3R3YA

Crystal structure of the fluoroacetate dehalogenase rpa1163 - his280asn/fluoroacetate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
297
structure length
296
Chain Sequence
LADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIAQSAATPLDVWRKWASDVQGAPIESGNFLPEEAPDQTAEALVRFFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping the reaction coordinates of enzymatic defluorination.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Hydrolase
molecule keywords Fluoroacetate dehalogenase
total genus 114
structure length 296
sequence length 297
chains with identical sequence B
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r3yA00
5EFZA 2Z8ZA 1L7AA 2V98A 3QH4A 1NX9A 4ROTA 5EIHA 3FNBA 1VZ3A 5KBYA 2HADA 3I6YA 3V1KA 4ZRDA 2ZYHA 5HFAA 2JGEA 4ZXFA 1TCAA 2ORYA 3LS2A 3D4LA 1CUGA 3QPDA 1JMKC 5D7BA 3G0DA 1UKAA 1LPPA 2HRRA 3UUEA 4BB0A 1CFJA 1H23A 5EHQA 1ODCA 4GWLA 1LNSA 2JEZA 2VF2A 1LBSA 3DOIA 2XQFA 3R40A 1GZ7A 3G9XA 5DLPA 5JZSA 1N1MA 1E3QA 4MQMA 4DNQA 1EB8A 5D3KA 4FBLA 3G0BA 3FCXA 1CUCA 1J2EA 2HDWA 1XZEA 4G1FA 4F21A 2QTBA 4FFWA 4N8SA 3ILSA 4G8BA 4JYPA 2VJCA 5AKJA 4LIPD 2WFLA 1TCCA 2OQIA 2WUFA 2QUAA 1WCYA 4I19A 1BU8A 1M33A 1ZI6A 1UOPA 3EQ8A 1Y7IA 2ES4A 1CEXA 4CCYA 3ZWQA 3WQHA 2WIFA 3QMVA 1C7JA 2RI6A 4H18A 1OXMA 4PW0A 4OUKX 1MNQA 1N5RA 2XUDA 2V97A 1J1IA 3F98A 1MO2A 3ZPXA 4TVKA 3F67A 4G4IA 2ACEA 3M83A 3O4GA 2VT7A 5SYMA 2WHQA 2HU7A 4FOLA 3VVLA 3FBWA 3JYHA 1Q84A 3WZLA 3BXPA 1LBTA 1QOZA 5ALNA 4CI9A 1Y37A 2IITA 4G8CA 2H9YA 3PFCA 1F0NA 3AILA 2X76A 3RM3A 3VJMA 2RHWA 3QZUA 5FLKA 2I78A 4QLAA 4W1RA 1W75A 2DHDA 4UFNA 3B3QA 1R1DA 4Q82A 5AH0A 3C70A 2VJAA 4JYMA 1ZGCA 2J4FA 2VAVA 3QPCA 4GI1A 2HA3A 1CUHA 4HAIA 2PPLA 4UUQA 1KU6A 3O4IA 4H35A 2K2QB 3IB3A 1MJ5A 2WHPB 3ZLTA 2G4LA 3GZJA 3DLTA 5C7YA 1EA5A 4J0CA 2ZYIA 3OURA 5ALWA 5AKEA 3KWJA 3IUMA 1QIFA 4ETWA 2BFNA 5AJHA 2OG1A 1DX6A 2H7CA 4ZI5A 3DCNA 2XQIA 4EY8A 2HFJA 4QWMA 1TIBA 5CT5A 4L72A 3HZOA 1QO9A 2QJRA 3VISA 5CW2A 3KXPA 3O0DA 2HM7A 4QE3A 4EHBA 4INZA 3O4JA 3DD5A 5JADA 1BE0A 3TRDA 3ICVA 2FJ0A 4P93A 1SOMA 5DWDA 3WWCA 4LXIA 3A2LA 3AINA 4B85A 3I2IA 4NZZA 4G9EA 4KACA 5FPPA 4BATA 4XIIA 4E46A 4MWSA 2PKYX 3AZOA 4AZ3A 5AHXA 2WJ6A 2AJ8A 3H19A 3HSSA 1BRTA 4I3FA 4MXDA 5ESRA 1BROA 4B81A 4UHBA 3WKAA 1QFMA 5FXMA 3ZLUA 4FNGA 2O2GA 3H2JA 4N8DA 3HABA 3FWHA 4U2EA 1ZGBA 2OGTA 5FV4A 4Y2SA 2VA9A 2DR0A 1XZMA 2CBGA 2HA7A 1LZLA 4H7IA 3IUNA 3WMRA 5AK3A 5ALUA 3EQ9A 2WIKA 2RONA 3PF9A 1W52X 5FUMA 3V1MA 3WYDA 1WB4A 4PSCA 1VXOA 5AI5A 2DQZA 1R4ZA 2OCLA 4AO6A 2HA2A 1CR6A 3C87A 1NU8A 1PV1A 4WDQA 5F4ZA 4A23A 2VQ6A 1Y7HA 1CUVA 4H77A 3K6KA 1XZBA 3AZPA 3NUZA 4DM7A 1GPNA 4H7HA 5JAPA 2WG2A 1CPYA 4OB6A 4D9JA 1UFOA 3I2HA 5EIAA 3M82A 2X8BA 4ITVA 1BCRA 3WL7A 3IVMA 3GA7A 3WWOA 1IVYA 3FYTA 4MEBA 2YYSA 4X7BA 4DYHA 2B9VA 4XVCA 3OOSA 2ROQA 4BYMA 3WKCA 3IUQA 5JATA 2XI4A 1BEZA 5AKLA 1SC9A 2I3ZA 1A8QA 2QXTA 4X6YA 2XUKA 1XZLA 4EY7A 1R50A 4CG1A 2Y6VA 1EI9A 1HKHA 1CUDA 1T2NA 2WJ4A 5ALHA 3W9UA 5CH8A 3JW8A 4EZIA 2Y2UA 3QVMA 2PL5A 3N0TA 1XLWA 5LZ7A 1KEZA 4JNCA 3BE8A 3D5EA 4B0OA 4BC0A 1VE7A 1E8DA 3F8SA 5H3HA 4M0EA 1CUEA 2XUHA 4W9RA 1YS2X 3MVEA 5FP0A 4MWTA 4BAZA 3RKSA 2GYVA 2AJDA 4YX9A 2JIDA 5DTIA 2GBCA 2XLBA 5DYYA 3I6MA 2FJPA 4K6HA 4BC1A 4CIAA 1JKMA 2HU5A 4UFPA 1CUIA 2QRUA 4DSAA 2CB9A 2HA6A 3L1IA 4LXHA 4J7AA 5KWIA 2B61A 1NU6A 2DCMA 5HFNA 4OSEA 4BVLA 4C87A 5IVIA 3IUJA 4C4YA 4XX1A 4J3JA 3GFFA 2XB6A 3V1LA 3VDXA 4WY8A 1IUPA 1ISPA 2OCIA 2XUGA 4FLMA 1XRPA 2ZSIA 3NOXA 4DMHA 2QKYA 5AKKA 4Q3LA 4IH9A 2HA4A 5HCUA 4U2CA 2VJBA 4AZ0A 1XLUA 1GXSA 4OYYA 2D5LA 1U2EA 3H17A 4QNNA 4BAUA 1YASA 3STWA 4J0KA 5DNWA 2OAGA 3DNMA 4P92A 3WLAA 5AKGA 3WKBA 4BAGA 3C45A 2CKMA 1CLEA 5LZ5A 1MAAA 5JANA 2DSNA 3D7RA 4BZZA 1ZD2P 3VVMA 1YAHA 1AQLA 1CUYA 3HJUA 1EHYA 2RGUA 5ALOA 4B9AA 5JD4A 3KDAA 4FLFA 1MU0A 5D3ZA 1MN6A 4GBGA 2WHPA 5T4FA 5AI6A 2QMQA 2GBFA 4X6UA 1L7RA 1QZ3A 4AN0A 3O95A 2Y6UA 1R3DA 1DQYA 3I6ZA 4QZVA 1CIJA 3BIWA 1G42A 1QTIA 3C8HA 4BP8A 4C6HA 2Y2VA 1FFDA 2WIGA 3DS8A 3FOBA 1YB6A 5EI5A 3O9MA 2PX6A 3AJAA 5JD6A 1DU4A 4BP9A 4QDOA 5BWBA 3G02A 1UK7A 5LIPA 4BVKA 3DKRA 2C58A 4KRYA 4OU4A 2DQYA 1D07A 5AKYA 1JFRA 4KE7A 3KSRA 4BE9A 1VLQA 3R3ZA 4DMCA 4W1SA 3LP5A 3A70A 4IO0A 1H2XA 4EUSA 4B6GA 5CH5A 3OG9A 4X3CA 1WPXA 5JZ9A 1MAHA 5EGNA 2D0DA 3D2BA 3LIIA 4X94A 3G9TA 5HK8A 1QIJA 1T4MA 2UZ0A 3OTQA 4W63A 5ISMA 1FJ2A 1E8NA 1W1IA 3WIOA 1U8EA 1XQXA 4KE9A 1AGYA 2WU4A 4BE4A 5EIEA 2ZJFA 3D2AA 3PICA 3SC2A 4F0JA 1XZDA 2Z3WA 3HXKA 4B83A 4UHCA 1UWCA 1CUSA 1MNAA 4K5QA 1LPBB 2I3DA 4KE8A 3M3DA 1LPAB 2DHCA 4DTCA 3BJRA 5HF6A 4WFJA 3WK9A 3BJMA 3W9BA 4DSZA 5HK9A 1JU3A 4DGQA 4HTAA 1QIHA 5ALFA 5AP9A 5CXUA 1XRQA 4A5SA 2OXEA 5CTAA 3WKEA 4S0XA 4ZV7A 5HKAA 5AIAA 1Q0RA 1BS9A 2GBIA 1ZIYA 2HU8A 2WTMA 2C5GA 5ALKA 5A7HA 2QUBA 5ALXA 4B7ZA 1XFDA 5C8XA 5A7GA 5JYCA 1P0PA 4EY6A 5CBKA 5E2IA 1WHSA 3OPMA 1VKHA 2PSFA 1IUNA 1HLGA 5ALEA 4CFSA 1UK8A 3ESCA 2G63A 4L3WA 4XWGA 1MX9A 1R9NA 4W1PA 5BWCA 4U2FA 3OC0A 4JEIA 1VE6A 3MUOA 2WIDA 4X90A 4Y2VA 3STVA 1N5MA 4PV7A 1P0IA 2PSDA 3FYUC 3U0VA 5IVDA 1SCIA 1VJ5A 3CN7A 4UPDA 1TQHA 1GQRA 1GT6A 5A6VA 2G5TA 3WA6A 3WZMA 1QIIA 1LGYA 3H1BA 2PBLA 4WFKA 1THGA 1USWA 1YA4A 5LZ2A 3C8DA 5JIBA 4E15A 1YSCA 2W6CX 4G4GA 2V9ZA 2XUIA 2WLSA 4C01A 2C7BA 2R11A 1EB9A 4H7DA 1TKRA 5SYNA 1K4YA 1XZHA 2ONCA 3C6YA 1DT5A 1BCSA 4EY5A 1FFAA 2H7YA 1K6EA 1AURA 3W06A 2YXPX 3NWOA 5HQ3B 5FKJA 4QLOA 4HXFB 4UHEA 3IULA 5AKZA 4TPKA 2XT0A 1XZKA 5E4JA 2QXUA 3R3YA 2WM2A 2WG1A 3KOOA 2O7RA 4Q34A 4IHAA 3L1JA 3PF8A 4RE5A 5CURA 3D59A 2OLEA 4QDXA 3E0XA 2Z5GA 2PSEA 3T52A 4WJLA 2VEOA 3MUNA 3K2IA 1W76A 1L7QA 2XUJA 4DNPA 1ZIXA 2AJLI 1SFRA 3WK4A 5BV7A 4PSUA 3ZV7A 1XQWA 3DQZA 1RYYA 3AUKA 5DTJA 5EHNA 4BCCA 3FYUB 5CH3A 3IDAA 1QONA 3W04A 2EEPA 3G0CA 2JGFA 4RGYA 4DIUA 4J0DA 5K3DA 4CCWA 1LZKA 4MJ3A 2NW6A 3U1TA 1F6WA 4H0CA 1XZJA 3EBLA 5AI8A 5I8PA 5JZBA 1O6GA 2VTVA 2WILA 1JI3A 2HIHA 4AMYA 1H2YA 3G0IA 2BUCA 4HRYA 1K8QA 2OGZA 3AIOA 3WKDA 1DWQA 3I2JA 1QE3A 3D3NA 2HA0A 4V2IA 4HXEB 1IZ7A 3QBJA 2VSQA 4FTWA 7YASA 3R3WA 2YASA 1DWPA 4RE6A 1CVLA 1ACLA 2BUBA 2WJ3A 4LXGA 2G5PA 3G0GA 2HHAA 4HZGA 4J0IA 2XQGA 4HXGA 3T4UA 1JJFA 2VAXA 2EDCA 5JARA 4P9NA 2CZQA 3JWEA 1YCDA 2HA5A 3BWXA 3V48A 1QLWA 3HYSA 2WHRA 1ODSA 2XMSA 2ZVDA 1B6GA 1EINA 2DHEA 4UBMA 4ARAA 1XZGA 4UBOA 2ACKA 1EK1A 1EH5A 4OYLA 4YK7A 1UZAA 4AO7A 2BUAA 4M0MA 1CRLA 1QIMA 3HRHA 4AX4A 2OCGA 3H18A 1ZJ4A 5K5EA 1A8UA 1ZD5A 4KRXA 4N8EA 5AK4A 4X85A 5AM2A 2QZPA 1LPNA 4MYSA 4C4XA 4KAFA 4KAAA 4X91A 4H7KA 3WJ1A 3C6ZA 2PU7A 3FLAA 1BEEA 4HS9A 4BTVA 2WQZA 1EVQA 4OD0A 3FLEA 3WYNA 1K63A 4U2DA 1ZI9A 1C4XA 1ACJA 3DEAA 3DL7A 2IX9A 5AOAA 1LPOA 4KAJA 5LLSA 3E3AA 4LYDA 2ZSHA 4M0FA 3H0CA 1QJ4A 2ZJ6A 3C43A 4GECA 3IURA 3DOHA 3BL8A 3GBSA 4O08A 1TCBA 5CT4A 3A2NA 4G9GA 4AQDA 2GZRA 4FKBA 3LIPA 2J4CA 4P08A 1LLFA 3AFIA 3FVRA 4LHEA 4ARBA 4JUIA 4PF1A 1XZIA 3I1IA 4ZGBA 5T4HA 1ZJ5A 2J3DA 4X92A 1IZ8A 2WFMA 3RARA 2GBGA 3S8YA 1ZD3A 4YPVA 2AJCA 4K6KA 1UKBA 4L0CA 1U4NA 1AC5A 4UBKA 1GKKA 4AO8A 1J06A 5ALVA 1DTEA 4Y2YA 4Y2XA 3FCYA 5ALYA 2XUQA 5I7UA 3WA7A 1FFCA 5IKXA 1OILA 1CUZA 4FFVA 2WUEA 5CXXA 1A8SA 4EY4A 3FYUA 4LKOA 3I2GA 5ALJA 1G4HA 1CQZA 5K3FB 1CV2A 4DMFA 1P0QA 1YR2A 1JT2A 4YASA 5LYYA 5ALDA 3HC7A 1A7UA 4QDUA 4BDTA 3PDCA 1DT3A 5ALGA 5C8VA 3H2KA 3DYVA 1E89A 1FFEA 4Q05A 3WWPA 3WL6A 4E11A 2V96A 1CUBA 2XMBA 3DDUA 1DINA 4X6XA 1DQZA 4KJXA 2XQJA 4B0PA 4NMWA 4CG3A 3GUUA 3R3UA 5AOCA 1XRNA 5DJ5A 4N5IX 2C0QA 3BDIA 3AIKA 1DWOA 1ZOIA 3QMWA 3CCCA 1Q0ZA 3E4DA 2JGJA 4NS4A 1H2WA 1XZFA 3AIMA 5HZGA 3F96A 5E4TA 1XRRA 3UMJA 5K3BA 1GGVA 1OCEA 5LP1A 4GDMA 3QYJA 1TAHA 2WTNA 1AKNA 2JGMA 5HF5A 3R41A 2IIVA 2FUKA 2YH2A 2XMGA 3O9VA 5A7FA 1YS1X 2GZSA 2XMQA 4PQEA 5CT6A 5JAHA 5A71A 3SX4A 2CUTA 4KR0A 2X5XA 4UHDA 1FFBA 2PVSA 1G5FA 4QEKA 3D0KA 4B82A 5FOQA 1F0PA 3QMMA 4UHFA 3X3HA 2I03A 1ODTC 5JAOA 4PSDA 3L1HA 3ESBA 3Q8WA 1SCKA 4Y9SA 2H7XA 3P2MA 1XRLA 5AK5A 1PFQA 4UHHA 2XMZA 4AN1A 2B4KA 4CG2A 3STTA 3M81A 3SWWA 3PUHA 5A2GA 1QFSA 3NGMA 1E5TA 3WK8A 4FWBA 1EDEA 2XE4A 2RIPA 2ZYSA 4BRSA 2QOEA 2RAUA 4X93A 4U2GA 2ZYRA 3E1GA 4DNFA 3WK6A 3IA2A 1JU4A 5AM0A 1WHTA 2AXEA 4FNMA 1DX4A 4GHWA 4X00A 1HL7A 5AM1A 5AM3A 2AJBA 5ALQA 4AB1A 2LIPA 2WSLA 3G9UA 4J0JA 2JEYA 5EHXA 5CT9A 4WFIA 5LZ9A 1VZ2A 2PUJA 4FBMA 4B9EA 2GYUA 4I4CA 4WY5A 1S8OA 4IH1A 5E4YA 3S2ZA 3GROA 3ESDA 4Y2PA 4MEAA 2PU5A 2QR5A 2JBWA 3HLKA 2H1IA 5AKIA 3KD2A 4GEGA 3VXKA 1QTRA 3STUA 3A6ZA 4DLNA 4MYDA 1WM1A 3ZLVA 3TGLA 4GW3A 4Y2RA 1JMYA 5AICA 1EVEA 1VA4A 5ALRA 1Z68A 4WCVA 1CUWA 4JH0A 1B41A 1UOQA 1E8MA 3I2FA 5K3AA 2C4HA 2BKLA 4Y2UA 2O7VA 5ALIA 3QPAA 4ZREA 5IVKA 4QDTA 4J0GA 1EXWA 2OGSA 5LKAA 1AMNA 3EIOA 3LLCA 3HI4A 3W2TA 3QITA 2BCEA 2HFKA 1ORVA 3R3VA 3CCBA 4BCDA 2EDAA 2WIJA 1EK2A 3EQ7A 2BJHA 3N2ZB 2O2HA 4HVTA 4BVJA 4F60A 3I2KA 1CUFA 4FDMA 1AUOA 2BGNA 3WK5A 3TEJA 1A88A 2XUOA 5FRDA 1IUOA 3STYA 2VATA 1ETHA 3WL8A 5HF8A 3CXUA 1W6RA 1W4LA 2WFLB 3R0VA 4Y2QA 5AK6A 3V1NA 1TK3A 4DMKA 1ZD4A 4Y7DA 4AXBA 3C6BA 2WG0A 3DYIA 2XLCA 4OCZA 1LPSA 1XROA 2BGRA 1QIDA 5AO9A 4WDRA 3ANTA 4BBZA 4X97A 2CEKA 2RHTA 3FLBA 4LYEA 5HKBA 3I28A 3I1YA 5DYWA 2VJDA 5A62A 4Y2JA 4BRZA 4N5HX 2B20A 2XDWA 3OM8A 5J3JA 1JJIA 1WPRA 3DL4A 4OU5A 4IQ4A 3BIXA 3ESAA 4Y2TA 1UXOA 3H1AA 4NVRA 5JAUA 2Z3ZA 5ALMA 1QIGA 2HRQA 4EB0A 4UBIA 3H04A 2ZJ7A 4H7FA 2JGKA 1X2EA 6YASA 1QGED 1H2ZA 4G5XA 5AM5A 1HQDA 4QWWA 3BF8A 5T4BA 5K3FA 2PM8A 4K2AA 1R88A 1SCQA 5LZ8A 3H2IA 3BDVA 3H2GA 5ALLA 4AMZA 1AZWA 2QJWA 4FMPA 5JALA 1F8UA 5JD5A 2QS9A 3C5WP 1I6WA 2OPHA 3D2CA 3Q0TA 5IH7A 3DJYA 1UOOA 1RWQA 5AIBA 2WFZA 1XQVA 3PI6A 4J0HA 5C8ZA 2XMDA 1QIKA 1XLVA 2XMRA 3PUIA 4K6GA 4U2BA 2R8BA 3YASA 1ZICA 2XUAA 5D6OA 3IIIA 4C88A 5C81A 3O4HA 5BOVA 4CCYB 1CUAA 1RP1A 4FHZA 5ALPA 3WI7A 1YB7A 4FLEA 4RPCA 1IMJA 5AI4A 3VJKA 3WIBA 4GXNA 3FVTA 4EA6A 3R3XA 1ZI8A 3C5VA 2P8SA 1GPKA 4Q3OA 1HDEA 1UK6A 2J3QA 4A16A 1QO7A 1ORWA 4OB8A 2XUFA 5AI0A 4B84A 3IBTA 3HACA 4KYVA 3CN9A 1CQWA 1XKTA 1UKCA 4G4JA 5AM4A 3KWFA 3TJMA 5HF9A 1VXRA 3HEAA 3UUFA 5HQ3A 4G8DA 4IH4A 2JGIA 1U65A 4RNCA 2BAGA 2XQKA 5AOBA 1WOMA 3V9AA 1E66A 4GLBA 2Y1KA 3A2MA 3RLIA 1BN6A 3GELA 4Q3KA 1JJBA 3ED1A 3K9BA 5YASA 4XJVA 1CUUA 1KU0A 2XUPA 2XMCA 5LZ4A 3PE6A 1EX9A 3DKKA 1XRMA 4UFOA 3FAKA 3F9CA 1XZAA 1MTZA 3MGAA 1Q83A 1YA8A 1WB5A 2C5FA 1VA5A 4TGLA 1XZCA 4KEAA 4Q1VA 5LKRA 1CUJA 3SK0A 3F97A 4PO3X 1XKLA 1X2BA 4X71A 1TRHA 3G7NA 1VOTA 4X95A 2O2IA 4BDSA 4QDZA 3B5EA 1P0MA 1G66A 1WB6A 2W22A 4C89A 4UBLA 3WWEA 2VT6A 1PJAA 4H7JA 1CUXA 1H22A 4L9AA 2OAEA 1QIEA 2PSHA 3EF3A 4PNZA 3WK7A 1XQYA 2PSJA 4W1QA 1GQSA 1MPXA 4BTLA 3FSGD 1O6FA 3QM1A 1R9MA 5DNVA 1GKLA 1UK9A 5ALTA 3AZQA 4H7EA 4OPMA 3VKFA 3WJ2A 4CIBA 2DFPA 4BCBA 2QM0A 3ANSA 3FSGA 2OCKA 1GPLA 3RK4A 5DNUA 2JGLA 3ZI7A 4BZWA 3G8YA 1HBJA 1MX1A 4UBNA 1YAJA 4ZV9A 2PUHA 4KE6A 4EBBA 3G9ZA 1AX9A 1FSSA 3VJLA 1UT6A 2Q0XA 1C7IA 4E14A 2OQVA 2JF0A 1MX5A 5AKXA 5FPQA 1EDDA 3ICWA 5K3CA 1HPLA 2WKWA 1EDBA 5ALZA 2CMFA 4DNOA 5FDFA 5EHZA 2WUGA 2ECFA 4HRXA 3PFBA 4B80A 1MT3A 3STXA 3BF7A 1K5PA 5I9IA 2WUDA 5AI9A 4QA9A 5JASA 5CMLA 5DYTA 1LPMA 3WL5A 2E3JA 1N8SA 4J03A 2GYWA 5ALSA 4UBJA 4OB7A 4Z49A 3B12A 4ZWNA 3H2HA 5IVHA 5KREA 5CT8A 2QT9A 2FX5A 1BN7A 3LCRA 3C6XA 5AKHA 5CRIA 2HL6A 3W05A 1J07A 2Z8XA 2CJPA 5K3EA 4MQLA 3WWDA 1THTA 4C4ZA 2WU3A 5T4EA 4F5ZA 2C0PA 5KWJA 1X70A 2QVBA
chains in the Genus database with same CATH superfamily
4XE5A 2QTVA 4MJ7A 5J2UB 1X1AA 3QE0A 4P5PA 3V2IA 4EL0A 1SRRA 2HSJA 1L7AA 3KD3A 1ZBDA 4TWZA 1HSZA 4NWIA 1BX3A 1GPYA 4W4TA 2WWWA 3RSFA 4DXDA 5FO0A 1VG1A 1U3DA 4J91A 2HADA 5ELXA 1QX4A 3I6YA 1L5VA 4QPCA 3Q3IA 4ZRDA 3V1KA 1DS6A 3K31A 3QKSB 3PVCA 4EW6A 4YA6A 1R4MA 4KVAA 1Z5WA 1W2WB 2ORYA 4LMAA 3REQA 5AVWA 2HDHA 3LS2A 2IX3A 3D4LA 2QLNA 1QBGA 2J45A 1UJMA 2QM3A 3OSUA 4NOJA 5IHPA 4R54A 2VDMB 4B3GA 4KVZA 2MINA 3NWJA 2R62A 4C05A 4ND7A 2WI8A 3UUEA 2W6JD 4BB0A 5GZ3A 1ZFNA 4UDOA 2YRWA 4EDFA 3BQ9A 4GVPA 3TQHA 5LDDC 4TM8A 1WXQA 5ECGC 2X8AA 1W0CA 3C3YA 4KLZA 1PT5A 4CG0A 4FYMA 1LNSA 2JEZA 5IJ9B 2OHGA 4TKVB 3LQYA 3N2LA 3ZWPA 3DZHA 4Q24A 3K5IA 2AZ4A 4ZHSA 4AL4A 4R5HA 4E13A 5G2OA 3HFJA 5DHSA 1RCFA 3RBXA 5L3QB 2B6HA 1Q0PA 4ES6A 4F3YA 2RGNC 2HK8A 3TX6A 1UBUS 4FEAA 4LWZA 5CUQA 3G9XA 3EEQA 5KNDA 2H16A 2V7BA 4DLUA 2K7ZA 2ATIA 1J5XA 3EA0A 4WW0A 5HUHA 1XZQA 4DNQA 1R74A 2GI4A 5KMGB 1U7TA 3O8BA 3GRUA 3URKA 5IC5A 1K7YA 1SCAA 2W8BA 4EJSA 3OPYB 3LX4A 3FUUA 2J9GA 5HQJA 4E7PA 1RC0A 3DMGA 3ZK9A 1XU4A 3QEMA 1ZD1A 4EY3A 5LP6F 1R00A 5G0SA 3WDKA 1L7EA 3S7TA 1RQXA 5F7OA 5BN5B 1RRPA 1AUQA 1QQ7A 4JLSA 1QHYA 1RI5A 1KFJB 4UM5A 1LH0A 3V7UA 3T35A 4RTMA 1AXRA 2WYUA 4TQUS 3EVGA 4F21A 2QTBA 3BGIA 4L5BA 2FDRA 3HO6A 5EWJB 3HB4X 2B7LA 4JYPA 1II0A 3P27A 4KQXA 1GPH1 4PLFA 4BNDA 2NMVA 4BJ3A 2KX7A 5AKJA 1OLUB 4LIPD 2WFLA 2JI9A 1L5NA 4OAQA 3O8CA 1U2DA 4OHPA 2ERCA 1P19A 3D7MA 4I9NA 4YPOA 4MI1A 4F2DA 4AY2A 5DBFA 4QEDA 1UT5A 4RVCA 2ZB8A 3PKZA 1KMHA 1JHYA 5LNK1 5JU6A 3EXG1 5F9MA 2ALJA 3A3NA 2FSSA 3AKDA 2XCSB 3JQRA 2HT1A 1SUPA 3EY9A 2ES4A 3IKMB 2HSGA 4DFDA 4CCYA 3ME5A 3VC2A 1WW8A 2FWJA 2QG6A 5FPHA 1CZHA 1HY3A 3H1EA 2J0SA 2WIFA 1P9RA 3L4KA 4J7UA 3AEQB 2C4WA 5INTA 4ZT2A 1PTJA 4YI5A 1N2GA 1DIRA 4D9CA 3OZFA 2AYXA 4CM6A 1Q1EA 4G5OA 4JMLA 4Z51A 2QRVA 2ENWA 1O9GA 4I2VA 5AJVB 1CFZA 1PEDA 3IMFA 4MKXA 4EA7A 4TRNA 2IHZA 2YWJA 1NTRA 1JMVA 2GKOA 3Q12A 3RABA 2Q4DA 4LPSA 2RK6A 1M1ZA 3JQDA 1DI0A 1J1IA 1XU9A 1Z29A 1EJ6A 1W4CA 3JYOA 2O57A 4JUAA 1DBWA 3R77A 1BGVA 2JA1A 1N3BA 2H1HA 3J80A 1U0FA 1ZNZA 2A94A 3UB4A 2V74B 4C5CA 1KC1A 2D1SA 2ZIXA 3L5KA 1D4AA 3E2IA 3HBAA 4IWYA 4H16A 5JDIC 3U7GA 1BMFD 5EAIA 2CWDA 3F3SA 3GJ0A 4O4HA 3EAFA 1SKBA 1HEIA 1N33B 3TZBA 4A3SA 3WRYC 4CMGA 4IRUB 1SK9A 4MLPA 3BWEA 3LHDA 4NI5A 3ZDZB 1Z12A 4A6EA 3A3OA 1DC6A 1FE8A 3UICA 4DDUA 1G41A 4GICA 4D3ZA 3RU3A 3D4OA 1WCWA 2O6LA 1VJDA 4DMMA 1VMEA 3GWGA 5MDHA 1YRHA 4DMRA 4DJTA 1D8TA 3AYXB 3OU6A 3V80A 4YUZA 2J3LA 3ED5A 3I9V6 3ZWMA 2LZ0A 3Q6IA 2CLSA 4E09A 3ZDDA 3S2FA 4CE6A 1OX4B 4CGYA 3AKZA 3A58B 3O38A 5AVJA 4YJ2A 2B5WA 4BMNA 3TQSA 2PWZA 3DTTA 3PB3A 3AUYA 4DNXA 3AILA 4WERA 2B83A 4A0QA 1KEPA 2PMCA 5CEJA 1ISFA 1K89A 2A9VA 4HKTA 2QBYB 4Q66C 1JBQA 1MC5A 1RBYA 5JWRA 1O8BA 2O9JA 5I5GA 3TGPA 2C2MA 5IX8A 1W75A 3L6UA 4QGHA 5J47A 1F2DA 1PP4A 2DHDA 1NXPA 3C1AA 4OMUA 4D5EA 4NP6A 4UFNA 1XTIA 1RQNA 2XKAA 4GX1A 4YRAA 3DWEX 2V8OA 2IEDA 4C4PA 3HHEA 4XCVA 4KR6A 1DIAA 4Q82A 4RPIA 2DPMA 3TLXA 3C70A 4UXHA 4TOIA 2YJ3A 3SQDA 4QXMA 2OV6A 3BSWA 2VXCA 4RETA 1NN5A 4Y67A 2PFKA 2WF9A 3BE6A 4B4OA 2VIIA 3CB2A 1H4QA 1TQ4A 3V6LA 1ZGCA 1IQUA 4YI3A 1DRWA 1PEYA 3QPCA 1I80A 3TNLA 5CNKA 2C4NA 1Y8CA 3S0JA 3C3JA 2X23A 1TTPB 1YDGA 3EXAA 3GFOA 4GI1A 4MARA 1F4LA 4YLGA 2WAMA 2V0GA 3A4MA 4TMXA 3JSXA 3TRHA 3Q7TA 5I4IA 1G7TA 3OI7A 4TMKA 4C6TA 1RR6A 5J2UF 1IN1A 1KU6A 3OLZA 2QROA 3O4IA 4H35A 4UNNA 4UUQA 4IIBA 5ER6A 1OFVA 1LA2A 3IE0A 1ISIA 4UU7A 5BYKA 1WHSB 5E38A 3GT4A 3FMVA 5A05A 3VNQA 1GTSA 3EPHA 4AKIA 1QZZA 4D8YA 1DXHA 2IS1A 5AJZA 1M1NA 3GZJA 5J4LA 2R6HA 3KEMA 2BZ0A 2XOEA 3AJ8A 3O1JC 1QVAA 3H2SA 3EVAA 5KDLA 1EA5A 2NIPA 1PTJC 2ZYIA 4J0CA 4QVGA 3OURA 4Y98A 4YGXB 3T54A 2ZYVX 3S8MA 5EWMA 1QRSA 3KWJA 2E1PA 4YS6A 3TGWA 2OOKA 3RS8A 2AN4A 4W5HA 1VLLA 1UJBA 3VPBA 3KSAC 3KKPA 1Z18A 2BONA 1OPRA 1X3LA 2OG1A 1DX6A 3D1JA 3E1SA 5EIXA 4D3YA 3CUVA 3JD0A 1YBVA 3L84A 3B5JA 2HQBA 4IMIB 3G9QA 5LA6F 3HJRA 4BN5A 4C4AA 4CKEA 4DPMA 1X7WA 4H4DA 1N6KA 4ZCMA 4QWMA 1GAEO 1J2JA 5F2OA 1GZ4A 4RULA 4BMVA 3MTEA 4F38A 1UMKA 4JR2A 5LUBA 3HZRA 3UJHA 1E1LA 1MO5A 2ZRBA 1QO9A 3ORYA 1CDEA 4P7BA 1B8UA 2XRMA 3KYBA 2NTYC 3CIOA 4HB0A 4YGYA 3EZ6A 3UYLA 4YXFA 3BMOA 2DFVA 5HDQA 4J4TA 1X7XB 3PHGA 3O0DA 4ZVLA 5D3QA 3PXDA 1R0LA 2BHNA 1OLOA 2ZU6A 1NXQA 4XOIA 2W6PA 5ICFA 5EJ2A 2O1WA 2F6RA 2KE5A 1N2HA 2Q3EA 4RSMA 3M1IA 2HOQA 4BFSA 4CM4A 3DBHB 2Y76A 3FTDA 4R2MA 4DCJA 1B73A 3LHIA 4K9OA 1HORA 3O4JA 1OMOA 1VMIA 4EMBA 2X1HA 5LU9A 3MWLA 1J42A 2W6ID 3JZDA 1ISHA 1Z7GA 1F2UA 3B6ZA 3CLSD 3ZWDA 4KFCA 5TF4A 3KALA 1KGDA 5AT1A 5D3MB 1Y1PA 2ZRCA 3FIUA 4DIFA 1DB3A 5EUMA 4JBWA 1C8KA 3NCHA 4HS4A 4DCUA 3R0QA 2Y27A 1IIBA 4G9EA 4WPGA 5E0OA 3NNDA 4GKAA 3KCQA 4Q18A 3I73A 2PEZA 1HDGO 3EVTA 3DE6X 1QZUA 3VNSA 4MICA 4II7A 3L92A 5LXTB 3AZOA 3WL3A 4GC5A 1C81A 2WJ6A 4X1OA 5FORA 2C7PA 1N7JA 3H19A 1NKVA 3D3WB 4LSMA 1KRXA 4PE5B 1BROA 3E5MA 4XVRA 3GV0A 1E3WB 4B81A 2RJ3A 5H3LA 2C0CA 2NZVG 3MIZA 1PWHA 5FXMA 1Z4OA 1U0RA 3WKAA 1DJMA 1Z6QA 4PANA 3SF8B 4RTRA 4Q4HB 2O2GA 3RYIA 3EEIA 2FPPA 2GAIA 4U2EA 5TSDA 1WBDA 3AUAA 2DFNA 1I7QB 5AJXA 1YHYA 4JVOA 4UUAA 3JD2A 5B3LA 5GIOE 4BPRA 2YWFA 1D4OA 2KLHA 3FOWA 4Y2SA 2JJYA 2VA9A 4TZ6A 2VPPA 4R81A 5DX0A 3BWMA 5K2OA 4RVHA 4ZQCB 2C2GA 1XUOA 2QNBA 2ODNA 2VDVE 3GRCA 5EE1A 1XZMA 2LCQA 2HA7A 4DCSA 4NYIQ 1M2WA 3LKVA 5EMKA 1R0WA 4NEGA 2D06A 1J5EB 1W4AA 2VKTA 2BM1A 3OC6A 4A8TA 3TNDA 3M1YA 2RONA 3ORRA 2JFVA 3PF9A 5F2EA 4ZVQA 4HLDA 5ER9A 3QE9Y 4YJ3F 1XVUA 3V1MA 3WYDA 1T8WA 2V7GA 2D8AA 3QBVA 5AUNB 2O8DA 2P5SA 1UAAA 2QVCA 2C31A 3KL4A 3RSSA 4ETIA 3QIAA 2DQZA 3BEDA 1SUBA 2AE2A 5DM4A 4Q37A 1QRAA 4LXQA 1URPA 2YMQA 4P7KA 1NU8A 1PV1A 3EHDA 2CUNA 4PQRA 4DJEC 1V4NA 3CH5A 5KOIA 2HHCA 4JU9A 1US8A 4FFMA 3MQFA 4MVYA 4BY9E 1KI6A 2ZB7A 2XA2A 3B3FA 3RS2A 5E6SB 1XZBA 1ZMBA 2C20A 3N2NA 2GJ4A 3SD7A 3A37A 2Q4TA 3NTOA 2XF2A 3OUTA 1DBSA 3RUIA 2IS2A 2VP3A 3OZCA 3ASYA 3BX1A 2NAPA 2BGIA 3CPSA 2DT5A 3L6EA 1SG6A 4OHBA 4DQXA 4N4AA 4O1IA 4ZCRA 4DLZA 1WXHA 3GCXA 1Z83A 4H7HA 3ROPA 3RVPA 3W8NA 3WFIA 4DHWA 4IDOA 2JLCA 3AU9A 3CLUC 4IDAA 1Z62A 2ID4A 2XEXA 5ILGA 3VR6D 3LKZA 2PGLA 3WO0A 3A6HA 4UQLA 1QM5A 4MUBA 1W25A 3E7PA 2X8BA 4ITVA 2BOVA 1BCRA 2VP6A 1XP5A 2AZTA 2P5TB 5TQJA 1NP7A 2ZRFA 3I0NA 4EA9A 3TS1A 4B3TB 2J5QA 4MRMA 1Y5IA 3FYTA 1H93A 2Q3DA 4LVNA 3QXJA 4MTLA 3AJEA 2AOUB 2GO1A 1G9XA 3D8SA 1B0ZA 4LHYA 4UULA 4X7BA 2B9VA 1W2GA 4XVCA 1UZNA 2ROQA 4Z99A 2WD9A 3ONWA 3ENNA 3NBAA 3VPDA 5FL3A 1WUIS 4FZ5A 2P68A 2CLEB 2HLDD 4BEJA 3TXXA 3JCZA 4UTOA 1A8QA 1U0GA 1W48A 1IWPB 1OJ7A 5BSUA 4Y2HA 1ATIA 2ZKIA 3HCAA 1DKPA 3ZY4A 3WJ7A 1Y4SA 4PYKA 4JI6B 4E30A 3F5FA 2QJOA 3EVFA 3DEIA 4OHFA 5JISA 1MTOA 3NV9A 3HZZA 1W0JA 5C53B 2HW8A 5DPMA 4CG1A 2JAXA 3T6KA 1KP3A 1Z22A 3WLTA 2QTVB 1CUDA 4HWRA 4XEUA 1C3JA 2D4HA 4ON9A 3HG7A 4YP5A 2R1UA 2JS7A 3GF4A 3WLJA 5KB3A 3I23A 1FQJA 3W9UA 1XD9A 4F5DA 4NX2A 3QV2A 1UOEA 4A8PA 3MTJA 3T4XA 1I2AA 2NU6A 3JW8A 3W2FA 2PWBA 3H9UA 2C3OA 3ZZUA 2PL3A 1RI4A 3FMFA 3ZZ0A 1X6VA 1M5TA 4ALKA 4GMGA 3HMQA 2VCEA 3DP7A 2HMUA 2Z2IA 4X61A 3ZU5A 5ECYA 5SZJA 3PQ3A 4N39A 4I4LA 3TI7A 1OV4A 2NU9B 4JENA 2ZIFA 1NC1A 621PA 2YCBA 3GG2A 2BEWA 4O4JB 1G2OA 5EKUA 1KEZA 3F46A 1P2FA 5LZ7A 4GNRA 5K8VA 5KQSA 5AXDA 2PYIA 1L5HA 4D98A 3BE8A 5IC4A 1E8DA 3B1JA 3F8SA 1TD1A 4I6GA 2Y77A 4NAUA 4B87A 2UZ4A 3ZKWB 4JC0A 1CR4A 4FQ5A 4NNPA 1I0ZA 3MCAA 4MW2A 1T2EA 3NIDB 2XUHA 3OETA 5CDGA 3IR6A 1U63A 2DC1A 3MVEA 2FEPA 3C5EA 3VH3A 3SEAA 5CDSA 2ANBA 1IDOA 1DSSG 3N8HA 4FR5A 2HX1A 2CJFA 4TLDA 5ED0A 2JFWA 5HFJA 5T41A 4WBNB 2JIDA 2VDRB 4FNOA 1XEXA 2IEBA 3T5TA 4PX9A 3JQQA 2VPXA 2XLBA 4RYDA 4C0LA 1KQGA 4DC9A 3AP1A 1G5TA 4KKVA 1KH2A 1FFYA 421PA 3MJDA 3IBSA 2H54A 3DCIA 1NN3A 3Q3VA 2OLJA 3KQPA 1I5EA 4BIMA 5ADHA 3HR8A 1DQNA 4CIAA 5EJ5A 3FTQA 1BXKA 4R1UA 1FFGA 2ZUTA 2AD1A 2XNCA 4WXMA 2WE8A 1E6CA 1VP9A 4E5MA 4F12A 4UFPA 2A2ZA 3HXPA 1I24A 2ONYA 4HNHA 3LI2A 3PFWO 2CN1A 3OKAA 2DQSA 5FFMA 3RVRA 1D2RA 2QTFA 3C1UA 2V59A 1AQIA 3HKCA 4O5OA 3DAGA 1WRBA 3L7LA 3WLPA 2DPHA 4ND4A 2POQX 2B61A 5KWIA 3G0HA 3VR6A 3BXOA 3OTWA 1G20E 2DCMA 2FWMX 2D2VA 1Z2OX 1JHZA 3BE4A 3GPBA 3KDSE 4FJ2A 3VU9A 5GTDA 2LGJA 5DBEX 5KWSA 2PS0A 3RHSA 4TUYA 5IXJA 1R0SA 4BNJA 4GO1A 4BVLA 3HJHA 5ERYA 1I9GA 2EW8A 4G23A 2ZBFA 4C87A 3PHHA 5MN6A 3IUJA 4GOLD 4TS9A 4V0LA 4C5BA 3AGQA 10MHA 2AEFA 3LKBA 4U7GA 4D42A 3LY8A 2JASA 3HKBA 5FBZA 1GG5A 1JIJA 1KERA 2OCPA 3F7TA 2ISSD 2WJZB 3CG4A 3GFFA 3E8XA 3OEWA 1W5TA 2XB6A 3Q3GE 4IHKA 4AUKA 3JAWB 1IZZA 3CR3C 1DAHA 2QRNA 4JOCA 1GGEA 3E15A 4K26A 4IVQA 3MRXA 3VDXA 2XD9A 1ZN9A 5EP4A 1IUPA 3MAGA 2RGDA 4X3PA 1YA6A 2OCIA 1UADA 1UPBA 4GMHA 1XRPA 2DFKB 3HSKA 2C5BA 2YJ5A 4U9HS 3NOXA 3Q9NA 1WP9A 2E21A 1MC1A 4V1CA 4IZOA 4DV6B 4Q00A 4EWLA 4YRKA 2YUTA 5KTNA 3NC0C 4C4SA 2QKYA 3EEOA 3TZKA 4YIKA 5EWMB 1TYDE 2GA8A 1J1ZA 2Z1DA 4N40A 2IF2A 3M9XA 4IH9A 4LZWA 2GEUA 1PGQA 1FMCA 4U2CA 1KYIA 3FROA 1V8PA 1WEKA 4Y0AA 4AZ0A 3RYCA 4W5OA 2IH2A 4BUCA 3AETB 2WYIA 3FZEA 2GYYA 1RXEA 3W8RA 2D5LA 2W98A 4FHCA 1N2JA 3H17A 4LSZA 2JJQA 1RHMA 4QNNA 3VKWA 4BAUA 4O0LA 3KUKA 2W2NA 4XIJA 5KYWA 1QF9A 2JLXA 2BKVA 4HUQB 1E6WA 3GP8A 1OV6A 4FKZA 1BXGA 1VL0A 2Q7XA 3H5OA 1E3WA 1U0TA 4I6EA 1OWNA 3WLAA 4D41A 2ZRPA 3UK0A 4D4KA 5K0GA 1CQPA 1PVDA 2X6RA 3C45A 3JZFA 4R2WA 1T5OA 1PR3A 3WKBA 3IFSA 4RGQA 1BHJA 1Q7RA 2PX4A 3C7DB 1XEFA 3HFSA 3AEYA 4IV0A 4LC9A 2C98A 1VL2A 2VOEA 2GCEA 4LF4B 3F6EX 1Y8QA 3EQ2A 1MAAA 3EAQA 3BPSA 4QQFA 4GDFA 5FR1A 4JFRA 4ZZ3A 4MYCA 5JANA 2DSNA 5JXWA 1CERA 1DRJA 1VDMA 3D7RA 3CRVA 3KQSA 3JATB 5CFMA 3CLTC 4TYYA 1AQLA 2X42A 1GFWA 4BQQA 4NFHA 3AW8A 3K0SA 4AUNA 3UAYA 1EHYA 4NABA 2WK1A 4O8ZA 3DC2A 4Y6SA 2WNHA 4B9AA 4QBKA 3I5XA 1RYEA 3RUHA 1V5WA 1Z2DA 2X0NA 5A5EA 1QC5B 2Q3MA 1EIZA 4OX9B 1UFRA 2MHCA 3GLFE 1MN6A 1ZH6A 4WKNA 3DKVA 2QZ4A 1XAIA 3VOAA 3HJTA 1Z3IX 4GBGA 4HGQA 4YJ2B 4TN1A 1KSJA 4LJKA 3USCS 3DFFA 3KOXA 4CNBA 3ZEIA 2GK6A 1U1CA 2QMQA 3LUKA 1A82A 1LI5A 1QZ3A 2VHEA 1M2JA 3O2NA 4PZDA 4M0DA 2W6IA 1E2EA 1NQXA 3OBBA 4FQ7A 2XB8A 2J85A 4IKOA 3AP3A 4IIJB 4REQA 1LQTA 3L8FA 1MT0A 3U26A 1FUYB 1EUDB 1ZYUA 4IUBS 5K9ZA 1MIHA 2LUOA 1XMOB 3IP3A 3RYFA 1P2SA 1MH1A 1GPUA 4GFDA 4IWXA 4R1PA 3JQPA 4TTJA 1RTTA 3A4IA 4P0TA 1G42A 4KYTA 5HPYB 3DBIA 1L5OA 1BHQ1 4F56A 3IE2A 1FSGA 2UUAB 2BD0A 5F9HA 3C8HA 1YTUA 4JEHA 3LAWA 5EXEA 2JFUA 1HM5A 2BKUA 1F1BA 3V4SA 4L4UA 4FCTA 4LFAB 3UPTA 5LQJA 5CHYA 1E3TA 1NPYA 3FOBA 4ZYUA 3EWIA 1PNTA 1YB6A 5B1IA 1U3WA 3LF1A 2CDAA 2VPTA 3ENZA 4E51A 3VTFA 4ZVNA 4TL6A 3Q87B 5TQ2B 5THXA 5IT9A 3BCSA 2DF8A 3T7DA 2V6IA 2O2XA 4MKGA 4BP9A 5BWBA 2Z1MA 2ZBEA 2OMEA 1UK7A 4D3FA 4ENPA 5LIPA 2WKSA 4AJOA 1AKVA 1QCCA 4XD7D 4BVKA 3I53A 3D6MA 4MDHA 1G3UA 1GUFA 1SQ6A 3G7SA 2GCIA 3RFCA 1JVNA 3K9FC 4KRYA 1ATZA 1DQRA 1NVWQ 4OU4A 5KS2A 1D07A 4JBXA 2XXAB 1UJ6A 1RHUA 4KC0A 2FKAA 1XX6A 3EOBI 2MSEB 4RLFA 5AKYA 4CL2A 4M53A 5B1HA 1LEHA 2H2AA 3KSRA 4HMQA 1VLQA 2XZDA 3VR5H 4BE9A 1WSBA 1H1LA 1T6NA 3GCZA 3V8NA 4DMCA 4EUNA 5JH7A 3GRAA 4K9QA 1DAMA 4W1SA 3NALA 3ND5A 2PGAA 2Y92A 2EJWA 4NF2A 5TGDA 5L4SA 1RJGA 2GZ2A 3U7HB 2Y0CA 4QM7A 3ER9A 1FNBA 2ZSEA 4X3CA 1IM2A 3FM9A 5K0ZA 3N76A 5JZ9A 1NYRA 3LVRE 4HDMB 1LDYA 4K9MA 1ECGA 5GV8A 5BV8A 3OJEA 4A36A 5C46F 3FYCA 2P9ZA 2Y0PA 2W8ZA 3TFQA 4GMXA 4EEXA 2AUNA 1Y1QA 3IAS1 3KXIA 4RVSA 1QIJA 1MV5A 1ZONA 2IYOA 3TG8A 4OKIA 1T4MA 5CU7A 3VHRA 2NSYA 4A82A 5ISMA 1TM3E 5H4HA 3BD6A 4TS1A 3FMGA 3USZA 2YOHA 4LSWA 3U7JA 5K0EA 2W0SA 1DG9A 4ZKEA 4FYXA 1W88A 1HOTA 3FH0A 4IIHA 1XQXA 3GPIA 1EVKA 2NTEA 1J70A 3L7YA 1FP2A 4HZUA 4KQIA 3AY3A 5FYDA 4F72A 1L5YA 5AW7A 3FKSA 1SUWA 4H27A 4S1WA 4A2QA 1ND6A 4P98A 1E7WA 3GAZA 3OZVA 3RYIB 4RSGA 2GZ3A 3I62A 1Z6XA 1ZQ1A 4F0JA 1BDHA 1JG1A 4LJSA 1P4GA 1TVCA 2Z3WA 3HXKA 2Q3BA 1Q1ZA 2AKAB 1N9GA 2YVAA 3UMSA 2OSVA 2X13A 1IVNA 1Q57A 4EATA 4RJKA 3KUXA 4QFBA 1CNMA 4I55A 4R9RA 4XVQA 2GZDA 3S5UA 5AVKA 3IRUA 1EAMA 2Q5LA 4KE8A 3DHWC 3NAMA 1H4TA 3M3DA 1LPAB 3ZKWA 4H31A 4PRZA 4E5NA 1XNRB 2LR0A 4BWVA 4D9IA 1PZFA 1RE0A 5HF6A 1DLIA 3P26A 2P3SA 3FRHA 3HVRA 4QU8A 1PV4A 1AK1A 4OKNA 1H42A 3OLWA 4DSZA 3OLCX 2PZ8A 5HK9A 2WPDA 5CB0A 1JU3A 1AKTA 2B1GA 3ENQA 3RF7A 1JEYB 3M4XA 3G2KA 2H29A 1TE2A 3HKDA 1NFRA 3S1AB 5IYZA 1USVA 1AHHA 3K4QA 1UDBA 4MR8A 4A5SA 1M6VB 1PGPA 1ZRSA 2ZIWB 3GD5A 4MKFA 1GR1A 2IXEA 3K6RA 1FBTA 3CLUD 2OXEA 5CTAA 3CX7A 3ZQKA 2P9CA 3FPSA 4H3SA 4XTRA 4D02A 2ZE7A 3H1PA 1AMUA 1RXYA 2B78A 1AHNA 2BR5A 5DGIA 2ZJ8A 3UH1A 4H9GA 2ZZKA 4S0XA 4ZV7A 3NYWA 1Q0RA 3AY7A 2BRUC 2ZUSA 2C77A 3IOCA 5FBLB 1HFEL 3IL2A 1UZLA 3GRRA 3JYNA 5FWYA 2VPIA 1RLMA 3OTOB 3FJYA 2Z04A 3P0RA 4GXQA 2CZGA 2E48A 3BFPA 3M9LA 4TRMA 5IULC 3N2GA 3GMTA 3GLIE 4YN3A 2GNPA 3I9FA 3TAXA 3CVXA 1DKLA 2Z57A 5A7GA 1ZHOA 3O94A 4F2WA 2XWBF 3IUSA 4NICA 2RAFA 3EUEA 1IY0A 3KZ1E 4DEXA 1W49A 2CK3D 2DPYA 2IF0A 2R4QA 1IZYA 1E2DA 1KFEB 3PD7A 1SN7A 3EFOA 3BTSA 4HWOA 1ISMA 1SUEA 1Z28A 3Q3JB 3GLKA 2AOUA 1Z73A 1VPLA 2FMKA 2FUG1 3ZI4A 1EQ2A 3WGGA 2FI1A 1KI4A 1G19A 3FUVA 4RD2A 1YJQA 1EWRA 3GLTA 3GT3A 4YAGA 4MQFB 3LLSA 4H2DA 4I08A 4KGXA 4Q4DA 4ZAGA 5KTKA 4IAOA 4UUOA 2XBMA 3EN0A 1TZJA 1XTBA 4QPJC 2HLNA 4W7HA 2ZI7A 1MX9A 3FRIA 4FDUA 2IV2X 4F5WA 3IP5A 1NKSA 5F5LA 3O8RA 5EXSA 4R3WA 3SICE 2WIBA 3GMIA 1QGUA 3W5VA 4JHXA 4MOWA 2ZVQX 4EG8A 3H2YA 5ENVA 3LFUA 3SNKA 1TQ6A 1Q20A 3AETA 4ERNA 5EEHA 2QR2A 3TVDA 1D2NA 1Z13A 5C7YA 1GNVA 3O90A 5DLQC 2YJNA 3D8RA 1NSFA 4FR0A 3TPFA 4IZHA 3PV0A 3F0TA 4MV5A 1PU2A 2B2CA 1S1CA 1WHTB 2QLBA 4PV7A 3L9WA 2I7TA 4NBSA 4TS3A 5E2BA 2J3HA 3INNA 2EU8A 3BMNB 2PV0A 1V1MA 2JCXA 2PSDA 1N0UA 2H1CA 4OH7A 3TMYA 3UMMA 1T8YA 3EUAA 1E3JA 3MJRA 4HQOA 3UYKA 4A8JA 3OLQA 4G41A 1VJ5A 1HETA 1GV0A 4KN9S 3CN7A 3T5MA 3FA2A 1ZG3A 2C3MA 1TQHA 4NNOA 4MVJG 1LRJA 1GNTA 4J16C 4UQPA 1PK9A 1KDPA 3UJ9A 4BX8A 4WN9A 2IYWA 5A6VA 1YBFA 2G5TA 2GSWA 1NBMD 1Y7TA 5F5XA 3BD8A 1NJFA 4OQLA 2W93A 3KSMA 1WXDA 3RUEA 3W5IA 4P32A 1R0BA 4I2NA 1N0VC 4H15A 1YA4A 4PFQA 2XRFA 4JI0B 5LZ2A 5I9BA 3EXHC 4HWGA 3UT5B 1UPAA 2ZKLA 2GEDA 4INOA 1J2RA 3NEYA 1NNLA 3FWNA 1G60A 1O5OA 1X1BA 5ENZA 3NEAA 4FZRA 3LXXA 1DFHA 2FZEA 1CQIB 4LY0A 3E9NA 2W43A 3PTZA 5M2QA 1CT9A 3CZRA 3H8JA 2CHEA 4MPTA 2C7BA 4EECA 4KO4S 3I8OA 3DKIA 2PKWA 2R11A 3PX3A 4G0PA 4H7DA 2ONKA 1TKRA 4KLCA 3SBXA 2YFYA 3NI2A 4R7TA 4RF4A 2ZM6B 1K4YA 3ABZA 4FFNA 2J31A 3RBZA 1E0AA 4HMPA 2PWPA 3DMPA 3OA2A 4PAMA 1JR2A 1VDZA 2VDPB 4Q7MB 1E3LA 4Q6WA 5J4YA 1SD1A 2XKBA 4KFRA 4PPQA 4DYVA 4EY5A 1L3IA 3MLEA 2QAGB 4DG8A 3OIGA 1D2CA 2QNRA 5CFPA 3IP7A 4UCQA 3HP1A 1AURA 3K5WA 3W06A 2DKOA 3GMSA 3R74A 2PT6A 3D43A 1IJFA 4R1NA 1SH7A 2D5IA 4UTNA 5COQA 2WTXA 1PZXA 1KHHA 1SBCA 2B1IA 5TS2A 2NV0A 3VV2A 3WWZA 4JX9A 4EF6A 4L3VA 5U4XA 2HQSA 4KFUA 5BQ3A 1N2CA 3C3KA 2EAUA 2I2DA 1K5DA 2FF5A 2ZTUA 3CSSA 3E9CA 4EW2A 2DUWA 5KDOA 4RAQA 3HKBB 1X8LA 2H52A 4J8PA 1DKRA 5TS3A 4LF8B 2CEAA 3SM9A 2WM2A 2ZJZA 2NUPB 4IIDA 4OMFG 3SIRA 5DX8A 4IRMA 1FYVA 1N0IA 1KJ9A 4TROA 2WG1A 5L53A 2O7RA 2O7QA 4GM1A 3SSAA 5H1YA 4RS4A 1AK2A 1U0JA 1YCHA 4NV0A 1QE0A 2Z2ZA 3BJEA 1BRMA 1QH8B 4MLDA 3D59A 5JLAA 1JJAA 4AJNA 1BDJA 2Q3CA 1UMCA 2Q9BA 4QGFA 4UD6A 2QVYX 1D1PA 1N5IA 3KVNA 3E0XA 3E3OA 5I47A 3AF4A 3AYZB 2XZOA 1FTGA 3T52A 2AN9A 4CKWA 4FE4A 1TU4A 3SHFA 4PTLA 3MUNA 1F7VA 3LA8A 1L7QA 1W5SA 1WDWB 3C8ZA 3EGWA 1Y48E 4MWEA 1KEKA 4IIGA 4RABA 4J76A 1ZCAA 2VJPA 1ZIXA 1KO5A 3OJWA 4EQ6B 5FOTA 1JX6A 2W2LD 1G8AA 3EGIA 2PEYA 4GYJA 1RI3A 3ZY6A 3AFHA 2HD4A 2VYNA 3L8GA 5BV7A 4PSUA 2GCOB 1EFRA 2J30A 4E08A 1H69A 2MMGA 5DHRA 1IC6A 1MOSA 4UEKA 3OPVA 5TARA 3VZDA 3CLTD 1GA1A 2IXFA 3BIJA 4FN4A 3UBMA 2JIPA 4XJXA 4G2NA 3N05A 2XRYA 4ZC8A 5C1OA 1BXRA 2MT9A 5DTJA 4IJKA 5HZKA 1QPZA 2G1JA 2O7NA 1SNYA 2ODWA 2QJFA 1QHHA 3FYUB 1LDGA 2JCYA 3OPNA 4IHQA 3L1UA 4FXPA 5KYGA 1EQUA 5CH3A 5JJIA 3BMCA 4HDRB 3DZGA 3LT4A 2AS0A 4YT5A 4M9SA 3PHCA 3BD7A 2BLNA 1QG2A 2EEPA 4DQVA 1VC2A 2W4IA 3ZJ5A 3OFSA 2GB4A 5K03A 3PWKA 3I9MA 5DNCA 4X1IA 4BNKA 2WMOB 4QTYA 1PBTA 3AOEC 4MUKA 2XCLA 1IXKA 1MGOA 4YQYA 5FI1B 4CCWA 1HL3A 1WJGA 1X1EA 3D54D 1VSTA 3Q5DA 1VM6A 2GBPA 2JRLA 2NW6A 2X7JA 3GZNA 3MFQA 4MQ5A 1FYFA 4W5TA 1ECPA 1E1RD 1F6WA 3HSYA 4W9NA 3EBLA 3QEBZ 1QQAA 3OU2A 2H85A 4G85A 4NCNA 3A05A 1N77A 3OCUA 1YD7A 1KBZA 1QHSA 4JJ4A 4KWHA 4MINA 5IKMA 1TM7E 4BVEA 3Q15C 3W5UA 3PX7A 4E2YA 3GJYA 2ZRGA 1D5WA 3O26A 4UU0A 3W90A 1YRLA 2WILA 5C1BA 4PC1A 3ETLA 4KIUA 1GPBA 2PT5A 4DWWA 4QOGA 1Y80A 2BUCA 4HRYA 4LHSA 1U5BB 1V16B 2FLWA 5KYWB 3AIOA 1T5IA 1E7YA 3ML1A 1GUDA 5MN5A 1SBHA 3WKDA 3VR5D 1LTHR 1K4MA 2FCAA 1DWQA 4HQFA 1J24A 3QF7A 2GETA 1Q2UA 3PGXA 1MA0A 1PIWA 2LDBA 3DFMA 3K53A 4P8RA 5KNBA 3EPKA 3QEAZ 4V2IA 1IZ7A 1SO8A 3QBJA 4KQCA 1RU3A 1DBQA 1FYEA 1TLTA 3OWHA 1ZA2A 3PNOA 5KX5B 3JWPA 3BEOA 4S05A 1U1DA 1KFKB 2Q2VA 4QOHA 1S02A 1DWPA 2BFOA 1FMTA 2DYKA 3QEJA 5IC6A 1CRZA 1E2NA 3AHIA 3PK0A 1IY1A 2EHDA 3VR3D 3KETA 1LXCA 3IE1A 3ZWKA 2FZCA 4BMDA 3DBOB 2ZZNA 4P84A 3ESQA 3MWDA 3PITA 4LXGA 1TRKA 3KT3A 3HDVA 2MSWA 1L4GA 3OCCA 4DM4A 3RC8A 2HHAA 4GT1A 4HZGA 1XA3A 2EDCA 3UFXA 2QTNA 2Z0MA 3D6NB 3EEFA 5F52A 1VCOA 3AR7A 4RD6A 1CVRA 1NVVR 1GO2A 1C9MA 4HN4B 3V9PA 1HO3A 1V43A 5KKCA 3O1HB 3K9CA 1X7DA 3JZAA 1Y3DE 3M6WA 3RFXA 4TXLA 2IOYA 3RSZA 5JV5A 2TS1A 5A9SB 3JQ7A 1WW2A 3IAHA 4V0KA 4BO5A 1E5VA 1BKDR 2YJTD 1Q77A 3GVPA 1ODSA 1QVVA 4ARUA 5DN6D 2CXSA 1IOLA 3S27A 4B5KA 5JS2A 1F0YA 4Z8YA 3TMKA 3S1AA 4FOSA 3ZGOA 1RHQA 4BUZA 1KOFA 1NVVQ 1ZA1A 3CVJA 2YVUA 4EHJA 1M7HA 4DY4A 1XDBA 1EGVB 2BC9A 3I3SR 3EZXA 4YJ2F 1KEEA 4DBLC 5KU1A 3CLRD 1Z4LA 1FOEB 2OZVA 3IP9A 4G1CA 4MLZA 4HAZA 4KG7A 4LJ6A 4CHGA 1PLJA 1OJLA 1U7DA 3UK7A 3BMOB 3BDAA 1UMBA 4Q01A 2BZGA 4L0MA 2ORIA 2B1JA 2I4TA 4AJPA 4C7MA 5B55A 3MTDA 2RJOA 1UZAA 2RHHA 2TMYA 4HGOA 4TMVA 4AO7A 3TOXA 4TL8A 2PUWA 3F3KA 1BQEA 1CDZA 1TFUA 2FKNA 4JC5A 1SXJB 2XW6A 4I9FA 5CVDA 1Y89A 3V3KA 4Y6LA 1B1AA 4E7OA 1ZJ4A 1K27A 3Q0IA 1QAQA 3KOWA 5FPTA 5JVDF 1S3IA 3GY0A 1NNSA 2Z5FA 1R4NA 2ACWA 3QTBA 1CLUA 1NNI1 3TD6A 3SVLA 2GZHA 2FPGB 3AXTA 5AK4A 4H08A 1FL9A 4X85A 2QUJA 1WNFA 1T3GA 1QRUA 1JHDA 1Z17A 1R0KA 4J6EA 3ISTA 3W4JA 3IDSA 5K0LA 3EZNA 1LC0A 4X8OA 4KAAA 4CF5A 3AW9A 4H7KA 5IAGA 2BBOA 4BVGA 3C6ZA 2EJVA 2PU7A 2HWKA 3OE4A 3HY4A 5TPWA 3ZY3A 4NZOA 1K6XA 1YCGA 2SNIE 4YUYA 2V7VA 2BEUB 1KETA 4HS9A 2E5LB 3QKTA 2WQZA 5M7EA 3EPJA 1EVQA 3AX6A 4OD0A 3HUEA 4RIHA 3VMFA 3FPBA 4LZAA 3FLEA 2YCLA 2BIFA 2RAVA 4LV5B 1R15A 1K7FB 3M5DA 1V96A 4RVUA 1BAPA 4UVHA 4U2DA 2DR3A 1NJ2A 1ZI9A 3IT2A 1PNRA 1NMQA 4AROA 1ACJA 4ZAZA 3SF8A 1E7MA 2YJ4A 3LPMA 2GF9A 2GT1A 1NNUA 1JLKA 2PZEA 1UIMA 1XDWA 3CNEA 1Q7EA 3IOYA 3KR2A 4ZEVA 4DBZA 1J25A 3E22B 3GCGA 4LNUA 1UEXC 4W8GA 4O25A 5LP6B 1NI5A 1V37A 5LLSA 3RBVA 4JR0A 4NCJA 4LX0A 2PX0A 3NQ41 2FMHA 4PLHA 3BWVA 2G1AA 1GGKA 3BFKA 4BN0A 1Z4JA 5C4GB 4LYDA 3M1LA 4R8VA 3BAFA 2WD7B 5JOQA 2GGSA 3K73O 1S0UA 1DVRA 1GM5A 3VRHA 1BX0A 4RK1A 3QKRB 3KV3O 1EUCA 4GECA 3ZHVA 4MMXB 4U7PB 3ZUPA 1DJNA 1YU9A 4A9AA 4S1NA 4O08A 3H84A 2G0TA 3NM5A 2IE8A 4Q48A 4JJIA 1TCBA 4PYIA 3T38A 4HNTA 2X7XA 5EP1A 3IKTA 4BVBA 3IIJA 4URYR 1VRWA 3RQIA 1W47A 4AQDA 1UQTA 1L8LA 2H7VA 2J3JA 4UAGA 4Z2YA 2GZRA 1GTRA 1GVHA 1E1YA 4QJ4A 3VKVA 4QTUB 1DWUA 3AFIA 3KJZA 1L4EA 4KWEA 2VRNA 1YZTA 4LHEA 2V65A 1PX0A 3R3HA 4WEOA 4EITA 1GNPA 2C9YA 4WSOA 4CV1A 4ENUA 3GLQA 4CTMA 4YFYA 4PF1A 3L7MA 4CN9A 2JAHA 3ICOA 2JHGA 4Y6PA 2B8JA 4ZGBA 4MR8B 1V0JA 1ZR4A 1ST2A 3HBNA 2PO5A 3RARA 1MEOA 2BM0A 3HYCA 4N65A 1AB5A 3S8YA 1CS4C 1VIYA 2PUVA 4ZVOA 4QKQA 4GGMX 3JRXA 5F1KA 4CEIA 1YU6A 4YPVA 2GD1O 1MABB 4L0CA 1UKBA 4O2RA 4YCNA 5EGSA 4A8HA 5FLXA 2C4TA 1UH5A 1KKUA 2Z09A 3HPQA 5FWYB 1CJVC 4Y2XA 1M7BA 2DJIA 3TLCA 3WE7A 5ADVA 3NXSA 1SZCA 2ILTA 3NIFB 5HJ5A 4PQGA 4RDIA 3WA7A 3INTA 2VSYA 3N1UA 4GI7A 1Q11A 4PONA 2IA5A 3R8XA 4CDNA 1TM5E 2PLAA 3RKSA 2WYWA 5L9AA 4JLOA 5CXXA 4LZOA 2JB9A 4OXXA 3VZBA 2ILVA 5JMPA 5PNTA 1MFZA 3X44A 1Z39A 1NGSA 3QNMA 1UF9A 3AOEA 5JNWA 3W5AA 4YAFA 4CIXA 5K3FB 3GOHA 3OFJA 4YMIA 3UCFA 2QMZA 3TZLA 2HNBA 3DLPX 1G4UR 1PG5A 4G8JA 4KH0A 1BZYA 5BNIA 3H4MA 1UPFA 3BUSA 4XR9A 4TSKA 3BCUA 3OZUA 5ALDA 3GRZA 1CJTC 3K1YA 1XEAA 2MYUA 2KQUA 1QH8A 2XITA 2WSYB 3I30X 3AESA 3IAFA 4QDUA 4BDTA 4AKGA 1S9DA 2FMUA 3PGJA 4QOSA 1CXZA 4YP7A 4CMIB 4KV7A 1ZVVA 3LD9A 1Q1GA 1S2DA 3TIXB 2PS1A 5TE9A 2IEYA 1E89A 1IQRA 1FFEA 4KIWA 4B6RA 4E5SA 5AW8A 3ANLA 5JCJD 3DLBA 4ZU3A 2PRYA 2WPNA 4P33A 3ZCSA 1U99A 4JJ7A 4Q05A 3IP6A 2BBSA 3K9GA 3AF0A 2NSHA 3OIUA 2VNIA 4XPIA 3LCMA 1HKUA 3ZU6A 3ROZA 4X6XA 4F4FA 1S3GA 2XEDA 1FX0B 3JQGB 3QPBA 2WVHA 1U2DC 4NMWA 3VR4D 1VBFA 2QM7A 4CG3A 5F33A 4AQ7A 1YQTA 5CDFA 1ZOLA 2PQ0A 1KDYA 4RV5A 2W42A 5AOCA 1HT3A 4TLBA 2BEWB 3AEKA 4O4JA 1B6SA 2ZUWA 5DJ5A 2QVGA 3JRNA 3UXEA 3VR5A 5KTTA 2UXDB 3L7AA 1P7YA 3QMWA 2Q3HA 4ZO9A 3S99A 2JIOA 3CFYA 3UA4A 4ZI7F 5L4LA 1V3TA 4DA9A 2QLMA 3WRXC 1U6KA 4MVJI 5BV0A 5JI3E 2BL4A 3MJFA 2DVMA 1XZFA 5IJ0A 2YIDA 4MDEA 2UZ1A 2WYVA 3TVTA 1NF3A 2OBMA 1F38A 4IM7A 3F2VA 4MDYA 2L42A 4Z3OA 1UL1X 4F9GA 3FPGA 4C7XA 1WY7A 3F96A 3FGZA 1IXRC 3UMJA 2GPJA 4NR0A 1NR5A 5EKTA 4BRWA 3QYJA 1E1RA 2Y4OA 4HQ6A 5E2AA 3UFXB 1OT5A 1SG0A 4AKSA 3OM0A 5ILOA 1ODKA 3DBRB 3RFVA 4UDNA 3R41A 1A77A 1Y1KE 2FW0A 3BD9A 5HF5A 3OCJA 3RAEC 1GCGA 2HUPA 2IIVA 1W4ZA 5B1DA 2FUKA 2O0MA 2V1XA 3EC7A 4F3CA 5DGCA 5F5NA 5KJCA 3UPUA 3WGHA 1SHUX 2XMGA 3B6EA 4F11A 4M9XA 5IT5A 2PGXA 2H4HA 1JHPA 2REQA 2XMQA 3VPFA 4DDHA 5L6MB 1YBHA 1Z74A 1OI2A 3C74A 3DMHA 1BW9B 5JAHA 4PYOA 4WKBA 2J4DA 3CWQA 4MUFA 4EX6A 2C7QA 5F98A 1J7JA 1KJZA 3C6KA 1QK3A 4NMMA 2X19A 4KZKA 3RRFA 4D0NA 3IODA 4IW3B 2X15A 3BRQA 1YVPA 4YJGA 5P8WA 1WMEA 3FYSA 5ANRB 5K6AC 3NTQA 2A0FA 2PVSA 2FLVA 3SHWA 5GPBA 3FNQA 4E03A 1OGIA 1IJBA 5JYEA 4BUJA 4DDMA 3EUWA 4M89A 1SKAA 1IBSA 5TPZA 4KFSA 5FOQA 1S8FA 3C6MA 1EX6A 3H5LA 3AVOA 1SC3A 1PTKA 2H2HA 2I03A 1WPQA 4UHFA 4YWJA 1FRQA 3X3HA 5JAOA 1I3NA 4DR5B 5FBQB 5FAXA 4GPEA 3UAVA 1H5NA 1UANA 1N92A 1R0YA 3D4NA 5JTTA 3Q8WA 1KBQA 3A6JA 4Y9SA 1ODFA 4YHBA 5JMWA 1XTSA 4ER0A 4OXRA 1FRNA 2ZVJA 4M7PA 2KJQA 1AN0A 1G0OA 1YR1A 3GD7A 4PLZA 4R40A 3W2HA 2HSWA 3L8MA 3P2MA 1NW4A 1XRLA 2AFIE 1E7SA 3W1WA 4OXQA 3ZHCA 4AYWA 4CTNA 4KITB 1PFQA 3N6VA 1X15A 1XRJA 4NEHB 2ATVA 4CG2A 4JB8A 4DCGA 2XXJA 3M81A 2FFHA 1ENPA 2NXJA 5TMPA 1IFXA 2EGUA 3L04A 3ZWVA 1EX7A 2W83A 2XDQB 3IPLA 5AKZA 4EVRA 3VPAA 5H68A 1U7WA 4HAVA 3FGNA 1U2RA 5AW4A 1TEXA 2J6HA 1YS6A 3V8MA 2PGIA 3T3GA 1FYDA 3HB5X 4RHEA 2X40A 4FWBA 4QLBA 1NVTA 1HSOA 2J5XA 1ZBQA 2AE1A 4BRSA 2GN9A 1I3CA 2O2YA 4HO1X 2QN2A 4U2GA 1N5JA 2C59A 1NBME 1AS0A 1QV9A 1S96A 5L3ZA 2IY8A 3D3JA 3E1GA 5KX5F 3WK6A 2RBGA 1U6JA 3CWZA 3IA2A 2JCBA 3DT9A 3K6SA 1U5BA 1T26A 2Q6OA 3LHKA 1XXHB 2AXEA 3OUUA 1DAOA 2MR5A 3AHEA 5HKOA 4IHJB 3DT6A 2EV9A 3JATA 2AOTA 4GZ3A 3SPXA 3IAM1 4U7WA 2VZLA 4JKYA 1D2MA 3DR5A 4QHYA 1U5CA 5AM3A 2AJBA 1F9EA 2XGMA 4TKZA 5ALQA 3IOEA 3UJ3X 3DNPA 2XE7A 3M3PA 1LNQA 3LLUA 3ZLJA 3N3BC 2O0KA 2VDQB 2LDXA 1CZKA 3MMZA 2WSLA 3KPYA 4IEIA 4WOKA 2OCYC 2A4MA 3G9UA 3P45A 2H31A 1H2HA 4B46A 5JNTA 5LQMA 3K71B 2HWYA 4LCJA 2PGJA 4I81A 5ETJA 3R7NA 1T5DX 2OC9A 4FBMA 2QNIA 4CI0B 2XYVA 1FC0A 4OQFA 4BLPA 5KVSA 1K08A 3JQAA 5C4MA 1S8OA 4KO3S 2VJOA 4QSMA 4UVDA 3ADOA 4TXJA 5EL0A 5FO1A 1QYXA 2H5JA 1J0AA 4RK7A 1YTLA 5JRDS 1P5ZB 3ZWYA 1W46A 2QR5A 1PJTA 4OOFA 3HLKA 3KVYA 4DQLA 4LQLA 2H1IA 1SKYB 4TWBA 4RNDB 1BEUB 3NDPA 3KD2A 1S9HA 2QK4A 3L8YA 5JTUA 4GEGA 3QVKA 2GHTA 1QUFA 3BFXA 3DE7X 1NBMA 3MRTA 3VXKA 2FFQA 1K92A 3PEFA 4EFLA 3H7IA 5H02A 4JA0A 5CITA 3LKDA 1AG9A 1FS4A 3CH4B 4HV4A 3EMKA 1WM1A 4OK5A 3ZBPA 3IUBA 1M7GA 2CF5A 3IXLA 3E7WA 1M1YA 1HYGA 4PCAA 3RSLA 2XPCA 4OSOA 3ZLVA 4KRGA 2I8AA 3WRVA 4E88A 5HS4A 1XTUA 1KDVA 3RO7A 1O94C 4EG3A 2P91A 4XRGA 1UPXA 4GW3A 1XP8A 4C7OB 2FEOA 4J16A 3A9WA 1W6UA 2DE0X 3PTAA 1G1MA 1B0UA 2FB9A 4FDAA 4KMOA 3SYKA 1LLCA 1VCNA 3A1VA 4DA6A 3IVAA 3KHSA 1L1EA 4JIGA 3GJXC 3W6UA 1C8VB 4PWZA 5DO9A 1Q19A 1Z68A 4RXTA 2Z9BA 4JL8A 4JOBA 4UPVA 4WCVA 4XGQA 5AXBA 3GUHA 3ZHZA 4YT4A 4ZYLA 4NTZA 1EVZA 3VX4A 3I2FA 4BLSA 3ZV4A 3SJUA 2F59A 3H5NA 5TQ0A 1AQJA 3TRFA 3IPCA 3MMNA 1O96A 4UATA 4Y2UA 1RC1A 3QTLA 3ER6A 3LHFA 4WZBA 1GDTA 2Y05A 1SD5A 1ZRMA 1SY7A 4QDTA 2R00C 2ZUCA 3VAAA 2G70A 3PR2B 3S55A 4N48A 5DYIA 5H81A 1KDTA 2B6NA 2EOAA 3N8IA 4MR9A 5DEOA 3NIGB 3H86A 3GLHE 5FWDA 5E95A 4AJIA 1T0UA 1P7WA 3T3EA 3OJ0A 3ZDQA 4EMSA 1IPHA 2XCOA 2XNKA 1S4MA 1V47A 3FNRA 4YCLA 3Q3HA 2BP7A 4YRDA 3T4EA 3HI4A 3UMBA 4DABA 2RGWA 3DTVA 2JDID 3NHAA 1SZJG 1XL1A 1NR7A 3OA0A 3QITA 1RJ9B 4MUNA 4L1KA 3W2TA 4MA4A 5IYZF 4TKUB 2QRVB 4PYMA 1RM0A 5IABA 2OXRA 4IJQA 3UW1A 4ZMRA 1Z4KA 5REQB 3H2BA 4IMJB 5JSZB 6NULA 2HK7A 2WIAA 4Q9IA 1EK2A 3CW2A 5FR2A 2EP8A 1B3RA 3DE5X 3EQ7A 2BJHA 3OKFA 3R5SA 2FWPA 4KUHA 3N2ZB 1EK0A 2QXYA 3RJTA 2O2HA 3KZCA 3AGPA 4OHWA 3WO1A 1LDNA 2ZTMA 3EVBA 4KLAA 3NAQA 4LF6B 4L7QA 3G5MA 5SY4A 1NNEA 1K75A 4KYIB 5FPSA 4EJSB 1PBNA 4L4YA 4BMOB 4C0BA 2FSVA 2ZETA 3ZVNA 2VL7A 2P9BA 1NPTO 2R25B 1K7SN 2SICE 2VHVA 3JQ9A 3FPJA 3KVRA 1R0RE 2GN4A 4HDSB 2CXUA 4M38A 4TRRA 1VE5A 3SR3A 1B14A 1H6BA 2YXLA 4N47A 4CMHA 4ZI2A 3RIXA 3VQTA 1TXGA 2ZUBA 2QPAA 2ZW9A 1LFDB 3EZGA 4KZPA 4H17A 3TEJA 2X4LA 4MWOA 4RK0A 2CFCA 2VATA 4H6PA 4OY3A 1ETHA 4YVFA 5EWJA 3UMGA 4BLOA 5BSGA 2ESRA 3S5JA 4XVUA 3CXUA 4JZYA 5HDBB 3WP1B 1W4LA 2EERA 4LYHA 1N7GA 4C3OB 1DG3A 1QK5A 3R0VA 3SVTA 1BQ3A 2L0XA 1SJ9A 5DWQA 4X1YA 2DQ4A 2FMFA 2J9XB 4DCNA 5C1DA 4K1LA 5BSFA 2EATA 1GADO 4E1VA 3N86A 1GITA 1ZPDA 4OCZA 1E6LA 3CIFA 1FQKA 2R6CA 1LPSA 5DLEA 3WNDA 3A7EA 3G88A 3TUIC 1IYZA 2HRBA 2R66A 5K20A 2X14A 1PHPA 3KHKA 3GAMA 4M9CA 1LSSA 5L3QA 1ZOOA 2QBYA 3I42A 3MERA 1E3DA 2CEKA 3U2QA 2Q4RA 4N7BA 4Q21A 2NP6A 3KT6A 2K5UA 4I46A 4QFMA 2XOKD 2BDTA 1U3CA 2NTNA 5DLDA 3VPSA 5I7FA 1IULA 4IPTA 3V8QA 3G8DA 1Z16A 2O23A 1PN3A 3IQIX 1Q21A 3PNBA 4BIIA 4Y2JA 1QGOA 3PHIA 2IDMA 3HDQA 1FJXA 4N5HX 1GG2A 1KJNA 5FB3A 3AL3A 1JKIA 3IUYA 2PCJA 1JLRA 5JNVA 2BF7A 4DVJA 5BMVF 1JJIA 1WPRA 3V34A 4IQ4A 4N0MA 1QG4A 1OLXB 1SVOA 2CDBA 3FSJX 3HCEA 3K1AB 3DOOA 4I3GA 1ZJZA 4EKGA 4ZYYA 4Y2TA 4ZVSA 1SM4A 4LZPA 4HYYA 2ZRNA 3SXPA 4AP6A 2WFAA 3BKXA 2VBGA 3H5RA 2HRQA 3NANA 1A71A 3H04A 4GMKA 2ZJ7A 1E1QD 2ZIVB 2GJSA 3P96A 2IFTA 5B1YA 3WNBA 1NMYA 3THWA 3ITDA 1QGED 3ASVA 3EGOA 2W6OA 3L7CA 1K68A 2PMKA 4S1TA 4M0CA 4PX2A 5I4KA 2EKQA 3ZNOA 4QWWA 3AXSA 4FMDF 4ARZA 3CX6A 3ET5A 5EIBC 4V38A 1IVSA 1YI0A 4AMBA 3D8HA 2PM8A 1JYEA 1SVUA 3LUFA 3GNLA 5LOVB 4YMSA 1R88A 1QVZA 2J3EA 3L41A 4JWTA 2QHXA 5D8DA 3VC1A 5TR9A 3QU7A 3QLTA 4CJXA 3CTMA 3BB1A 2QJWA 4ZCQA 3LQ2A 2WJAA 3IS3A 1RHJA 2JJMA 3OO1A 5T3UA 1PNVA 4AZ3B 2QS9A 3C5WP 1X94A 3GDGA 4ZHQA 3GEBA 3GOQA 3D2CA 2BF4A 4XD7A 1HFKA 2GNOA 1X7HA 1ZC3A 1TKBA 1F5NA 1E0KA 2OV8A 2CVQA 3BZBA 3N8GA 5TMDA 4O1MA 4CR6A 1DL5A 1H8ED 5TJ9A 3O3OB 3FSEA 4NMHA 4ZOCA 2HJGA 1XMIA 2X2EA 3PQ5A 4MNTA 4O1HA 3URMA 1SB8A 2H48A 2IGTA 3QNUA 5KNCA 4GH5A 3V4RA 1XQVA 3ROQA 3TKYA 2PUEA 1F60A 1PQ4A 3G2NA 1ECCA 3NHRA 1H3FA 1VBKA 1Z6GA 3PI6A 1HLFA 4J0HA 3ZE2B 6ADHA 3K6SB 4OKSA 4EG1A 1OIVA 1RT9A 1WV1A 1OLUA 3IA7A 4K46A 4CFYA 4K6GA 4O2BF 5CR9A 4AICA 5JI2E 3H3JA 1ZICA 2VHJA 1WSDA 1V9CA 2PXXA 3A1TA 3FPCA 4LUCA 5BN5A 3VHLB 1KZ4A 3SS8A 3KEQA 2WQ6A 1JB1A 5DCUA 1E9SA 2AFIB 1H5UA 4YRMA 1H94A 1GNSA 3TQOA 3UOAB 5LMCA 3DUWA 4NOMA 5G0VA 2G1PA 2GTPA 3P71T 3O4HA 1DC3A 3ITEA 5JG7A 2G7MC 3K92A 3E9QA 5E8RA 3AM4A 3UT5A 2X5OA 1IZ0A 1P7CA 4FHZA 3L40A 4U6SA 5GZ6A 3WI7A 2UVQA 4M9ZA 5LBIA 3SIXA 1REQB 3JQAB 1G8HA 5CFRA 1IMJA 3EIEA 5HUQA 5NLLA 3FN4A 3G2JA 1XJWA 4DR1B 2O8EA 4MVJA 1JFVA 3ZX4A 3CLKA 2XE6A 1HA3A 2BI4A 3A3YA 3LUCA 3QHQA 4EA6A 2O20A 3AHFA 2AL7A 2AR7A 4M1OA 5DBOA 3UHPA 1B93A 5LXTA 3U62A 3F7NA 1DZ3A 1HDEA 1I4LD 4J29A 4L3OA 1I7LA 5F1PA 1JT9A 3GH3A 3LWDA 1OU4A 2BH2A 2EJTA 4DR4B 1R8QA 4NESA 3EXHB 4MLCA 5FPYA 4B84A 5AW1A 4KYVA 4DR7B 1SOAA 2P4UA 4LF9B 1FVHA 4FFPA 1CP2A 3G2QA 3JX9A 4P53A 4E3ZA 4YHHB 1UKCA 5LLDA 1PR1A 1WVIA 3ZHRA 3THYA 3GPDG 5AM4A 1FW6A 5B1EA 3KWFA 3OD1A 4B1FA 1DHTA 4BZPA 2ZEJA 2Z2XA 2DLNA 2XKJE 4IDBA 3T1HB 1XXHA 2QX8A 1MO4A 1V2GA 5IUNC 4EHDA 2YL2A 2BMAA 4G8DA 4YJGB 1EUZA 2AI2A 3ORQA 4ZVVA 2OA0A 4L78A 4WKCA 1R2QA 3FY4A 3GH1A 1IBLB 2E6KA 2BAGA 1U2GC 1FSZA 3GNSA 3KPVA 1WOMA 3O21A 4GQAA 3TCKA 3V9AA 5JUWA 5HGXA 1J9EA 4AY3A 1M2GA 2R65A 1IU9A 5I5EA 4G37A 3Q8KA 4HNSA 4C6TB 5K8LA 1K5HA 4PAQA 1AV6A 1VHQA 3OJFA 1ILWA 4NU0A 1AV7A 3VO8A 3AR4A 2DTXA 2YN0A 4XJVA 3EXG2 4FUQA 5DGXA 4ZQBA 1KU0A 3K0HA 4E0BA 2YHSA 1E9RA 5CB4A 2XUPA 3NB0A 4L8FA 2Q1TA 5AVXA 5CM2Z 2IS4A 4R7GA 3EAGA 2VWGA 3WLRA 2G8NA 2IHKA 3KZOA 1YMUA 1RZRA 3F9CA 3IPXA 1T2UA 2GJ9A 2YZGA 3A9TA 5E3IA 3LXUX 5JNSA 4LW8A 1F1JA 2ZTHA 3C8MA 1ZH0A 5HKKA 4L75A 4OA8A 4MUIA 5A4MS 5CLFA 4ESVA 4R1TA 1RLOA 3OQPA 5HVNA 3LE8A 3PA8A 4WNCA 1N78A 3FD8A 4I5DA 3HRKA 5C3MA 1MEEA 2AMJA 2CNDA 2XTZA 4Q1VA 1AS2A 3O8DA 3A9CA 2NM0A 4UZFA 5LKRA 3KJGA 2C61A 2V6FA 3ABQB 1VKJA 1X2BA 2Q9AA 1BGWA 3L18A 1KQNA 5IFKA 4J4BA 5FI0B 4RJLA 3OF3A 3OE5A 1A69A 2WEKA 5JE8A 2JIQA 2G71A 2WTBA 2HF7A 1TDJA 1I0IA 4QUHA 4OI4A 5DULA 4YCAA 1CQJA 1SR8A 3C3MA 3HA3A 1A7JA 5IDVA 5IN5A 3FWYA 1TZ2A 4JU8A 4QDZA 4BDSA 5JDIA 1FNNA 2ZP1A 1P0MA 1Q5PA 1J33A 2X58A 2Z4RA 1NUHA 4K1XA 1OI3A 1WB6A 3CWCA 1GL7A 1P62B 2D74A 4WK4B 4POOA 4UBLA 3C7TA 4OO3A 4MP6A 1OXUA 2XVMA 4XVHA 5E7QA 1OBFO 1KZ1A 4O6VA 3PE4A 4DWVA 2C9MA 3NETA 5EN4A 4JP3A 5FOVA 4WGFA 2VHYA 1ULUA 4L9SA 4H7JA 2FY8A 2OAEA 2HU2A 4KLNA 1QIEA 4QUIA 4ZVMA 3RG8A 3SG0A 4EGJA 2PSHA 2XT6A 3PRKE 7MHTA 3PHJA 5DIZA 3FNEA 1EXDA 1Q12A 4ERXA 1XQYA 1EFAA 1T34A 3PD1A 3IT3A 3NJ8A 4MUXA 2H4XA 3RVQA 2X9LA 4PCVA 1G6HA 5AVUA 4TV8A 3JU3A 3LU1A 3MWGA 5FEMA 3U31A 4GX5A 4YONB 3H4VA 2CFIA 1Z56C 2I0FA 1Q74A 3GB9A 3KR0A 3PQ7A 3Q85A 5EKXA 1E7QA 4K9PA 1NZFA 4OJNA 2ECQA 1QHXA 3H0EA 1JA0A 3GFSA 3IDOA 2G0NA 1UK9A 3T9AA 4CKEB 4LHZA 1JI0A 2DH5A 2RC5A 1M1YE 1PJRA 3HJGA 2A88A 1LS6A 3ULKA 3CNBA 3KKQA 1N2OA 1ELOA 4QYXA 3GAFA 3PC8C 4LDRA 4H3HB 3VKFA 1N57A 3QBDA 4RVOA 4NXNB 1RYZA 1U0NA 4TLLB 3HXLA 5LIRA 1L7BA 4TSFA 1HWYA 3HB1A 5CDFE 1IJEA 5KCZA 2XA9A 5H3CA 1RHKA 5KX5A 2OCKA 2R7NA 2X4GA 1GPLA 1LX6A 3RK4A 3S2GA 2GCPA 2GD0A 1XQ6A 5I7VA 1AU9A 1WSAA 4MRSA 1T35A 3CZQA 1JYSA 3ZI7A 4ZDIA 2AZDA 2NU9A 4UBNA <