3R3ZA

Crystal structure of the fluoroacetate dehalogenase rpa1163 - wt/glycolate
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
304
structure length
304
Chain Sequence
b'GHMPDLADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHDRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIAQSAATPLDVWRKWASDVQGAPIESGHFLPEEAPDQTAEALVRFFSAAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fluoroacetate dehalogenase
publication title Mapping the reaction coordinates of enzymatic defluorination.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Hydrolase
total genus 117
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r3zA00
2H1IA 3W06A 3WL7A 4BP9A 1HLGA 1Z68A 5CRIA 4K2AA 2H7XA 4XVCA 5FV4A 2ES4A 1UWCA 2WIJA 2XMSA 4CG1A 1JJFA 2PU5A 3ZLVA 4B80A 3G9ZA 4PV7A 3NUZA 4C6HA 3WI7A 2OLEA 1JJBA 3QPDA 5C8VA 1DX6A 2XUOA 1ODCA 5KWJA 5AKLA 3R40A 1CV2A 4J0HA 2X8BA 3D0KA 1CUJA 3JWEA 4RNCA 1MX5A 4AO7A 1IUNA 2BJHA 4G4GA 3G02A 3HYSA 3FSGA 4G4IA 4M0MA 4ZWNA 4AN1A 1KU0A 1UFOA 5IVDA 3LIIA 5AIBA 4AO8A 4H7HA 1CUVA 4UBJA 1GPNA 5LZ9A 5JAUA 1XRLA 2CEKA 5HZGA 3PICA 3OG9A 3FLBA 2OCKA 1E8DA 1EA5A 4L3WA 4HRYA 3U1TA 2PM8A 5T4HA 4MQLA 4UBNA 1CUSA 3MGAA 4Q05A 2J3DA 4PSUA 4H77A 1OCEA 3G9XA 3V1NA 1UKBA 3M82A 4CIAA 4AN0A 1QTIA 3A6ZA 1X2BA 3BJRA 5AKXA 4BAGA 2GBIA 1XZEA 5ESRA 1IMJA 4NMWA 5D3KA 4AX4A 1XZHA 4X00A 4J03A 4D9JA 3VVLA 3ESCA 3ZLUA 1AURA 1P0QA 1QFMA 2OAEA 1E89A 4F21A 4LXHA 1AX9A 2QRUA 4FBMA 4XJVA 2C58A 4UHDA 2CBGA 4PW0A 1QFSA 5FPPA 4X7BA 5HF5A 1U2EA 3GZJA 4XX1A 2ZVDA 4H7FA 4KAFA 3F8SA 2HIHA 4UBOA 4FFVA 1N1MA 5ALTA 2JEZA 3ESBA 5BV7A 4UFPA 4WDQA 3EQ9A 4KE9A 5ALOA 1QZ3A 5K3EA 4J0CA 3S8YA 4JNCA 3O95A 2ZYSA 1T4MA 4EY8A 3WYNA 3AILA 5AICA 2DCMA 1BN6A 4X71A 3KWJA 4H7JA 3IBTA 1WPRA 4C89A 1TKRA 5IKXA 1MPXA 1WHTA 4X91A 1Y37A 4X95A 4OB6A 3AJAA 1NU8A 1N5RA 2WJ4A 2XMGA 4BTVA 2XUGA 4H7EA 3FVRA 5J3JA 1ZD4A 3K9BA 3D5EA 1AZWA 2DQYA 4BVJA 3GELA 4LXGA 1EB9A 4AZ0A 4B9EA 2WUFA 3WL6A 5AKYA 4FNGA 3R41A 1USWA 3N0TA 4KJXA 3ANSA 3QVMA 1IZ8A 1FSSA 1F0PA 5EHXA 5ALJA 1GKLA 5LIPA 1XZFA 1XRMA 2VEOA 1DX4A 3GUUA 3QM1A 3AFIA 4OSEA 4B0OA 3L1IA 2JGIA 5ALFA 5AM5A 4G9GA 7YASA 5DWDA 3H19A 2UZ0A 5DYTA 3M83A 1MAAA 1EH5A 4MEAA 2J4CA 4C4ZA 3DDUA 4IO0A 1CQWA 4P92A 1EDBA 4UUQA 3X3HA 3LCRA 4EB0A 3WQHA 4J0JA 2WHPB 5C8ZA 1JMKC 5AK4A 4FOLA 1GGVA 2WHRA 2XQKA 3HRHA 3AZQA 3W9BA 1HKHA 1TCAA 4DNPA 3WJ1A 1ORWA 3FCYA 1S8OA 5JZ9A 2IITA 1YS2X 4F60A 3H2GA 1H2ZA 3I2IA 4DYHA 2BUBA 4XWGA 4UPDA 1GKKA 4PF1A 1ZGBA 3PF8A 3OM8A 3HJUA 3ZI7A 3IB3A 2VTVA 1XZGA 5DLPA 1MAHA 1U65A 3ED1A 3WKBA 1XRRA 2VT7A 1T2NA 1W52X 3DYIA 5D6OA 4N5HX 4DSZA 3WWOA 3A2NA 3AINA 4QWMA 5IVKA 2V98A 5ALMA 2WFLB 3WYDA 3L1JA 3C6XA 2OQVA 1LPPA 3R3VA 4E11A 4W9RA 2WU4A 4DMFA 5AK3A 3K2IA 2HU7A 5DNUA 3R3XA 5JYCA 4G9EA 4RE5A 1GQRA 2XMQA 4X6UA 1YA8A 3I2GA 5FRDA 5AIAA 4Y2VA 4LKOA 2CMFA 5HQ3B 5EGNA 4Z49A 1O6FA 5CMLA 3WKAA 4X92A 2GBCA 3TGLA 4S0XA 5DTIA 1UK9A 2WTMA 2PSEA 4I4CA 4CIBA 1E5TA 1EX9A 2BUCA 2NW6A 3QPCA 2OAGA 1YS1X 2WSLA 3V9AA 2P8SA 3HZOA 1VJ5A 4DMHA 2D5LA 2QM0A 5ALNA 1LPBB 1F8UA 1E8NA 3C70A 4EHBA 4K6HA 1CUEA 1ZD2P 1XRNA 3ICVA 1UZAA 4KACA 4AO6A 1CUBA 5AJHA 3ZWQA 2HA5A 3WWDA 2ACEA 3D7RA 3DD5A 4KAAA 1HL7A 3KOOA 4H18A 3RK4A 4Q3KA 5JAHA 4ARBA 5K3FB 3RM3A 4C01A 2HU5A 3I6MA 5AOBA 3D2CA 5FP0A 1QIFA 1Q84A 4EY4A 3VJLA 3KDAA 4GLBA 3O4HA 3W2TA 4Q1VA 3MUOA 2V96A 3QYJA 4UBKA 4BCCA 3I1YA 4MQMA 2ZJFA 1FFBA 4IH4A 5E4TA 3RARA 2RONA 1UK6A 2OGZA 4W1RA 1F0NA 4BBZA 4P9NA 4WCVA 3DS8A 1JU4A 1CLEA 4KE8A 5HF8A 2QVBA 2GYVA 3A70A 2WG2A 1MN6A 3M81A 2QUBA 4MEBA 4P08A 1YCDA 1XZKA 1LPOA 3KD2A 1LPMA 1THTA 4KEAA 2V9ZA 4U2DA 3O4IA 5LKRA 1QONA 5HFAA 6YASA 2HU8A 2XQIA 2ZYRA 4PSDA 1ACJA 2BGNA 1AQLA 4DIUA 1UOQA 2C0PA 3DQZA 2JIDA 4WY8A 1EINA 3NOXA 3BXPA 2WQZA 4M0FA 2Y2UA 3HXKA 4L0CA 3WMRA 1LPSA 2WUGA 4WFIA 3D2BA 3QH4A 3C87A 3G0BA 4UFOA 1J2EA 2HA3A 5SYNA 4B7ZA 4IQ4A 4JYMA 5FDFA 2WHPA 1DQYA 3EQ7A 4UBIA 2VA9A 3ESAA 2XUPA 3WLAA 2XMCA 3WWPA 2WIDA 5AM4A 5ALXA 2FX5A 1XRPA 1ZIYA 4W63A 3C43A 4H35A 2WG1A 2ZSIA 2XUFA 3BDIA 5ALDA 4BVLA 5KBYA 3IURA 3W04A 5LZ4A 3FBWA 3DOHA 1BS9A 5AKJA 4MWTA 3LP5A 3A2LA 3HC7A 1X70A 3G0DA 3FSGD 2WFLA 1MT3A 4JUIA 1QIDA 3FYUB 5AM2A 2R11A 2DSNA 2C4HA 2Y6UA 1H23A 5HKAA 2RIPA 4HVTA 3ESDA 3WWEA 2ZJ7A 1GQSA 1MU0A 4E46A 5HQ3A 3D3NA 4QDTA 3V1KA 1TCBA 1QO7A 3HSSA 4Y2SA 4AB1A 1ORVA 3W05A 3H2KA 1TIBA 4H0CA 1R1DA 2OCLA 3O9VA 4FLEA 4QLOA 4RPCA 4FHZA 4OB7A 1HPLA 1VE7A 3IDAA 2JGKA 1QIMA 1XRQA 1MX1A 4J7AA 1WB4A 4B85A 3DKKA 3C5WP 1CUWA 1LNSA 2XI4A 2OGTA 1YR2A 1XZDA 2WU3A 2DHCA 1SFRA 3ILSA 4K5QA 4CFSA 3H2JA 5T4FA 4M0EA 1FFAA 5AI6A 1VLQA 2PSDA 2GBFA 2WTNA 5JASA 4A16A 5DJ5A 5BOVA 4BZWA 1QIIA 4KR0A 3P2MA 4KRXA 4FKBA 4OUKX 5K3FA 3R0VA 4DTCA 3WK9A 4DMCA 2HHAA 1W6RA 2AJCA 1HDEA 2Y2VA 4FLMA 3E0XA 4HXFB 5ALUA 1TRHA 4KE6A 3VDXA 1G42A 3WZMA 4H7DA 3H04A 2OXEA 3C8HA 1ZI6A 4GEGA 4QDOA 3TEJA 1R50A 3I2KA 4A5SA 1W1IA 2DHEA 3IIIA 2XLCA 4EY6A 1BRTA 4FBLA 1QJ4A 3F96A 3H1AA 2RHTA 4NVRA 3ZV7A 3SK0A 3DEAA 1E66A 1OILA 1N5MA 1BROA 5JD4A 4A23A 5C8XA 4UBLA 3WJ2A 5ALRA 5LZ7A 2XQGA 4BP8A 5CT4A 3OTQA 3OOSA 1CUIA 4W1QA 1CRLA 2K2QB 3FYTA 3I28A 1C7JA 1VZ2A 3CCCA 5JAOA 2QT9A 1WOMA 1WCYA 5EI5A 5CXXA 4QDUA 2QJWA 4G4JA 1XLVA 3G8YA 4IH9A 1EB8A 4FDMA 3RLIA 4U2EA 4PQEA 1W75A 2PX6A 1DQZA 3R3ZA 5AI8A 1XQWA 1BE0A 2WILA 4X94A 5LZ8A 3DL4A 2GYUA 4TGLA 5FOQA 1HBJA 3W9UA 1XFDA 3STTA 4WFKA 1JFRA 5K3CA 4RE6A 2PUHA 1JU3A 5AKGA 3FVTA 4ZXFA 1LLFA 4BE9A 2PSFA 2G5TA 4GI1A 1XLUA 5C81A 5JIBA 2WHQA 3FYUC 3G0GA 4DNOA 1QTRA 2VQ6A 4WFJA 1MX9A 3WK8A 2QJRA 3OURA 2JGJA 4N8DA 5AP9A 1ODSA 4LXIA 3GFFA 3STUA 5K5EA 1IUOA 1AMNA 4BAUA 4INZA 1AUOA 1K8QA 1K4YA 5E4YA 5HKBA 3O9MA 4BB0A 1JT2A 3BIWA 5T4EA 4IHAA 3I6YA 4DNFA 4F0JA 5CURA 1J1IA 1A88A 1SOMA 1XLWA 4Y2TA 1YSCA 4G8DA 1XZJA 3FYUA 3VVMA 5HK8A 1XKTA 1FFCA 4NZZA 1IVYA 1QGED 3M3DA 2JEYA 2ZJ6A 3H17A 3IVMA 5EHZA 2VT6A 3AIMA 4AZ3A 1QE3A 1SC9A 4L72A 3PFCA 5ALYA 3N2ZB 1A7UA 3DKRA 3SC2A 2EDCA 4QEKA 4UHBA 2OPHA 4YPVA 4BRSA 1THGA 2B20A 3UMJA 2VJCA 2J3QA 5FKJA 2H7YA 3ICWA 4P93A 1I6WA 5HF6A 1R9MA 3G9UA 3D2AA 1BCRA 1TK3A 1G66A 1MJ5A 4BTLA 1R3DA 2HA2A 2XUIA 3DOIA 2Z3WA 3PUIA 3O4JA 4PO3X 5AI0A 1U4NA 5AHXA 3YASA 2WJ3A 4Q82A 5JD6A 1WB5A 4JH0A 3TJMA 5DTJA 2C7BA 4QA9A 1Y7HA 3QZUA 1HQDA 3BE8A 1AKNA 3CCBA 3C6BA 2HA7A 2XB6A 5D7BA 3TRDA 2ECFA 2BCEA 3CXUA 1UK8A 1XZLA 4EUSA 4Y9SA 5HFNA 4GHWA 1Y7IA 5E2IA 4BRZA 1C4XA 1EXWA 1XZAA 4C4YA 3I2JA 1LPAB 3MVEA 1CIJA 3BJMA 4BVKA 1ODTC 4J0GA 5AKKA 3VXKA 1N8SA 5ALGA 3H2IA 5AKIA 2Z8XA 4HAIA 1M33A 2XUDA 4EBBA 4J0IA 5AO9A 3SWWA 2WG0A 2H9YA 3WIBA 1XQXA 2VAXA 5EHNA 5JADA 2B61A 4X97A 2CB9A 4CG2A 2HFJA 1L7QA 1ZGCA 5ALSA 4J0DA 5KREA 2WUDA 5CH5A 1ZD5A 4UHEA 4FFWA 2O2HA 1A8UA 5LYYA 4X6XA 4X6YA 3STVA 2B9VA 5ALZA 3IUQA 4GDMA 4AMZA 4K6GA 3E1GA 5CT5A 2AJBA 5JD5A 4Y2QA 2XDWA 1P0IA 2OGSA 3I2HA 4V2IA 3EBLA 4U2FA 2EEPA 4QZVA 3E3AA 3R3WA 2HRRA 3HACA 3F9CA 3H18A 3QMVA 4G1FA 5CBKA 3QMWA 5EIAA 4C88A 1QIEA 4KYVA 3FLEA 3R3UA 4FLFA 5A62A 4ZREA 3F98A 1UXOA 4ARAA 3HABA 2ROQA 1ZD3A 4Q3OA 4KAJA 2HL6A 5A2GA 3B3QA 3E4DA 3H0CA 3GROA 5FUMA 5LLSA 3IUNA 1SCKA 1YAJA 1XZCA 1GXSA 4BZZA 3FCXA 5DYWA 3WK5A 4BDTA 1XZIA 4GWLA 1QOZA 1VKHA 2YASA 2W22A 1BEEA 2Q0XA 1LBSA 1YB6A 5A7GA 4Y2XA 2RAUA 1D07A 2RI6A 1B41A 4ZV7A 1AC5A 5EHQA 3LS2A 1XQVA 1EK2A 2FJPA 4K6KA 3KXPA 3ANTA 3NGMA 2PL5A 1EVQA 4DM7A 2R8BA 1ZJ4A 4EZIA 2FUKA 1YB7A 5C7YA 2AXEA 2AJ8A 1E3QA 3VJKA 1ZJ5A 3LLCA 4OD0A 2WLSA 1TQHA 4HS9A 2Z3ZA 2Y6VA 2JGFA 2HDWA 2WIFA 3NWOA 3T4UA 3WK4A 3WL8A 4IH1A 3QITA 2OG1A 4AXBA 3WL5A 1L7AA 1EVEA 4I19A 4B81A 2H7CA 4OU4A 3H2HA 5JANA 3JYHA 4JYPA 2WM2A 3AUKA 2AJLI 5CW2A 5CT6A 5JZSA 4X3CA 5ALPA 4ZRDA 1VA5A 3G0IA 1U8EA 1EHYA 3FOBA 1ZI9A 1CUXA 1K6EA 4QNNA 1VXRA 2O7VA 2I3DA 4DLNA 2C5FA 1NU6A 1PJAA 4AQDA 2HM7A 2HA6A 4BCBA 3IA2A 1E8MA 1DTEA 1EI9A 2XUJA 3PDCA 1W4LA 3U0VA 3HEAA 1VZ3A 5JALA 1CUHA 3GA7A 1ZOIA 4B0PA 2WIKA 2RHWA 4ZGBA 2BGRA 4OCZA 2WFZA 4OPMA 2IX9A 1XZMA 4OB8A 3DYVA 1C7IA 2XUAA 2HFKA 5I7UA 3C6YA 5FXMA 3PUHA 3B5EA 5K3AA 4HTAA 3DNMA 5CH8A 3V1MA 2PSHA 3KWFA 1W76A 1MNQA 3C5VA 1CFJA 4HRXA 1DT3A 4Q3LA 4PSCA 3PI6A 4H7IA 2HA4A 3EIOA 2QS9A 5ALQA 1QO9A 4QDZA 2QXUA 1B6GA 1UKCA 1XQYA 5F4ZA 1LZLA 4BE4A 2D0DA 2VSQA 4QE3A 2QMQA 4LYEA 2VAVA 1DWQA 1VXOA 1GT6A 5ALKA 5AKEA 3DJYA 3UUFA 1Q83A 3L1HA 2JGEA 5AI5A 3AZOA 1JI3A 5I8PA 2G5PA 3OC0A 2PKYX 5CXUA 4GBGA 2PBLA 4GW3A 2XUHA 1CVLA 4GECA 4J3JA 5D3ZA 4YK7A 2V97A 1VOTA 3SX4A 5ALIA 4BYMA 1ISPA 4U2CA 2GZSA 1H2XA 5BWCA 1R4ZA 4E14A 1QIHA 2EDAA 1SCQA 2WUEA 2QR5A 4G5XA 2BFNA 3JW8A 1TAHA 1K5PA 1BU8A 1RP1A 1J07A 5A7HA 4FMPA 3UUEA 2RGUA 2G4LA 4GXNA 1Q0RA 1XKLA 2HADA 4OU5A 4Y2YA 1CUUA 5CT9A 2LIPA 1JJIA 2CKMA 3G9TA 4BC0A 4DSAA 5EIHA 2QZPA 2XE4A 1UOPA 3EQ8A 5HF9A 2AJDA 4LYDA 2OQIA 3T52A 1YAHA 2I03A 1DINA 1MO2A 1P0MA 3I6ZA 4CG3A 4NS4A 4Y7DA 2XMBA 5SYMA 2BKLA 3WKCA 1WB6A 1QLWA 3QMMA 3BF8A 4Y2RA 5A6VA 3HI4A 4UHHA 2C5GA 2XMZA 4FWBA 2CZQA 1DU4A 4N5IX 5AI9A 3IUMA 5AM1A 5FLKA 4C4XA 4TVKA 4B6GA 3HLKA 1G5FA 3FNBA 3FAKA 1EDDA 3RKSA 3A2MA 3D59A 1K63A 1FJ2A 2CUTA 1WPXA 4Y2UA 1IZ7A 2JGLA 3AIOA 4YASA 1LPNA 4W1PA 2G63A 3O4GA 4G8BA 4OYYA 1CUAA 3F97A 2HA0A 2GZRA 4G8CA 2JF0A 1KEZA 1CUFA 2PUJA 2X76A 1A8QA 5E4JA 5KWIA 5AK6A 1L7RA 3WKEA 5IVHA 1WM1A 4J0KA 5EIEA 2QXTA 2ZYHA 5ALWA 1QIKA 5AKHA 4PNZA 3WWCA 3CN9A 4Q34A 3PF9A 1F6WA 2VF2A 1CR6A 2ZSHA 1ACLA 2YYSA 2ONCA 2XMDA 5FPQA 5JZBA 2J4FA 4MWSA 3PE6A 3STYA 2DFPA 3G7NA 4TPKA 4X85A 1UKAA 2YH2A 2VATA 4UHFA 5LP1A 3DLTA 3Q0TA 2Z5GA 1UT6A 2QTBA 3DCNA 4JEIA 4CCYB 4U2BA 5HK9A 1PFQA 2I78A 1R88A 1ZIXA 4X93A 3MUNA 5IVIA 2WJ6A 4KE7A 1ZICA 3I2FA 1PV1A 1OXMA 2PPLA 3WA7A 4CI9A 3OPMA 4EY5A 4YX9A 4WY5A 3BL8A 1ZI8A 1TCCA 1IUPA 5IH7A 2FJ0A 2OCGA 1JMYA 5AM3A 1G4HA 4N8EA 1A8SA 1LGYA 4UHCA 1RYYA 5BWBA 3G0CA 2DHDA 2ORYA 4UBMA 3WIOA 1FFEA 5DNWA 5LZ2A 1LBTA 1JKMA 4WJLA 4FTWA 5A71A 4HXGA 4B82A 1QIGA 3ZLTA 4U2GA 1CUGA 1H2WA 4BATA 3I1IA 5ALVA 1DT5A 1ETHA 1H2YA 1KU6A 1P0PA 3BWXA 4BCDA 2ACKA 1CUCA 2YXPX 2WKWA 3V48A 1BN7A 1UOOA 1Q0ZA 2XQJA 4Y2PA 3BF7A 1DWPA 3C45A 1J06A 5CTAA 1EDEA 1X2EA 1SCIA 4X90A 3D4LA 3BIXA 4MYSA 5AM0A 3GBSA 4BDSA 3S2ZA 5ALHA 2O2GA 1CPYA 5CH3A 1YASA 2OCIA 2QOEA 2XQFA 1RWQA 5YASA 3QPAA 3VJMA 1QIJA 3WA6A 5LZ5A 1VE6A 1YA4A 2HRQA 4EY7A 5JATA 1CEXA 4B83A 2C0QA 3FWHA 3WZLA 5AOCA 4E15A 1VA4A 3IULA 1GPLA 3R3YA 3AZPA 3IUJA 2X5XA 2XUKA 4ZV9A 3STWA 5HCUA 1UK7A 2O7RA 3DL7A 4ZI5A 5T4BA 4C87A 4CCWA 4H7KA 4LIPD 3WK6A 3KSRA 4RGYA 2WFMA 5ALEA 4WDRA 1FFDA 4DGQA 2GBGA 2VJAA 4MJ3A 2Y1KA 1BCSA 3EF3A 1MTZA 4I3FA 3CN7A 3AIKA 3O0DA 5ALLA 1CUYA 2JGMA 4MYDA 4QLAA 3C8DA 5AK5A 2BAGA 3F67A 5AI4A 3PFBA 4EA6A 4HXEB 3LIPA 2XLBA 5LKAA 3FLAA 2PVSA 1CQZA 1MNAA 2QKYA 2PU7A 4N8SA 2XMRA 4ETWA 2QUAA 1WHSA 3WKDA 1CUDA 4FNMA 3VKFA 4DMKA 3Q8WA 2VJBA 4DNQA 2O2IA 2W6CX 1BEZA 5DYYA 3ZPXA 1CUZA 5AH0A 4KRYA 5I9IA 1R9NA 3WK7A 1LZKA 2Z8ZA 3QBJA 5K3BA 5CT8A 1GPKA 4HZGA 1XROA 5K3DA 5JARA 4XIIA 5JAPA 3H1BA 3K6KA 2BUAA 5EFZA 4BC1A 3VISA 4OYLA 4QWWA 3B12A 4QDXA 1XZBA 3BDVA 1AGYA 2E3JA 1GZ7A 2VJDA 5AOAA 1EK1A 5AKZA 2XUQA 4BAZA 4F5ZA 3STXA 4LHEA 5A7FA 4B84A 2B4KA 2GYWA 2IIVA 3C6ZA 2DQZA 2XT0A 5ISMA 4CCYA 1DWOA 2WIGA 2ZYIA 1H22A 2PSJA 4ITVA 1O6GA 4L9AA 4W1SA 3V1LA 4AMYA 5H3HA 4ROTA 4Y2JA 2I3ZA 4MXDA 2DR0A 2JBWA 4UFNA 2CJPA 1NX9A 4O08A 5DNVA 4B9AA
chains in the Genus database with same CATH superfamily
3AONB 4OA8A 1R66A 1SKBA 2GRUA 2EG5A 4FGJA 5E9JA 5DM2A 1KFKB 4NEHB 1ITZA 1N9GA 4WESB 2JD2A 4RWZA 5CRIA 4FOSA 2QA5A 2ZWMA 4RD2A 2X13A 3DGEC 1ENPA 1RC8A 4A8JC 1GLVA 2G0NA 2WSSD 4KQ2A 2ES4A 3ZKWB 4YACA 3IO3A 4FYIA 4M0KA 3TZLA 1UWCA 2J7PD 4NJMB 3W0LB 2NYUA 1ZHFA 2GWHA 2RAPA 1HT1E 4HDAA 4CDGA 4EKGA 4ZGGA 5A2QA 5KTOA 3UENA 1E4YA 2ZJ4A 2Z0MA 2A7QA 5I01A 4JLBA 3FHCB 4PV7A 4URWR 5FOWA 4NBKA 5LBTA 2HCFA 4LJ6A 4AY3A 4B3XA 3JQBA 4IEEA 5GVSA 3NUZA 4YGXB 4Q48A 2VYVD 2HR1A 1HC7A 1XMPA 4ACAA 4INAA 4I1VA 5A1TA 5B12A 5I7RA 2VQ3A 4RKYA 3J81A 1VKJA 3JATB 2Q99A 2XCOA 2X5NA 5CGQB 1W5TA 2XUOA 3EMBA 3FFXA 3OQBA 1GGNA 3DBVO 3DOCA 5LQSA 3RUAA 4BNWA 4XW2A 1B74A 4PX3A 2B30A 1IFXA 2C57A 2OHJA 2R2GA 2X8BA 3BJEA 5NLLA 2CE7A 1Q16A 4EA7A 5BR4A 3K70C 3LKBA 1J97A 4GKBA 1R37A 1XV5A 1JT9A 5TF4A 2MDTA 2HDNB 3NIDB 4M2LA 2Q4OA 2BGTA 2B9EA 4RNCA 1MX5A 1UZMA 4QO7A 4UDOA 4AO7A 4QQKA 1E77A 1U8ZA 2BJHA 3OIVA 4TKLA 1E7QA 2OWDA 3BBLA 3IVGA 3NXSA 2UVPB 4G4GA 3HYSA 3A4MA 2P2ZA 1OAOC 4L5YA 5HKLA 1P4GA 1D3AA 3AWIA 3P9IA 1QYIA 2YRXA 3VR5A 4AN1A 3K9LA 5FPYA 3K96A 4ZZ1A 1UFOA 4UMDA 5IVDA 1TM1E 1FTYA 1OYVA 1NDUA 2FMKA 2OYRA 5AIBA 1T9CA 4EKYA 3AVPA 2O48X 2ORWA 4AO8A 4PLGA 4DBLE 4ZVSA 1GL7A 1QG6A 3LDHA 1G2OA 1CY1A 1UXKA 4BUZA 5LZ9A 1PKEA 1HDYA 4CKCA 5HJEA 1QSGA 2WJJA 3GGCA 1HEYA 2XVZA 5CX4A 4P3PA 3ZY6A 4UNIA 1RMTA 3SZOA 2FHPA 2E82A 5CVJA 3ZWNA 1HFJA 1KR5A 1YZQA 2ZRKA 3C41J 3CH5A 4EMTA 1MD9A 4RC9A 1Q1NA 2AEEA 3PS9A 1EA5A 1TU3A 3E9QA 4L3WA 2FG6C 5DI3A 4WH0A 2BCJQ 4UBNA 3QIVA 2OXCA 3OQMA 3UF0A 1VHWA 4M1OA 3MGAA 3QI2A 4O2BA 5COAA 1A0OA 1WVMA 5EZ5A 4BQQA 2C7PA 1VYTA 3W5AA 4Z4GA 2I4MA 1G3QA 1V25A 1TEZA 3D1LA 2I62A 2VP3A 3QPVA 4G5HA 4J2HA 3T9FA 2KMLA 3KR9A 3ZZ0A 1K2VN 1M9NA 1NSFA 1GEEA 2DFKB 2NSLA 3M82A 4TL7A 2ECOA 1RLJA 1QTIA 3ABSB 1CSEE 4J16C 1ZRMA 1Z5NA 1SH7A 4RF4A 3I73A 4LDNA 5AKXA 4KN8A 4FEAA 2QTCA 4PZDA 1JPUA 2OSVA 5CCDA 1XZEA 4BAGA 5MGNA 4FDAA 2BEWA 1EZ1A 3QVKA 2G04A 2ISCA 4WADA 4ZVVA 1RKUA 1R4NA 4ZMRA 1IZ0A 1CRWG 2X8JA 1M1YA 2BISA 3EEYA 3JQRA 3OCYA 5KVVA 1OH6A 1NWCA 3E9ZA 5D3KA 2QK4A 2DF8A 4NNJA 1KNXA 5IARA 4YJHB 4X00A 4JUAA 3VPDA 4J9VA 4J03A 1AKWA 5EE5B 3TNDA 4J43A 4LX0A 4EPVA 1B23P 4ZJZA 3KQLA 1RYEA 4QNRA 5DMHA 3PUZA 1XQ1A 1YBVA 2YMPA 4IJVA 5JS6A 3ZWXA 3LBAA 2R8YA 5EPUA 1XHEA 1MB2A 1U4OA 1ZKDA 2DJIA 2MSLA 4Q3AA 4UXIA 3MWDA 2PMEA 3S55A 1K66A 3H97A 4YRLA 4XJVA 3K20A 5BR8B 1Y8RA 2BM8A 5TQ0B 4UEJA 4ZYYA 1I36A 3JQGB 4P4GA 1SCAA 4UHDA 3K09A 3IIJA 2ZBDA 2VT3A 2DPGA 1V26A 2QTRA 5A6SA 3R75A 1W5FA 3MN1A 2WWGA 3GUCA 1B1CA 1OAAA 1DEAA 4DWOA 1MHPA 1ZUWA 4J9UE 5K51A 5EUQB 1EDZA 1Y0BA 2ZVDA 3S7TA 3JQ8B 3V7NA 2R751 1DAFA 3ZE9A 3HZHA 1ECFA 1KK2A 3RI3A 2NSJA 3TZCA 4UU0A 3B1JA 1MJFA 1T1GA 3AEKA 2EX4A 4NESA 5LA6A 4JJ7A 4R9UC 1BKYA 1DXYA 2FFHA 2CLEB 1IN6A 2XH8A 5ALTA 3QX9A 4MRVA 1UR5A 2Z2XA 5ITSA 1VHTA 1X92A 4XLLA 5BV7A 5LLDA 2ZIVB 2BGMA 1KFBB 1Z8HA 2AVDA 2W2KA 2JHPA 3EQ9A 3CX4A 1QZ3A 3OA0A 5ALOA 2LRHA 1BG6A 1M7BA 1O4VA 4U02A 5DB4A 4C05A 2DLCX 2OHFA 3BHNA 3DT9A 3FBGA 4TYPA 1RHUA 4CQJA 4BRUA 3S8YA 1NGSA 2AE2A 4Q16A 3WGZA 1FE8A 4IIGA 4MA0A 3FROA 4WPGA 4ABTA 1CETA 3PHIA 1XPRA 3ITEA 3L84A 4QBKA 4FSXA 3F4LA 2YOHA 4JJIA 4UEKA 1B43A 3N76A 3N3AC 4X71A 5K7SA 4L50A 4COOA 5B53A 1E2IA 3HKCA 3NV9A 5FFNA 1SA0A 5KSOA 2PFGA 1WPRA 5KX5F 1T35A 1BDHA 1E98A 4QTXA 4YIKA 2OD9A 5F51A 2QU7A 3LOUA 3R3HA 1Y7PA 4NXMB 1I7NA 1ZUHA 4XGKA 1MPXA 4HGNA 4CHTA 1JFLA 1SG6A 3CEPB 4TQ9A 3OFJA 1L4EA 2W9XA 3FKJA 4MI1A 3RS7A 3TZKA 3F3MA 5DHRA 1NXSA 1Q0SA 2FR8C 2HWUA 3A7DA 3AF5A 2NWQA 3UJ6A 4B6FA 2R44A 2QJTA 3AJAA 3NWEA 3VYSB 2QROA 5KC8A 4UPVA 3R9XA 2XXAB 1NU8A 2PZMA 2J5RA 2BFEB 2MYTA 4MKIA 1LA2A 1D4AA 3EW7A 4JI5B 3FPFA 4QVGA 1E2EA 2WJ4A 3IBFA 5JRZA 2EBWA 3THXB 2J0QA 1RIIA 3KZKA 3Q7TA 2RG7A 4IDEA 2H1LA 5AVZA 1I8TA 1IM2A 1B4DA 1V37A 3EMVA 4E3WA 3HO1A 1XDGA 4YQYA 1UMDB 2NUPA 1AN0A 4RSHA 4F4HA 1JEDA 1G8KA 3DCIA 1OH7A 1U3DA 1L7MA 2GXUA 5LQUA 4X1IA 3HXMA 2ZJBA 4GM4A 1YI1A 5AVKA 4IOLA 4NCKA 8OHMA 1QE0A 3C3CA 3JY6A 3P71T 2PZLA 3SYTA 1XQ6A 2CCGA 1JHYA 3BA6A 5H8WA 2R6JA 4LXGA 4F71A 2R60A 3VAZA 1E0KA 1K2WA 1PQ4A 3GMTA 5AJUA 1P73A 1CK4A 5GWXA 1RM0A 2AK3A 2DE0X 3R41A 4TSFD 1BJKA 2QVCA 4YLEA 1UBJS 2ZIUB 4KJXA 2D2EA 1SXPA 2VXOA 3AYZB 3AG5A 2QRVB 3TWOA 1A9QA 2Y67A 1ISRA 4RFSB 4JX8A 5B2EA 3H5NA 1PDWA 4NHOA 1GKLA 4P38A 2ZSKA 2CYAA 2EKBA 3DPIA 3GUUA 3HJHA 4X0EA 2V7QA 5JR3A 4GZ6A 4OOEA 1VKNA 5WRFA 4NMXB 5EZ6B 1U3WA 1IL0A 1VIVA 2ACVA 2CF5A 3AFIA 3JQFA 4DC1A 4EECA 4Q3EA 4F12A 1AQJA 4GKJB 5KVCA 5AW6A 1Y1RA 1EP2B 3PEEA 5CFOA 4B0OA 1SKAA 2AHRA 2BKXA 4TS1A 1UQRA 2MSKA 3ESQA 5DNCA 4UAGA 1KI6B 3M89A 4L0DA 2WVHA 2XWSA 2TMDA 5AM5A 5EINA 5KVQA 3Q10A 4G9GA 1OWLA 5F2KA 4GI2A 2OAQ1 4PONA 1W4CA 4ZVUA 3PCTA 7YASA 4CV3A 1I3MA 2A9FA 2FSIA 2UZ0A 4IG4A 4PC6A 5DYTA 2AA3A 3VGPA 2QRPA 1EH5A 1Z06A 1O6ZA 4DMGA 4F6LA 4MEAA 3NCTA 4P92A 1O94D 2IGTA 4JP5A 1EDBA 4LHWA 5EY5B 3OX1A 3DVQX 4B5LA 4Z4QA 2YJGA 5IHXA 2Q8QA 3GEEA 1M6HA 3ILXA 4J90A 1E9SA 2FR0A 3NHZA 3QW2A 4MKZA 4DVGA 5AHKA 4J0JA 3NAQA 3UN1A 1U7WA 4B48A 1WCV1 2ZTSA 5H7XA 3TQRA 4AKIA 1QGYA 1Z83A 5A5FA 3NKLA 5ED4A 3Q8MA 1GG5A 1E1YA 2D13A 2E1PA 1HKHA 3AZQA 3GARA 3HRHA 3KJQA 1UMCB 1TCAA 4EEZA 2BF7A 3ZU5A 3FPHA 4PR0A 3WJ1A 2QDKA 5HUQA 3PKJA 1X1TA 2IYTA 1G63A 3ET4A 3IT1A 3FCYA 4ND8A 4UTXA 2FPIA 3UWPA 3VFDA 3Q3EA 5I48A 2HEGA 3H9CA 3NANA 1G2PA 3QHQA 4AY6A 1HE3A 4JA0A 1SVMA 3CLRD 3K35A 4F60A 4CGYA 4EB3A 4P4SA 3RRBA 2CUZA 3OIDA 1VHQA 3URMA 1EJBA 3B1VA 4N6NA 4DYHA 1IG0A 4FX5A 1RJWA 1NJFA 4XWGA 5AJVB 3LDAA 3TMKA 4RMIA 1T3GA 1KDZA 3U40A 3RAFC 4WN3A 4RCVA 1GZ5A 1ZA2A 2ET6A 1O08A 3SDSA 1VKOA 3KXLA 5A4IS 3H5LA 1NHGA 4IG9A 3AHIA 4UPEA 4PHGA 2GPWA 2CJWB 2PRZA 3KOUA 4CKZA 4LRYA 5KOIA 1XALA 2FPLA 3TLYA 4P3KA 3THSA 1HUQA 2OZEA 3GUHA 3WE7A 4AZVA 4ZVMA 1W73A 4YR7A 5K4GA 4LFCB 1QP4A 3BGDA 3HKBA 1NF8A 4N5HX 3AYXB 2B8JA 3NHPA 3RVBA 2WAMA 2PJRA 5LJIA 5J2UA 5I45A 2GFIA 1P7ZA 2DTDA 2V58A 3LY8A 3NZEA 2ZKIA 3I53A 3O7WA 5IVKA 3NHRA 2BBWA 2C8JA 1XTQA 3WO1A 4AT1A 2OQVA 2I6QA 3GGPA 3KQTA 3JQEA 3RADC 1QORA 5DGXA 4MROA 4E11A 3GT3A 4PR3A 2FSFA 4W9RA 5ELMA 1XTUA 2PLWA 3OSZA 4DEVA 3M5WA 4KXUA 4I1YA 5DNUA 1M2JA 3VR6A 4EPWA 1MO6A 2UUPA 1A5SB 1JHMA 3CGWA 4X6UA 1YA8A 2ZJ2A 5EJIA 4JFAA 1ZYUA 4R0NA 4YR9A 4G1UC 3CVUA 3HNPA 4HQRA 4ENQA 1EQAA 5AIAA 2CL7X 2PCLA 4LV8B 3QVTA 1CZRA 1BXRA 3P1JA 1PJ2A 1QRDA 4UATA 2QUIA 5EESA 4YDQA 4ZIRB 3KJGA 3IMFA 1QV7A 2PVPA 3AVOA 4M1KA 3JTEA 4NYJQ 2IBSA 3HHPA 5LXTF 1QH8B 3W3AA 4R9NA 1AV7A 4Z51A 1QG0A 2H5JA 4Z6KA 3TGLA 3A1DA 4Q02A 1Q91A 1Q95A 3OJEA 4S0XA 3LT0A 3JR7A 2ATIA 5FTNA 4R1SA 1LJ8A 4R8VA 3ERCA 2F59A 4EG5A 1RJEA 2P9EA 3QNUA 3JZAA 4KL8S 4DMMA 5B1HA 1E5TA 3SHWA 2GCOA 2VWQA 2WUWE 4HJRA 4R83A 2K2WA 4ZJPA 2JJ8A 1JQ5A 5JJIA 1NVXQ 3ORHA 1IK4A 1T2FA 4JUBA 4NOMA 4CDNA 4F9TA 2QBYA 4G0YA 3WGJA 3VOSA 3B3AA 3ZNQA 4ER0A 3H5WA 1Y3HA 3M70A 2GBLC 4MRSA 4WQMA 4DMHA 3ZJTA 2ZYTX 3N3BC 1JEQB 2VPYA 5MN6A 3TBFA 1D04A 3DOFA 1OU4A 2Z30A 4PAOA 3L0OA 3QE2A 3G2NA 4P7BA 4ECAA 2M1XA 4B33A 3DVSX 1E8NA 3SJUA 3TZ6A 1AS0A 5K0EA 3N6XA 1T8PA 2A1IA 4Z9YA 3IL2A 3L06A 2GPYA 5KPJA 3T5TA 2CNOA 3UKJA 3ICVA 5HWSA 4CUZA 4AS3A 2AFHA 4FN5A 1UZAA 4MUYA 3R9IA 4AO6A 1WZUA 1W4RA 1Z26A 3LM8A 3PQDA 3GDHA 4FZVA 4QQRA 3LWNA 1T26A 2DH5A 5AJHA 3DVLA 2JEOA 2Z6AA 1RHRA 2HA5A 2I6FA 3EXIB 1KDPA 2DX7A 2WNHA 3MJRA 4P4TA 3WWDA 3U6BA 1NF3A 2W98A 3KG2A 5L45A 1EK6A 1EVIA 2K87A 1P2FA 1LU9A 4X63A 3WY9A 4ACBA 3RKUA 3RKRA 2IXTA 2ODNA 5F33A 2J8ZA 3D4PA 4H18A 4S1PA 5CEJA 2VF7A 2JVIA 1HM5A 2PZAA 2X0JA 4IEFB 4Q4JB 3BZBA 1JYFA 2WBLC 4GYYA 2JJ1A 2H8GA 4Q3KA 5HE9A 2YVLA 1APBA 3RM3A 1I51A 1YQUA 3MSXA 3OM1A 1ZONA 2H1RA 3I6MA 3SBEA 4LBWA 3SXUA 3HJAA 3STHA 4MP8A 4P31A 3BMNA 1OT3A 2D3TA 2JFHA 3R0JA 3U9SA 3WYAA 4CG0A 4GPD1 1ZGHA 2FXVA 1JHVA 4QGHA 5CIWA 3KFVA 1Q84A 1J0DA 2OCPA 3G2OA 3PD1A 1MO3A 4OMCA 3T8YA 1Z29A 4BN0A 2P2NA 4FCCA 1PQPA 3F3SA 4R16A 4GLBA 3O4HA 1FLVA 3C4VA 4K8RB 5SYAA 3GCZA 3W2TA 5G3YA 1O9BA 1QZXA 1FX0B 2PL1A 3PNOA 1QAQA 4UNSA 3QYJA 3D3WA 2GEKA 3OE5A 2DXIA 1A82A 6GPBA 1R00A 2YWDA 2A30A 2GM3A 3B2EA 5JQGB 3HA7A 3QNMA 1OIWA 1ZXLA 1F12A 4GE3A 2NT4A 3RARA 3LVBA 1FDWA 1AXEA 3MUFA 3KZOA 3NHWA 1ZINA 3QUSA 4PYMA 4ARZA 1X87A 2B8EA 3C4JA 3C6KA 3LKVA 1NATA 3H65A 3QE4A 4LUCA 3ZZ1A 3TB4A 1XYYA 3VYUB 1V1MA 1IB6A 1F17A 3UV7A 3GJSA 1U7OA 2XT9A 3VH1A 3K71B 5CVDA 4YTEA 3OKFA 2QQFA 3I0NA 3EFBA 1Z07A 2AN9A 5CLFA 3F49S 5K0JA 1USVA 5L8VA 4R2WA 1KZHA 5LQJA 2WAOA 3FBTA 2RJ3A 1W85B 2ZBUA 3MB5A 1IHOA 4G8JA 2GYVA 3OKPA 3PC2A 4IQFA 3CKYA 1MIOB 1UP4A 3LW7A 2Y1EA 3P2OA 1K27A 3MIZA 5BMOA 4D42A 4MEBA 2J5XA 2C94A 4WKGA 1DXOA 4QAQA 1LPOA 4YMSA 2JA1A 5AFSA 1U28A 3Q85A 3T06B 4Q9LA 4WIAA 3EA0A 1HFWA 4BE7B 2CNLA 4U7PB 5BNTA 5GZ1A 1C1YA 2F43B 1NG9A 4URFA 5FPHA 4J1QA 4ETNA 4RMJA 4WBNF 5LKRA 2ILVA 4TZ6A 5HFAA 1ULUA 3HBAA 6YASA 1S1CA 4IILA 1AUQA 1OXVA 1FNCA 2WLTA 1WXQA 4BO8A 1M2OB 1F8YA 5FJIA 1NDHA 1V3VA 2I22A 3R7FA 4AJNA 4DADA 4WEQA 5KYGA 1T3LA 1UWKA 1ACJA 2C5LA 4BMSA 3Q8LA 2D5BA 3HEBA 4C3VA 2YXNA 3NTXA 3ZDQA 1E3JA 5DBOA 3P26A 2Q4RA 2P1RA 1S2MA 1ZGZA 4GI3A 5LNK1 1W36D 4OAPA 2AVNA 3NOXA 3BWDD 3IODA 3KB6A 3BXPA 4GMKA 5J43A 3M0EA 4M0FA 3M5PA 4F7WA 1PZEA 5IN5A 1XI2A 1NVUQ 5B36A 3HXKA 4YBZA 3UMMA 1MABA 3JZDA 3U4HA 1W0KD 2VJOA 1ZUNB 2HGZA 4MA5A 4KUEA 4G36A 4XR9A 3RRXA 4WFIA 2X5OA 4O29A 2BEVA 4D8XA 1R6UA 4N3GA 4HNUA 3RYIB 3SVZA 1WSWA 3QFSA 5C8YB 4MIEA 3Q6NA 2Y1WA 3N0XA 4JKOA 1UDAA 3H5RA 4KUGA 2O2EA 4P4NA 1ML3A 2RK3A 3SBOA 1NFFA 4Z0TA 3EN0A 3G0BA 4B7CA 3WYFA 1Q7CA 1KDTA 2WD7B 1TEHA 1CT9A 1TXGA 4INJA 1K8ZB 4UD6A 1O6BA 3ADOA 4HLQB 1K3TA 3CVVA 1B2RA 1TMOA 2PNFA 5FDFA 3VNSA 1KMNA 3AEZA 1CZHA 1DQYA 3KVYA 1UAAA 2PL3A 2WU1A 1G7CA 1AKYA 2XNCA 3ENQA 3K1JA 4LDAA 4L2IA 2A0YA 3L7BA 1SQFA 2SKEA 1OVGA 1E3TA 2XE6A 1Q1QA 1P74A 2XUPA 1ST3A 2EYUA 1SWVA 4JASB 1SUWA 3DOJA 5FA8A 1LW7A 4NNOA 1RPTA 2DMRA 4XM1A 5ALXA 4D41A 4D4MA 1C9DB 4F4FA 5M29A 1UKZA 2PKCA 3GIDA 1ILEA 5B1EA 4CIYA 1TTPB 4EG0A 2DERA 1DADA 1IXSB 1DDIA 2GO1A 1XRPA 4R9RA 2P9QA 1JVBA 2H4HA 4ITRC 1PHRA 2WYUA 3GH3A 1AVTA 2VN8A 4J76A 4W63A 4D4GA 4HB2A 1X9HA 4G1EB 2N42A 4DPLA 2WG1A 2ZSIA 2QY6A 2H1HA 2A2ZA 2FZCA 4EA8A 5HKOA 2YOGA 1JG3A 1X1BA 2VPZA 3QFCA 3ZNNA 3UC5A 4BVLA 5KBYA 4DIKA 1BVRA 3W04A 4EAQA 5LZ4A 1KRXA 3QVLA 3ZDDA 3FBWA 2YVQA 3MUEA 3UYKA 3UNXA 2BV3A 4D8YA 1D2NA 3NUGA 1TM5E 4MWTA 3FNEA 4HYTA 3SXPA 4BNIA 1FXWF 4NCBA 3PGKA 3IILA 4LJKA 1DJLA 3I45A 5JW6A 1B1AA 1WMDA 1T5IA 2G09A 3JSXA 4CM9D 4IRUB 3RT1A 3CNOA 3K8YA 3FMOB 3GEMA 1DCFA 1WZEA 2A84A 3OT1A 3QQPA 4G81A 2I6TA 4OIFA 2ZE5A 3DFFA 4PYRA 4LOLA 1TIKA 2WF5A 1O7JA 2AI1A 3LC1O 1F9EA 3VSAA 2IBMA 1F5NA 1I7SB 3KOMA 2J5QA 2FF5A 1EGAA 3EHEA 4HH1A 1ECJA 4HUQA 3HR7A 4TTJA 3FYUB 4S0ZA 2VBIA 1G4AE 2XQVA 2GEDA 5FLYA 3IBCA 4EJSC 2Y6UA 2P3SA 3U3ZA 3H8VA 1LB1B 3BTOA 1N1GA 3DV0A 4YONB 1AGPA 2AF4C 4X7PA 2RIPA 2H4FA 3QVOA 3VDQA 1T4BA 5B1SA 4DDUA 1KO5A 3QGMA 2O8FB 1GQSA 5GY7A 1G20B 1RKQA 4MUKA 4GX0A 2QT1A 4N0QA 3G13A 1UFVA 3EEQA 3N7UA 2I2WA 4M6WB 3P9RA 4P58A 3TFWA 1RPZA 2O9JA 1GPMA 2QTHA 3D3NA 5CR9A 2ODEA 3V1KA 4BHTA 1A2OA 3SC2B 3EA4A 2W11A 4NYIR 3T5DA 3VO1A 1QRTA 4X1YA 3NHJA 3QF4A 4FHFA 4ZRMA 3T1TA 1QRSA 4TTSA 2YR0A 4H0CA 5JDCA 1R1DA 1Z2DA 2GNPA 4AYWA 4F9EA 5KKCA 1U0RA 1HYGA 1VE9A 2NZUG 3H87A 4JCCA 4LSWA 3TQCA 5LJLA 3BB1A 4V0KA 2GXAA 3NFYA 3ABZA 1A9YA 2YV1A 3HFRA 1DQSA 3EGCA 3DAHA 5GONB 2E4ZA 2XDQA 3IDAA 1P19A 3LD9A 1HZJA 4MV7A 1XRQA 5EXEA 2GPJA 1OLUA 1KFEB 4XGQA 3AW9A 2ZIXB 1C14A 3GNSA 3N1UA 3TR5A 4NBVA 5FX2A 3INTA 3SX0A 3B6EA 5TQ2A 4B85A 4BY9E 2V7TA 5BW5A 4PGMA 4JI0B 3R7SA 3DKKA 4UTRA 2YWBA 1C50A 4DLRA 5GV7A 3A6FA 5EMLA 2XI4A 2WT9A 4QQ8A 1YR2A 1XZDA 1YDGA 2IIPA 1SFRA 3ILSA 3NHUA 1RNLA 2AMVA 4RZ3A 5TY0A 2IT1A 1FUKA 4AD8A 4I9FA 1K92A 3H5AA 2AG6A 5T4FA 4NKRA 4AJIA 2HZBA 4AF6A 5LYJB 1OPXA 5SZJA 3B6IA 1TADA 5AQEA 1JKJA 2CVQA 5AI6A 1ZXXA 2TMKA 3QUCA 1VLQA 1ZC4A 4F84A 3ZH2A 4DCTA 5CVCA 3MJHA 4CMCA 3P32A 4CFSA 3DMPA 1OGIA 3ZHUA 1GLNA 1DJQA 3F6RA 5KHAA 1WUTA 4AUMA 4G25A 4BXOA 1NQ5A 2VP0A 3FN4A 3G49A 3MRTA 1D6JA 2FE1A 3EXFB 5TEVA 5IM4A 4KR0A 1VIDA 4KRXA 3R8FA 1U1DA 4A10A 1QANA 4BNDA 4NXNB 2FLWA 5K3FA 4AWAA 2IY7A 1QJCA 3TKLA 3TD9A 5FBRB 3EPHA 4DLVA 5T5QA 3CR8A 1DUIA 3QOXA 1SGWA 4KQFA 4QSMA 2QRHA 3TNFA 3WK9A 3OJOA 1WMAA 4DMCA 5CJ2A 1GARA 1ISSA 4G0NA 5F3RA 3AERA 2VAMA 4UZSA 4U8HA 2IEDA 3RUIA 1NIPA 1X94A 1EK5A 4HXFB 5ADUS 1KJIA 3Q11A 4U4AA 1B14A 2WSIA 3HFSA 1S8AA 1FQWA 4IJQA 1SN7A 1UBKS 1YCHA 2IEIA 4MWZA 3TFQA 3WZMA 2R7AA 1SXJA 2C5BA 3C8HA 4URZR 3K4PA 3MJSA 3CWCA 1E4VA 3W8DA 2UZ1A 4GEGA 4OHYA 2NM0A 4XLTA 3TEJA 1R50A 2I4LA 1THMA 3BYZA 2ZYDA 1FK8A 2BFOA 1E20A 2Y9MB 4MP6A 2AUNA 1RYMA 3KWLA 4O8ZA 4OF4A 1YE5A 2AOUA 3SYLA 3VSBA 3CCFA 4CQLB 2YL2A 1VRCA 2ZPUA 3KLOA 5FA6A 3SAJA 3KJZA 4EFKA 1QJ4A 4Z1MD 1UKYA 3U31A 1BMFA 2YNMA 2GM9A 2B6NA 1W9MA 3DAOA 2ZI4A 4E5DA 2H07A 3CEAA 2W0MA 4A0QA 1HLFA 3V3KA 1A8HA 1T6YA 1U2GC 4MVJG 5GVRA 2I87A 3KKQA 1P18A 2GR9A 1QAOA 1MAVA 4PSAA 1OILA 421PA 4EB8A 4K88A 3KZNA 1G6HA 2DVMA 5LOVF 3DLAA 3SBXA 4CEJA 2I9KA 3I6BA 3QEKA 5DCWA 3NYRA 4HH4A 1D7AA 1R3UA 2R8EA 4LHVA 4E7OA 4LMRA 4EHIA 3O2SB 5PGMA 2UXDB 3OZCA 3A25A 5LZ7A 2XQGA 4BP8A 5CT4A 2Q6KA 2VZEA 3OTQA 1EBUA 1P39A 2NSHA 4FFSA 3HU3A 3OOSA 3LQ1A 2XWPA 4ENTA 1DCTA 4W1QA 3ONDA 2W7TA 1RFLA 3UGQA 4W5HA 2ZYWX 1MB4A 3FYTA 5TQVA 2GESA 3BWBA 1GNRA 4Q1FA 3AUXA 4JT8A 1C7JA 1PZXA 3ADPA 4DJEC 3ZHVA 3DV2A 3FPCA 4JXKA 3WJ7A 1XCBA 2F1RA 2ZRBA 4HZUB 4HX2A 1QHGA 4EOGA 3IXQA 3L0YA 2ADFA 2BHLA 1BEUB 2ABWA 4V38A 2QT9A 4A7PA 2Z9CA 1DRKA 3QX8A 4DLSA 2LBPA 5HKKD 3LC0A 4HTFB 2HCTA 1PS9A 2RAFA 1GTZA 4BFXA 2E4VA 3FYDA 2C5SA 5D6NA 3TBHA 3C15C 4EGQA 5KYWB 4YUVA 3RV4A 1WX1A 2A6PA 2QIPA 3DZDA 1XLVA 1S1MA 3DL2A 1D0IA 1N8KA 4R3NA 4RGQA 5EFOA 4D0GA 5IKPA 4HEA6 3UK0A 4IH9A 3VDRA 2XITA 4OJNA 2CXPA 5EVCA 4CF3A 2PX6A 1DQZA 4LA4A 4YRPA 1DFGA 2WILA 5G0TA 3FF1A 3FI0A 1Y5MA 2FN9A 1PR0A 1KXJA 3GT7A 4CMEC 1QX4A 1R5NA 1T1RA 5CEFA 1S7CA 1XFDA 2V0CA 3EVBA 2YC4C 3IKTA 3L0SA 2EX0A 3UOWA 5L4NA 1AQNA 5JTTA 1HLDA 1JFRA 3IQEA 2AYZA 1VYVA 2CLMB 2XRYA 1XQ9A 3F0TA 4A4DA 2V1XA 3IP7A 1XAGA 1R0ZA 4UNQA 3REQB 1TD1A 1JU3A 4AY5A 5FNZA 4E22A 1A3CA 1YE3A 3MINA 3ZWDA 1FVFA 2QPAA 3VPXA 3TDMA 4EPRA 4L8GA 1YHZA 4C5CA 3QLUC 5BSUA 4UREA 1GAWA 1XLUA 3ENZA 4J1SA 4XIJA 3BMOA 5ED0A 1C5KA 3JARA 1J24A 4DLWA 1M34B 1GQOA 1GL3A 1P7CA 1ODKA 2RGGA 1DEHA 4HAOA 3TI7A 2ZRCA 4FXOA 3RIGA 1OFVA 4WFJA 4JIMA 2EHDA 3MRVA 1MX9A 3AXTA 2GN1A 3U4QB 3KYDA 3TOXA 1WWKA 3TW8A 1T2UA 2NV2B 3OWXA 2Q5EA 4DY6A 3H7AA 4ZCLA 1Y9DA 3RT7A 1SURA 5AP9A 3W8FA 4BLTA 4DG5A 3E5RA 4I55B 1QHYA 2COUA 2NV6A 4RIGA 2IV7A 4UM5A 3TLMA 1V3UA 1IUOA 1KSFX 2LR0A 5EEGA 1TTQB 4BB9A 1N5OX 3OPYA 3Q3VA 4FXPA 5KNLA 1K8QA 5E4YA 3I01M 1WB9A 1U99A 1KJJA 5HNKA 3UANA 2AWNA 1KY3A 1E1RD 3ORQA 2HREA 2V74B 5EWJB 1TO6A 3CH7A 2I7CA 4YRZA 2H5IA 3FTQA 5AUOB 3IP1A 2VKTA 3LPAA 5D3MB 5L3QA 2BBTA 1Q44A 1JDNA 5AHOA 1PJSA 1LLQA 2JBAB 2Y0EA 4XQGA 1UOEA 2YDXA 1P7VA 2AOXA 5FOUA 4JYZA 4DNFA 1KYYA 1G9SA 3ZDCA 2JAPA 1IN8A 5K8TA 3C0KA 2RE8A 3I2YX 4KXYA 4V24A 5HG0A 1Y3IA 3QBTA 5IKMA 1SVSA 2XAAA 2X6RA 1NBME 3ZCQA 1YSCA 4G8DA 3ZOZA 2CKDA 5DEOA 4CODB 3BL6A 4QU0A 5CA1A 5HS6A 3C39A 5GGYA 4QYTA 1EHIA 1U3FA 1GTG1 1XKTA 2QRKA 3RNOA 2BEKA 2WWWA 4XGIA 1FFCA 2F3RA 2NU6A 4EYKA 4JYAB 1QGED 1KIFA 2HUPA 3M3DA 3V8EA 4DTIA 2XYPA 2ZJ6A 3Q88A 4RY9A 3LBYA 4CL3A 2O3JA 3HXOA 1PGNA 5EHZA 2JAHA 1D7OA 2CB0A 2JH3A 5KAMA 2W58A 4KR3A 3RBZA 3CE9A 3CS3A 4RELA 4RTPA 3U7EB 3ILYA 2G6BA 1NXQA 1RJGA 3IV7A 4UCFA 5AXBA 1MHTA 4W5OA 4HNAA 1A7UA 3ACBA 3DKRA 3L6EA 1ST2A 3BQNB 3GA0A 4I9NA 4UUPA 5E3IA 2F64A 2OXTA 3FDIA 4LZJA 1K97A 4DR4B 3LV8A 4DCOA 2LCFA 4BRSA 2JAUA 3K0FA 1KEPA 1J9GA 2WVAA 4BDTA 3H75A 2DULA 3DF7A 5DTRA 3OPVA 5ILGA 1N8NA 1VLZA 5CLIA 1E2PA 5C3UA 1KEUA 4WL0A 4O8CA 3HLTA 2MR5A 4CDMA 2OCAA 4S24A 1I6WA 3C7TA 4NF2A 4GKVA 1RZRD 1TZ2A 4HAWA 3SSOA 4UU7A 4KSCA 1HFKA 1Q1EA 3PC3A 4NAVA 3DE2X 4NE9A 2QZZA 1OJ7A 2WM3A 2CV2A 2I80A 1E6EA 1H5UA 2YN0A 1R3DA 1XTPA 2HA2A 2R5WA 3CB4A 2XUIA 1P2SA 4TMVA 3E2IA 5DN6D 3IOCA 2WIBA 2R85A 1EMDA 1JBQA 5FFFA 1QQBA 3B8HA 2Q5FA 4XEUA 4CKXA 2ZQZA 4XWOA 2AKEA 3QVGB 1P5HA 2IEZA 3G1UA 2C31A 4JKYA 4C0LA 4JLUA 3DTVA 1ZLYA 1XT6A 2V5AA 4R54A 2CXXA 3M7IA 1WB5A 2D1YA 5EE0A 3TJMA 3BGVA 3ZTYA 4BO6A 4YRBA 2C7BA 3CTMA 2F3UA 4YCDA 2EJTA 4QA9A 3LTNC 4R6WA 1JSLA 1EXNA 5FQOA 3OWOA 3BE8A 2NZYA 3CCBA 4R5MA 2XA9A 2HA7A 1FJXA 1KSGA 3QPBA 5D7BA 2PNJA 4ZVLA 1PEAA 3GRVA 1I3KA 1QX3A 1RCTE 3DM5A 4CQMD 2BCEA 5IM5A 5JXJA 4TLCA 3PNPA 1DTSA 4J4TA 3HVHA 3PEWA 4QBGB 3CXUA 5K8CA 4MW7A 3U80A 1DHRA 1S0UA 2OXIA 1NVVR 1IQUA 1XZLA 3LUFA 3P9PA 3ROQA 5HFNA 4C20A 5JYEA 4GHWA 3NPAA 1Y7IA 4F21A 3BFJA 5I47A 2AXNA 1V47A 4BRZA 1J1UA 2H2DA 3K72B 3TSWA 5TPZD 2PSSA 2DM6A 2MT9A 1SAYA 1OYWA 3H3JA 2WRZA 3AI3A 5KOJA 4JUDX 3IE1A 1IZ9A 1C4XA 4HDNA 1F1BA 1EXWA 2I8AA 1XZAA 4ERXA 3PC6A 4R3WA 1V8DA 3TRFA 4I08A 3GN2A 2QLBA 1O2DA 3GFVA 5J5VA 5AW4A 3OX4A 2XRZA 4EI9A 1XXHB 3VR0A 3MVEA 1Q1BA 3N0VA 4O2AB 4PO9A 4YRFA 4N9QA 1QC5A 3WMFA 4BVKA 5IXSA 3Q98A 2I6GA 4DV1B 3BX1A 5B7PA 5AKKA 3O90A 3HFJA 3R8CA 2IPMA 3P5BA 4P5EA 3VXKA 5E1DA 2I2FA 1P6QA 4JT4A 1XDSA 1WDLA 3G1TA 5EQTA 4EW1A 1GFIA 3WZ2A 4XX0B 3GAZA 2REQB 3WRXC 2BH9A 4LF8B 4HAIA 4LY0A 1M33A 3ZQ4A 4BNLA 5JFGA 3R9KA 1VTKA 2IH2A 1WU8A 5AO9A 2CHEA 5TNXA 1CJVC 2PQMA 3GJZA 5AYVA 5TJHA 3A4TA 4HDCA 1G0NA 1WXHA 5JFOA 1UDWA 4OK6A 1G21E 2JB9A 4QT0A 4Y9UA 4HLCA 5EHNA 2NU7B 4BMZA 4EUHA 2C2YA 3U3XA 1GZVA 2XZLA 4TL8A 3KTAB 3GCWA 1LW6E 1ZK2A 3DDHA 4QO8A 4N41A 3ZIAA 4EVQA 1LJLA 1EVYA 1EZ4A 4RANA 4J0DA 5ALSA 1GNQA 5G2OA 5KREA 2EJWA 4QQNA 2JZOA 4EHKA 4ZYZA 2OUKA 5IK2A 3LLUA 4I3HA 1V5IA 1BMTA 3VV2A 4CMKA 3HN7A 4P2GA 3WLRA 1FJGB 1A8UA 3TAHA 2G67A 3QXCA 1AQ6A 5BYAA 4OI4A 3IIKA 4WSOA 1JR3D 1R6TA 4TLLB 1EFRA 1NT4A 3LXXA 1RQXA 1RRFA 4RD0A 4AMZA 1EX6A 1HE5A 1KK0A 3JD4A 4YXWA 4PYIA 4HBGA 4R2LA 4F04A 1KMIY 1SBHA 4KLAA 3W7AA 5FTKA 3H9EO 4KXLA 4LVNA 2AJBA 2PGIA 5JD5A 4IEIA 4F93B 4PGFA 4XB6B 4D43A 1NW5A 4V0ME 4FJ2A 3L01A 4CMIA 2VR1A 1BO6A 2IZ0A 2XDWA 1E9VA 1P0IA 2IIQA 2OGSA 2SKCA 3BBPA 2W6JD 2ZAOA 3L43A 1JXOA 3EBLA 2EEPA 3PPVA 4OOFA 3R3WA 1X6VA 2P4SA 2VOEA 2HRRA 3O73A 3OQPA 5M5BA 3AR9A 5C1OA 3H18A 3N59A 3QMVA 1NA5A 3QMWA 2TRSB 4FIDA 2FQ1A 4GM0A 3DWGA 3WNVA 3SQMA 4C88A 4ZYVA 4JT2A 3FLEA 3R3UA 4R0VA 1B73A 2ZYVX 3OIYA 1M72A 1GV1A 5EHIA 3GD7A 1Y1QA 4AFNA 3AR6A 4ALJA 4XPIB 5IFKA 3VOBA 4Q4AA 5ILOA 1PD1A 4MX8A 4ARIA 2JFWA 3F98A 1FYFA 3E9YA 4IL5A 1EFVB 1UXOA 3DUFA 3JYOA 2EIHA 4JVMA 4F86A 3ANMA 4IHJF 2ROQA 5DRYA 2EZ9A 4U7GA 5GGXA 2OYCA 1YJ8A 1PLJA 1QYXA 3MBOA 3V8BA 1FDUA 4Q3OA 3T3EA 2R00C 5A2GA 3Q5DA 2C4TA 4YJFB 3B3QA 3T3IA 3IP9A 3UK2A 3GVCA 2R1TA 1L8XA 5LLSA 1KI1A 1YAJA 1OZFA 2XBMA 5TJ9A 1GXSA 1NUPA 2RGDA 4L28A 1FFXB 2H2WA 4ER3A 2YZ7A 3M6UA 1SKQA 2LW7A 2PWYA 3HJGA 4O4LB 1P5ZB 2Q45A 2BP7A 5J23A 4R3UC 3K0CC 3I0MA 3ITDA 1NLFA 2Y92A 1PT9A 5TPWB 3GLGE 4K9SA 1AKMA 3KB2A 1TCVA 1PFYA 3ZK8A 1KS2A 2Z56A 3EGDA 3G5AA 4O4JB 4OHKA 3JS5A 4TKZA 2G8LA 3WB2A 3CH4B 1IULA 1D2MA 2C2BA 2QLLA 4U5QA 5FWDA 1TKCA 2V4ZA 5CDFE 1OPRA 5JV5A 4XWAA 2GRAA 1MVOA 4A91A 2PX4A 4IMIB 4RVCA 4ZV7A 1M2FA 1ILWA 1LF5A 5EHQA 3RFCA 5BV1A 5SZKB 4D8UA 1GAXA 2C82A 2FJPA 4ZC8A 4FNOA 1OBFO 1P0FA 3KXPA 2BR4A 4XPZA 3FOFC 2ECQA 1JXAA 1BQ3A 1ZJ4A 3SSMA 1C3OA 2YIJA 3VYTB 1LXCA 2FUKA 2Q2VA 1YMVA 5AW5A 5JNUA 3KJNA 3V4RA 4MDFA 1BVUA 3F5MA 3VSCA 5C7YA 4QUJA 5F7ZA 4M1WA 1Y6RA 3RRJA 1GADO 3X1KA 1E3QA 3EVDA 4KI0A 4LHZA 4FC6A 4V3BA 4OHZA 4BNGA 3B36A 2FSVC 3ZGZA 2QTFA 1P7YA 1F2TA 1AQIA 2X4IA 4C08A 3GCXA 4RQUA 1X8XA 5EIFA 3DAGA 4ZT4A 1EQUA 4K9QA 2CNDA 4J2TA 1Y8ZA 3LCUA 3RS2A 3MZ0A 2ZAIA 2ICAA 2X19A 2R0QC 1H2EA 4OI0A 1QPBA 3IDQA 1OU0A 2PX2A 1T43A 2HDWA 1OIXA 2ZBPA 5FBHA 1Q7GA 1JR2A 1NJGA 3WK4A 3AEXA 2J45A 2BFCB 1Y4AE 1AF4A 1KMCA 1ECLA 2WJZB 2ZROA 1E5LA 1PR6A 1LSOA 4ZI3A 1NXWA 2HDOA 3L6OO 3WBKA 3PYLA 1S2LA 3P2EA 2AYYA 3T41A 3EGXB 1P3Y1 4HB0A 1Q57A 2M6RA 1YU6A 2YWEA 3E22B 4JP3A 1UPCA 2GEFA 4RKEA 1Z4QA 3DULA 1GYRA 2M9MA 3IQFA 2JH8A 1KTIA 3OEHA 3EDQA 4KK3A 4UUMA 1I5OA 1LV8A 3IUPA 4HS4A 1USUA 2Q3FA 2AC2A 1R9GA 1K7FB 1P80A 2H7CA 2O7SA 1DC3A 2QD5A 3OHMA 2QAGB 4EL0A 2YW9A 3FZGA 3H2HA 3BKXA 1AIPA 4D9HA 4WZBA 4YVFA 1PNOA 1XVIA 4JYPA 4QARA 4E12A 4L3OA 3ZZTA 3LCCA 3D0RA 4J4BA 3D4BA 1OVMA 1I3LA 4PZ0A 2FJUA 3B53X 4QJBA 5CT6A 4B1FA 3JAMA 4RYDA 4TV8F 1ZISA 5K03A 1B3RA 3PDIB 4X3CA 5BR1A 4COKA 2B4AA 2CNBA 4M49A 3EXHA 1ZI9A 4NBLA 1CUXA 1RRGA 2HK8A 5HRAA 5TE9A 1N9KA 4DLNA 3DZHA 1N6LA 3WQRA 2XV1A 3BD6A 4A73A 4OQPA 1NU6A 1H9AA 2LD4A 4FE4A 1MPTA 3N8DA 4I8XA 4YJ2B 2AQ8A 1AK1A 1Z25A 2IC5A 1AMNA 3ZCUA 5GV8A 3AM4A 2HA6A 4KOEC 4BCBA 4V02A 4JP1A 3QFTA 2Q8NA 2P6RA 1N25A 3JQQA 5IC4A 4WXRA 2C83A 5F1KA 1EI9A 3HRKA 5EZYB 4HKTA 2XUJA 1NMQA 1QGUA 2VQDA 3PPXA 2EZ4A 1RPNA 3QSYA 2P2SA 2NXJA 4R31A 5CM9C 4ZCTA 1V3QE 2QB5A 2Q5OA 1CB7A 2PWAA 3GMIA 1WA5A 1ENOA 3D7KA 3C3WA 4L8VA 2QVXX 3IVRA 3QU2A 3S1AB 3HSYA 3T3DA 1CUHA 2DWUA 1ZOIA 1I7QB 2MHCA 1ULSA 1V1RB 4TZTA 2GT1A 4B0PA 5FF9A 1LBHA 3LQ2A 5ECDA 3ONWA 3UCEA 3TG8A 3EPKA 2RHWA 1T25A 5BUCA 2BT4A 4RJKA 3W34A 3VYVA 4QREA 4X1KB 3BVPA 2IX9A 2JATA 1WG8A 1XZMA 4LDZA 4LW8A 2A33A 1T5SA 3HYLA 1OZAA 4M9SA 5P21A 3DYVA 2BWJA 2I66A 4DDMA 3IESA 4V1CB 1NQVA 4KX5A 4ZQIA 5I7UA 2Z9DA 4CTKA 3SZRA 5HTOA 3DJFA 2R62A 3PUHA 5DKFA 3B5EA 5K3AA 3U3MA 3GLFE 2JFYA 4ZZ0A 4YDRA 3B85A 3DNMA 1ZHOA 1I2CA 5TT1A 4EMSA 2KB0A 4RDHA 3L4BC 2ZJ5A 4EG7A 2CK3D 1HOXA 4G0XA 4BO1A 2IOFA 4Q9DA 2O8CA 1YOVB 3ZU6A 1FQOA 1AA6A 2OBMA 1W29A 1QOQB 3HDQA 1WZNA 1XFAA 4WVLA 5FYQA 5K09A 5JS1A 3F5QA 3LHDA 3HS3A 2HA4A 1OW3B 3NALA 2QS9A 2GHIA 3CRZA 2Y1OA 1XR3A 1AXGA 1TM3E 3H11A 2A0KA 3PC7A 3I5YA 4HDOB 3SHFA 1E1NA 3CZQA 5I4BA 1LDYA 1EXMA 4S35A 1WW2A 2IZOA 1H2RS 3PFHA 4IYJA 3SNKA 1VG8A 3QBDA 3T7TA 5J2TA 3AXSA 1QYCA 1MA3A 1Q2UA 3MNFA 2HCBA 1SCDA 4JVOA 3OKCA 4UOEA 4KKXB 3O26A 4MQ5A 1ZITA 1OBOA 2ZT8A 3K4HA 3OY2A 2F3SA 4P7KA 3KC2A 3ROEA 4BNTA 4JLDA 1LK5A 1CR4A 3U9TA 1FDOA 4NICA 5JO9A 1G41A 3KXKA 5F4ZA 4UNRA 3JAWB 2C9ZA 2RGNC 4I6EA 1DUSA 1B26A 3N7TA 3UPUA 3U37A 4NYIQ 1IBLB 3KO8A 2VSQA 3Q41A 4GI5A 5TV2A 3RVDA 1CQXA 4HLUC 2ZXFA 4YRMA 4LYEA 4J91A 4XYMA 1DWQA 1D2AA 2PH7A 2PQ2A 1RXSA 2XDAA 4FFBB 5DOVA 4DM4A 4FD2A 4JZYA 2IYYA 3I9V1 2CK3A 4RCYA 4W8HA 5EXPA 3SIWA 1JIQA 5IKOA 1L5SA 3EIHA 5AKEA 1E6KA 3UUFA 3DEFA 1QQ6A 2AI3A 2FZ4A 2AOTA 1U2PA 1JDSA 1KOJA 2FF7A 2EBHX 2JGEA 3RK1A 3AZOA 3TE7A 1H2FA 4P53A 2PT7A 2KJQA 5EJGA 1HDOA 1UFRA 3I76A 1ESNA 4DSTA 2DOKA 3DPSA 1IC6A 1LK0A 5CXUA 3AB7A 3G88A 1WP9A 4UE2A 3QBEA 4LMBA 1HNXB 3OT4A 3NTQA 3TCXB 5JSFA 3W2IA 5AUQA 1K1EA 2DBYA 4QJ4A 5HUJA 3TKYA 5IZ4A 3VR4H 4M8KA 1KBQA 1ENYA 4XB2A 3OU6A 4L6CA 4YK7A 4QUIA 4P0TA 3ZXYA 1VOTA 2PGJA 1XMJA 2QNRA 3HE3A 1C1DB 3NB0A 3FZEA 3PL1A 5B1DA 4A5OA 2PD4A 1Z0AA 4ALLA 3DAYA 4B4WA 3HM2A 1Q1ZA 5G4KA 1GTVA 3JAKA 1GZDA 2ZREA 4FZRA 2XEXA 2J9XB 1NW7A 1ORRA 1R4ZA 3OZIA 4LKRA 4JENA 3MT7A 4ZEMA 1ESCA 3HUTA 1QIHA 1RI3A 4HDRB 4EP1A 5LU9A 1GGKA 2PWBA 1SC4A 2PA0A 3FMIA 1C30B 1YI0A 2JJ2D 2QR5A 4X24A 2NIPA 4E2YA 2ID7A 1G21A 1CQIA 2VRWA 1DCKA 3I64A 2QW1A 4BMVA 1R12A 2G9RA 3DW3X 3KPVA 4XUCA 3TUJC 3ZWAA 3BRWA 5A7HA 1Y5LA 1Z0SA 2FDXA 1C29B 1C81A 4M9RA 3UUEA 2JD1A 3H7IA 1J8MF 2AEJA 3K8ZA 3LL7A 2HLPA 3CF0A 3DFZA 3CZMA 3H99A 1KC3A 4MMZB 1VHJA 1G3IA 2WA2A 4PAWA 4DDKA 1VYHA 2DH6A 2IZ6A 4DABA 5BUZA 3WLFA 5LBIA 5IKEA 1O4WA 1E1MA 4GLJA 4IX1A 2R65A 4IY1A 3VKHA 3R4VA 4P3XA 5DTMA 2YYYA 3OICA 2A4KA 2IYZA 4MYTA 3NONA 3TLGA 5AW9A 2LIPA 3CLKA 1JJIA 2CKMA 2ZTMA 3GJ4A 4LVOA 5BO5A 4G67A 2DETA 4DSAA 4KR7A 1SHKA 2J6HA 4AYXA 4M8SA 4BASA 2GK3A 3OQIA 3HH8A 4YECA 5AOVA 4ER7A 1BAPA 1YVEI 3JQAA 5CCEA 4CEHB 3HB0A 3TLKA 3ZD6A 2VCYA 2XE4A 1Z13A 2I33A 2FW6A 3OESA 2ZJZA 4J7XA 2G5CA 2I4OA 1POXA 1UJNA 2P8JA 1ODLA 4TYMA 4YRGA 2BGJA 9LDTA 3AVXA 5KEIA 2AOVA 2XR1A 4ESEA 1T9DA 4P35A 3SIXA 3LHIA 5TMPA 3W77A 2CUKA 3CR3C 4Q24A 3B51X 4LYDA 4DIDA 1JVSA 2CXHA 4CMAA 4POOA 1CP3A 4LWQA 4GX5A 4DR5B 1Z82A 1SVNA 3T52A 2O2SA 3QUTA 4IXTA 4DQDA 2BZGA 1EZZA 2I03A 1IM5A 2Q9UA 4KOAA 4LNUB 3TI9A 1QCZA 3MJEA 5LSAA 1MO2A 2HMWA 3I6ZA 3LFUA 4Q7KA 1ZVVA 2HHCA 3CUYA 4L74A 5JMPA 2D62A 1KP2A 2OM2A 2Z2KA 3SR3A 5HGXA 5DF1A 1MO4A 1PDVA 3C5CA 4XIFA 1XX6A 3OLXA 5T7BA 4AKSA 5D85A 2BKLA 1YZFA 2E6UX 1QLWA 3EY9A 5F4BA 2YXEA 2DWCA 1K7EB 3F8WA 5EWMB 1GEGA 5B4UA 3UBTA 4UHHA 2XMZA 4PICA 5AW2A 2GF2A 5HMMA 4WUTA 3W9YA 5EJ7A 2C95A 1ZLXA 4YCJA 3UW3A 4N5IX 3OJLA 3IUMA 4NV1A 5AI9A 3JQ9A 4PHCA 1GD1O 4FFPA 2FEOA 2NTJA 5FOSA 4B6GA 3HLKA 3BAFA 4WE3A 4CCAA 5CFPA 4XKJA 4EUKA 5KYXA 4GL2A 2J1LA 1P2UA 5A5DA 4DLBA 4TUYF 1PK8A 3GLGA 5GAJA 3FAKA 3N2LA 3SZ3A 4BFLA 1PV4A 5IASA 1JN0A 3HMQA 1NPYA 4TLEA 4ZALA 4LGCA 3MGKA 2ZSEA 4KIFA 4JJFA 1JG1A 1WKCA 1K63A 2QL7A 3D59A 2J0EA 3BEOA 5CDFA 4R1MA 4RY8A 3H1PA 2DWPA 2QSYA 4GRAA 3DWFA 5H82A 3BRCA 4S1OA 4YO7A 1XMIA 3L0ZA 2X7JA 3OZ7A 1OX4A 4DJFC 5ULLA 4OQYA 3OOYA 3O31A 3LKDA 1NR7A 5DSTA 4B3GA 3BD7A 3VVCA 3DWIA 4HT3B 2WZDA 1X8KA 5K8LA 1YGYA 3T9DA 4XVQA 1Z6AA 3GUYA 2YV5A 1E1CA 1ES9A 2VH2A 2P2DA 1NNSA 3EBPA 2HA0A 4W8OA 3LQQA 4CKWB 2EP7A 3ZH9B 2QMEA 2YBEA 4TMTA 2ZUCA 2P30A 3PNLA 2X0EA 2OP0A 1CUFA 3F90A 3V4SA 3BMCA 5E4JA 2NG1A 5AK6A 2QVGA 3UPDA 1YR6A 3T94A 4S1VA 4JOCA 4DQ0A 2UXBB 1RKBA 1BHO1 3F6EX 4RLHA 2QXTA 1PS0A 2ZSAA 4KXMA 4YMIA 4WCFA 4L22A 4Q7JB 4RQAA 1KQFA 3OEYA 3TLEA 4Q01A 5LP6C 2CFCA 1PQUA 4TXNA 3TPZA 2YWCA 3AEYA 1ZMRA 2FUNB 4HNGA 5AESA 3MTIA 1ZJJA 2GOYA 5ALWA 1I33A 1UJ4A 2RBGA 1GR0A 3D6HA 5CJJA 4D7AA 1R6DA 3E5HA 4DUGD 3GYGA 5T6BA 2I3GA 5JT1A 3CN9A 2R1ZA 2E9SA 3UA3A 3WLKX 2DY1A 4XOUA 1O5OA 1B8NA 1RYBA 3L05A 2QUHA 4N03A 4WN9B 2OSBA 2P5YA 1ZSYA 3N87A 1IMOA 1DXQA 3FCUB 3LVQE 1U6JA 4B35A 5G0SA 3ED5A 1M73E 2GVDC 5JVDF 1ECCA 1EVZA 4OQDA 4FGLA 2NP7A 1YJ5A 2VDRB 3PFIA 5HTKA 2BJWA 3TS1A 5KYVA 4MSUA 2EQBA 1O94C 3AFNA 1Z2OX 3PXGA 4EVSA 4LJYA 3BRQA 4XB1A 1M5UA 3RASA 2W43A 3DNFA 4CQNA 1VBFA 1PN3A 3K0HA 3KSZO 1C0IA 4X85A 2ZUTA 2W6NA 3P52A 3WIUA 4UCQA 1UKAA 1SVUA 2QUJA 5LP1A 1CKEA 3E2PA 1GCAA 3OZFA 3QMPA 1QS0B 2YQ4A 1AH2A 3UY4A 1I14A 2QVYX 3REOA 3WNZA 4BIIA 1HI9A 1DBVO 1KMMA 1UMBB 4JODA 5DNEA 1UIMA 2W42A 4G5OA 1CJUC 1XRSB 2XOKD 3ZVRA 3EH1A 4JGBA 2WV9A 1S9HA 1O1YA 1X7DA 1Z8DA 3DCNA 4ASUA 4BMXA 4Y6LA 4IVPA 4GOOD 4U2BA 4PYNA 2PZJA 3ETDA 4TTTS 4YT5A 1KI3A 4B3SB 3CLVA 5JD3A 3F78A 3HYNA 3CLRC 3M6FA 3IJPA 3V9PA 3DP7A 3OJ0A 1JX6A 5HJ2A 5HBRA 4ESOA 2PN1A 1E2FA 1KETA 2CZGA 2RHMA 1DIHA 1LNQA 2ORED 4RZHA 4X93A 2PT9A 5IDYA 3MUNA 2JKZA 1PWZA 1U0FA 4L07A 1XZQA 3EC7A 1U0OC 2P7HA 1PV1A 3DL0A 4IZ6A 4K9DA 4ZAVA 1QG2A 3CLSD 4GOLD 4N6OA 3KPWA 4C7KA 4CR7A 4QGSA 3PQ5A 4CI9A 1LLCA 3CSSA 4EY5A 4YX9A 3PNMA 3TVDA 3KTFA 4CL0A 1FVOA 4YUYA 5FT9A 1Z45A 1H66A 3RODA 2IOYA 1RYZA 4RW0A 2IBTA 4P86A 5IH7A 3DWEX 4PYLA 3BK1A 1YRHA 2J6BA 1S5PA 2OCGA 1XG5A 4M7PA 4RM3A 5A05A 3TQOA 2NQTA 3S1SA 4LOAA 4X8OA 2YN2A 3T35A 1N9GB 3CRNA 3U3KA 4HNVA 3FE2A 3JZFA 1VJGA 1W2GA 2X2OA 3HO6A 4K9MA 2NUTA 4A6PA 4BKRA 3GLFA 1LGYA 3MT0A 1WS6A 3ISTA 2ZR0A 3L8FA 1PDOA 1C9EA 1X80A 4BMOB 4R71A 1RYYA 4CT4B 5BWBA 3CNBA 4LOHA 1CFZA 1I9CA 4ZZ2A 3RYHA 1B0ZA 3I4FA 2W5UA 3WHKA 3WAKA 4X44A 3E9CA 2PEZA 4TQUS 2QMYA 5JO0A 4UBMA 3ZDAA 2HZ7A 2OT3B 3LMKA 4ZO9A 3JYLA 1Q21A 1PBNA 2VSNA 4OJYA 1ESMA 1TOAA 1WLYA 2NN3C 2OMKA 3KUDA 5DLEA 3ZC3A 2K4MA 4ZDIA 1TZCA 5A71A 4B6SA 2K7FA 2Q5IA 1QIGA 1KA9H 3BTUA 4RHEA 1E9EA 1Y9ZA 3KEMA 3Q7SA 4U2GA 3BD9A 1LQ2A 1CUGA 3ZLTA 1HNZB 3ZUGA 4Z7QB 4GZMA 3F74A 1OV6A 2CXSA 5EJ6A 3PK0A 1KJWA 1SZDA 1P0PA 1R6XA 1JA9A 3CF4A 3T5CA 3SEQA 4BCDA 4EMBA 2ACKA 2WQ7A 3WGIA 1FLNA 1EJ0A 1KY4A 1P3DA 3A26A 1V8ZA 3V48A 4YREA 1EAYA 1AB6A 2DKNA 3T9CA 2OV3A 1SIWA 3Q7IA 4YMTA 3GR6A 1SD2A 3EZGA 4ERNA 3JVIA 4IGEA 4QFBA 4O3MA 4PPQA 4Y2PA 5G53C 1L5GB 4YIHA 3KQUA 2DZDA 4CR6A 3W5DA 1Y48E 1XXLA 1SJ9A 1G3RA 2O8NA 5A4KA 1GIAA 2PG3A 1N2HA 2FKNA 2Z5LA 5I5GA 3C45A 3N2IA 3ND8A 1WMFA 2ZJ0A 1SCIA 3S2FA 3ABOB 5IMSA 2OGUA 3GC6A 1UEJA 4MYSA 2DPLA 3GBSA 3GGDA 3MLEA 4CCWA 6REQA 1PEDA 4CKCB 4OL9A 2WW8A 5AVWA 4RK1A 5LIRA 4YRNA 5D1NA 2H1CA 4MPDA 3H9QA 3K6SA 4QPNA 2EX1A 1Z4NA 3VA7A 3AUUA 1RWQA 3WXMA 5HVNA 1U3GA 4YAJA 2O8EA 1RMQA 4DA4A 3OCVA 2KLHA 3QPAA 4RJIA 3V7YA 4QIHA 3I42A 1O54A 2EFEB 1VE6A 1J0XO 2YWGA 1RYHA 3WYBA 4X62B 1Z3CA 2Z43A 2ZANA 1Z6QA 2QYHA 2VHWA 1CEXA 4IVRA 4TV9F 5DI3B 4B83A 4EKEA 2O0HA 4GWKA 1A98A 2MSWA 3JWIA 4O2BB 3T38A 5I7OA 1QF6A 1ZH0A 4UUNA 4TXJA 1YZGA 3QTTA 4BJ6A 4WKPA 4M21A 3VHXA 3FDZA 1I4EB 1I6MA 1TJ5A 3BB4A 3WZLA 5LQAA 4DL9A 3PNBA 3TRKA 4E15A 3HCCA 1BH6A 2ZRAA 3KDSE 3NKVA 4XJXA 5DK6A 3WQBA 3EX7C 2UU9B 3LPNA 2YVAA 4XFKA 4FT4A 4LXQA 3W5BA 1IIBA 3KK0A 3MPUA 3ICCA 2BEWB 3OMWA 3PHLA 4CDRA 1P0CA 1Q50A 1R4NB 1YDEA 2RH4A 1Y1KE 2X5XA 3IUJA 3LQFA 3NRBA 4N7RA 2X8JB 1M1YB 5JH7F 5M04A 3USCS 3MF4A 4ZV9A 2AN3A 4CLRA 2ZM5A 2GXSA 4LQCA 1MJNA 3TB6A 5F7XA 2FH5B 1M1NA 5BW8A 5K0FA 2B2NA 2H06A 3ETEA 4C87A 4EUNA 4LIPD 3EWNA 5KQPA 1J20A 1XNJA 2IS1A 3FF4A 3KSRA 4OBEA 1UDRA 1CIPA 4WDRA 4BB5A 2OB2A 2R2AA 4DGQA 1UMKA 2JHAA 4YAWA 2KX7A 5CFRA 1QHFA 3GN1A 1W4ZA 3H6HA 3MWDB 4ZJYA 1MTZA 4I3FA 3CN7A 3PXDA 3AIKA 3CZRA 3OO0A 2JLWA 1Y8RB 1V2HE 2C88A 4TLBA 3GLIA 2BMDA 2WHEA 4JLVA 1UC8A 2GKOA 4GYWA 5AI4A 3PFBA 3X1ZA 3IQHX 1KYWA 4DV2B 2XWQA 3W7VA 5FAKA 4MUNA 2B7LA 2XIJA 1FY2A 3IP5A 2BPOA 4RHUA 13PKA 3W4KA 1XMVA 4Q6WA 5A6SB 3FLAA 1V6AA 3U48A 3LDUA 2PX5A 4ZICA 2YWRA 5BNWA 4YN3A 3RTGA 3S27A 4CU5A 4GDFA 4B3DA 2JD0A 1AGXA 3BH6A 5DT9A 5G0VA 4GUAA 2Y1LA 4AMGA 1YJQA 2R48A 1E79A 3QKWA 1YRWA 2BW0A 3EXG2 1ZR2A 1KVRA 3ETNA 1P4JA 1OZHA 2CL5A 2PU7A 5AK0A 5JPDA 3FPKA 2Z6QA 5T64A 3AEKB 1Y7TA 5KX5A 3JPYA 5LA6B 5IT0A 5AUNB 3ZV6A 1VECA 3VKFA 2QRLA 3EWAA 3P45A 1FCJA 2PFKA 2W2KB 3JYQA 5K2OA 4FWIB 1ADGA 1DTWA 3OTWA 2A14A 2QQEA 3OA2A 3HGMA 2VJBA 3RWBA 2I1QA 3IYLW 1V11A 4I14A 5JWOA 1VB5A 4Z0HO 2XHEA 3SC3A 1SVIA 3V3TA 1KWKA 3LRTA 4WUVA 1DO0A 1ONSA 3PXXA 3HKDA 3E03A 4UZFA 2DTEA 2O05A 3GZTB 3N70A 1AG9A 4LY6A 2C7QA 5I9IA 2ZBGA 1XVUA 3KFLA 4WNAA 1GRRA 1ZVKA 2ANCA 3HKCB