3R3ZA

Crystal structure of the fluoroacetate dehalogenase rpa1163 - wt/glycolate
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
304
structure length
304
Chain Sequence
GHMPDLADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHDRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIAQSAATPLDVWRKWASDVQGAPIESGHFLPEEAPDQTAEALVRFFSAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping the reaction coordinates of enzymatic defluorination.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Hydrolase
molecule keywords Fluoroacetate dehalogenase
total genus 117
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r3zA00
5CT5A 4IH9A 1Y7HA 3C5VA 4WFKA 1NU6A 4DNPA 1X70A 3H2IA 3WZMA 3G0IA 1EXWA 1LNSA 2JGMA 2PUHA 3GELA 4I4CA 1XZAA 5JD5A 3IUNA 5ESRA 4NS4A 1XZGA 1CUUA 1NX9A 3EQ8A 5D3KA 5HK9A 1ZD3A 2HFKA 4UHBA 4FLEA 1UK9A 4FNMA 1NU8A 1QO9A 7YASA 2XQKA 3QVMA 1N8SA 2QRUA 4QNNA 2VJBA 2H7XA 3HEAA 3C87A 4B84A 1LPNA 1EX9A 3M81A 1QIFA 4EY4A 3O4IA 2HL6A 4MWTA 1CQZA 1FFAA 2I3DA 4QDTA 5IVKA 3V1MA 1YB6A 1FFDA 2ACKA 2BCEA 5JARA 1XRMA 2WG1A 3STUA 1ZI6A 5ALRA 3MGAA 5C7YA 3SX4A 5CTAA 2Z8XA 1GKKA 1UOQA 4DYHA 2BFNA 4J03A 5IVIA 1ZJ5A 4G5XA 3ZLTA 2PUJA 2ZYIA 1Y7IA 3FOBA 3ESDA 5A62A 5DYYA 2XMGA 4FLMA 1UK7A 1TK3A 4FOLA 2V98A 4X6XA 5DWDA 1D07A 3LLCA 3F98A 4PSUA 2O2GA 4KACA 1ODTC 2OCLA 1Z68A 2XLCA 5HF6A 4MXDA 4F0JA 2O7VA 4G4IA 4W63A 2WIGA 3RM3A 4YX9A 1JMKC 2QXTA 4Q3LA 4X85A 1A7UA 2CKMA 3IDAA 2ES4A 2WIFA 3DJYA 4LXGA 5C81A 1EDEA 2XMZA 3B5EA 3ZPXA 1PV1A 4JEIA 4L9AA 5BWCA 4U2DA 2GZRA 5HQ3B 2WG0A 5AI8A 1GPKA 5D3ZA 1SC9A 3OOSA 4AQDA 1YA8A 3WQHA 5AKIA 1QIIA 1ZD4A 4BDTA 5C8ZA 1YR2A 3M83A 3PFBA 1CPYA 2JF0A 4QLOA 1JJIA 3EQ7A 4AO8A 5ALGA 1HPLA 1UKCA 1CUIA 3VISA 1YB7A 4AB1A 4WJLA 2C5GA 4U2FA 1U4NA 4H7HA 1FFEA 3FYUB 2JGFA 2HU8A 3QITA 4BAUA 1WB5A 5BWBA 1DTEA 4FTWA 5CT9A 4ITVA 1BCSA 3GZJA 1H2ZA 3V1KA 4A23A 1YSCA 4OYYA 1JMYA 4U2BA 4X6UA 3WLAA 1UKBA 3WK5A 4DNOA 5AHXA 2WKWA 3C6XA 1LZLA 1G5FA 1QIEA 1TAHA 5HCUA 4KEAA 4ZXFA 4DMCA 4QWWA 2HA6A 4P92A 3I2GA 1QIDA 2OG1A 4XX1A 2PVSA 4B82A 1DWPA 5ALPA 4XVCA 5I8PA 4ZGBA 4LXIA 1EK1A 5CT8A 2EEPA 1OILA 5JAPA 2XUIA 5EFZA 1XRRA 5LZ8A 1MAAA 2HA2A 1LPSA 4WFIA 5T4HA 2WLSA 1B6GA 3BJRA 5ALVA 1H23A 3O4JA 2RHWA 3V1NA 4MEBA 5DTJA 1MTZA 2JGLA 4QDOA 3WJ1A 3MVEA 5AKZA 4EA6A 5AKHA 2I03A 3VVMA 3AJAA 1ZIYA 4KYVA 5HK8A 4QDXA 5FP0A 3AILA 4EBBA 5FRDA 5ALOA 2JGEA 1ZD2P 4OB6A 5E4TA 1CUYA 4BVLA 5ALMA 2ONCA 3FYUC 4KE8A 5LKAA 5T4EA 4Z49A 2JIDA 4AO7A 1FSSA 2QVBA 5JAOA 5ALDA 1K8QA 2C5FA 5BV7A 1DWQA 1QOZA 1E8NA 4G8DA 4J0IA 5EHQA 3JW8A 5AKLA 1J07A 3G02A 5FUMA 3DDUA 3AIKA 1AUOA 1E3QA 3WA6A 3ZWQA 1AMNA 1JU3A 3JYHA 3U0VA 5DTIA 3RK4A 4OU4A 3W04A 4P93A 3E0XA 3D2BA 4X7BA 1UKAA 3L1JA 4LKOA 4DMHA 3C43A 1XZJA 3FCYA 1WCYA 4BZZA 5LLSA 4BB0A 3SWWA 1T4MA 4KAFA 4ZREA 1AX9A 1QIJA 4UBMA 3D59A 4YPVA 4XJVA 4PQEA 5HF5A 3MUOA 2XMBA 5AI5A 3I2FA 1BEZA 2P8SA 2JBWA 2BUBA 4FFWA 4AZ3A 4B7ZA 2O2IA 3W2TA 3KSRA 2CB9A 4WDQA 3D5EA 1HKHA 3WWDA 2RGUA 1F0NA 5AK4A 5DNWA 4G8CA 2OXEA 4GW3A 3BXPA 3IUMA 2NW6A 4C4ZA 2XUDA 2WSLA 4K6HA 2BGRA 4B83A 3WL6A 1BE0A 5CMLA 2CEKA 4JYMA 4MJ3A 1JU4A 2WUEA 1ZGCA 1YCDA 5LZ7A 4BBZA 1J2EA 1EVEA 4D9JA 2Y6UA 4F21A 2C4HA 5AM2A 2WJ3A 1OXMA 1CR6A 5CW2A 2PL5A 2WFZA 1TCCA 3QMWA 2QXUA 4G9GA 5JANA 3TRDA 5SYNA 3I1IA 3F96A 4UBKA 1MNAA 2YYSA 4C01A 4BP9A 2ORYA 5SYMA 4DMFA 3TEJA 1P0IA 3SK0A 5AI4A 4OSEA 2QJWA 3FLEA 4QE3A 1JJFA 1XRNA 2QKYA 3DEAA 5A7HA 1IUPA 1DQZA 4P08A 2HA0A 3BIWA 2Y2UA 4GHWA 3CCCA 4X92A 2WTMA 3G8YA 1DT3A 2H7YA 1GXSA 2DFPA 3UUFA 4FLFA 5AK6A 1MAHA 3HZOA 5AKXA 2DHCA 2YXPX 4UHCA 5AKGA 2VF2A 5ALJA 3IUQA 3A6ZA 1G42A 1K6EA 1IZ7A 2AJCA 3STVA 1AKNA 3ANTA 3FNBA 3HLKA 4U2GA 4MYSA 3O95A 4H18A 4Y2SA 3VVLA 4LYEA 1H2XA 3OTQA 1LLFA 3I2KA 1HL7A 2CBGA 3B12A 4BE4A 2X76A 2OAGA 3HRHA 3LIPA 1W4LA 3IIIA 3G0BA 4IH4A 4UBIA 5FKJA 2PU5A 4B80A 1UK8A 4ARBA 2HRQA 5DNUA 5HF8A 4QDZA 1G66A 3TGLA 4KJXA 2VA9A 1ZIXA 4Q3KA 4HRYA 2XI4A 3H2KA 3GBSA 1QTIA 1EI9A 3O4GA 3DNMA 1MO2A 5CURA 2XQJA 4I3FA 1E89A 3IBTA 4K2AA 5HQ3A 1QFSA 4N8DA 5CXUA 3FLBA 2WU3A 2QM0A 1IUNA 1CLEA 3DOHA 1MN6A 2H9YA 4NVRA 1VZ3A 4CFSA 5I9IA 3R3ZA 1JFRA 2RI6A 1BRTA 2XUOA 2B4KA 3JWEA 1PFQA 1DU4A 3M82A 1K4YA 1JT2A 4KE7A 4V2IA 4N8SA 2J4FA 2V9ZA 3N2ZB 3KDAA 4FFVA 4CI9A 3IULA 2XUGA 3BF8A 5HKAA 4EY7A 4G4GA 3NGMA 4H7FA 1QIMA 1CUCA 4A5SA 3WWCA 4AMYA 4W9RA 5EI5A 1R1DA 3WKDA 2J3QA 5ALXA 5ALZA 2OAEA 3BJMA 2WU4A 1ACLA 3H0CA 1JKMA 4WY8A 2ZYHA 1CUGA 3BDIA 2QZPA 5HF9A 1A8QA 1EHYA 1QZ3A 2ECFA 4C87A 2XMDA 1DINA 4BRSA 2VT7A 2QMQA 2O2HA 3NUZA 4BCDA 2XQFA 3G7NA 3VJKA 1C7JA 2HM7A 3WK9A 2R11A 2Z3WA 3VKFA 4XIIA 4UFNA 5FXMA 4BAZA 5JYCA 2HHAA 1MPXA 3WL7A 2D5LA 3LCRA 4Y2YA 4UFPA 5JAHA 4AN0A 4IH1A 1BS9A 3DOIA 3WJ2A 2OQIA 4W1RA 1XZFA 3O0DA 3WKAA 1LBTA 4RPCA 1XZHA 5AKYA 3ICVA 1CUSA 5ALUA 4P9NA 3DL7A 3HACA 1QIKA 5ALHA 4WFJA 1BROA 1XQVA 2W6CX 2JGKA 3I1YA 3R40A 1LPAB 4FKBA 1O6GA 5CT6A 4C6HA 1Q0ZA 5A7FA 1TQHA 4H77A 1AURA 2XDWA 5ALIA 2G4LA 1VLQA 3W9BA 4HTAA 5LZ2A 3ESCA 3WK7A 2HIHA 3L1IA 4EB0A 1EB9A 3TJMA 3B3QA 3S8YA 1XROA 2EDCA 2WUGA 3DYVA 4ROTA 1SFRA 5AM1A 4UHEA 3F67A 2GYVA 1XKLA 3H1AA 5JD4A 4EY6A 1SCKA 3OG9A 2QR5A 2XMCA 2LIPA 2PX6A 1CUXA 1R88A 3AIMA 3EIOA 3S2ZA 4RNCA 3QPCA 5K3FB 2AJDA 2PBLA 5ALFA 5IH7A 2C58A 4G8BA 2CZQA 1A8SA 1Q0RA 1K63A 1P0QA 3ESAA 3ILSA 5JAUA 3R0VA 5FV4A 4YASA 4OPMA 1ODSA 4CCWA 3EF3A 4B6GA 1R9NA 4CIBA 5JIBA 3QH4A 1A88A 4DMKA 3AFIA 5AM4A 5JZSA 1QFMA 2GBCA 2XE4A 2ZJ7A 2V96A 4BCCA 4Y2VA 1LGYA 3UMJA 2I78A 1R9MA 3WL8A 4RE6A 3BE8A 3IA2A 4X00A 1J06A 1AQLA 5H3HA 3H17A 3GROA 4FDMA 5K3CA 5E4YA 2OGSA 1BN7A 4KE6A 1YA4A 3STWA 1WPRA 1J1IA 1XQWA 1AGYA 4AN1A 2BUAA 3OC0A 3QPAA 2JGJA 2J3DA 1F0PA 4AXBA 1FFCA 3PE6A 1ZI8A 5T4BA 3R41A 4N8EA 4DSAA 3LS2A 5ALWA 4Y2JA 5I7UA 1EDDA 1THGA 5T4FA 3RLIA 1QLWA 3FVTA 3FAKA 1UK6A 3FBWA 1VE7A 1F8UA 2HRRA 4N5IX 1VXRA 3R3XA 3A70A 5CBKA 2AJ8A 1LPBB 1WM1A 2WFLA 3QMMA 3O4HA 2YH2A 3G0DA 1CEXA 4X3CA 5D7BA 4DM7A 4KAJA 2XUAA 5CT4A 2XUFA 2WHPB 1BCRA 1KU6A 4W1SA 3R3WA 4OCZA 3QMVA 2PSDA 2B20A 2EDAA 3I28A 4W1QA 4J0GA 5AM5A 2OGTA 4UPDA 5ISMA 4XWGA 3QM1A 4NMWA 3D3NA 5IVDA 1CUHA 3I2IA 1GQRA 5CH3A 4FNGA 4Q1VA 3RKSA 2ROQA 3WK4A 5CRIA 4DLNA 1LPOA 3GA7A 4LHEA 3UUEA 2PSEA 3EQ9A 5LYYA 5LZ4A 2PPLA 4F5ZA 1PJAA 4WDRA 4BTVA 4INZA 1UT6A 4O08A 3A2NA 4N5HX 1XZIA 4GWLA 1W76A 3HYSA 3K6KA 4J0KA 1Q83A 1N5RA 3FSGD 3FSGA 2AJLI 4JH0A 4QLAA 2D0DA 4J7AA 3QBJA 1WOMA 1XLUA 5A6VA 2XMQA 3G9UA 2QS9A 3D0KA 2BKLA 2AXEA 5AP9A 2QT9A 2WG2A 3DKKA 2JGIA 3DL4A 4BC0A 2GBGA 2HU7A 3WWOA 4AMZA 4Y2XA 4IHAA 1W52X 4PW0A 4Q05A 3V9AA 2XMSA 1XZEA 4GECA 4J0HA 4H7DA 2PSFA 2CUTA 4L0CA 5BOVA 3D2AA 3EBLA 2ACEA 5EGNA 5FLKA 1CQWA 3F9CA 5K5EA 2WFMA 4DNQA 1ORWA 3C45A 1P0PA 4MEAA 5KWIA 4UUQA 5F4ZA 2XUKA 2CJPA 5ALYA 4L3WA 2VEOA 1JJBA 1UOOA 3E1GA 4KRYA 2K2QB 1RP1A 1UZAA 1XQYA 1VE6A 2C7BA 3IUJA 1CUJA 1UXOA 3A2MA 4Y7DA 3I6MA 5AKEA 3R3YA 2DHEA 4J0JA 1WB4A 2PU7A 2VJAA 4ZV9A 2UZ0A 3ICWA 1C7IA 3PUIA 5AOAA 4A16A 1ORVA 2X8BA 1M33A 3L1HA 1N5MA 1XLVA 1GKLA 2QOEA 2H7CA 1QIHA 2DSNA 2G5PA 3DCNA 3M3DA 4U2EA 1THTA 5HKBA 2VT6A 2VQ6A 1XFDA 1TCAA 4HXFB 3G9XA 4AX4A 3QPDA 1DT5A 3KWFA 3PICA 5DJ5A 1YASA 2ZSHA 2DHDA 3AIOA 4L72A 1DWOA 3ZI7A 2OCIA 1VOTA 3WKEA 4QA9A 1YS2X 5AICA 1XKTA 3KXPA 2Y2VA 4JYPA 4BZWA 1H22A 3VJMA 4E46A 5AH0A 3DS8A 1CUVA 2ZSIA 3QZUA 5ALTA 3STXA 3DD5A 3WYDA 3I6ZA 2X5XA 4Y2UA 2RHTA 4C4XA 3WIOA 2VATA 5AIAA 4B9EA 5LZ9A 4LYDA 6YASA 1B41A 1K5PA 3C8DA 1CUZA 3R3UA 3AZPA 2QUAA 5AOBA 1ZOIA 5DYTA 4BE9A 4KE9A 4H7JA 3PF8A 1EK2A 1CUEA 4CCYA 3C70A 4PO3X 5EIEA 1ZI9A 4BVKA 1MU0A 4CIAA 3WWEA 3LP5A 1JI3A 3DYIA 5HZGA 4MQLA 4MYDA 4OD0A 1E8MA 4ETWA 2FX5A 4EUSA 1UFOA 5CH8A 2XUHA 4PSDA 5AJHA 2O7RA 1VA5A 1LBSA 4DTCA 4H0CA 5AIBA 1DX4A 5JD6A 3C6YA 5AKJA 2QTBA 3DKRA 5EIHA 3WIBA 3DQZA 4CG3A 2BJHA 2WIKA 5DYWA 5K3BA 1MX5A 1MX9A 2WTNA 2IITA 5AI0A 3WK6A 2HFJA 1GPNA 3D2CA 1CFJA 2HA7A 3DLTA 3H1BA 3HJUA 1IMJA 3LIIA 3H2JA 2RONA 2Z5GA 5D6OA 3W9UA 3D7RA 3I2JA 4Q34A 5CXXA 3KOOA 3OM8A 3C8HA 4K6GA 2OCGA 4FBLA 2J4CA 5K3DA 3F97A 1KU0A 2DQYA 1YAHA 2ZVDA 3NWOA 2GBIA 2Y1KA 4C88A 3E3AA 3AINA 3ZLUA 3FLAA 4K6KA 1E66A 3BIXA 2VTVA 3PUHA 2BGNA 4UFOA 5J3JA 2E3JA 1LPMA 2B61A 2XT0A 1CUDA 2JEYA 2BUCA 5DNVA 1IZ8A 4OUKX 2HDWA 1EH5A 5CH5A 3AZOA 1YS1X 4C89A 1Y37A 1H2WA 1LPPA 4UHFA 3N0TA 4M0MA 1XQXA 4X93A 4ZI5A 2VAVA 2PKYX 2JEZA 5FDFA 2FJ0A 4CG1A 4UHHA 2WHQA 1R50A 2IX9A 5E4JA 4EZIA 1H2YA 1N1MA 1RYYA 3VXKA 5E2IA 2H1IA 5LKRA 5ALNA 4Q3OA 1ODCA 1SOMA 4EY8A 3PFCA 4BATA 1USWA 1ZJ4A 4BRZA 1DX6A 1KEZA 1ETHA 3RARA 3V1LA 4UBJA 4GLBA 2Z3ZA 2R8BA 1HDEA 3D4LA 1BN6A 4YK7A 2G5TA 2HU5A 2QJRA 5JATA 1XZKA 1UWCA 1GGVA 5AI9A 1GQSA 1XZMA 1YAJA 3STTA 2C0QA 4H7EA 5KBYA 1CUFA 2DR0A 3WA7A 4X71A 1L7QA 2VJDA 3KD2A 4B85A 1IUOA 1FFBA 2XUQA 2ZYRA 4H35A 1EA5A 3V48A 1XZCA 1MX1A 2VSQA 1LZKA 4KAAA 2Z8ZA 4JNCA 4BC1A 2YASA 2WUDA 3FWHA 1MJ5A 3KWJA 1VJ5A 4LIPD 2HA3A 2VAXA 3HI4A 3WI7A 2ZJFA 4X6YA 5AM3A 1XRQA 4AZ0A 4HVTA 1CV2A 4KRXA 4QEKA 5C8XA 4NZZA 5K3FA 2HADA 1BEEA 4Y2QA 3GFFA 1XLWA 3U1TA 2WM2A 5FOQA 1IVYA 5AM0A 2XQIA 2QUBA 4C4YA 1EVQA 1L7AA 3C6BA 1FJ2A 3MUNA 1ISPA 5ALSA 2BAGA 5JALA 4KR0A 5IKXA 5ALLA 1MT3A 3E4DA 4J3JA 2XUPA 2VJCA 4ARAA 4U2CA 1RWQA 2WJ6A 4PV7A 2WHPA 5JZ9A 5EIAA 4ZWNA 4UBNA 1HQDA 1VA4A 1CRLA 1Q84A 2ZYSA 3H18A 2G63A 4J0CA 1QO7A 2GYWA 1HLGA 4GBGA 1I6WA 4UHDA 3ZLVA 4WCVA 4E14A 1G4HA 2I3ZA 1CVLA 4AO6A 3Q8WA 4TPKA 4B0PA 4G9EA 3P2MA 4OB8A 2OLEA 5ALKA 4DNFA 3GUUA 2GBFA 4E15A 1CIJA 4MWSA 4X97A 4PSCA 3WYNA 2OCKA 2XQGA 3HABA 4X91A 3SC2A 4FHZA 2WJ4A 5AI6A 4GEGA 5EHXA 4G4JA 5ALQA 3A2LA 3O9VA 1WHSA 4J0DA 4HRXA 4MQMA 3WZLA 5KREA 3G9TA 2RIPA 1VZ2A 1UOPA 1CUAA 5A7GA 1QE3A 3G0CA 4Y2TA 4X90A 3BDVA 1XRPA 1L7RA 4BYMA 3R3VA 2GZSA 4OU5A 2WHRA 1O6FA 1ZD5A 1CUWA 5LZ5A 1EB8A 1P0MA 3CN7A 4BCBA 5EHNA 4TVKA 4CG2A 3FYUA 5A2GA 4UBLA 5JASA 3HSSA 4HXGA 2ZJ6A 3HC7A 1ZICA 3I6YA 1TCBA 3W06A 4WY5A 4BTLA 3PI6A 2HA5A 1XZDA 4FMPA 1VXOA 1C4XA 2XMRA 2XB6A 1U8EA 3ANSA 3ZV7A 1WB6A 2OGZA 4QWMA 5KWJA 3I2HA 1EDBA 5IVHA 1ZGBA 2OQVA 2AJBA 1E5TA 3OPMA 1S8OA 2WQZA 4IO0A 3K9BA 4OB7A 2Q0XA 4M0EA 1X2EA 3CCBA 1CUBA 3H19A 1U65A 2CMFA 5LIPA 1GZ7A 2WUFA 1A8UA 1SCIA 1BU8A 3VDXA 4B81A 4BP8A 4OYLA 1W6RA 5JZBA 3YASA 1OCEA 3WK8A 3QYJA 4GI1A 3FCXA 5AKKA 4H7IA 4W1PA 1XZBA 1TIBA 2WIDA 2GYUA 2WFLB 4HS9A 1X2BA 3IVMA 5AO9A 1VKHA 4HAIA 1QIGA 5JADA 2W22A 1R4ZA 5K3EA 3ED1A 5AK3A 4QZVA 2Y6VA 3BWXA 3O9MA 3C5WP 1U2EA 3CXUA 1XRLA 3H2GA 5A71A 4M0FA 5LP1A 1TRHA 1AC5A 1QGED 5FPPA 2XUJA 3NOXA 4BAGA 5FPQA 2C0PA 4LXHA 4F60A 1DQYA 2XLBA 1W75A 2IIVA 1T2NA 2WILA 4Y2PA 2FJPA 1QJ4A 4B9AA 3H04A 1TKRA 5YASA 1GT6A 1GPLA 3PDCA 3X3HA 4BVJA 1XZLA 4Y9SA 3T52A 5DLPA 4DSZA 4IQ4A 3W05A 4Q82A 4RE5A 4JUIA 3WKBA 1AZWA 2PSJA 4HZGA 4UBOA 1ACJA 1QTRA 1WHTA 3WL5A 4E11A 2V97A 3AUKA 4B0OA 4H7KA 3FYTA 4X94A 4PF1A 1MNQA 3WMRA 4DIUA 2PSHA 4BDSA 5EHZA 3F8SA 3HXKA 4PNZA 4RGYA 5C8VA 1HBJA 4ZRDA 4GXNA 3Q0TA 1SCQA 4QDUA 4FBMA 2DQZA 3OURA 4ZV7A 2FUKA 3PF9A 5AOCA 1QONA 4K5QA 1EINA 3WWPA 2RAUA 3IURA 3STYA 3H2HA 3FVRA 4TGLA 4FWBA 3IB3A 4X95A 3WKCA 2HA4A 3C6ZA 4S0XA 3VJLA 3T4UA 2OPHA 4HXEB 4EY5A 5AK5A 3BF7A 1WPXA 3K2IA 4GDMA 4DGQA 2PM8A 2DCMA 1F6WA 3ESBA 4Y2RA 1W1IA 3CN9A 3BL8A 4I19A 5HFAA 4CCYB 1E8DA 4EHBA 2B9VA 5HFNA 5K3AA 3G0GA 1R3DA 5ALEA 2WIJA 3G9ZA 4G1FA 3AZQA
chains in the Genus database with same CATH superfamily
2ZR9A 5CT5A 4S2UA 2HJHA 3DBRB 1UDAA 1C29B 1YC5A 2MT9A 3E7FA 3FJOA 3G2OA 2VA8A 5FWDA 3NANA 4DDVA 1NU6A 4FYYA 1CD5A 3O1JC 4B1FA 4TTSA 3MJCA 4FNOA 4Q0MA 2I2FA 1LNSA 3U4IA 2OVBA 4N47A 1KO4A 5KTMA 2PUHA 2V7UA 4K05A 2A86A 1SELA 4NYMR 1XZAA 3OQIA 4XJTA 4OLJA 5FH9A 1D2HA 3SYKA 1XD2B 1CQPA 1KEEA 2H17A 2JJQA 3M6WA 3NTLA 2W2XA 5KHAA 5CVDA 1RWXA 3HBAA 1Y8RB 1LK5A 1XZGA 2Y8EA 2AMLA 4Y0AA 3T3GA 5DIFA 3GCXA 3MWDA 5I7WA 3QY9A 1CUUA 3EQ8A 1JBEA 5D3KA 4MVYA 2GHIA 4TTVA 5HIMA 5HK9A 2GS9A 1B2LA 2JGRA 4J94A 5I9IA 1GQ2A 2AQIA 3RK0A 4PYKA 3E9DA 2Q29A 4FNMA 1DFHA 1NU8A 2VH1A 1VJDA 3SZ3A 3OD5A 1U4SA 1VKRA 5C31A 1QZXA 4EUKA 4PGAA 3VO2A 2CVQA 1IOVA 2V9CA 3ND5A 5EXSA 2OY0A 5F7ZA 2OCAA 4B84A 1L3CA 3HP7A 3RFCA 3RWOA 3PLAE 3PFNA 4EK9A 1G4UR 1U2ZA 2OZPA 3GJ5A 4CKEB 3O4IA 1DDOA 3SS9X 1G8SA 3VYVA 2I8AA 2VS1A 2I3DA 2V7EA 3V6LA 3IV6A 2CBXA 4QDTA 1Q12A 2HB6A 4Z9BA 1KEVA 1GSIA 1H1TA 5B3AA 2G04A 4LECA 4D6PA 3T3NA 1A95A 1O96A 1YB6A 4JBIA 5CUQA 5E1OA 2X4IA 3RRFA 1QB7A 2IYVA 1FFDA 1JSCA 1R6AA 2ACKA 2YQ5A 3AF2A 4P7BA 1E61A 2BCEA 4I5FA 4OJKA 3UF0A 5JARA 1YDMA 1YV9A 3Q8MA 2O54A 3HCDA 1VBNA 3QG1A 1JDNA 5K45A 2ZWOA 5TB5A 4XH9B 5HOEA 4HEQA 1ZI6A 2P5SA 1QP0A 1EP2B 2UU9B 2FN4A 1PZNA 3QVKA 3SX4A 2VDKB 5CTAA 1SBIA 4X61A 4YRNA 3FZYA 2C9MA 1PZXA 2BFNA 3FSJX 2B8NA 4HUQB 4G5XA 1Q7GA 4LW8A 3ZLTA 4CQMB 3MHTA 1R66A 3TAHA 1H4SA 2IF0A 2CKDA 2EERA 5IUNC 2QORA 1NLFA 1MAUA 3DCYA 2I6GA 2DE0X 3C8MA 3PXGA 3WIEA 1Y7IA 3J7AC 2GFHA 3DMPA 3VR6D 5CA1F 3FOBA 3ESDA 3HGQA 3H6HA 4AJPA 5A62A 4DAOA 2R6JA 1Z47A 3L02A 1CJKC 3SQNA 4HFMA 3N9IA 1TLTA 3MNFA 3B1KA 3QYFA 3W6NA 1XELA 5KWJA 1GPYA 2IL1A 1HT0A 4FOLA 4MA0A 4Q7EA 3OVMA 5KJ1A 1D6JA 3VR4A 2XB8A 4OHFA 5CHEA 5FADA 1H1LA 4GOMD 1N2JA 4C03A 1V47A 1CRZA 4AJIA 1HR0B 8ATCA 4UM9B 4MUKA 4X7PA 3WLEA 3MMNA 5ADUS 1QKIA 2GLXA 3F90A 5DCYA 3VU0A 2OCLA 2B1JA 5HE9A 4LZZA 3M5WA 2OZVA 4IF4A 2BH9A 2X40A 1CERA 1ZW1A 2YMLA 4QOSA 4X8HA 3NBFA 4LJ9A 5HF6A 4MXDA 4UXJA 1UJMA 4MGHA 1G16A 3EMBA 4ER0A 1V7PC 4MVJP 1JMKC 3LLVA 4IUBS 4ALIA 1Q0UA 4ZI2A 3S2FA 3F3YA 1Y80A 3D64A 1RNLA 4X85A 2Y1XA 2FGJA 3CG4A 3I8XA 3IDAA 3QKUA 3R0JA 1XB2A 1ZW6A 2ES4A 1X0VA 1CY2A 3UATA 3HO1A 4LXGA 3S2IA 1FDSA 1X7XA 4D98A 2ZETA 5C81A 2WD7A 4CV1A 2J3HA 2XMZA 1Y98A 3RIHA 3B5EA 3TZQA 3QVUA 4JEIA 3WLMA 1TZJA 1QCZA 2NU7B 5DB4A 4L9AA 4E08A 4U2DA 5A4KA 1I1OA 1JLLB 2ZRCA 5GOZA 5BR1A 2GZRA 1TFRA 4RX1A 1XTVA 1GGEA 5FOWA 2GERA 3MJHA 4G81A 4JA0A 4NEQA 5AI8A 4C7BA 1J90A 4C76A 4NMXB 1RCTE 3H7AA 3OFNA 3G8DA 5FBZA 4XGIA 4PR0A 3R7WA 3DUFB 1WSDA 4XD7D 5THXA 3VHXA 3VR1A 5M2QA 3A11A 2X15A 3LBYA 1QIIA 1ZCFA 3IHWA 1B0UA 2XWPA 3T5DA 3DTVA 5ITZB 1V9LA 3JZMA 3PFBA 4YCLA 4DV0B 2BTEA 1FMCA 1M2NA 1XYYA 4MCIA 1JJIA 4WUVA 4M7PA 2EIHA 4FCTA 4GKBA 5BR8B 3RFUA 3FPGA 1ULHA 2Q2NA 1E2IA 4OX9B 3FFTA 3SZLA 1WMEA 1ODJA 1HPLA 2XTNA 1EFHA 1UKCA 5FEUA 4J91A 3VC2A 1W88B 5EJGA 1GLNA 3LC1O 1XP5A 3GMSA 4BNZA 2GFIA 2OV8A 1SXQA 4XX0B 4TV8B 2VBIA 1AKTA 3P9SA 1WXXA 1OKKA 1M8GA 3K94A 2F6RA 4XZ3A 1YH3A 1O8BA 2BDEA 4BKMA 3ADOA 1EBUA 4CKCA 3BREA 5HUQA 2QP9X 1EXDA 3DZJA 4LZAA 2COUA 3HDYA 3WNDA 2VHTA 3HCWA 3T8YA 4B33A 3RIEA 2WR8A 4JJGA 4MW9A 2QM8A 2R8PA 4Y0NA 1HE5A 5CT9A 5D2CA 2GD2A 1PSDA 2BVNA 2W0MA 3RIXA 4WXRA 1BCSA 3PB3A 4ZOLA 2NU6A 1H2ZA 3H83A 3IDOA 3VHRA 3V1KA 5A4FS 1JLSA 2GETA 5DSXA 4IP0A 2BY4A 4JT2A 5J43A 4O5OA 4U2BA 2ONZA 4X6UA 4OJYA 5A1JA 2QMHA 2F90A 4R16A 4E22A 1UKBA 5JHGB 1P9WA 3LPAA 5AHXA 1YTUA 2XTJA 5CDTA 4WLEA 4ZXFA 3IEIA 5BP7A 2FPRA 4CODB 5EMHA 1Y1KE 2GK6A 3MSCA 4YUYA 1T9GS 4IAOA 4P92A 3I2GA 1KPGA 2Y68A 5CGZA 3IDSA 4XX1A 2PVSA 1M76A 5J58A 4GOOD 5LQKA 1D9ZA 2IIQA 3G17A 3G2PA 3Q3GE 2EL9A 4IZHA 2OYCA 1DWPA 1MC4A 1SOWA 2UXDB 2C2WA 3WGIA 4ZGBA 4LXIA 3OPNA 4P35A 2WZCA 3TCKA 2J0EA 5CT8A 2PGJA 2EEPA 1OILA 1WZEA 5J2TF 2PD4A 5J2TB 2LE0A 3WIVA 3F6YA 2ZRHA 3V7FA 1ULTA 3OOEA 4HUTA 4O1IA 5EFZA 3UK0A 4WK2B 5LZ8A 1MAAA 1YUNA 4IKPA 3H9UA 5HRUA 1JQJC 2FRDA 4G2NA 4WFIA 1EFVA 1V6SA 4BGUA 4D0RA 1G20E 1JSLA 4UXIA 5AXBA 5TPZA 5FTWA 1T1EA 3BJRA 2PWPA 1C8LA 2JD2A 1G5TA 4N4AA 4M9SA 1NFRA 1Z4PX 2W5UA 3EY9A 1F0YA 2JVJA 4XDGA 4EKIA 1EWVA 3V1NA 4MEBA 4C3ZA 2EKZA 1MTZA 2DEUA 1KO8A 1IHUA 3EEQA 5DGXA 3EGDB 2JGLA 3GRRA 3QPBA 1H3EA 3GAAA 4QQ8A 2EGGA 4QYXA 1FSPA 5CNKA 4KIFA 2I6XA 3UWMA 3CR8A 4EA6A 4CFZA 5IVPA 2AWNA 1E6CA 1JLMA 1JXAA 1NW6A 2G08A 3AJAA 3MRXA 1ZIYA 3Q10A 1BG6A 1MIOB 1CQJA 2D0IA 4LXQA 4Y6QA 4EUHA 1K5HA 4G0ZA 1DAKA 3DLAA 4QDXA 4EDFA 3PNVA 3I52A 5IJ9B 3O74A 5FP0A 1NIPA 3NVMB 2WJVA 5HWSA 121PA 4GP7A 4B40A 2W2LD 4U4AA 1YBFA 3QOFA 1BYUA 5ALOA 1TA9A 2W2LA 3D6TB 4EGJA 1SHTX 3NOQA 3BRSA 4RAQA 2NUBA 1AV7A 1U9IC 2GJ4A 3KOYA 5CX4A 5CEFA 3BEOA 4YI5A 3W8FA 5KNDA 3V3TA 1R8SA 3MPOA 3KJFA 1T2FA 1G5PA 2O0JA 2BELA 1R6XA 3PQCA 3ZH2A 4UOZA 2GN9A 2I4MA 5AYVA 4C7VA 1LV7A 4G1BA 2KLBA 1ZEJA 3LVQE 3KFLA 3FCOA 1G19A 2MSDB 4UD2A 3KLMX 4I5IA 3RNOA 1KQ3A 3TIVA 3NVKI 2ZITA 3BXFA 9GPBA 1HMYA 4JODA 1N2BA 2DQKA 1C0EA 4GS5A 4AJ1A 1Y1LA 2CJFA 1AO3A 3RVKA 1FSSA 4QU5A 4UZSA 1LVUA 2ZP1A 2IEZA 3O8DA 4QNMA 1CY1A 1NVTA 1QBKC 4FN5A 1K8QA 4GNKA 4RD1A 4ARSA 3N07A 3C1AA 2QIOA 3CPEA 1DWQA 2I4TA 1XA0A 3PX2A 2IC5A 5L40A 1GKIA 3EEIA 5AKLA 3BL5A 1NQUA 3LCCA 3ZWOA 1NXOA 2J5BA 1U2DC 3Q6NA 3AIKA 3DPIA 3D0OA 1AUOA 2O8DA 2G1UA 3ZWQA 3F2VA 3Q7PA 4BV3A 5H4GA 5HYVA 4C4SA 1TMKA 5DTIA 3RK4A 4OU4A 3LT0A 3TUJC 1TC2A 1TZBA 3KKPA 5AVVA 1T6YA 2ZT6A 1G8PA 2CE7A 1K7YA 4FYKA 1L7XA 1WR8A 3D2BA 4L0QA 3P9CA 1UKAA 5FF9A 1NVVQ 4LKOA 1XRSB 4M1ZA 5KB3A 3KBOA 3AKEA 3DH0A 3QLEA 4NKRA 1Z08A 3L1UA 1WLSA 3C43A 1ZXXA 3QHQA 4DA4A 2DG2A 5LLSA 5KJFA 5HE8A 1AX9A 2I3AA 4FD3A 2QLNA 4QBKA 4UBMA 5DNEA 2GEKA 5AW9A 1R4MA 2EW1A 4XB2A 3U7EB 2ZR0A 1H4QA 1E3DA 4BMXA 3Q9NA 2UYHA 4EZEA 4HAZA 1E2FA 2JBWA 2BUBA 2FQQA 5CA0B 2J6CA 1ZS9A 1OB5A 4PAQA 1C30B 3QJ5A 4TKLA 4BMVA 5ADHA 3W2TA 5L9AA 3L1VA 1YA6A 2W90A 2PXAA 1S6YA 3E22A 3KSRA 3PJGA 2VNHA 2CB9A 3Q72A 3SQOA 1CEQA 3D5EA 1HKHA 3VAYA 4RTSA 3EDOA 3KUCA 2OENG 1RJDA 1ZN7A 4R1NA 4YUXA 4LK3A 2I4IA 1DG1G 1BS1A 1HWYA 1J24A 4GOKA 5KHLB 2ASEA 1CDOA 1U11A 2NAFA 3HUTA 3IUMA 4E09A 1V37A 1NIJA 2AWOA 2YFQA 4C4ZA 2ZBUA 1P1FA 1SVNA 2FR1A 3N6VA 4ZVUA 2FW0A 2WSLA 2I71A 4X5OA 1N0UA 1I24A 3D7MA 4XVHA 1BE0A 4OOEA 4S04A 1PBNA 3I6BA 4DR5B 2P2CA 1SIOA 3HCNA 3ZDCA 3EPLA 4JYMA 4X7RA 5LMUB 3I6IA 3L4BC 3WFIA 1QC5A 2H5JA 2QEQA 4I6JA 3DZKA 4HDRB 1O97C 3F5SA 3T7CA 4ALJA 1YE5A 1M0WA 1YCDA 3I9V1 3LY8A 3SE7A 4IL5A 4BBZA 4DYVA 4D9JA 2RFLA 4OH1A 2C4HA 2IDJA 3TI9A 3ND7A 5AM2A 1HQKA 1OIXA 1Y34E 2PGDA 4L4XA 2UZ3A 3FUWA 1U28C 3KALA 3TZHA 2WFZA 3JQBA 3GJRA 4HPWA 1TCCA 1Z38A 1JHZA 1E9DA 3QMWA 5HS4A 3R9WA 1IZ0A 2GF0A 4G86A 1SOUA 1WCV1 5HX7A 1THMA 1BX1A 5DHQA 2CMHA 3C5EA 3EXG1 4LVOA 4A6DA 4XQ9A 3THWA 1G5IA 1AQNA 1JR6A 1DKLA 4NBVA 1KMMA 2DJ5A 3F96A 5F5LA 1ZAKA 3CPHA 3WOHA 1Z4MA 2GNAA 3B2NA 3CLVA 5GV7A 1GL7A 2FEAA 3T3DA 5BORA 2FXVA 1US8A 4E2WA 1Z63A 1GZHB 3BCUA 1M6EX 2DT5A 2G3YA 4QOHA 4ZVQA 2QRZA 4J3FA 3HYTA 5SYMA 3AB8A 2D0OB 4OGKA 2X8WA 2A4MA 1MB3A 3IPLA 4TKUA 3SK0A 1SCDA 3TEJA 3V4PB 2UZAA 5LQJA 1R6TA 1P75A 2BZSA 3MWEA 1FNNA 5JE8A 4JBHA 2CNKA 1FMJA 2V8OA 1GFSA 1P2FA 5F78A 2XOKA 1JJFA 3BMXA 4RDCA 4D8UA 1DKOA 3VSAA 5IKMA 2Z6QA 5A7HA 3V1TC 2VKTA 4WKOA 3VPAA 4CQJA 3IUYA 1DQZA 4HR7A 1R15A 2H85A 2XWJI 3AQIA 3QY0A 4WOBA 5FOXA 5KYKA 2D8AA 4LGMA 1T3LA 4MS3B 2AE1A 3BIWA 1AKMA 2Y2UA 4RZQA 4GHWA 3C5HA 5G0VA 4XIGS 2DSTA 4WK0B 3TFQA 2WI8A 3H2SA 1YI8A 1XK6A 2R4QA 3RADC 5G3ZA 1QLJA 2YQZA 4KNVA 8MHTA 2X3YA 2AXPA 1GUFA 2O2DA 1NR5A 3F49S 2QVZX 3N0WA 1YKSA 2LCIA 4IRUB 3AF5A 3O5AA 2ZSJA 4P31A 4FQ8A 1F6DA 3CISA 2WU8A 3PEEA 3D6MA 4FLFA 2FMIA 4J1TC 4UCFA 4Q4AA 1MAHA 3KJNA 5C80A 3D43A 3HZOA 2FUNB 4DRXB 3GOHA 4QXOA 4UQLA 5JYBA 2VIIA 3SVLA 2FG5A 3VBEA 3N87A 3SJCA 4CR7A 4QC2A 1VQ1A 3B8HA 5DCUA 1BXGB 4UAUA 5K3OA 3VPGA 4MROA 4G1UC 1DKNA 2BGKA 1EYZA 3B70A 4OQDA 3BAZA 5LPNA 2D5CA 1GP2A 2TMKA 2VF2A 4K9KA 2Z3VA 1XYGA 2ZIAA 4GMKA 4WIAA 4AVYA 3A6ZA 3CEMA 5I4CA 2BISA 3ETEA 3LHKA 1K6EA 2Q6KA 5DTRA 2FCRA 2ANBA 3NT4A 5ITVA 5LL6P 5LUBA 3MS4A 2WZQA 3WNZA 1UBMS 1R8JA 1KAGA 3MIZA 2FX3A 5FFFA 4UMVA 1NNUA 4JLNA 4LWOA 3T1QA 3AG6A 4DYDA 2ZRDA 4QVKA 4OJNA 1HRDA 4J16A 3OPYI 1J09A 1PJLA 1U8YA 2GBPA 4MYSA 4S12A 1SG6A 2DRIA 3KZOA 5H9VA 3T9DA 3ICEA 1UPAA 5GTDA 4F11A 4RXTA 2UZIR 1TQ8A 1OXVA 1U2PA 5B7NA 1IB6A 1EKXA 1JT9A 4TS1A 1SUSA 2NSDA 3PHBE 2FWBA 1ZN8A 1LLFA 2LTAA 2CBGA 3IX7A 4FEEA 3O84A 3W1VA 4Z4FA 2JDID 2NNLD 4FGWA 5BRNA 4JBGA 4NX2A 2Q4DA 1D0SA 4HC4A 3F5MA 3HCRA 2AG0A 2OP1A 1HEYA 1RYDA 2A6PA 3KSBC 4I1RA 3B6IA 3QA9A 2CXPA 2XD4A 4PPGA 5D5PA 1Z4OA 2FEOA 1U4OA 3SJAA 1IULA 5FKJA 2CLOB 1W1WA 3FVVA 3JWHA 2YJ6A 1UK8A 3WB1A 4V38A 4G5HA 5HF8A 1CZLA 2X1VA 3WGLA 4PU0A 4KJXA 1NN5A 1TVKA 2OORC 1G6KA 1HT1E 3EFBA 3KZXA 4M87A 2IS4A 4KDFA 3ZS8A 5AW8A 1A98A 2C8KA 1ATZA 4NPAA 2BSQA 1CNEA 2PMFA 1ZUD1 3CT4A 3IP7A 2XI4A 4BLPA 4UU1A 2W2NA 4Y1RB 5DTEA 1NVFA 3F7OA 4NMMA 3TN7A 1O4WA 1ISMA 2ZREA 4BTEA 1ATIA 2GPYA 4AIIA 2PO5A 3M9WA 3PFGA 5LP6F 3NQ41 4RKRA 2UZ1A 2XAAA 2RJOA 3HO6A 3JYNA 1F1JA 2VDJA 1NVKA 4QPJC 3UXHA 4HZUA 3HMKA 1T13A 4QJIA 2EW8A 4W6QA 1ZVQA 2XHEA 4QUDA 5F5NA 3VUFA 4N8DA 1FS6A 5CXUA 1RAEA 2YDYA 3DE3X 1HNNA 1XUOA 2GILA 3IUEA 4FFNA 2R6HA 2WU3A 3VV3A 2QM0A 3HNPA 1IUNA 3OM0A 3OZRA 3QE2A 2W4MA 1R0KA 1F2TB 2NZ2A 2D1SA 4V0OA 4M88A 2RI6A 1BRTA 3AY7A 1NF8A 2SNIE 4FYXA 3FGNA 4MRVA 2Q2VA 1RAFA 1CRQA 3JWEA 2UAGA 5EE1A 4B17A 4F56A 4QJ3A 1GV1A 3WYGA 2CXHA 2GO1A 1SHUX 2DH6A 1K4YA 3DJFA 3LUAA 1JW9B 1FLNA 4N8SA 1BVRA 2GD0A 2I29A 4J0EA 1V2GA 5CM8B 1AUPA 1JB9A 1A5SB 1YACA 4N03A 3UT5B 6LDHA 3BTOA 2VTDA 4CIYA 4TTQA 1AS0A 4IFEA 1MC5A 3C3MA 3FSRA 4RW0A 4OQEA 1U0OC 1DJLA 2CD7A 2JJ8A 1KH1A 2XUGA 3LNTA 4D92A 2VO1A 5BYJA 4URYR 2VJNA 4G4GA 1RM3A 5JNRA 4TYWA 3TW8B 1IYZA 1QIMA 1Q7CA 3BB3A 3E27A 2GZ1A 4YREA 1YNSA 1CUCA 1SRRA 4MI9A 4QGAA 5FNVF 4XSHA 5IP5A 1EZ1A 3HTXA 3ZIDA 5JDCA 4A5SA 4AMYA 1Z0AA 2GWRA 5A3RA 3EPHA 2CFTA 3H5LA 4O8CA 4W9RA 2JLVA 4P0QB 1P74A 1R1DA 3DM9B 4YDHB 4JX9A 1PWZA 5ALZA 1I30A 2OAEA 3ZC3A 4AG6A 1W36D 2V3VA 4TUYF 1KNXA 3JQAB 1OI3A 2VF5X 3QX9A 4XJXA 1W93A 3UGKA 3OQBA 2DLNA 5IFLA 5KOHB 4IVNA 5DP1A 3UJAA 3R7BA 1PZEA 2ZYHA 3IAS6 4C1NA 1JJVA 4QLBA 2UUOA 2KSQA 1OBOA 4CMHA 1CUGA 3BDIA 4AY2A 2G0AA 1KK0A 3L4JA 2QRKA 3NHSA 4CM8A 2AZ4A 5HF9A 5BURA 1A8QA 1SZJG 1X9IA 3I09A 3FTEA 3GLFE 1QHEA 2LPMA 1I3OA 1ZH0A 1WD7A 1RT9A 4FUTA 3R7WB 1QQBA 2DTEA 1KJYA 1YJXA 1TTTA 3K8ZA 3SFZA 4LOKA 4ARUA 1QH8B 4KR7A 1RJ9B 2F9MA 4XEHA 5CDUA 3T3EA 3A1SA 2XQFA 1ORTA 1GRRA 3VTAA 1JEEA 3DOCA 1ZUNA 4M8NE 2Z5FA 3L43A 3SC3A 4UASA 4G8JA 3UWSA 4CUZA 4MB0A 3A4LA 4AY5A 2A3RA 4EHDA 1XXLA 2OC9A 4MCAA 2JHFA 3GEHA 2GPSA 4V03A 1D1QA 2R11A 4MDHA 2Z3WA 3M4YA 3RYHB 1TM1E 2NUAB 4MITA 4EYQA 3VNBA 3COJA 3VKFA 3QXHA 3PQEA 3LKBA 2NWQA 3OOYA 4NLLA 4B46A 2XZTA 2ZJAA 5JMWA 4U1RA 2H4YA 1KBQA 3BTVA 2BGLA 5CCEA 4B09A 3LVBA 2CJXA 4AZ3B 3NFRA 3WL7A 5KSZA 1UBCA 5K8TA 1L5QA 1I3LA 3PHCA 4IIBA 2D5LA 3IMEA 4NJEA 2XA2A 3U81A 1PG5A 2VQSA 1SXJA 4JBLA 1YVDA 1HKUA 5L7WA 3AF4A 4G85A 4ID3A 5IKOA 1TW2A 5KYTA 2YVLA 1I1NA 4Z5XA 2RHJA 1ZKMA 1IQPA 1Y8QB 3CNHA 5CTJA 2PS9A 1A50B 3ONVA 1A76A 1ZXLA 1BS9A 3UGQA 1VL0A 4NR0A 3DNFA 3UV3A 3KXDA 3EVEA 4A3SA 2UVPB 4MWZA 3HR4A 4ADSG 2IEYA 3SNKA 4W5TA 2H2IA 2QZ4A 5IZCC 1OXUA 4XM2A 1AMOA 2NT4A 2X0JA 2UVPA 3BHJA 4RHTA 1Z56C 4A5OA 5BQ5A 1XMQB 3ASUA 4U7JA 4AZWA 4OATA 3AUYA 2AQ8A 1WSBA 3DMFA 3OMXA 4RPCA 3SBXA 4CMEA 4CGYA 4HT3B 1ADJA 1PTJA 2I99A 1EUCA 3LT5A 2H5IA 5E0OA 3ODGA 1HFEL 4L95C 1NKVA 4P9NA 2VRWA 2NVWA 3HY4A 1OYWA 1TM2A 2DERA 1TW3A 4MS1B 3RJ9A 5SY9A 1GHTA 1W581 4ZI3A 2JGKA 3OZGA 3R40A 1LPAB 4FKBA 1O9GA 4O4IB 3UEOA 5CLJA 1O0SA 1Q11A 3KOUA 4GQAA 2DP4E 2Q1TA 3F3KA 1X1TA 3HVUA 4ZYTA 1Q0ZA 1Y81A 3E23A 5A7FA 1W88A 5EPUA 1C0PA 2HU2A 3W5DA 4QSHA 1FTSA 2QYOA 1UPCA 3QBTA 4H77A 3TUZC 2IYUA 2ZU0C 4URWR 1WXGA 2M32A 4E70A 5ALIA 2GTPA 3OF3A 4UPVA 2XNHA 3TECE 1GGKA 2W42A 4DR6B 3R7LA 4S1PA 5JSKA 4OGLA 4KP7A 1E98A 2B4RO 2OO7A 4PLFA 1ENOA 5GINE 4FYIA 4Z1MA 4AFNA 5CLFA 1XDDA 1OPRA 4J07A 5GZ3A 1UUFA 3N1UA 1BJRE 1R74A 5JPIA 4YN3A 3L1IA 3HNOA 1J9GA 5FYQA 3EDMA 4GE3A 5F52A 4CCSA 5EZYF 2O8BB 1E9CA 3RS4A 3S8YA 3FTDA 3QPVA 3ZE7A 4I3GA 4D25A 1DXYA 1OXTA 3A04A 1EWTA 2O7QA 3ACBA 2EDCA 1XTPA 1XXHE 1GRCA 3WHKA 3DYVA 3A37A 2NPIA 1SFRA 5I8WA 1XU4A 2QDKA 1WSAA 3ILXA 3K2BA 1E0KA 1AH2A 2QT1A 2JCXA 4LSWA 4A0HA 1U7UA 1H1DA 3OZEA 1P91A 2GYVA 1HQCA 5JD4A 2JZOA 2Q5OA 1SZCA 2YN4A 3SZMA 1QP4A 1KOGA 2F3UA 4IINA 2XZLA 1QORA 3R8CA 4CL8A 5JBNA 5D8DA 3FFWA 3ZWBA 3ER9A 4UEJA 4L07A 5C4GB 5LQUA 1Y5IA 3URMA 1DADA 2LIPA 3ZZUA 1T5LA 4F4HA 2NO4A 4J8PA 1GZUA 1CUXA 4HSEA 4GWGA 1MDBA 1ZVKA 4PLYA 4AJLA 2AI3A 4DOMA 3AUJB 4Q1CA 1YMUA 3LU1A 4CXMA 5DX1A 2RGDA 4I2NA 2WKSA 1FU4A 4R2JA 4B48A 3OO1A 3ZV3A 5DOVA 5CNMA 3M6XA 3ZHXA 3ETNA 4RNCA 3U60B 2XIQA 3QPCA 3GUHA 4NYIQ 3UK7A 2P9CA 3I30X 3OZ7A 1VL1A 2PTGA 4NH4A 3HZRA 3LW7A 2ZTMA 2VSFA 1GR1A 2C29D 5IH7A 1H9AA 3SXJA 1UDRA 1XCBA 2C58A 1YIDA 4LRQA 3OUUA 5L95A 4PX3A 1P0QA 2IOYA 3ILSA 3ASZA 1RMTA 2REQA 4YV0A 3NM4A 3R0VA 4IHJB 3ZWAA 4L5IA 2C96A 4OQNA 4LJ7A 5L6MB 5FPTA 3SAJA 3PDIA 5FV4A 2C7OA 1JAXA 1X80A 1N2ZA 5HCIA 1SQ6A 2WM3A 3OFKA 1KEPA 4FDLA 4DCJA 4DANA 2ZSFA 1GA6A 1OYOA 4FMCF 4G25A 4WPGA 1QG4A 2PYZA 3RUEA 3TLKA 4NABA 2DUUA 4C05A 4C07A 4EHKA 1WP9A 5KSYA 4MVJI 5JIBA 4P38A 2A84A 2QRNA 3DFMA 1ST2A 1TC1A 1ZU5A 3HJCA 4LMBA 4MR8B 4R01A 3UHFA 3C4QA 4ENTA 2YXLA 3DVQX 3SICE 5LJIA 1ZVVA 1UBOS 3EXG2 3E84A 2BDTA 1X3LA 4JLPA 4XM1A 5JY6A 4KH0A 1WS6A 2J59A 5HRCA 1A82A 4PZ0A 1A4IA 3HVKA 4U9IS 1IQUA 1N4DA 4BQEA 3ZTYA 1TUEA 2IH5A 4QFCA 5JZSA 1DFIA 1WW3A 3EF1A 4HMOA 2EFYA 2F3QA 3HFSA 1SH7A 1PS0A 1F9EA 2PWYA 5E9AA 5TQ0A 2XGJA 3V8RA 2NSLA 2APJA 1JPNA 2Q7XA 1XEXA 2PIAA 2QE6A 1KYWA 3GP3A 2ZWIA 1UBTS 1DPGA 1VKJA 3IVRA 3WGZA 2PS0A 1K7FB 1P5FA 1JZTA 1AQLA 1ODIA 3O94A 3W6OA 1JDSA 1JBQA 3PPXA 4FONA 4CMJA 2GKSA 4PAWA 5FWYA 2XMPA 3MXOA 4EI9A 4ENPA 4JI8B 3IELA 1FBNA 1M2HA 3MTGA 4O0MA 4CQLB 4RABA 8LDHA 3WDKA 4IICA 2YIMA 4KSBA 3HZHA 3U3XA 4IQFA 2HD4A 4CIWA 5K3CA 2OGSA 2POQX 3A27A 1O89A 3C3JA 1BN7A 3EARA 3P20A 1W35A 1YA4A 1DXHA 3PEFA 1GCUA 5FTMA 2IW1A 1TYAE 1KE1A 1WPRA 4FZRA 1ZOLA 1N7HA 2ZUCA 2G28A 1NGSA 4JK3A 4YAKA 2AKYA 1XEAA 3VPBA 3AJDA 3EHDA 4OQYA 3PR2B 3QPAA 3RJTA 3CWZA 3UYKA 2J3DA 1BDJA 4IHJF 1QHNA 1Z7YA 3NUQA 3U48A 4XEUA 3ZEAA 2CHGA 1YBVA 4KDCA 3VH2A 2GM3A 3KEMA 4UVHA 2JD0A 2CFRA 1F2UA 2MYTA 3LT2A 5BW4A 1UBNA 3KQVA 2VSXA 3PWZA 4DR1B 3RTEA 2PFKA 1B3BA 5F76A 3LS2A 1T8YA 4HNGA 3GAFA 1X92A 2P4SA 5TQJA 5F2NA 3TNLA 4KSYA 1FP4B 3MT7A 4Y2JA 4JDUA 2H1RA 3TKYA 2HXSA 1EDDA 2RI1A 4N41A 4F3CA 2PQMA 2AN1A 5B1YA 2FPGB 5IAEA 3PNKA 1R6UA 3CX6A 2WSIA 4PZCA 4RVNA 2RBEA 4WD3A 3TE7A 1XVTA 5LB2A 2BEUA 4FFPA 5ER9A 3UBTA 1YJAA 1PK9A 5BNZA 1IM2A 2IXTA 5AUQA 1F8UA 2ZRQA 3IAEA 1U2RA 3AOEA 2HRRA 4N5IX 4GGOA 1VXRA 3MWEB 5L3SA 2QG9A 2ZTHA 3D7LA 3IP5A 3UH0A 4WQMA 1OYYA 3ZWYA 1DEHA 5CBKA 4KITB 3WLRA 2Z2XA 3O2JA 2GD6A 2LDBA 1L9XA 1SCUB 2AJ8A 2WYWA 4K8RB 4G41A 4PXSA 4RHYA 5IPFA 1H8EA 3FZEA 4IVRA 2X0KA 4YT8A 1QB8A 5JSZB 3MM4A 3JQ8B 5BYBA 2VRNA 2IPMA 4L6AA 2P9FA 4L75A 2J5KA 4FYHA 2NLOA 2NZJA 2KYRA 2J67A 5EWJA 3WX0A 4QYSA 3GLIB 4YBZA 2WF5A 1CEXA 4Z86A 4ZCIA 3HQ4O 4X3CA 3EN0A 3E7XA 2GAJA 4UUMA 1AKQA 1T1SA 3BGOS 3GCGA 1O54A 2ZRLA 4P98A 3SD7A 4YB8A 4OXQA 5CT4A 2XUFA 3C4JA 2ZPUA 1QC5B 1U0NA 4WXEA 3C7DB 5A0FA 3WRYA 1RE1A 3JQAD 3R3WA 1D1SA 1J8FA 2Q6OA 1DEOA 1EZZA 3RQSA 2Q3LA 4IJUA 1O4VA 5EAIA 3HR8A 2G76A 4J0GA 1G7CA 3VX4A 3ENNA 3DEYX 1E2MA 4ZCQA 4KPFC 2XZOA 3JX9A 2PYIA 3CLUC 4UTPA 1V43A 2ZQZA 4O4HB 1NUSA 3LX8A 2X0EA 4BX3A 1DE0A 4UPDA 1JVBA 3CLTC 3ZE1B 1E2PA 1T4GA 3HCEA 3NHJA 3VR3A 3FCUB 4FDTA 3VR5H 1GM5A 4XVQA 3VR3D 2YHIB 3UN1A 1PK7A 1Z6AA 1KA9H 4L15A 2IYTA 1SKYB 5A5DA 4MUEA 1UP7A 4L8YA 3SSAA 4NMWA 3LSYA 2YVKA 3R6GA 5CB4B 3O83A 3FMFA 1DO2A 1SM4A 2VHJA 1YR3A 2HAEA 2WAYA 3ZU6A 1Z7BA 3OQJA 1QUEA 2Y1LA 5EWJB 1NG1A 2RIRA 4EO4A 4CL3A 4GI2A 2QB5A 2X3FA 3L49A 5LXTA 5KYUA 2P5UA 1BO6A 1R4MB 4KMOA 4Q1VA 5FA6A 1V8ZA 3F0TA 3MOGA 3RKSA 16PKA 4Z54A 2V03A 4BNVA 3L06A 5CRIA 2E6UX 3BIOA 3ZIAA 5TF0A 2C4KA 4OHXA 2Y66A 4LZNA 1TA0A 1TPZA 1UDBA 3QTLA 4KN5A 5EIBD 2Z2KA 4UU8A 4D99A 2I2DA 1F1BA 4WXYB 3WGYA 2FPSA 2R2GA 2ZRBA 4ZCSA 5JU6A 3I4FA 1MOQA 1M34B 2FPPB 1PO7A 2C78A 1Y89A 4KXWA 5DOZA 5LZ4A 4FGKA 2O8FB 1IEWA 1SCNE 1QS0B 3QU4A 5CK4A 3H5AA 4WDRA 4JI7B 3JQBC 4BTVA 3UAWA 1DIGA 3FLMA 4OQLA 1LTQA 3WGVA 2NU9A 3TFWA 2XXAA 4GMXA 2IUTA 3OPQA 1UT6A 2WWFA 3A2NA 3BH0A 2BGJA 5JNTA 4XGNA 4MEJA 2OQRA 4EYGA 4ENVA 4FDAA 5JJIA 1XZIA 3HKBB 1Q15A 1HOTA 5EMLA 3K6KA 3MHPA 3OZFA 4J0KA 3SX0A 5L4NA 4U9HS 2IIPA 2YW2A 3Q3EA 3PUJA 1T2DA 4NP6A 4AXXA 3FSGA 1QVWA 2IYWA 3HWRA 4PHFA 3PUYA 1VL5A 2BKEA 3EJ6A 4JH0A 1VI2A 4QLAA 3F3SA 3EVTA 3QF4B 3M4JA 4RO0A 3DZBA 2FE4A 4QIHA 5BMVB 1NXPA 3ZVRA 1GFWA 1BDIA 3QBJA 5A6VA 1XLUA 1RPNA 2DWQA 3G9UA 1P44A 4YYZA 3OOJA 4B6EA 4QOGA 1MORA 1WABA 2M6RA 3N70A 4AWBA 4IEIA 5ESDA 1DQPA 1PZMA 1X7ZB 3A4IA 4MSUA 3L7CA 4OMFG 4MKXA 1ENYA 3FPKA 4JFRA 1P7ZA 2GBGA 1S7GA 5FI0B 2PZEA 3DSRA 3EG9A 5C1DA 5AM3A 1BHQ1 3BMQA 3DP9A 4CT5A 2HU7A 5F4BA 4BNFA 4HQ6A 1J21A 1AJEA 2C4UA 2XOEA 5KQSA 4MAMA 2V45A 2WJIA 3NNNA 4CDNA 1JDZA 1DRJA 1D2AA 2P11A 2AT1A 2XCIA 4KXQA 4C29A 5IW8A 1J23A 2BF7A 1D2MA 2XMSA 1HFJA 1XZEA 3D0RA 3OZBA 3JAKA 2GI4A 3HDQA 5DSTA 1N0IA 4X1IB 2I91A 1N2CA 1V8PA 3FNQA 2HLPA 3AHIA 2ZE5A 4HZIA 5BOVA 4BQPA 1R37A 1ODLA 2FSPA 4WOPA 4DR2B 3N74A 3NWEA 2WMOB 4BHTA 2E55A 1MQ9A 5TPWB 4UTXA 3ZWVA 2J08A 4DNQA 3AJRA 4J43A 1L1QA 4PM4A 4QRDA 4DDWA 4H08A 4F72A 3ZCUA 5KWIA 4UCWA 3BN3A 1E0JA 2XUKA 1UOEA 3GCZA 1XNHA 4Y1FA 3GOQA 2O52A 5ALYA 4CM4B 2CJWB 3C3CA 3NHUA 2MWMA 2I6TA 3Q85A 3TPCA 1BAPA 3QX8A 1YI0A 2HHJA 2OCBA 2AYXA 2WM8A 2C7GA 3GY0A 4QG7A 1G63A 2C5BA 2W6IA 1W48A 1UOOA 3AR4A 2H48A 3ANYB 4GZ3A 2ZQYA 4W5OA 3AYXB 3SDZA 2JJ2A 1VE6A 2C7BA 2EF0A 3IBFA 2AUNA 1MAWA 3IUJA 1CUJA 1PI3A 3PGLA 1JTVA 1ZQ1A 2JAQA 3I6MA 4DVJA 3ILYA 5AKEA 5HUJA 3CVVA 3WOVA 2IYPA 2E0IA 4ZV9A 5AVTA 3ICWA 4JDPA 1OASA 4RPIA 3TSOA 4ZHSA 1N2IA 2IV7A 4E6PA 4XWOA 2ZAOA 3DO8A 1IY8A 4C2BA 1I94B 5KYXB 3SM3A 4P2GA 4DSOA 3ZCTA 4UMEA 4KX3A 1SHKA 1GGJA 2X8BA 3I5AA 4PXAA 3N76A 1GKLA 5A4AA 2YNMD 3VTKA 2H7CA 1D4ZA 2DSNA 2HLDD 2J7PA 3H2ZA 3SM9A 4BNLA 6CHYA 4LYGA 3AUSA 1PL8A 2HDNB 3M2PA 1DZIA 2VHQA 4RSGA 1THTA 5J2UA 3DOFA 4M1SA 1SG9A 1XFDA 1HLPA 4ZYYA 1DC5A 1TCAA 4F84A 4JXXA 2O2YA 2VHEA 2Z2JA 2JFFA 3T1TA 4AQYB 2BW0A 1RLOA 3I01M 3MMXA 3QE3A 4QDJA 4XM0A 4BNIA 1V6AA 5DJ5A 4CGZA 2QUKA 1YASA 1L7VC 2GOYA 3AIOA 1FNMA 4MLDA 2YINC 1H66A 4Q7JB 3WDMA 2NT3A 1FVXA 3BKWA 2ENUA 3IKMB 1ZO8A 5EXPA 3WKEA 3O8RA 1LI7A 3C3YA 3IKJA 1DKUA 3PC6A 5K1ZA 4B7XA 4ER3A 4ZJPA 3B2QA 1TAUA 1MT0A 1ID1A 3GO4A 3I9OA 4C3OB 5J2UF 4RULA 2BF4A 2CZCA 5AICA 3KXPA 4NZYA 2KMLA 3BRWD 2V1XA 3PA8A 1CB0A 2ZDQA 3ZKWB 2JVKA 3E05A 6Q21A 4TYQA 2GHRA 4JYPA 4NOMA 1DTWB 2ODWA 2H11A 2Q0SA 3A36A 1D1PA 4V0RA 3ZHVA 1OFUA 5G1OA 2PT7A 3OMWA 1T6ZA 3AVTA 3HKCA 3VJMA 2OO5C 4F2WA 2XIJA 4Z7NB 1W0JD 2AV6A 1UODA 4DEXA 2PZKA 1ESEA 3TZBA 1TNDA 1UMCB 3UY4A 2QIPA 2G9ZA 3W4JA 5EUBA 4LY6A 4MW5A 2YN0A 3W2HA 1J42A 4EEKA 2WLTA 3UMRA 1CUVA 4ITUA 4QXQA 4GC5A 2JBAA 2P5YA 5A4IS 2FEXA 3RSHA 5JJBA 3FPSA 2PGAA 4KIWA 3STXA 1J33A 4H1HA 4O2BF 2YXBA 3DD5A 4KQWA 3L5OA 1QCCA 3S1SA 4D3DA 3DDSA 3E5MA 3WYDA 1U3GA 1QV9A 3HCPA 4EAAA 2FW6A 3O8OA 1GU1A 3KHTA 5A4JA 1B76A 1FTNA 3AERB 7ADHA 4DDHA 1S9DA 3FWKA 3HPQA 2FETA 2Q8PA 3ZDBA 3CKKA 2YVQA 3CFYA 2O05A 4NU5A 4RFSA 4HDKA 3G0HA 4Q4LA 3T34A 4WNAB 1MHTA 2V3CC 3P2OA 3ETLA 2GCIA 3KVVA 4BZXA 2CSUA 2VP5A 2C8JA 3IO5A 3SEFA 4ZDIA 1B41A 1FNCA 2QAIA 3VYWA 5T6MA 1MP0A 1UBEA 3IXLA 2QY6A 2G6TA 1PCXA 1XD2A 5DYTA 1P4HA 4BE9A 2QZZA 4R3NA 4IDAA 4WMLA 1L7EA 3QFTA 1Q6ZA 1WUHS 3GJ4A 2Z4RA 4H7JA 2Y05A 3PF8A 4JQZA 2RJ3A 4ZKDA 2BFDB 2C92A 1QVAA 1CUEA 1NVAA 1WL8A 1YULA 2H1WA 1PFKA 2WJYA 3OH8A 3OZWA 2IEDA 3PCTA 3QJYA 4PO3X 4GX1A 5B1EA 2R5WA 2B1RA 1VMEA 5EIEA 2B1QA 2AN9A 3G85A 3EJWA 1PFWA 3MTJA 1TJ5A 1P62B 3BERA 1JI3A 3L7OA 5AR1A 5BO5A 1QX4A 5HZGA 1KO5A 3MXTA 3ZVMA 2JFNA 4RHFA 2R7MA 2HMTA 1GO2A 2ISSD 2JFQA 3OX2A 4JZKA 5FBKA 3WGTA 4PO1A 1EX6A 1GVHA 3OJOA 3BGWA 3L0IB 4MI3A 2G6BA 1XZQA 3PCRB 4KO2S 4U7FA 4B35A 4XLTA 4BMZA 4M76B 2B0JA 3T95A 3IMKA 5BNFA 4JOQA 4OL0A 1WMFA 2EX0A 1Z4QA 2YWRA 3H2BA 1PFVA 1ECFA 3SPXA 4FDVA 1NDUA 3HA3A 2IYAA 2WVGA 1OXSC 3D4BA 5KX5A 1DLJA 1N9ZA 4BMSA 1WY7A 4QUBA 4KN6A 3FAZA 2YQ4A 4Q1BA 1OAAA 4JB0A 2FA9A 2WB4A 3MWLA 1C8BA 3PLNA 2QMZA 3EQ6A 3UHAA 1Y3HA 2A9VA 4EO7A 4GYKA 4HUQA 1MRSA 3IPAA 5PGMA 2AUTA 3A6FA 5BYKA 4Y2GA 2A1TS 1PLLA 4RKQA 5BR4A 3DT6A 1O0BA 5I5EA 1U1EA 2K4MA 1OD6A 2ATEA 2AD5A 2Q1XA 3A9CA 3OIGA 3AF1A 4EW2A 2E6KA 2ZIZA 1XEFA 4ZOQI 4W99A 2V6MA 4LI0A 4R31A 3N2GA 2COKA 3BE5A 4YLEA 3VC7A 4EEZA 5JDIC 1D4OA 1YJCA 5LM3A 3BCHA 1FX0B 5JY1A 4NXMB 1ODKA 3DKRA 5H4HA 4HLUC 3CBGA 3EBOA 5C46F 3AQ4A 3OE5A 4YAEA 2DX7A 3KZCA 4DLTA 1OV6A 4QUAA 3UWDA 3CGWA 7MHTA 1N0VC 2RAPA 2F00A 2FTKE 4PC3A 5ERYA 5CU7A 2JAPA 4WASA 1G3MA 1LSUA 5BNIA 4GT1A 2WJJA 3T9EA 1L3IA 2CUZA 1HLFA 1OOEA 2GK3A 3LCVB 5K3BA 3UG6A 3KWLA 3VAAA 4B75A 1BDMA 1LSOA 1NUUA 2H2HA 2WTNA 1SRQA 3L79A 1J7JA 4Z9YA 3UANA 5D3MB 4EMSA 2IITA 3SDBA 3M1AA 1NAIA 1AKYA 5CVVA 2X7HA 1XOIA 3AM5A 3C2QA 3IQEA 4PHGA 3RRYA 3QE4A 3V4FA 1VPVA 3H1BA 4HADA 3HJHA 1IMJA 4LOHA 4TMZA 3PRYA 4D74A 2ZTVA 2XX3A 2Z5GA 1FDRA 3L3BA 3LIIA 3O6VA 4HFRA 4P3NA 4WRRA 3W9UA 3FGPA 3H7IA 2QX8A 3W8DA 4EMBA 4ETNA 3OM8A 2IGTA 4B44A 2CWWA 3TINA 5GONB 4JBYA 1IQRA 3DEIA 5I9NA 1NJ1A 2FMFA 4F8JA 4U5XA 3PDJA 3U37A 3HI6A 2QAGA 3HVIA 3PV0A 2I87A 1N77A 3E3AA 1EPUA 1HDIA 2YRWA 3FLAA 1SXJD 3QFSA 1GEEA 2QR3A 4JJ4A 3JD1A 2H2FA 3O8QB 2I7CA 2EBFX 3AP2A 3INGA 1JFFB 4I1IA 1JG3A 4R69A 2XDAA 4UFOA 5BSGA 1X1SA 3FDFA 1LPMA 2D3WA 5REQA 2B61A 3OZDA 1CUDA 4NCJA 3ZXUB 3LA6A 1QHHA 1U90A 4M4SA 1G2QA 3VZCA 4OXXA 1U31A 4C0XA 1EH5A 2C7RA 3AV3A 2EAUA 5DF1A 1T2AA 5IUJC 1ZUWA 4JP5A 4GDFA 4F1WA 4C0SA 5ETJA 4Q4JA 3REGA 1D4FA 4O1HA 4CF6A 2ZI5A 5AJZA 1M6YA 5EJFA 1YE8A 2P6NA 3N0TA 1RU3A 1ESCA 4O4LA 3CX8A 4ZO7A 3IESA 1J4AA 5F1OA 5JNLA 2BBTA 3D5QA 4PN3A 5J5CA 5KSWB 1M2JA 3R7NA 4JQCA 4BRUA 4M0MA 1XQXA 3FFBA 5CB4A 3INRA 2OHIA 1OI4A 2YHSA 2EFGA 1OVMA 1LX6A 3M9XA 1WXIA 3G2NA 2IFTA 2IYQA 3ZJTA 3F5QA 3FPCA 3CLRD 1CY8A 3JVIA 4JT9A 1X1CA 4AYXA 5FDFA 2PVCA 4ISCA 5L3VA 4EF5A 3R9XB 4MI1A 1QK3A 3ONWA 3OQHA 4UNRA 1PN3A 1K27A 2NGRA 4WBNA 4Q7MB 1R50A 3ZDRA 1P5HA 1WNFA 2IX9A 5E4JA 1KYIA 3LCUA 2C83A 1B16A 4Z8XA 4ALMA 3MYRA 4WUTA 2GD1O 5KO2A 1LFDB 3FD8A 3MG9A 4H27A 4XA8A 5JD3A 4S1TA 4A6EA 5LKRA 2GZHA 4LAFA 3AB3A 3KHKA 4OL9A 5AJVB 4PLTA 1YT5A 4FI3F 1I3MA 1SKAA 4QVIA 3GEIA 3GLHE 3K5WA 1I9GA 1WV1A 5JAMA 1USWA 3NOOA 2O2EA 5K8VA 1DX6A 2XHZA 4RZ2A 2V6GA 1KEZA 3PBKA 3QBVA 3NBQA 3SP1A 3ZNPA 3RRMA 4BO0A 5F23A 5FWYB 2OE2A 4GLBA 1MEJA 3ASYA 4XUGB 3FPJA 3LDAA 3QFFA 5AQEA 2Z3ZA 4E0BA 2YWXA 3IMFA 1YZYA 1JB1A 1PJ3A 1T34A 2R8BA 3NDJA 2PBRA 3K32A 4RADA 2G80A 5FBLB 1L1RA 5EJ8A 4YJHB 5JATA 1N6RA 5KINB 4D41A 2CT8A 1JQDA 1XZKA 1GGVA 2VFAA 3FUUA 4YUVA 3AV0B 2QUZA 4FEAA 2XODA 5LOVA 2EKLA 1MV8A 2IZZA 4YWHA 3RKRA 2WYIA 3T7EA 4H7EA 2G9UA 2RK4A 4GZ5A 4M1YA 4XGKA 4PPFA 4ZK2A 3WA7A 1E3SA 4G5GA 1L7QA 3JQ6A 4DMRA 4I9UA 3VPCA 4I9HA 3VUEA 4W5NA 2CLFB 3AKZA 4D9FA 4B85A 4KPGA 2LGJA 2QNRA 1IUOA 3UOWA 2DXIA 1FFBA 2ZYRA 1DHRA 1H2EA 4H35A 3ES9A 2ZTSA 1QYXA 2VZ8A 5LBUA 3P1JA 5KNBH 5M04A 4JLBA 1PP4A 1XZCA 2LXNA 2BWJA 1RMQA 1R0ZA 1ZWLA 1WQ1R 4G2TA 1EU1A 3KYJB 1NW4A 2O7NA 3ELBA 1G2IA 4KAAA 3RV4A 1KI9A 4MQFB 1E1LA 4CNBA 1L5FA 3A31A 3FOWA 5FBVB 5IAAA 1RLJA 1NMYA 4BC1A 3GQVA 2FWAA 3HVJA 1UZUA 3PL5A 1SUEA 4LIPD 3TLZA 1VJ5A 1FQJA 2QE7A 2ZG6A 1XMPA 2B6HA 3HI4A 1LLUA 1NWCA 3QKIA 3DXXA 5JNUA 9MHTA 4OGWA 2C04A 2ATVA 2PN1A 5B2ZA 3ROZA 1T10A 3T15A 4D4KA 2O8DB 4M0PA 4FCCA 3F6SA 5ERXA 2NPFA 2ZXEA 4TT3D 4ETMA 2XECA 3MQFA 3QSGA 4QEKA 2XNJA 4RVCA 1Z0JA 1VDZA 1JYFA 3EY4A 3U4QB 3CUEF 2C98A 4J1SA 4B6RA 2HADA 1BE1A 1K3TA 1Z4LA 2AK2A 2PD6A 5HJ2A 3S44A 3ZE9A 1XLWA 3WAJA 3BIJA 3U1TA 2IHKA 1RTTA 3FUCA 3QWFA 4GKKB 3EFOB 4V0MA 4X1YA 4XYMA 4EI7A 1QO0A 3C7CB 3GW8A 3PRHA 4G5OA 4AS3A 3MLAA 4C4AA 2H2DA 1GTL1 4PG8A 4OI1A 2ZAYA 3TLAA 2C1EA 4M8SA 1V1RA 3C6BA 1FJ2A 1LFAA 2QG4A 2FWRA 2ZT8A 2P77A 3EVCA 5GGXA 2RE8A 1ISPA 5JALA 1P1KA 1IH8A 1XK7A 4TWZA 1E1KA 1KY2A 1JKXA 5IKXA 1MT3A 2JLYA 2HYIC 1L7OA 4IUCS 4NCKA 1G59A 4NXNB 3GG2A 2ZJZA 3LQRA 1UC8A 2QQFA 3PKZA 3GRKA 3QKSB 5ECWA 3O47A 4FE7A 5IAJA 2XZPA 1OH6A 4XW2A 3G1TA 1GNLA 3QXSA 3NMUF 4QQFA 4OKSA 5HJ5A 1H5NA 1WBBA 1BVYF 4KB5A 1RWQA 2RGRA 3D54D 4QX6A 3B9BA 4AUKA 5EIAA 5JZ9A 3IVCA 2VQFB 4PZ9A 3NHYA 2VDWA 3O4VA 1AN0A 1T5TA 4G0OA 2CNNA 1H0HA 4ZWNA 1CF2O 2JHCA 5K8UA 2W4QA 2WV7A 3HKEB 4LRXA 3CLSC 1U1CA 3RRBA 1TQ6A 2YXEA 3UJPA 2AZTA 4K6OA 4UEWA 1R3UA 4PANA 5A02A 3FNGA 2P75A 1SB9A 2RHBA 4I4TA 3WYEA 1O6CA 3ZBPA 2VQDA 3Q3VA 3A4TA 1Z28A 2LCFA 1U0SY 2GZDA 1QO7A 3DC7A 3FRIA 3Q87B 2HMVA 4XX0A 4P3XA 5F5XA 1QFXA 3TDMA 2HTEA 1YVPA 2RKBA 4DGSA 4WCVA 2Z5VA 5CLGA 5FBHA 3V1YA 1B8PA 2X1LA 1KTIA 1H2AS 3GEBA 1BS2A 1W30A 4RVGA 2J1LA 1WDWB 1E6EA 1Y8CA 1JX6A 4BQSA 1CVLA 1VIAA 2FK8A 4CU5A 5D85A 3H5OA 4JT8A 2CZGA 1HLDA 3PNOA 2FWIA 1T9KA 2GO7A 4IOKA 4MUYA 2R7NA 3AM4A 3TNYA 4AO6A 4JLWA 3Q8WA 1G6Q1 2BE7A 4TM8A 1E3EA 4Z0HO 4NIMA 3AHJA 2ZYTX 3LFTA 5FFNA 4B0PA 4G9EA 2VXCA 2CLKB 1ZNWA 2ODAA 4MVJD 4IG4A 3VHXB 3EFOA 4KQ9A 3P2MA 4PXYA 1IATA 1MVOA 4TMYA 1CEYA 2ONYA 5ALKA 3FDXA 4JLMA 1K66A 2AX4A 2D5AA 3RFTA 5HKKD 3U61B 4ZTUB 4RMGA 1RM5A 1N25A 1JNYA 1RI4A 1H3NA 1A9YA 1KI3A 1YS6A 2D74A 2GBFA 3Q15C 5DM70 4U02A 5CFPA 3ETHA 3HN6A 3RC8A 1NVVR 2R8ZA 3OAAA 4BP1A 3R5SA 4E2FA 4HN2A 1ADCA 4NPHA 1QYDA 1Y4SA 3OE7D 4UTNA 2BP7B 2XQGA 4HVCA 3IL2A 1NYQA 3ANNA 4X91A 3SC2A 5ELXA 3P4UA 5COBA 4NL4H 3AEXA 2FSVC 2XGGA 3QFRA 4HFNA 2W6ID 4RFVA 4AJNA 3C7AA 2PSSA 4GEGA 1FFYA 1RAIA 3ADPA 2QPOA 3ZNNA 3I9MA 3SYNA 1ISJA 1Y5LA 4MW4A 5HNKA 4GBED 2MYNA 4IEEA 1XC7A 4HS4A 4CIXA 2L19A 2ZRGA 3KAPA 2N0SA 4GICA 1SC3A 2F3PA 3MAAC 1EP9A 3FXAA 2ACWA 1Z0DA 3NGLA 4N3AA 4RKYA 5B1SA 1TYDE 3O9VA 4TLBA 3V46A 4BZQA 5B53A 1UZLA 1QP8A 3E6AA 4UPEA 1XO1A 3TE6A 2AW5A 1RRCA 2VT3A 3G9TA 3TCNA 2B98A 1KY3A 1JQ3A 4DLAA 2Z1NA 2RIPA 2C5SA 2I9PA 1R0CA 4NDNE 3W6ZA 5JQWA 2Z2YA 1FJGB 3K4PA 1BOFA 1UPBA 2FEMA 1E7MA 3R5HA 5DM60 5EJ4A 3Q9UA 4BQRA 2OWEA 1YZKA 2CC2A 2AOXA 5A7GA 2B5WA 3AEUB 3G0CA 4PLWA 1FQWA 4F2HA 4CLRA 2DECA 5HJ7A 4DB4A 2Z43A 3TD2A 3JATB 1Z36A 1CJMA 4RJLA 1M72A 3FB4A 2QM7A 1EK0A 3BGIA 1P6XA 4FZ5A 4OU5A 1SU8A 1N2CB 1JDBB 2WHRA 4DPMA 1WV0A 4H3KB 2PFSA 3HS3A 1ZD5A 2O2JA 2BI7A 1CUWA 2G0NA 2Y76A 3CZCA 3LVRE 5ENZA 2R3SA 3GDFA 4C0LA 3T1HB 3E35A 3UT0A 4ZHQB 3U09A 1P0MA 2CNWA 4HYQA 5AD1A 4E13A 2BH2A 5EXTA 1ULBA 4BCBA 1M1NA 1RZ3A 3QBDA 1DAHA 5EHNA 4WOKA 2FDRA 3TJZA 3TRKA 4CR6A 4DJ5X 4DJFC 1J1UA 3TL2A 1XTRA 3HV2A 4HGNA 1QFYA 5A2GA 1U3UA 3E61A 3TH5A 4ACBA 1T36B 1VECA 4QFDA 4WVFA 1LDBA 4HXGA 2W11A 2ZJ6A 2RH9B 4BO9A 3I6YA 3NEJA 4M1OA 1WHTB 3KQTA 1VMAA 4WY5A 5EOVA 3TLMA 1CR4A 1WVIA 3ZIAD 4RGBA 2EQ5A 1P18A 4FZ3A 5B7GA 1N3YA 3PI6A 2HCFA 3OO0A 3V4VB 5BMVF 1CZUA 3D6NB 1PNVA 1JHPA 4FMPA 4D9KA 2VK8A 2IH2A 1MJNA 4DY6A 5CCBA 1SNYA 3P4YA 4IR7A 3I9NA 1XVUA 4M1TA 2OFFA 1AMUA 3OJFA 1KYTA 1R9JA 1U3CA 3ZV7A 4R7TA 3ENWA 3L7JA 4HGQA 1UJ4A 4M99A 1NQOA 4YGXB 3TLBA 5K6RA 1BCRB 3I2HA 3VSBA 5HVNA 1P33A 3FFXA 4EUEA 2J6HA 5DCLA 1B8VA 1XWFA 2OQVA 1J5XA 5MHTA 4AJKA 5KNLA 2GA8A 1V4BA 3GJZA 2QX7A 3KDPA 3NHBA 3W5UA 2WQZA 5BMOA 2VHZA 2P7IA 5IULC 4BGIA 1P2VA 5TC4A 2VF7A 3OLVA 3CKLA 3PC3A 3A9WA 3W3AD 1A8IA 1XAHA 1KK2A 1JHDA 1KC1A 2XWQA 4R81A 3CCBA 4N7BA 3U4HA 1WXFA 2DOKA 4LYHA 3K1TA 1JFVA 3H19A 4OHWA 4OBEA 5A9TA 1RXWA 5A03A 4MKZA 4I99A 3K0HA 2N46A 2ZM5A 2FGKA 1GNQA 1E2QA 3S0JA 1BU8A 4CLHA 1M73E 3WHIA 2LP4Y 4G65A 3VDXA 2C9OA 2JANA 4BP8A 4DBLE 1DPFA 1RKVA 5CCDA 4XXHA 2FZWA 2VHUA 4QT0A 1CY7A 3O2NA 1OFVA 4I7EA 4OEHA 4ZT6A 2J6IA 5FPKA 3S40A 1KDOA 3FCXA 1OHHA 2PKCA 5AKKA 1E4VA 3K1AB 4X8LA 4FHGA 4PYJA 5BXQC 4HK4A 1P0FA 4BLVA 2WJZB 5ADVA 4P80A 3JVUA 4UVDA 5G40A 2ID4A 2V1UA 1PV4A 5J9FA 4GWKA 3MFQA 2WIDA 5CDHA 3KOZA 4MX8A 3B7GA 2FPIA 3JS5A 3TIIA 2G67A 2FUG6 2JLWA 2GUGA 3IVMA 3FI9A 3ILHA 3OM1A 4YYEA 1FYFA 3E9MA 3DFZA 3TS1A 1VKHA 4G5YA 1RVDA 3EIEA 1AHIA 4RSRA 4X0EA 2C1XA 2Y27A 3SHFA 3GN1A 1O77A 4JS0A 4XQGA 2LV8A 4FS8A 3O2QB 2FW7A 3JD0A 4PBRA 1BTOA 4A0QA 4PAMA 4MULA 2DR2A 5SYAA 3ZQUA 3H3JA 3QVGA 1GZ6A 3SQMA 3X2FA 4WLUA 1VCHA 4LBZA 3W9YA 2QVGA 5CG1A 4X1OA 3OBIA 3Q8KA 3UAYA 1RQNA 2EC5A 4A15A 3CXUA 5JSUA 3FWNA 4HAOA 2JLQA 3IYLW 1XRLA 3QQ5A 4U6QA 3H2GA 5JJCA 2JFHA 3L04A 3EXEA 1XTBA 2R1TB 4FSDA 3DTNA 3LO8A 1GNRA 1QGED 4J9UE 2EKBA 1VIYA 2VK1A 3F4BA 4WT7A 4GUDA 4JJ8A 4RIGA 1IZYA 2QUIA 4KGDA 4HQLA 1TVKB 4MQUA 3DHVA 2GTIA 3ZV4A 2IY8A 2ZB4A 4CUKA 2Q21A 2F9FA 4BAGA 3EYWA 1AE1A 3AWDA 2K7ZA 4CMBA 3SMQA 2FPUA 1FYDA 1F8FA 2HEGA 3V8PA 2YRXA 5J4YA 4F60A 4UARA 4QTZA 1I80A 2X4LA 5HHTA 4ZU6X 1XDWA 2EFCB 1WPQA 2OBFA 3R3JA 4WXPA 1UFQA 4Y2PA 1B4DA 2WNHA 3EK2A 5JXHA 3ND8A 2FJPA 4A36A 1P7YA 1SVSA 2VOEA 1Y5NA 3UC5A 2Y99A 4D8XA 1SXPA 3U4MA 1TKRA 1KEEB 2PA3A 5DLQC 3VI3B 1GT6A 3JPWA 1GPLA 5IAGA 3RG8A 2YFKA 3LPCA 4RCYA 1V3QE 3E4CA 3ZBQA 3REFA 1XZLA 3C74A 1H5QA 3AO0B 3L7KA 4PEVA 2E87A 1FS5A 2PUAA 3FMPB 3T52A 4H6VA 1ZIPA 2YHUA 5DLPA 5KTYA 3WNQA 2JCBA 1TCVA 4HDQB 3PP8A 2ORWA 4TSRA 3TPFA 4M9QA 3DGEC 3W05A 2DPHA 4RE5A 1DMSA 2FW1A 2RGEA 3LBNA 1YS7A 2AZDA 4QARA 4R6XA 3RHSA 3U9SA 3H75A 5C7IO 1ZK3A 2DYKA 3LW8A 2VR1A 1HETA 1AZWA 1EEXB 2BR5A 2H1VA 2PSJA 1UMBB 2Q4TA 3LF2A 1GFZA 5DGIA 3S55A 4L02A 4UBOA 3TLEA 3EIFA 1A9SA 4BNHA 1WHTA 4LVNA 2TS1A 3WGJA 4E11A 4WZBA 2V55B 3ICPA 2FW9A 1G8FA 2WF7A 4X63A 2P7HA 4H7KA 5IHXA 4QHTA 3O1LA 4DDUA 3OX3A 5H9WA 4LZWA 4BY9E 1MNQA 1WXDA 4D80A 3NEYA 3BMCB 3WLLA 2PSHA 3GGOA 3SIPA 1XMVA 1L8XA 1QQ5A 2WKPA 4ZK6A 4RA6A 1NASA 4PC6A 3TBKA 1TKBA 4BMYA 3Q2OA 2RHLA 4EKEA 1EDZA 3HXKA 1KYXA 2PUVA 1LDEA 3CKYA 3O4RA 4JKOA 4PNZA 5B6IA 1NATA 4RGYA 2FQ1A 2PY6A 2KHZA 2RGNA 3HFRA 4PFKA 4JI4B 1SBTA 3IP6A