GOND 1GUDA 1ZD8A 2JIZA 3I9V6 1TPZA 4EHLA 2HK6A 2HGZA 2QQGA 1VLJA 2V7EA 2QE7D 1ZJ4A 3PC8C 1U8YA 1NLFA 3DOIA 2GTPA 1N7IA 4M3NA 3KB1A 3B1ZA 1WAMA 3MA0A 4MW0A 2LDBA 4DLPA 3ZQJA 3PR2B 3GQVA 5C8XA 3E84A 3TAUA 1PSZA 5IU6A 3EC2A 4JJEA 5FPPA 1HURA 5E9QA 4M83A 3TQCA 3IDFA 1Y8QB 3G59A 5EMHA 3W79A 1NVVQ 3KSDO 2UZIR 1VB3A 2QX8A 3NMUF 3JQFC 4TZ0A 2OCDA 4FJ0A 3P9QA 1CY1A 1QWSA 3TUIC 1EK5A 2YH2A 5EFOA 1ODIA 2PBZA 4I55F 4MVCA 3F73A 1HEIA 1F1BA 5HZMA 1CQZA 3M6FA 3SJZA 4IIBA 4IJMA 3LQQA 4EQZA 5A9SA 521PA 4WQMA 4U02A 4OB7A 1A96A 1ATZA 3GLQA 1I0IA 1KY2A 1WOYA 2GCNA 3UWDA 4EMUA 2O07A 2YZMA 4QECA 4WNAA 2JJQA 5JXJA 1B0AA 1DG9A 4RK1A 4A26A 4MW6A 1RR6A 1DPFA 4NR0A 1REQA 5HE8A 1JAHA 4HGQA 1FFYA 1SKQA 2ZP1A 3AIMA 4JT8A 4IFEA 2IEIA 5D6OA 3V33A 3KVYA 1S96A 2F9FA 3MG9A 3EMDA 4AP6A 4MZDA 4B2IA 1NJ2A 2E21A 1JLLB 3HP7A 1S89A 4W5RA 5AM1A 3LV8A 1UM9A 3INGA 5DTQA 1X2BA 3ZE8A 3BSFA 1I2BA 1XMJA 4D4IA 2WK1A 1MC5A 2DPXA 1XQVA 2LVBA 5FO0A 3DHYA 1A2BA 3OY2A 2JI6A 4IKPA 3HSYA 4XKJA 3BWBA 2BKAA 5IBQA 1EBFA 2Q1TA 1FE8A 1VIMA 4EB8A 4R2XA 1D0VA 4BC0A 2D59A 1N2JA 2NV0A 5TV2A 4C08A 2BGJA 4EG0A 13PKA 2JARA 2DSNA 3Q9SA 4JU8A 1PX0A 5DGTA 2HT1A 1MOQA 4BCCA 4C06A 5DISB 4FXPA 2FW9A 3INNA 3MYYA 1XHLA 1SKUA 3C8DA 2YC4C 1M1NA 2IHVA 1VL0A 4JASB 1W46A 5AJTA 1S8AA 4X91A 4RD6A 1XRNA 4OH1A 4QNMA 1P33A 2RHCA 3KTAA 4D9NA 4NAUA 1XZQA 3ZWQA 5IKOA 4YUXA 3EFOA 4GX1A 1ZI8A 5E38A 1AMUA 5JAIA 5JMOA 1G20B 2B36A 4W7IA 3PB3A 3QXHA 4EHBA 2ZUWA 3L6DA 1B8OA 2P68A 5ALSA 2EJUA 2G82A 3BSSA 1V2GA 3L8CA 2Z2JA 4I66A 4EJ6A 4CM9A 4HSGA 3ZEIA 3FTPA 4FHEA 1TKAA 1YKGA 4GQIA 3AP1A 1Q50A 4FTWA 4UNNA 1KI6A 5FNVF 3CLHA 3MN1A 4TQ9A 4ANFA 2BCGY 1P2DA 4G63A 5I9TA 2WT9A 5KYWA 3ZWNA 5AYVA 3EVBA 4QYXA 4PO1A 5IJ0B 4IF4A 3CJTA 5IG2A 1Y9EA 3P9RA 4RTQA 1JS1X 3U37A 3A7DA 1ZN9A 2R6GA 4K05A 1XZMA 3I9MA 4R1MA 5ALVA 4B6JA 4WACA 4DDKA 3IKMB 3M1AA 1GGFA 1JR4A 1JWAB 4BIIA 4UFOA 3P9NA 2CWDA 3GRFA 4KGVA 4CMBA 4B44A 3ZNPA 2GYUA 1H8EA 2SBTA 4TKUA 3JXEA 2P9HA 4RC9A 4CI0B 3DW3X 2BI7A 3QRWA 3U61B 1JHQA 4DAOA 2QROA 1PZMA 4V1CI 4QEDA 3OPYI 2EX4A 1Y9ZA 4V0KA 2AOTA 4JHLA 5FWYA 3MT9A 3LOUA 4M1MA 3RLIA 2GLTA 1U4NA 3MLEA 1GQOA 1A7AA 1UBOS 3NWEA 2DF8A 3QE9Y 2AXNA 5LZ7A 2RGGA 2ZSIA 1W47A 3ZV4A 3KYBA 2BBTA 4UZFA 2B21A 1EVQA 2OFFA 4MQLA 1F3LA 4BGDA 1J0EA 1QWOA 2GYWA 1XDSA 2IOHA 2R5FA 3EXG2 5F33A 4BP8A 1NQOA 1S02A 3ABOB 1Z7YA 4B84A 1A8IA 3CKKA 4U8HA 4ZI2A 4HAWA 2ADOA 5FOWA 1UOQA 4XB6B 1YKSA 3G8BA 4LZAA 4BNUA 3IT0A 4RK5A 2XCRB 2FPLA 4KXVA 2IHYA 3AL0C 1M2OB 4OLBA 3GAZA 3EY9A 4BV2A 1IIRA 3GFSA 2H1VA 4HNAB 5AVYA 3NWOA 4FLFA 1W4RA 2ZVJA 4BLVA 2HX1A 2CNWD 3D5TA 4KP7A 4RDCA 5C2JB 3NIGB 1XRLA 5HOEA 2QF7A 3M6MD 3Q40A 1KOJA 2QK4A 4EY8A 3IOYA 3NALA 3QA9A 2VNJA 2HMSA 5DYYA 1PI3A 1NLZA 4HDOB 3DFZA 1OXBB 3S99A 2D0PB 2GZ3A 3SXPA 4CDMA 1X1EA 4WFKA 4TMFA 3UBMA 4IQ4A 1TMGE 2V9CA 1U7WA 4KXNA 1TI7A 2OORA 3FR8A 3EVEA 4DSNA 2EKBA 3V6LA 1QP7A 1EA5A 4CYMA 1XKXA 3R8XA 4NC9A 2QMUA 3FTNA 3R41A 4U6SA 4PC6A 3WVNA 3VDNB 4R9SA 1J5PA 1HT0A 5ALHA 2HA5A 2JHAA 4KLZA 3WB2A 2DEUA 1XAIA 5E8RA 3UKJA 9LDBA 5FX2A 4O1IA 5IYZB 1O94D 4UM9D 5E4JA 4LXIA 4W6ZA 1HH4A 3L05A 1GO2A 2C29D 2X4LA 1AXGA 3NCTA 3AU9A 4D3FA 1N77A 1EGMB 1G9XA 2HA3A 2QPLA 2IS1A 3P9CA 1EM8A 2VDNB 3DBRB 5U1PA 5A5EA 1E20A 1RKQA 3SCZA 1ICIA 1Q3HA 3TZ6A 1MRNA 4G01B 3NHFA 4X93A 1ZD2P 4H0CA 2CEAA 1VJTA 1Q0QA 1HKHA 1XDZA 4LK3A 1L5MA 4LNUB 4UKDA 1C4WA 1F1JA 4OVKA 2R25B 1A9SA 3UJ8A 5F23A 1CF4A 1M2EA 5K03A 4W5JA 1Q0ZA 1XBTA 1MN6A 2WPDA 5K6TA 2ECFA 2CXOA 3Q87B 2NZUG 1LW6E 4H4DA 3RODA 5JYEA 1T5SA 1RZRD 1K4YA 2I65A 5F2EA 2FQXA 4H7EA 4I55B 5TLSA 1GPNA 4BGUA 2AUNA 2N46A 3K1AA 1ULSA 1DKPA 4MV4A 2O8CB 2HSDA 3IMGA 2X58A 4YASA 1KJ8A 3PUVA 4C0LA 1HT3A 1YE3A 1GVHA 2BFBB 2OHXA 3Q5DA 1A4RA 4G85A 4LYGA 5FBKA 3MOIA 4ZEWA 1FVOA 1URPA 4KKVA 2XQIA 4RPKA 4LNAA 1H2HA 1ZCZA 3ODPA 4GZ6A 5JATA 2FP4B 1ECCA 2OMKA 1Z15A 2J9YB 3ROEA 5BWCA 4XVHA 2GN6A 2V55B 4M46A 3CE6A 4BN0A 4YDSA 3B6MA 1TW2A 2EKZA 2IY9A 4E5UA 3D4LA 2CHFA 4PCVA 4F3YA 2ODTX 4K6HA 1YS6A 4BQQA 2A86A 4OO3A 3M4NA 2DFLA 3IBSA 2A35A 1G291 1WB4A 2FUG6 2BY4A 4NCNA 4BFYA 5A5FA 3TB4A 1WXHA 2C8VA 3I76A 3TFWA 1P0FA 4POOA 3PGJA 3C6ZA 4RV4A 4TQGA 3NBAA 4F93B 1VLMA 3EAGA 5JZVA 3ZYCA 4PWZA 3U56A 1P3Y1 3FDFA 1NUAA 3VMMA 1MFPA 2GTHA 1L5NA 4D0RA 2YCBA 1JR3E 3DDSA 4DXHA 2X40A 4JI2B 3DOJA 5IWCA 2PD3A 3DHEA 1M2NA 1MTOA 1WQ3A 2NSDA 1L7MA 3BBPA 5LBUA 3TNFA 3NBXX 1GPAA 1CFJA 4ZXFA 3ZK7A 5BT8A 1FZTA 4WADA 5AQ1A 3PC6A 3CVUA 4ZQIA 3TRJA 3U7JA 1B2LA 3AY6A 1WZUA 1WXEA 2B1RA 5CJPA 1Y6ZA 4TV9B 4Y7CA 4OMDA 2WJGA 3GPLA 2HCJB 4QEKA 4DJTA 1I4OA 5EIFA 3H5IA 4K40A 3QENA 2IEGA 1IRXA 3H1AA 3H1FA 3O2QB 4IGKA 1S9DA 1H65A 1NG1A 1JJ7A 1JHRA 5JI3E 5KTKA 5CAEB 3IE0A 2DUWA 3V48A 4MHSA 3N6VA 4RHTA 3TOVA 1VRCA 1VKHA 2D5AA 2HDNB 2R6JA 3M8KA 4U0JA 4YALA 4QFBA 2FLWA 3Q72A 4M1YA 1Y6RA 3SYKA 3UM9A 3S2ZA 1GPUA 4DLBA 5B4UA 4M8SA 1G6OA 1CK4A 4HC4A 4JQCA 4R1PA 4URHA 4H1WA 1WNFA 1XLWA 4XB2A 3KP1A 2G5TA 4H6XA 4R8KA 1C9JA 4YIKA 1W73A 2IZZA 4JJZA 4O4IF 2D5LA 3EFBA 3PNMA 1U3WA 4LQ4A 1ICEA 3ZU2A 2C3YA 2QN7A 2FFHA 3IPAA 1AQ6A 1FP7A 2CCKA 3A4MA 4DFDA 2R00A 4ZT3A 5G41A 1K3TA 5FLXA 3N70A 4JBGA 3T7EA 1NQAO 3GLKA 1ULAA 5AM4A 2BYTA 3B85A 1GCOA 1H69A 3N2NA 5FBHA 4W8HA 4U9UA 1P6XA 4XIIA 5ERGB 2Y6VA 3EZGA 5ARBA 1IN6A 2ON6A 4US1R 2PJDA 4BLWA 4KQGA 4Q18A 4BNGA 4IUBS 1QRRA 3I8OA 3QG1A 3ONFA 4ZOCA 4MYHA 4XJXA 3NDBB 1RXWA 3HGQA 3N0RA 1JNXX 2IOFA 4PZ0A 5T4FA 3WYNA 5DJ5A 1V43A 1AF7A 3KLNA 4MV7A 3G8CA 3L5KA 3KAQA 1Q57A 4B7XA 5JW6A 1J70A 3CWQA 2R79A 4LJRA 1SG0A 4MP8A 1OI7A 4G1CA 2E6UX 4QOIA 3MPOA 5FL7A 3BG5A 4EH1A 3DNMA 5KWIA 2AUMA 1UXIA 2HD4A 1J42A 4BLTA 2C95A 2OD9A 2HDHA 2IU3A 4UHFA 5IJXA 1VMEA 2XA1A 5AKXA 1GKKA 4UBJA 4BO7A 2R7KA 3NTRA 4M8NE 4BL5A 3QE0A 1JFFA 4R0MA 2O7VA 2ZI3A 3HU1A 4ARIA 1IPFA 4PFSA 2H00A 1T6XA 5CW2A 3ZXXA 4BRUA 3W3AD 5D8DA 3W5DA 3OIYA 3LQYA 2Q8PA 2X9LA 1H3EA 1RPZA 2XKKA 2WF9A 4MVJG 1VKJA 4DNOA 1Q19A 2WMDA 4F84A 5A62A 3GGGA 1E5VA 3AR3A 3NT2A 4S2UA 2LXNA 3TUJC 3L01A 2B1GA 3AOEA 4G41A 4OGKA 3QUSA 1TJ3A 4ZAYA 3U9SA 2PMDA 2WU1A 2I91A 4JQYA 1RQGA 2WYHA 3A05A 5A3QA 3FDZA 1MHTA 1JE1A 4ZO8A 2YV4A 3W8FA 5T8KC 6GPBA 4DZRA 1II8A 1VPEA 1WSBA 3EW7A 2HDOA 2C5FA 1E9RA 4NYMQ 5K0TA 1RZVA 1AB5A 4YRGA 4KVGA 2X7HA 3U3JA 4ZYZA 3HI4A 4TL6A 3F6SA 1G19A 6YASA 3L04A 3PPYA 4MA5A 2F9LA 2XT0A 5K8CA 3AU8A 5JD6A 4KJXA 1OX4A 2ODBA 1B16A 5J4HA 3EN0A 2WJAA 2CV1A 3GGPA 1F60A 1J33A 3VDMA 3V7YA 4NLLA 1C8LA 4D0LB 4D4HA 1G98A 5JHGB 3BGOS 4C3UA 3QVKA 4LN1A 5I4CA 3H9UA 4ZO9A 4RVNA 3KU4A 2F1OA 4E7PA 3JASA 4PR3A 3E7XA 4WKNA 4N5MA 2HKIA 4X1YA 1KY3A 2GRAA 3R0QA 2FN9A 2W4QA 2AD1A 1SUSA 1DQNA 2BKVA 1V6CA 2GZMA 4WOKA 4ZC1A 3ZQUA 1RXEA 5U4QA 1GZ3A 1RWVA 1ZMRA 3R3YA 4XYMA 3UGKA 1FYEA 2GRUA 1GDHA 4HRYA 4HWSA 3UJ7A 6Q21A 1W49A 1IHOA 3R6TA 3VTAA 1E96A 5G53C 2VDPB 3LIPA 3LVBA 3OPMA 1F6WA 5EZ5A 4EGAA 3RVNA 4YCLA 2IPMA 2WMOB 3QIAA 4RL6A 4RLQA 3DVQX 5LP6F 4EUSA 5FADA 2ZK7A 1UC8A 1WVMA 3C5VA 1AQYA 4IAOA 4ZT4A 2W6OA 1JHMA 2J33A 4G5QA 3E8SA 2ODNA 2O7SA 3QI7A 3ZWCA 1Q1ZA 4WY5A 2O8BB 3M3DA 4Q7MB 1YCDA 1UBTS 1I5RA 1HXHA 5G4KB 1I9CA 2AFVA 4CMJA 1EG7A 1WVIA 3HR4A 3D3QA 5T3UA 4ZHQF 4DW8A 5A04A 3EBPA 4E3WA 2JJ1D 4XIYA 1M76A 2X5XA 3PPWA 1HF3A 4TGLA 1GPH1 1PKXA 4J6EA 1JL3A 1WD7A 1WDWB 5JVDB 5AXAA 3P52A 2ZOSA 1N2IA 2HQBA 4IGIA 4QLAA 2HPHA 5TQVA 5JXHA 4YP9A 2QQFA 2DFTA 2BMFA 5BN4A 1LQ2A 4YS6A 4K6MA 1YAHA 4UDYX 2PZGA 2ZRJA 4D6PA 2VH5R 2R4TA 2O2GA 2Z9DA 1DB3A 4HDRA 4AJJA 2FSVC 2HU7A 1XJ5A 2RC6A 1E2UA 3OIDA 2O3JA 5IXJA 3THYA 3TLXA 1W87A 1P3JA 4MWEA 2JGRA 1GOTA 1ZD9A 3BILA 3MELA 4NU8X 2QS9A 2VPXA 4WX2B 1Z8HA 2YOHA 3AKCA 4LZLA 4FINA 4NH0A 3VTKA 1TX4B 1YR3A 2AMJA 3QLJA 5B6PA 3FUCA 2QSYA 4CL0A 4FYXA 1DSSG 4XARA 1DBRA 3KG2A 2ZJ4A 3PX2A 4N12A 1XYVA 4RMGA 1SU4A 3VOAA 5HZHA 5L4NA 4RORA 1LI7A 2WJWA 4OQFA 4PYQA 1LXCA 5EJMA 1L5WA 3NHJA 3QU4A 4E5PA 2JGEA 4DIFA 3CT6A 2QTAA 2IE0A 4NMXB 2TSYB 4IINA 1C8KA 2Q9AA 4HDMA 3VVLA 1UBFA 3GPBA 2JFGA 3C3YA 3T6KA 5L7WA 3V4LA 2BP7B 4TN5A 1AN0A 5DLYA 3VNSA 3FOWA 5K05A 2C4MA 3B82A 3C16C 1BN6A 1ZH2A 4KYUA 4RPGA 5D5QA 3UAZA 4Y9DA 3WRXC 1I51A 2PT9A 1LVUA 5CPFA 4QXPA 2POCA 4ZKEA 2VPPA 4F85A 4DIDA 3FI9A 3SF8B 2MYUA 2ZATA 3LYLA 3R5KA 1D5CA 1Y4DE 1W5SA 2WHPA 1CRWG 1MOSA 3HXKA 1U8UA 1YB5A 2JC3A 5CM2Z 5D51S 1WUTA 4Z3DA 4AYXA 1TTPB 2QRZA 4QGSA 2R5WA 1E0AA 2VK4A 3PD1A 2I99A 4QBIA 3AP3A 3QPUA 1Q77A 3ND6A 3RW9A 3RVLA 4HVCA 3GEDA 4BCDA 2H1OA 1KZ1A 3FPGA 1GGJA 1ZX1A 2PVPA 3E3OA 3KB6A 2RI0A 2O8EA 4ABYA 3A14A 3D6TB 4FCTA 3MMXA 3N7TA 4PO3X 1LSJA 4LOKA 2EKPA 1V26A 3ZHCA 4XEUA 2AG1A 1ZVVA 3MTAA 4KV9A 3WIOA 2GN0A 5LIPA 1FNSA 1JF8A 1GEGA 5EAIA 2V6IA 1Z6QA 1WP9A 2YFYA 3D7KA 3JARA 5TGZA 2G76A 5FBWB 3P20A 2VP9A 1T2CA 2OVFA 4RTLA 1L7AA 1NQTA 4M2LA 3D6HA 4G6ZA 4ZO4A 2K2WA 4C0AC 3U1VA 3HNOA 2PLFA 1U2TA 3R44A 4BO9A 3R24A 2CJPA 2PH5A 2IUEA 1Z33A 3OP4A 2WV7A 4RY8A 4CRWB 1PO7A 2WQZA 1NFRA 3UGTA 4LY0A 3SFVA 4DZTA 1TZJA 2G8NA 2M32A 1VLLA 1YXMA 1O5TA 1L7BA 4X6XA 1KEWA 1ODSA 2DHDA 1QZZA 1DI0A 2VWQA 4JLNA 3CUVA 4MA4A 3BB4A 3VYSB 2QMEA 3N0WA 1O9GA 1SUDA 3TLMA 1WBBA 1YOVA 2EZ8A 2ZRLA 4AKGA 3KFLA 1OWLA 1O0BA 4WCDA 3VHXA 2R6R1 4HNUA 3UOGA 4HXGA 3SDZA 1RE1A 1NLMA 4XWGA 3G79A 1O94C 1ODCA 4Y2UA 4MEAA 2I1WA 3KKLA 1XXHA 1OBFO 2DQ4A 2ETVA 1V5GA 3AEXA 3BGSA 3DKKA 4FZ5A 4ZPJA 2QD5A 1FUEA 3OZFA 2RCNA 3QI2A 4HLDA 1Y5MA 5GPBA 5TR9A 4E13A 5LD2B 3PC2A 3FDJA 5KCZA 1ODKA 1WL8A 2P6UA 2Z56A 3EUAA 1YZUA 4P83A 3VAZA 4BLPA 3AQIA 3NYIA 1PQWA 3K0AA 4UOZA 4YUAA 4LF7B 3IB6A 3TGWA 1BNCA 1RWXA 1QG0A 2HF8A 1WF6A 2Y0DA 3DDWA 2J7KA 3QITA 2FQYA 3BAFA 4KR9A 4AKTA 4FUTA 1CYEA 1OPRA 1M1YE 1Y1LA 1QH8A 1YNOA 2B61A 1E8NA 5JXWA 2FEXA 4MLCA 5JROA 4LTMA 1IN5A 3DE3X 2P3OA 1G1MA 1EJ6A 1YD7A 5TB5A 3S7TA 3H9BA 2HWXA 1KI1A 2E4VA 2P2YA 1ULUA 1XP5A 2Q3LA 4D5EA 4DA0A 4XM1A 3REQB 4QWWA 4EG8A 2P1RA 1EP9A 2XNDA 1L4LA 5CGZA 1QZTA 1JKXA 1E7MA 3N6RA 1N3LA 4BU0A 2PIDA 2KPOA 3OJOA 4CKYA 2OSVA 2KE5A 3GFVA 5C5IA 3QLUC 4J3JA 1RRGA 2ETXA 5TX7A 3A58B 1GPMA 1NDHA 1SWVA 1I8TA 1PX2A 5CLFA 1Y6JA 3LLUA 1M66A 1T1SA 4ZI5A 1N8NA 1IDOA 1PGQA 1NASA 2CGEA 1EVZA 5TEWA 3RK0A 1HYHA 4Y30A 3K70C 3A1SA 5AOBA 2VIIA 4F4JA 3OOEA 4XPIA 5KSZA 1WUHS 3IDOA 4EI7A 3BFVA 1HX7A 4O8CA 4GI5A 5C7LO 3FF4A 1NC3A 4IO0A 4N18A 4N7BA 4IF6A 4NNPA 4TV8F 5B3JC 3TF5A 2M6RA 3PICA 2MOKA 1PTJC 3MGGA 3QX7A 5L7TA 2X15A 4NH4A 4NE7A 1P9RA 4H7HA 2A1TR 4UPEA 1PR0A 1V8ZA 4ZVRA 3FYCA 3AVYA 2PRZA 2Q3BA 4NS4A 4KK4A 4L95C 1ECJA 2B8WA 4NWIA 1YZYA 2REBA 3OTQA 1BQ3A 1VSBA 2P4SA 2AXPA 3F98A 4IJQA 4LXGA 5C1IA 1QAOA 3WGVA 4B3SB 1CVLA 5D5HA 4WCFC 1XZGA 2ERXA 3NQ41 1YJXA 3URKA 4C7JA 4OM7A 5IDVA 1FMFA 3OUTA 2JFQA 4G4GA 3FXAA 1O3YA 3JQ7B 4E4RA 4IDPA 1UMDB 1FJXA 4C30A 1K86A 2PEYA 1TYBE 1BFKA 5K99A 1IUOA 1WABA 4PZEA 1L8AA 2EYQA 3OT4A 2WF8A 5CR9A 3OG9A 221PA 3WB1A 1U04A 4M6WA 1W76A 5ELMA 4J43A 2W2KB 2P77A 1W88B 3L4JA 3JD4A 5IMSA 2MSNA 4UXIA 3WOHA 3Q7EA 2CXPA 4KIJA 4WK6A 3UT5B 3W9SA 4JXZA 4Y9UA 4IOKA 1OGJA 1ZM2A 3CZMA 4BJ1A 4HS9A 5B1DA 1FXWA 4ZEVA 2WA2A 1DEOA 2DERA 2FK7A 2OHVA 3Q8MA 2XOKD 4S1VA 1E4EA 3F3YA 2JFVA 5DPMA 3QNMA 3BIOA 3SICE 1BFUA 1E3JA 3AHJA 3EGXB 5CA0F 3PQDA 4P7FA 1RTTA 4YJFA 2WG2A 4QUDA 2RKOA 1YMUA 1R6XA 1CJBA 1WY7A 3ZTWA 5IAEA 5IEJA 2X2FA 2X5JO 2A8YA 1QIGA 5E0OA 1GPYA 3F71A 4I4CA 3K1ZA 4QFCA 3ILSA 3ZNQA 4R5HA 4AY4A 1RAIA 1QPGA 3BA1A 4LBWA 4G37A 4ZVOA 3R3JA 1CQWA 5FR2A 3WRXA 4FI3F 5JH7A 4K3VA 3IUMA 3GC6A 2XOEA 3ITNA 4M0CA 4TT3D 2CVQA 2YUTA 5JZOA 4J75A 4YT4A 1P17A 4M53A 1RFLA 3NHWA 2EFJA 1AZSC 3PYMA 2YX1A 2EF1A 3GJ5A 1BDHA 1Z2OX 4XVQA 4DR7B 1PWHA 2XYRA 3H8VA 5JISA 1GFWA 2HBRA 3T1OA 2X8LA 2XGSA 3FB1A 4HP8A 1YUNA 2GPBA 4KXLA 3MJTA 5KVQA 5CITA 3IS3A 4D4KA 5LQKA 3CPJB 1Y0BA 1JIJA 1JPVA 1JECA 2NVOA 4I1SA 1ZRMA 1GPBA 1QHIA 2PZBA 1HE5A 2DC1A 5ALOA 4A23A 4YEDA 2GR9A 4B6FA 4GFDA 1H9AA 2GN8A 2VPTA 5HEKA 2OPHA 1W8DA 2VQDA 3T5DA 5FLKA 3TZQA 3BZWA 4G65A 4PNZA 4EF5A 1KEKA 4ED9A 1JQDA 1C8BA 1ISFA 4REQA 1NXXA 5F21A 5LQNA 3UJ3X 1JDPA 4OAQA 4F1KA 4F3KA 3P7MA 3CVXA 1V4VA 2FEKA 2GSWA 4O5AA 3SFZA 4OHKA 1ISMA 4O63O 2C0PA 1R8XA 1EINA 1EFLA 3EVFA 4OJKA 3VOSA 1C2TA 2ZCVA 4UTOA 3OUUA 1DC7A 1RM4A 1VSVA 4C5BA 3QLVC 1NBWB 1XALA 1J99A 2G0TA 4WV3A 1TVEA 2DHRA 3LZCA 5MN5A 1NZFA 4B3BA 3PGKA 3W04A 4F9FA 1DEAA 4DCPA 4TKVA 4IHJB 2AD5A 4KXYA 4OIFA 1TB4A 3EAQA 1NJ5A 4WZBB 5AVWA 4UAUA 1NRWA 1X14A 5CW1A 1L4KA 2W4MA 3P9KA 4M21A 4OXYA 3UO8B 4HN9A 4GLBA 3SSOA 4M9UA 4W9NA 2O20A 4I50F 5DIFA 4FHGA 1PEAA 1UDRA 1NSTA 2QMHA 4JGIA 1IBCA 3IUBA 5P21A 4EF6A 3EYAA 4OU4A 1Q83A 1ZNZA 3A3OA 3I6MA 2FWRA 4YT2A 1PR3A 3U62A 4OB6A 2G09A 4KVFA 1I3LA 4Q24A 2JHCA 3HV2A 5EUCA 1EUDB 2FH5B 2XDAA 1SXJB 2O2JA 2PMCA 1KOLA 4OEHA 4QTUB 1PFUA 5LP6B 4D9KA 1F8UA 3O4JA 1T15A 5DYTA 4LSGA 5ARDA 1PTJA 3THYB 3WBBA 2ZREA 2YICA 5LZ5A 1I3CA 4ZVMA 4DSZA 1I10A 1KO7A 1ZHOA 5HUHA 1YQXA 2OCPA 3FYUA 3FOZA 4Z1MD 2CLOB 3H05A 4BQEA 3O9VA 2CXSA 1H8ED 1Z83A 4P32A 2G06A 2BHLA 3DHNA 4IDEA 4KQMA 4AN1A 4YUZA 3H5VA 1HEUA 4Z9YA 2BRUC 2ECQA 4PG8A 5HUJA 2IYLD 1CRPA 4XWWA 2ONZA 1RKUA 4HDNB 5D3QA 3S70A 1HOTA 1XDGA 4EYSA 2HO4A 1D2MA 4CL3A 5CDGA 4RVHA 2XMQA 2VJLA 5FA5A 4EA7A 5HQ3B 2ZROA 1XL0A 2JAXA 3RS4A 4O29A 4B45A 1U80A 1ZIXA 4IQ0A 4NDAA 4NXMB 4BY9E 4JUBA 2OHOA 3GJ6A 5JCOA 1TM5E 1YRAA 3N2EA 3OQHA 2SECE 2EJWA 3BZUA 4HX9A 4IRUB 4X6YA 3HUFA 2VT6A 3SZGA 4JY7A 3BDIA 5CXQA 2HUNA 2PGJA 3AESB 2A1UA 4Q34A 4D9GA 1PL0A 1THGA 5JYDA 2YWEA 5CLLA 3T1TA 3P0RA 1T10A 4H3HB 1E0JA 3W6OA 4AU1A 4Y67A 1M10A 4A82A 4F8JA 2OQRA 2Q49A 4UE2A 1LTHR 4D43A 4WZ6A 2PUCA 3AF2A 3WLNA 5FV4A 3W6ZA 4M9ZA 3JR3A 1H5NA 1L7NA 3NH6A 4LDJA 3H0CA 5JS2A 2NZXA 4ND1A 5BURA 1GPKA 1MAWA 1CTQA 3FFWA 4QREA 4X62B 1GLGA 3RSLA 1IEVA 1JHAA 4Q7EA 4M9RA 3MWKA 1TT5B 3AHCA 2GASA 4KAJA 3JYOA 3VJKA 2FLVA 4R31A 2VXYA 1OBOA 4D02A 1EGVB 1GKIA 2I6UA 2JJ8A 4RANA 2P6PA 3DA8A 3RRYA 3PQ8A 3ZEAA 3AXTA 4WY2A 5JASA 4FW9A 1QQ7A 2XCTB 4JJKA 1HNXB 2MR5A 1JHOA 3JWGA 4N9WA 4E2ZA 3K0FB 1IN7A 3NLLA 1LH0A 1XZDA 5IDYA 5CVVA 2VUSA 4UAJA 4WUTA 2JIMA 4BNHA 4CIYA 3HNPA 2NXCA 1YQTA 1PFKA 2PAAA 2JGKA 4PCUA 1GKLA 1L0BA 5CMLA 3VDQA 1PFGA 1MABB 2SCUA 4ZTUB 1E63A 3EDCA 3ER6A 2ID9A 1STOA 3MJDA 4HDCA 5HYVA 1KNQA 1JAYA 1XGKA 1XNGA 2IFTA 3I9V1 1KIFA 3MWEA 1XZCA 2XY4A 1O6BA 1PZHA 3C5CA 3A28A 3SQXA 2X5KO 2AEJA 5EOVA 3IEKA 5EWMA 2H4WA 1FYDA 1JH8A 1RHKA 3USES 4PG5A 3WV4A 4AG5A 1UBHS 1BEZA 1R66A 5LXTA 1R4MB 2OBMA 5IT4A 1YOBA 4J03A 3GA7A 4F8EA 4R16A 4CI9A 3X43A 4B73A 1FXUA 4QUBA 5GM2A 4DIUA 3EZYA 4ZOLA 2UUCB 1V96A 1AHIA 3P0HA 1Y42X 4QNNA 2ZYTX 4NG5A 1CY2A 2O8EB 4QHYA 1UT5A 2JBWA 3HL4A 1J56A 4GDFA 1ULBA 2PU7A 3NKLA 3HYCA 3MLAA 4I5EA 4Y2GA 3VSBA 1OTHA 4C4RA 1XMIA 5EERA 2AG0A 4H35A 4YAOA 4Q01A 4IQ8A 5DBEX 4EGQA 3A3PA 1Z6XA 4MS4A 4DDMA 4L4UA 4R71A 2RJNA 3VR6D 1GL3A 2Y9MB 1SOUA 4GOLD 2BKXA 5LJIA 1K5PA 1NXTA 2P75A 1LKZA 4RZQA 4A8JC 5I47A 3ZNNA 3AERB 5GJVC 5CB8A 3LBHA 4HFMA 3FVQA 3IP6A 4R8RA 4IS3A 2QM7A 2LCIA 3N5CA 3OJEA 5CVUA 2ZWAA 5ED0A 4YCMA 3R3SA 1W9HA 1EZ1A 1O77A 1WA5A 1XZFA 4INJA 3WXBA 5BW4A 3VPCA 1ZGAA 2EFEB 2IY7A 3IQXA 3NEJA 4UM8B 4Y0VA 4F04A 1TCVA 1YZVA 3OZ7A 3PQCA 4BX3A 2YZNA 1RPAA 1UWVA 3ANXA 1FUKA 4Y1FA 5DI3A 3RS5A 1N2CA 3VH4A 5BV8A 3DO6A 4DPKA 4YMWA 1WZEA 4QG7A 2YQZA 2OOKA 3E9DA 1AVTA 1QGAA 1RWQA 3FB4A 3Q6NA 3QU9A 2OHIA 2ZSHA 5KOHB 4Z9FA 4MWDA 5F2KA 2XUHA 4BX2A 2QUBA 2ZDQA 3PQEA 4C3ZA 2IS2A 1B0PA 3G0DA 3V3TA 2YDXA 1RHRA 1YR2A 4LYJA 3NHAA 5GWXA 5JQGA 2E87A 3B6EA 1ZOOA 1DIHA 3SN6A 3C6YA 3SJCA 3TNLA 1AQLA 1PR1A 2OYSA 4IRXA 4P35A 3S2SA 4HJXA 2ZSJA 3VZSA 4XPZA 3R74A 2BCEA 5CP8A 1SXHA 3N75A 1J23A 4WCFB 3VKUA 3F6YA 5GONA 3AFMA 5DP2A 3FYDA 1G5PA 2WJ3A 2O23A 3ZWKA 1GAXA 2GEUA 5B3AA 1L5OA 1VG0B 2LRHA 4RD0A 4GEGA 3ETGA 3RARA 3G0IA 4D97A 4JI7B 1WSDA 1X13A 3X2EA 1MJFA 3B6ZA 5BR8B 3HE3A 2OG2A 4DXDA 5FYQA 5ITZA 1DTWB 4Y6QA 2DFKB 5LZ2A 4PXSA 4I6JA 2DOKA 3AIOA 3GRKA 5EMJA 4DA6A 5HZKA 1GUBA 1MRSA 5CX4A 1S4MA 2AN1A 1QBKC 2HDWA 2IEAA 3ANYB 1XVUA 3BZBA 2IPOA 5JSFA 4Y2XA 1I3MA 5IAJA 3C3WA 1YMQA 2R96A 2ZBVA 2DRIA 4Q1BA 4RPJA 1C14A 3F1LA 2AFIB 3DTVA 3H9CA 4LC1A 1EUQA 1WMAA 1NA5A <