3R3ZA

Crystal structure of the fluoroacetate dehalogenase rpa1163 - wt/glycolate
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
304
structure length
304
Chain Sequence
GHMPDLADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHDRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIAQSAATPLDVWRKWASDVQGAPIESGHFLPEEAPDQTAEALVRFFSAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fluoroacetate dehalogenase
publication title Mapping the reaction coordinates of enzymatic defluorination.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Hydrolase
total genus 117
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r3zA00
4B6GA 1TK3A 2OCGA 2PX6A 3QMWA 4ZI5A 2BFNA 4AZ0A 5EI5A 4CFSA 4NVRA 1GKLA 4X7BA 2HIHA 4DYHA 2UZ0A 4H77A 1XRRA 4UHFA 5ALOA 3W2TA 1XROA 1HLGA 2VA9A 1MAHA 3O0DA 2Y6VA 1CLEA 3BJRA 4J0DA 4WY5A 3D2CA 1YCDA 1QJ4A 4BYMA 2OCKA 2Q0XA 4HXFB 4MJ3A 4Q3LA 1BU8A 2JIDA 1IMJA 5IVIA 1C7IA 1ZIXA 7YASA 1XQYA 5IVDA 4MQMA 4RPCA 5LLSA 5AM1A 3AIOA 4GECA 5K3DA 4L9AA 2DHCA 1ZIYA 3DKRA 3QH4A 2B9VA 1IZ8A 3VVMA 4EY6A 3I2JA 4H7DA 5IKXA 3BF7A 3E1GA 1CUCA 3STUA 1WB4A 2Z3WA 2V97A 5LZ7A 4B85A 3G0CA 2ACKA 1MT3A 2WFZA 5SYMA 5DNVA 3WK6A 2J4CA 4PV7A 4CG3A 3DS8A 1WHSA 4K6HA 1QIGA 4B82A 1MJ5A 4N5HX 5KWIA 4G1FA 2X5XA 4C87A 4I4CA 1DTEA 3C8HA 3O4JA 2VJAA 3WMRA 2I3ZA 4BB0A 3G9UA 5AKJA 1QZ3A 5JAUA 5CT5A 2B4KA 2ZJFA 1TCAA 1M33A 5CH8A 1CUHA 4PQEA 2ZSHA 3HABA 3F67A 1UKBA 3HJUA 5ALKA 4AXBA 3VJLA 2Y2VA 2QKYA 4YASA 3HRHA 4XIIA 1G4HA 4X3CA 3BIXA 4ITVA 3GA7A 5JZSA 3AIMA 5DTJA 4LIPD 4MEBA 1THGA 1A88A 1CUZA 3DD5A 1QFSA 2WUEA 4AB1A 4M0FA 2OAEA 4OD0A 4UHCA 3H2IA 1CUBA 2QOEA 4J0IA 1CUFA 4B84A 3WQHA 2VJBA 2ECFA 3STTA 3T4UA 5CH3A 3BDIA 3DOIA 4C4XA 5C81A 3WKEA 4NZZA 3LIIA 1GPLA 5JD4A 3LP5A 1UFOA 5ISMA 3HSSA 3L1JA 3ZV7A 3B3QA 5AKLA 2JGJA 4H18A 5H3HA 1XZFA 1H23A 2HU7A 3RKSA 1E66A 3VJMA 3K9BA 2AJ8A 2OGZA 4UFNA 1XKTA 5KBYA 1DU4A 1RYYA 1UOOA 5AHXA 5FLKA 4PSUA 4J0GA 2C5GA 4QEKA 2YASA 3DEAA 4HXEB 3ESBA 3WK5A 1AX9A 1GQSA 3QM1A 5ESRA 5FOQA 3G0DA 2PSJA 4Y2YA 3H1BA 2R11A 3DL7A 4Q3KA 5AI8A 1QFMA 5A7HA 3PF8A 2RGUA 3R3ZA 5IVKA 2HA5A 3F97A 2QRUA 3D4LA 3OPMA 3G0IA 4FTWA 5EIAA 4BCBA 1UZAA 4U2FA 1LBSA 3T52A 4MWTA 1Y7HA 1SFRA 1F0NA 4BVJA 5JADA 4X93A 2DQZA 4B81A 1UOQA 1CEXA 3DQZA 5AOCA 5AI0A 1WCYA 3G7NA 4ARAA 4H7JA 3RM3A 4WCVA 1N5MA 2QUAA 1ZICA 2ACEA 3V48A 4FKBA 2Y2UA 4CCWA 4KE8A 2G63A 5AKGA 1IUNA 5AOAA 1QIDA 1JFRA 5A7FA 1VXRA 1B41A 1AC5A 3H1AA 4DNOA 1U65A 2JEYA 4P92A 1EK2A 3KDAA 3HYSA 2VT6A 1J07A 1EI9A 3WKBA 3AINA 4BCDA 1GZ7A 3DL4A 3EQ8A 4W1RA 4K6KA 2HRRA 4OSEA 5AP9A 4B80A 1IUOA 4LXIA 1G66A 4XVCA 1VKHA 4KRYA 1CUDA 2DFPA 1L7RA 3O4GA 5FPQA 5LKRA 4J3JA 4FBLA 1U4NA 2WFLA 3ANSA 4DGQA 3NWOA 4MXDA 1JU3A 2WIDA 4HRXA 3VXKA 3G8YA 4EY5A 5IH7A 1VA5A 2VAXA 4C89A 1QIHA 2FUKA 1LNSA 1GT6A 1ZD4A 2O2HA 3M3DA 3IVMA 4Y2VA 3IDAA 5K3FA 4UBNA 2IX9A 3HXKA 4BDTA 2HA2A 4Y2XA 3F96A 2WIJA 1YS1X 2CMFA 4BC0A 2GBCA 5AM4A 1LPSA 5ALXA 4A16A 2GZSA 5JAOA 3DCNA 1LPNA 4AO8A 2J3DA 3S2ZA 1YB6A 1ZD5A 2GBGA 4GHWA 3PUHA 2OCIA 4L0CA 4JYMA 1J1IA 1EVEA 3KOOA 4FFWA 1BS9A 4QLAA 5K3CA 5JAPA 5DNWA 3I2KA 2RAUA 1FFDA 2J3QA 3D3NA 3FWHA 4ZWNA 2RHWA 4GXNA 4X71A 3OOSA 3AIKA 3EF3A 3I1IA 5K3FB 1YAJA 1MN6A 1QTRA 5FPPA 3PDCA 3FVTA 1N1MA 5FUMA 1BN7A 4H7KA 4EUSA 3WKDA 2HADA 4AN1A 1F6WA 3I6YA 4BCCA 4BAZA 2E3JA 4A23A 2Y1KA 4MEAA 2VAVA 3AZQA 1ACLA 4CI9A 3BWXA 5CT9A 1BCSA 3ESDA 1NU8A 4C88A 2QJRA 2PSHA 5ALUA 4F60A 1XRNA 3GBSA 1FFEA 1BCRA 4DSZA 2GBIA 2PSEA 2OXEA 3NOXA 5BWCA 3QMMA 3VKFA 4GWLA 5DYTA 1HDEA 4E14A 3FCYA 1XQWA 1U2EA 3R3VA 1ETHA 2Z3ZA 5K3AA 4OUKX 1MTZA 5D3KA 3U0VA 3ZLVA 3IUMA 3WWDA 1TRHA 3D2AA 4EHBA 2HRQA 4N8DA 3AUKA 4INZA 1D07A 1FFBA 4OYYA 3K2IA 4BP8A 1KU6A 5FXMA 5KWJA 2HFJA 3PI6A 2G5TA 2PPLA 4WFKA 2QXTA 2XMBA 3DKKA 5D3ZA 4G4GA 4QDTA 4X92A 3H19A 1QONA 4BRSA 5DYYA 5CMLA 4G9EA 3EQ7A 5CRIA 1WB6A 4J0JA 1QIKA 4QDZA 4JYPA 4FHZA 4ZXFA 3R40A 3G9ZA 1SOMA 4OU4A 4AMYA 5JATA 2JGIA 1ORVA 2P8SA 1CQZA 1LPPA 2XUHA 5CXXA 1EA5A 3DYVA 3PE6A 1TCCA 3OG9A 5AIAA 4N5IX 5FP0A 4EZIA 2AJDA 2VT7A 4KE9A 1DWPA 1QE3A 4TGLA 2DHEA 3HC7A 4EA6A 1K4YA 2CB9A 4UHBA 3V1KA 3O4HA 4W63A 2AJCA 2XUJA 4EY7A 2CBGA 1W76A 5LYYA 1XZCA 3WWEA 4RNCA 4B9EA 4Q1VA 4KJXA 4FFVA 1VA4A 3WYDA 5LP1A 3IUQA 4UHDA 2B61A 5JZ9A 1K63A 3OURA 3QPAA 4OU5A 4P93A 5LIPA 1HPLA 4BP9A 1EDBA 3H17A 5KREA 1TKRA 1AGYA 2WTMA 5LZ9A 4B7ZA 2Z5GA 1WM1A 1AKNA 5JYCA 5AI9A 1BEZA 3FVRA 3ICVA 3KXPA 2VSQA 2V98A 4K6GA 1Q0ZA 5CH5A 3RLIA 4PNZA 3C6ZA 3A2LA 1K5PA 1HBJA 5HF6A 1A7UA 4UBKA 3H18A 4LKOA 1CUUA 3KD2A 2BUCA 1J06A 1MO2A 4BDSA 1O6FA 5LZ8A 4GLBA 1JMYA 1IZ7A 1Q83A 3STVA 2WFMA 2BKLA 2GZRA 5AKKA 5ALSA 4PSDA 1MX9A 3YASA 1VXOA 3GFFA 2JGEA 4QDOA 4CG1A 3I1YA 4X95A 1CUVA 4G8CA 2XUPA 5ALJA 3FYUC 4UBJA 3V1NA 1ODTC 1DWQA 2ZYSA 5EHZA 2QJWA 3IULA 2QUBA 3E4DA 3A2MA 3W9UA 4PSCA 4E15A 5HKAA 2PBLA 1J2EA 1QGED 3F9CA 1DWOA 4DMFA 1AURA 5K5EA 3QPDA 1VJ5A 3HACA 5AKEA 1VLQA 1KEZA 2C7BA 2ZJ7A 4Y7DA 2HU8A 4GBGA 4Y2PA 1ZJ5A 4LYDA 3QITA 5EIEA 4PO3X 3ZLUA 4Y2JA 2Y6UA 3VVLA 4UBOA 2D0DA 3LS2A 5JARA 2VQ6A 2I78A 5ALZA 1CRLA 4KYVA 1CUGA 4OPMA 5C8XA 3HI4A 3C5WP 2JGKA 4OYLA 3O95A 3V1LA 1P0PA 5A2GA 1XZBA 1E5TA 4Y2UA 3WJ2A 1CUSA 2ONCA 2ZYHA 4X6XA 1JKMA 1USWA 3WIBA 1CUIA 5EFZA 1W6RA 2WUFA 4P9NA 4XWGA 1CUYA 1DX4A 1JMKC 3R3YA 3M82A 2WKWA 1H2YA 4FLMA 1QO9A 5HK8A 3WL8A 1QIIA 4W9RA 4Z49A 5J3JA 5HZGA 3V9AA 5ALGA 1O6GA 3WKCA 4WDQA 3D0KA 1IUPA 4J0HA 4UBMA 4Y2SA 3C6XA 1QTIA 2ES4A 3UUFA 1EINA 1XLUA 2WJ3A 5C8ZA 4Q82A 4KE6A 1EK1A 3ZLTA 4QDUA 2VF2A 3A70A 1CQWA 1WPXA 4LXHA 5ALMA 2EDAA 2CKMA 2K2QB 1LBTA 4OCZA 3CCCA 5JALA 2HA6A 5ALIA 3CXUA 4HS9A 1TCBA 5CT4A 1MNAA 3WWCA 4V2IA 2XMQA 4S0XA 1P0QA 2DR0A 1QIFA 5CT6A 4RE5A 4W1SA 3FAKA 2XUDA 3L1HA 3CN9A 4AQDA 3CN7A 1YB7A 2QVBA 5AKZA 3FYTA 4X6UA 1CVLA 4LXGA 4N8SA 2PVSA 1N8SA 4DNFA 2O2GA 3WZMA 4BVLA 1X2BA 2WJ4A 4N8EA 4DMHA 2XMDA 2WQZA 4AMZA 5AKXA 4F5ZA 5I9IA 1XLVA 1R9MA 1BROA 5E4TA 1MPXA 4ZREA 3MUNA 4F0JA 1E8NA 5ALEA 3SX4A 2PSFA 5AI6A 1I6WA 5EHXA 3W05A 1ZD3A 4QLOA 1A8UA 4IO0A 5AJHA 3GZJA 4CIBA 1BRTA 2WUDA 5AI4A 2HM7A 5I8PA 3O9VA 3C87A 5AH0A 5DNUA 1ODSA 2DQYA 2H7YA 3WKAA 1X2EA 1WOMA 3R3UA 3BIWA 4XX1A 4IQ4A 5JANA 2RONA 4BAGA 2DCMA 3WA7A 5AM5A 4IH4A 4IHAA 2WU3A 4E46A 1EHYA 2XLBA 3NUZA 4G8DA 5JZBA 3E3AA 4H7HA 1GQRA 5IVHA 2XQFA 3I6ZA 1P0IA 2G4LA 5CURA 4UPDA 4M0EA 5DJ5A 3W04A 3KWFA 2Z8XA 4BZWA 3H2JA 5HKBA 3FCXA 5DWDA 1H22A 2GYVA 2VATA 3R0VA 5D7BA 4KE7A 1C4XA 3ICWA 5T4FA 3WZLA 1THTA 3OM8A 5AK5A 3G0BA 3AILA 5FRDA 4BBZA 2EEPA 3I6MA 1HQDA 1XZJA 1JT2A 2RI6A 1UK6A 4HZGA 4DIUA 3FBWA 2ROQA 2WIKA 3H04A 3D7RA 5FKJA 2XUAA 1XZAA 4I3FA 1AMNA 1EDDA 4L72A 4FOLA 4GI1A 1W4LA 2ORYA 4NMWA 5K3BA 2WHQA 4J0KA 1EDEA 1TQHA 3WL7A 4H7IA 3C70A 2RHTA 4EB0A 3AZOA 4C4YA 2ZSIA 1A8SA 5CW2A 1UK9A 1Z68A 4A5SA 1JU4A 4DLNA 1G5FA 2EDCA 4X00A 1ZJ4A 1XZLA 2QZPA 5AKYA 2CEKA 5AM2A 3B12A 1Y37A 1ISPA 3ESAA 4G8BA 3WI7A 3FSGA 1QLWA 3AFIA 2HA0A 4GDMA 2WFLB 4DMCA 4RE6A 4FLEA 2XUGA 4FWBA 5AKIA 5EGNA 3DYIA 1UWCA 5DTIA 2LIPA 2HHAA 1YASA 1ODCA 4DTCA 1OCEA 4ZV7A 5ALTA 2VEOA 5HF9A 1E8DA 3H2KA 2QT9A 2HL6A 3N0TA 5ALRA 3ESCA 5DYWA 2YH2A 2V9ZA 1R9NA 1K8QA 3HZOA 4Y2TA 4G9GA 2H7XA 4ROTA 3EIOA 1YAHA 1F8UA 1LPAB 2J4FA 4Q3OA 3W9BA 1JI3A 1XQVA 4KRXA 3WWOA 2V96A 4W1QA 2OGSA 1E89A 3FLEA 3TEJA 3O4IA 2CJPA 4YK7A 4BAUA 1XZEA 2PU5A 2OPHA 4C6HA 3MVEA 4RGYA 4PF1A 1YS2X 1SCKA 2JGFA 4J03A 3D59A 4X97A 2O7RA 5AICA 1PJAA 1AUOA 3I2FA 3UUEA 4LHEA 4Q05A 4HXGA 3SC2A 1CUXA 5BV7A 1BE0A 4K5QA 4I19A 3P2MA 1WPRA 5JIBA 3I2GA 4OB8A 1ZI6A 1UT6A 4O08A 1W75A 4C4ZA 5HK9A 4DMKA 5ALHA 2CZQA 3BXPA 3N2ZB 5ALYA 2IIVA 1LPMA 1XRQA 2OGTA 3U1TA 2HA4A 3QMVA 3ZI7A 3STXA 4CCYA 5ALPA 2B20A 2JF0A 4IH9A 4QDXA 4JNCA 3QYJA 5HCUA 1XRMA 2C5FA 3WK8A 5A62A 4ZGBA 2FJ0A 3FOBA 3HEAA 1CIJA 1XRPA 2QXUA 3PFCA 5FDFA 3DOHA 2XMRA 3GELA 2IITA 4HVTA 3R41A 2C4HA 3R3WA 4NS4A 4LYEA 1HL7A 1UKAA 2C0QA 5LZ4A 4J0CA 1PFQA 4KAJA 1NU6A 4QNNA 4U2CA 1QIMA 2GBFA 2PL5A 2PUHA 2QS9A 5AIBA 2DHDA 4BATA 1FFAA 1ZGBA 3RARA 3E0XA 2BAGA 3LCRA 1AQLA 2BGNA 4UUQA 3MGAA 5AOBA 3TRDA 4UBIA 1W52X 1UK8A 1SC9A 3H2HA 5EIHA 3WJ1A 2XLCA 3KSRA 1MNQA 4DNPA 1Q0RA 1R88A 4ZRDA 1AZWA 1XZHA 1PV1A 5LZ2A 3JWEA 4TVKA 1MX5A 3PICA 1EX9A 3A6ZA 2OQVA 1ZOIA 2HFKA 1LZLA 5E4JA 1XQXA 2W6CX 5K3EA 5ALNA 5ALLA 5DLPA 3WLAA 1OXMA 1ZI9A 2WG0A 1XLWA 5HF8A 2GYWA 2WILA 4GEGA 1UOPA 1QIJA 5F4ZA 3NGMA 4G4IA 4KAFA 1P0MA 2WIFA 5EHQA 4F21A 5E2IA 3WK9A 4WY8A 1RWQA 4D9JA 3C6BA 1ZD2P 1EH5A 4U2EA 5YASA 3WL5A 2WG1A 5ALFA 5ALQA 3WYNA 4BTLA 2OCLA 4KEAA 5T4HA 5CXUA 1GXSA 4U2GA 1RP1A 1L7QA 4EY4A 1Y7IA 1EB8A 5ALWA 5AK6A 1HKHA 1VZ3A 2JGLA 3FNBA 1H2WA 1H2XA 2D5LA 4EY8A 1E3QA 1XZKA 3IUNA 1T4MA 1CUEA 3TJMA 2AXEA 4EBBA 2CUTA 4JUIA 3JYHA 3FLBA 4UFOA 4M0MA 2DSNA 5AK4A 2OQIA 3QVMA 2WJ6A 3WWPA 4FNGA 3CCBA 4GW3A 4HAIA 4Y2RA 2XUQA 4C01A 4JH0A 3BDVA 1EB9A 2XUIA 2ZVDA 3F8SA 1CUJA 2HDWA 3B5EA 1XZGA 4W1PA 3IUJA 1LPBB 3BF8A 3DLTA 4QA9A 4UHHA 3ANTA 1BN6A 2XMGA 4DM7A 1YA8A 5BWBA 3QZUA 5C7YA 4QWWA 3QBJA 5AKHA 5ALDA 2XQGA 3X3HA 2WM2A 1N5RA 2QTBA 3IBTA 4UHEA 3PFBA 5AO9A 1X70A 4X85A 1DQZA 3WK4A 3BE8A 1R4ZA 2AJBA 4BE4A 2JEZA 1G42A 2GYUA 2W22A 2XB6A 4P08A 1XRLA 2VTVA 1DT3A 1LZKA 1R1DA 4H7FA 3UMJA 2NW6A 2QR5A 4MQLA 1C7JA 4DNQA 1KU0A 2QM0A 1OILA 3LIPA 4B9AA 4E11A 4DSAA 4H35A 4L3WA 1FJ2A 2XQKA 4MWSA 3C8DA 5HQ3A 3H2GA 4AN0A 2WSLA 2BUAA 4ARBA 2H7CA 2XT0A 4X91A 2HA7A 2X8BA 4H7EA 3R3XA 2ZYRA 3I2IA 5JAHA 3STYA 4G5XA 1QOZA 3WA6A 5T4EA 3EBLA 2RIPA 3V1MA 4PW0A 1CUWA 2WG2A 2XUKA 1ORWA 3VISA 2AJLI 2PM8A 3TGLA 5ALVA 4XJVA 5A71A 4B83A 3M81A 3C43A 1JJBA 3AJAA 3ED1A 3Q8WA 4Y9SA 2XMZA 5HQ3B 2WUGA 3M83A 3ZPXA 5A6VA 4FBMA 3G9TA 5FV4A 2G5PA 3ZWQA 5JD5A 3DJYA 3BL8A 4B0PA 3FLAA 1YR2A 2XMSA 4KAAA 4Q34A 1XZMA 3GROA 2BGRA 2HU5A 1XZDA 3C45A 3F98A 1ACJA 1MU0A 4X6YA 3EQ9A 4BRZA 3WIOA 4B0OA 2PUJA 3AZPA 3G9XA 5C8VA 5AM3A 4QWMA 3OC0A 4X94A 4BVKA 6YASA 1LGYA 4IH1A 2X76A 1EXWA 1B6GA 5AM0A 1VZ2A 2XUFA 1Q84A 3FSGD 3K6KA 4FNMA 1IVYA 5SYNA 2I03A 5HFNA 3S8YA 3D2BA 1EVQA 3WK7A 2WU4A 4TPKA 4U2DA 2ZJ6A 3IURA 3IIIA 1DQYA 1K6EA 2XQIA 4AO6A 1U8EA 4KR0A 3OTQA 3GUUA 1TAHA 4ZV9A 3ILSA 4OB7A 1FFCA 4JEIA 2VJCA 4UFPA 4BC1A 3RK4A 4BE9A 2FJPA 5HFAA 1SCQA 1CPYA 2VJDA 2OLEA 3DNMA 2BJHA 5CTAA 2OAGA 1CUAA 2ZYIA 5AI5A 1FSSA 4K2AA 2PSDA 2WLSA 1QIEA 4HRYA 3LLCA 3STWA 3G0GA 4FMPA 4FDMA 1E8MA 2XUOA 4WFJA 3VJKA 3W06A 1R50A 1XZIA 3SK0A 1QO7A 2O7VA 3SWWA 3I2HA 4UBLA 4WFIA 2YYSA 1MAAA 1S8OA 1L7AA 4ETWA 4CIAA 2XI4A 3BJMA 3JW8A 2XMCA 2WHRA 2XDWA 3H0CA 1WHTA 5EHNA 2WTNA 4Y2QA 3C5VA 1GKKA 1GPNA 2BUBA 4AX4A 4KACA 4FLFA 1LLFA 2I3DA 5A7GA 2O2IA 1UKCA 4HTAA 1CR6A 1R3DA 3C6YA 4QZVA 1XFDA 4CG2A 1H2ZA 3IB3A 1BEEA 1GPKA 1UXOA 1F0PA 3WL6A 1XKLA 2YXPX 1DINA 2PU7A 2BCEA 2WHPA 2H1IA 5LKAA 4QE3A 5LZ5A 3QPCA 5CBKA 4X90A 2Z8ZA 5CT8A 1CFJA 5HF5A 2JBWA 1UK7A 1ZGCA 2H9YA 5D6OA 1YA4A 4YPVA 5AK3A 2WIGA 3G02A 3IA2A 5BOVA 5JD6A 1LPOA 3MUOA 3HLKA 1ZI8A 2OG1A 4AZ3A 4BTVA 1T2NA 1SCIA 1VE6A 1WB5A 3FYUA 1TIBA 3I28A 1DX6A 2R8BA 2WHPB 1NX9A 3A2NA 4G4JA 3Q0TA 1JJFA 3VDXA 4MYDA 4U2BA 5T4BA 2QMQA 3L1IA 2C0PA 4J7AA 2JGMA 2FX5A 1DT5A 3D5EA 3DDUA 5JASA 1GGVA 1MX1A 2XE4A 1JJIA 4WDRA 3O9MA 4H0CA 1VOTA 5I7UA 5E4YA 3PF9A 2HA3A 2C58A 4MYSA 4OB6A 4BZZA 1CV2A 4AO7A 4WJLA 3PUIA 4YX9A 1VE7A 2PKYX 1A8QA 2XQJA 1YSCA 3FYUB 3KWJA 1W1IA 4CCYB
chains in the Genus database with same CATH superfamily
4B2IA 4B6GA 3H3JA 2JB9A 1G5QA 2ZJ1A 4LKRA 3PTAA 5CFPA 1VI5A 2DSTA 4QRIA 2OCGA 2IEGA 3QMWA 2YXDA 1MUUA 4PXAA 3ZY3A 5B57C 4RIGA 2BFNA 1WX1A 2VF4X 2P3QA 2P9BA 4AZ0A 1R8JA 1AJEA 2IF2A 1QHSA 3BK1A 5EUCA 2CNWA 5C8YB 1I4EB 3TW4A 5H9WA 1IY8A 1N1DA 4YXWA 3VAZA 1GEEA 2KQUA 3Q72A 4CFSA 1UJBA 1TMYA 2CJWA 1JKJB 4E6EA 5J5AA 1V4NA 4DCSA 6ADHA 2QAGA 2V4ZA 3I53A 5F64A 1KYIA 5EWMA 2A9QA 3O03A 1XROA 1SZCA 1HLGA 2VA9A 4WLFA 4B47A 3O0DA 4L8VA 3Q0IA 2B34A 5C51B 1XTPA 4GUAA 1V48A 4Z7JA 1H8EA 1QF9A 2J9YB 4HRAA 2IBMA 1WW8A 8LDHA 3NT4A 1NBWB 4I1SA 5E3IA 3DZ8A 3TCXB 3AM5A 5LA6A 5PNTA 3BMNA 2Q0SA 4MJ3A 4RTJA 4LVUA 1UMBB 4DJEC 4YV2A 4J2TA 4Q3LA 2ISQA 3O47A 4NE9A 4F11A 1KO7A 4U7DA 5IVIA 3UMVA 1HNXB 4B3BA 4Z53A 1HFJA 1XQYA 1EM6A 2DWQA 2PKXA 4RHCA 1EHCA 2WNHA 4B3FX 3UICA 3GWGA 2D1SA 1HYEA 2PH5A 1URPA 3WXMA 5TARA 4V1CB 5KEIA 3UJAA 5LQUA 3ZK7A 1KOJA 1RLUA 3BAFA 4YROA 3E2IA 3MQ4A 3OIVA 5LNK6 5GGYA 4E12A 3O82A 1L7VC 5KCMA 3SR4A 2Z83A 1CWUA 1H05A 1NOKA 2ZKIA 1QYRA 4HV4A 3H2ZA 4AS1A 1IONA 1OKKA 1DIOB 2JEOA 4R0MA 3QH4A 4BV8A 3H5NA 1AH2A 2YRXA 2R62A 1IZ8A 3B1ZA 3BMQB 3I83A 4WRRA 3VZCA 1Z0JA 5B3LA 2QSYA 3L2OB 3VVMA 4DF3A 3BH0A 3I2JA 4LTDA 1EJBA 3PR2B 4DR3B 3E7FA 1GA4A 1BVUA 3KZOA 4YALA 1ATIA 2W0SA 1M2WA 2YV3A 4TTJA 3GEBA 1QG2A 3MJFA 1DRKA 3LUCA 3RAJA 4WLEA 4C4AA 4FFSA 3ZIUA 1KJJA 2ZYUX 2PBFA 5CB6A 1Y6GA 1VECA 3C5HA 3E2MA 4B7UA 3QUQA 1ZDMA 3UHJA 4GNKA 2Z3WA 3OLQA 1ELOA 1O95D 3A6DA 1H1DA 4M8KA 4CJXA 2ACKA 1HK7A 2CWWA 4K88A 3ICEA 2WFZA 3O8DA 4AP5A 1LX7A 1CR4A 3WK6A 1PVVA 1NASA 1WHSA 4RDXA 1QIGA 4B82A 3H6HA 2J6CA 3KDSE 5IM4A 4XUEA 4N5HX 4B4WA 1Y1LA 4H6PA 1J7JA 2M6LA 5KWIA 4Q47A 1A1VA 3ZI0A 5E95A 3R6WA 3FDFA 1EP3B 2X5XA 3E27A 1WZIA 2P0EA 3BE4A 4CIYA 1ZW6A 2WW8A 2YIVX 3GCDA 4HDCA 4CETA 1DTEA 3ORFA 2XY4A 3D0OA 4CLOA 3QLTA 2GWHA 1OFTA 1PE0A 3G9UA 2AK3A 2AUTA 4FMDF 5AKJA 4E2WA 2IYLD 3WY9A 3TD9A 2IFTA 5CT5A 3HXQA 1Z5WA 3E1KA 3BXZA 4GD3Q 3JQCA 2ZJFA 2YUTA 4DG5A 1TCAA 5CH8A 4R1UA 3HSYA 1R6VA 3OCCA 2ZSHA 3QNMA 1XAJA 2YQ4A 3IBFA 4LJ8A 2HRZA 3BTOA 3W2FA 2I1QA 2EJTA 3HJUA 2FF7A 4B74A 5L53A 1TJ5A 1HEUA 4AXBA 2Z9DA 5T5QA 4BQOA 4IXTA 3SMVA 1U7DA 2AE2A 4L6CA 1RYBA 2Y2VA 5M3BA 2COUA 3VJLA 3I9OA 4GPTA 3ONEA 4FYXA 3VHXA 4FKMA 3NQ41 1RZVA 5KNCD 3GK3A 1DXYA 5B37A 4LRWA 1I32A 1F2UB 1O9GA 1QDLB 4ITVA 1JTFA 2PG3A 3LLUA 1JTVA 3FN4A 1TLLA 4MEBA 1THGA 1NJ1A 1CUZA 2YY6A 4N7RA 4EHFA 5EZYF 3LMKA 5HOQA 1SU8A 3DLCA 1NVWQ 3BPSA 2DUJA 3K9QO 2X4LA 4MLPA 3UJCA 4NYMR 1W7AA 1PDWA 3PUXA 1WQ4A 4FYWA 5IW8A 1N6KA 1T8YA 2FE4A 2W5UA 3UCFA 4WXEA 4ZAXA 1M54A 4C78A 2FPWA 5HPYB 1H2AS 2Z9BA 1PK8A 1UDXA 4JENA 1GCIA 2YL2A 4B84A 1OFGA 5L95A 3FCAA 3WQHA 1XU4A 1RHMA 2ECFA 4UVEA 2A0XA 3KV3O 3CGWA 5DWQA 4N49A 3RU9A 4L1KA 4NH0A 3G5TA 4HGRA 3RREA 1NN5A 4U3JA 2B0JA 3PFWO 4XEUA 4AJJA 1W1UA 1LKZA 1QMGA 2GRUA 3LHDA 3V3TA 4RHTA 3AP2A 2C7GA 2RC6A 3MXOA 3PB3A 3PXBA 2BEUA 3F9IA 4IX9A 4WLNA 1I7SB 1AKYA 2SCUA 9ATCA 5FORA 2P9JA 3FRHA 4PLZA 5KOJB 2QRMA 1BE1A 1SH7A 2DQ4A 1KBZA 2NTJA 3M5CA 5IS2A 1EP9A 1OT3A 2IZ5A 3C3BA 3HMQA 3P9ZA 4CHTA 4IQGA 4LTMA 1N36B 4D9EA 1Z6TA 3B60A 5AKLA 3IILA 3HYLA 1QBKC 3IR7A 4RKFA 4IUCS 1T5SA 3Q5GA 5JHGB 3JQ7A 8GPBA 2QG9A 5F2EA 2RKWA 1XZFA 5B7QA 5IDWA 5CIYA 4ZCTA 3PQ2A 4L4XA 2GXQA 1YXMA 3KLMX 2NIPA 1KAGA 4URFA 2JJQA 4BKMA 4BQFA 3HK2A 3D0QA 3N1UA 2J3HA 1SBQA 2OGZA 1E4EB 2GS9A 3SZLA 2BYTA 1P7PA 2OP0A 1Q1BA 2A3NA 3JCZA 4JROA 4RH3A 5FJJA 4AWXA 4K7JA 3LUAA 2ZRDA 3WNZA 5AHXA 2IOFA 3AERB 1Z8NA 2J3KA 4JLSA 5C37A 1SBHA 1MV8A 3CRZA 3TM4A 3RUDA 4PSUA 1WB9A 1DJOA 5CX1A 2C5GA 1E3TA 1ZGAA 2YASA 5CCEA 2Y0DA 3BZUA 3C3CA 4HNQA 4D43A 4DR5B 1LSOA 4Y9UA 3SQXA 1Y9JA 3PFFA 3PR1A 4BQPA 5E0OA 1XP5A 2AK2A 4O4JF 2XGMA 4OREX 3JYLA 2J48A 5DHUA 2UUAB 1AX9A 5ESRA 3G0DA 2P6NA 1M1YB 5JWRA 3DF9A 1X1DA 4IMIB 2EFHB 3S55A 3SHWA 2G1PA 1JR6A 2HLDD 1O95C 3ILVA 2V5VA 3PDWA 4Y2YA 4E1BA 1ZR2A 1FTQA 3QUSA 2IXGA 3R6TA 5BYKA 1KFCB 4Q3KA 3D6VA 2QUZA 3DVSX 3L77A 3AHCA 2PA3A 3KXIA 4Q03A 3I2YX 4UMEA 5IVKA 4F71A 2HA5A 4K9LA 2IU4A 5KVCA 4L8GA 1XQ9A 4J9UE 3TSYA 3ZK9A 1E2IA 1OLXA 3I1JA 1Z2CA 2FRDA 3K0FA 1JFTA 4YAOA 4EFKA 1JQKA 3UK6A 2HXSA 3LHIA 2BEJA 5EIAA 4E13A 3K5IA 4BLOA 5KWVA 1EDZA 3U4QA 1UZAA 1IMOA 2PL9A 3N28A 4ZQBA 2NO4A 2L18A 4ZO7A 1GU1A 1CNFA 2FSSA 4PAWA 3T52A 4MWTA 4A92A 3PFNA 1Y7HA 3JAWB 3ZZMA 4BLVA 1C3OA 3T7CA 1HE1C 1AXGA 5JCZA 4MDEA 1L5OA 2WSSA 1J39A 4MPTA 3TTWA 3MRTA 5FA5A 1S2MA 1TEXA 5KTSA 3T38A 4Z5XA 3HP1A 4X93A 4JT2A 3DYBA 1NM5C 4GP9A 4L2IB 1CEXA 4BNUA 4EG6A 3OTOB 1EUQA 2Q3DA 4K9DA 1EWTA 5L45A 4KNWA 3MHTA 6Q21A 4KIFA 4HAYA 4JCOA 3WIDA 2B1RA 2M6KA 1DEKA 1WCYA 5CYGA 5A4DA 1UL1X 1AIPA 3NKLA 4MVJI 3IEVA 3PWSA 3F74A 4CMIA 4YB8A 4JP2A 4YMSA 5DE3A 4DIFA 4EJ2A 2QROA 1NX6A 3TEMA 5CHYA 3V48A 4CFYA 1WO8A 1Y8RB 1OYOA 2Y2UA 4CCWA 3NWEA 2NZWA 4XA8A 2G63A 3DMDA 3RCBA 3RFVA 5KNBD 5GZ3A 3S7ZA 4O2BF 4PNEA 3QLUA 1HUQA 4KQHA 1IAQA 4P4SA 2AFVA 1E3JA 3L7MA 3RSHA 2XCRB 1M2EA 3MWEA 3WNVA 2FPMA 1B41A 4XWYA 2TRSB 4RD3A 4X1IA 3DVQX 3KQHA 3Q9SA 1Y7LA 4WD3A 121PA 3MILA 4P92A 1FXSA 3ES9A 4E1AA 4EYOA 4CTMA 4LYGA 2ZWOA 2ID9A 1JB1A 3AEQB 4OP3A 4RFSA 3RKRA 3NBAA 4CQLB 2VT6A 1TM1E 10MHA 3BIJA 3QJGA 4J91A 2PGJA 1KEPA 5DH9A 4MUFA 3DMGA 3JVVA 2AX3A 3OKPA 3HG7A 4PLTA 2UV8A 3Q7IA 3OIYA 3P52A 4KZPA 3WLFA 3DL4A 3NNSA 1DUIA 4BVBA 4BCDA 3NH6A 3QFHA 4P5DA 1NT4A 4P83A 5JG7A 2QRNA 2NZUG 1SG6A 3V34A 3VU0A 2A33A 1O03A 4MITA 1XKXA 2BLLA 1LB1B 1XYGA 3K5HA 4LRUA 1YE5A 1THMA 3FGZA 3EZLA 3PDUA 3D0RA 1YS7A 1G66A 4XVCA 1VKHA 4KRYA 2BEKA 1UZLA 2WOOA 3AKYA 4L5AA 3VNRA 2RBEA 1XMJA 2Q4RA 1LRKA 1L7RA 3EN0A 4LSMA 5M5BA 5FPQA 1KZYC 2Q1UA 1KL7A 3T5GA 1SIWA 1ZK0A 4FFPA 1DWUA 5C4GB 5TC4A 3UZUA 4PU0A 5J58A 3ANSA 2WM3A 1ADCA 1JE0A 1WMEA 1L0BA 2HXGA 1J8DA 2EHJA 1O96B 4HXYA 2WT8A 3ZDRA 4OOEA 3OA2A 3B1VA 4YUAA 2J5BA 2WJPA 4KTVE 2HSEA 1FDUA 3A1VA 1ISJA 1CYDA 1N2HA 4HRXA 3VXKA 2ZITA 3I8XA 2B4YA 3D8HA 5FHQA 1J97A 5IH7A 1RXYA 4TTSA 3VKGA 1Z8HA 1II8A 1E3DA 1T5HX 2RGDA 4G65A 2NTNA 2AFIE 4C89A 1FSZA 5DIFA 1QIHA 1JQAA 1S2OA 1KK1A 1LNSA 3EGXB 2IIQA 3GT4A 4I5EA 2R68A 3EQZA 4I2NA 2BGGA 1GT6A 2SNIE 2EWMA 2IZOA 1T2VA 2QP9X 4DJ5X 4ERNA 1TJ4A 4UCFA 1NQXA 2VK2A 3TIFA 1NYQA 2H2HA 2D0OB 5K3FA 4CLRB 1CHDA 3L01A 4CQMD 2A4MA 2IX9A 4EMUA 4EEKA 2INGX 1TMGE 3HXKA 2PZGA 1Z4IA 3PNQA 4L5YA 5AXBA 4C7JA 5BW5A 3THWA 4G5RA 3ASYA 2AIRA 1SVSA 1DMRA 5BOSB 1GAXA 1WLYA 3JWGA 4RO0A 5AM4A 4OQ4A 1QGZA 2FPOA 1LPSA 1FLDA 2RK3A 2ZJBA 1NI5A 1KI8A 1KMHA 1OXKB 2PZLA 3H7IA 2REOA 4BQEA 1I01A 2ZJYA 3OJFA 3GLGA 5E6RA 4R31A 2CNOA 3QTTA 2ZYGA 4CUZA 3QUBA 3DAPA 3GZ4A 5AVKA 4D26A 2ZBGA 2ZBDA 5JSZB 2J3MA 4I36A 2J87A 5TQ2B 3U48A 3BTUA 3PUHA 1QHFA 3BBLA 4ZHQA 2XCUA 2O2DA 2XKAA 3KT8A 2HQSA 1J1IA 3PWZA 1S4MA 1N2CA 3EQ2A 4X8HA 2F4VB 3L0OA 2IPNA 5JAPA 5ILQA 1G291 3RUEA 1QPZA 3T3OA 2J3QA 5SV2A 4ZWNA 2BRUC 1U7ZA 1HTBA 3BX1A 3D3QA 5AK0A 1W4CA 2I62A 2CVPA 2KLHA 1DO0A 1QQ5A 4NQZA 2XVMA 1OBHA 4N7MA 4EPXA 3C8ZA 4W5OA 3CLVA 1KI6B 3N2YA 4MGEA 4WEQA 3VGJA 5BR4A 4I9HA 5IKEA 1AMOA 2JZOA 2ZU0C 1QH8A 4D3SA 3SJUA 1HURA 1YAJA 3GRZA 4TKLA 1EKXA 1KNQA 4ZOLF 2BGJA 3T9CA 1NBMA 2AI2A 3HCAA 1E9SA 1KFKB 2YRWA 1AE1A 4FPXA 4MRNA 3FVWA 4JSYA 1PZXA 4JKIA 4DAEA 4OXNA 1OX4B 1VHJA 4INAA 4X1KB 4GXQA 1K5DA 4H7KA 4R16A 4S1TA 4EUSA 5BXYA 3ZDBA 2Q99A 3NT2A 2Z5LA 4QREA 3ENNA 3S1SA 2ZYTX 3EVDA 5CVVA 3A6KA 4L5CA 5FUYA 4AN1A 5J1SB 3LKDA 1Y9DA 3I6YA 1Y6JA 2RHDA 2QQ0A 2QY6A 3QEKA 4PFJA 2K7ZA 3NM6B 1YJ8A 4DLVA 1H2EA 3PGXA 4HVLA 2E3JA 2YZMA 2DAPA 4GM1A 1HT2E 4A23A 3B9RA 3ETNA 3CH6A 4MEAA 2VAVA 3AZQA 2AVDA 5C7IO 1ZZGA 4YP9A 1RXEA 2FEXA 1S2LA 2C2ZA 3JZIA 1CRQA 1J99A 2O54A 2I67A 4N3GA 2QJRA 4TTVA 4EA8A 1QANA 3NHFA 2ZB3A 3FSJX 4D97A 4F84A 4UU7A 4KODA 5B3JC 3PNSA 4XSVA 3K0CA 1N3YA 1X1BA 4AK9A 2GJ9A 1J20A 4G0VA 3ROZA 4UUPA 2OXEA 1HFEL 3EDQA 4NDAA 2NP6A 1SHLA 2F4NA 1ND5A 3Q12A 1T1IA 3QMMA 4Y9RA 1FNNA 4MPJA 3VKFA 3SHTA 4GWLA 1JHUA 5BN4B 3U3XA 3GJ3A 3HCPA 4G6ZA 1UM9A 1W46A 1E1NA 1PV2A 1VPDA 2VP2A 3KKQA 5AHOA 3BSFA 3UWPA 1NW8A 4E14A 1ATZA 4EKEA 3FCYA 5LDDC 3GRAA 3O8QA 1UQUA 1XQWA 2ECQA 3B1YA 1KJZA 5KAPA 1T9GS 1Z2NX 4JKYA 5HEKA 4FZVA 1V5WA 3WQRA 4CU2A 1DKOA 5JI3E 2VOJA 1ZVVA 3E9CA 3M9WA 4YJFB 1TO2E 3G2MA 4LE2A 2ONZA 2CLSA 3IUMA 2I7CA 2ECOA 3WWDA 1IK6A 4P3XA 1TCUA 1TRHA 3IQHX 4KIGA 3EFEA 1H2BA 3D2AA 2GOYA 4EHBA 2GM3A 1EUZA 2HREA 3V1UA 1GO2A 5TQ0B 2HWKA 3U3ZA 1T4GA 2RHBA 3MTAA 1JG7A 3PFHA 3S2UA 1G3QA 5K0LA 3LQ2A 4GPEA 3VZPA 4WZAB 5G0SA 4D0NA 7ABPA 3Q1LA 2XECA 4C76A 4GZLA 4NONA 4BP8A 1ISFA 3JQGA 7ADHA 5BMVF 4H1HA 5FXMA 1V96A 2ZAIA 4H15A 4S3MA 3PI6A 4HH4A 5CNKA 1F4PA 1Z39A 1KFJB 5EP4A 2BDEA 2H1HA 2ZTVA 4GR9A 4QDTA 4TV9F 3ZZTA 1BA3A 4P7BA 4INPA 2GO1A 3TZQA 3P9NA 5AHKA 3O21A 2WHXA 2I4MA 1GRRA 4GE3A 4QBKA 5DYYA 5ULLA 2HLPA 3LBNA 4BNGA 5IFLA 2X9VA 3EQ7A 3LPLA 4JSRA 4OJYA 2JFOA 1U6KA 3CO0S 5EEGA 2NVWA 4IJQA 2Z2KA 1L4KA 1R4NB 3QLJA 1W5TA 3NBYC 2FMHA 4FHZA 3R40A 1N33B 1NQUA 4NU5A 4BASA 1T0BA 1SOMA 1DPGA 1A8HA 1XTTA 4LF4B 5JATA 3UG6A 2C04A 1Z74A 1ORVA 2FPSA 2JGIA 2KYRA 2P8SA 3P4UA 4B6JA 3QK7A 5I51A 1J1UA 3N6XA 1Y9ZA 5KJ6A 1W30A 3IKTA 2QM3A 1XT6A 4AQ7A 5SY9A 2XUHA 3KSUA 3GEMA 1G2IA 1QKJA 4RTMA 4U5QA 4NJOA 5C5DA 3AB7A 2I8CA 1X3LA 1BD4A 2F1JA 2PO7A 4X0EA 3SF0A 2EKZA 2WYWA 4ZC8A 4TXHA 3GCWA 4BJ5A 2LCIA 4LHZA 4N5IX 2E9SA 2YW9A 5EE3A 4ZMBA 5LOVA 2IYRA 2IHZA 4GI2A 4I4IA 2AJDA 4H1WA 1IHOA 4QHTA 7MDHA 4FHCA 5DBHX 1WRBA 4KE9A 2ZWMA 2V6BA 1OVGA 1ZJZA 1QPBA 2Z2JA 1QE3A 4YRMA 2IHNA 5KTRA 1ZH0A 2OFOA 3LA8A 1PJ4A 5LC1A 2BTEA 2DHEA 3ZD6A 3R77A 4TS3A 1LWNA 4EA6A 1SCDA 4BO9A 3P2JA 2XUJA 4MHSA 4EY7A 2P0AA 1NPYA 1YL6A 1L5YA 2VRNA 3OD5A 1N2EA 1UBUS 4I55A 2HCRA 4WKBA 1Y81A 4I9UA 4DADA 1O5IA 4EFMA 1W76A 1I6LA 4MIOA 5LYYA 2DPMA 3UJ7A 1LK7A 3TQOA 4L07A 2FG7C 3I9V6 1NRWA 1NNEA 3LL4A 3A4NA 5ARCA 4F5WA 4KRGA 3ESXA 1NVTA 3WMFA 5LP1A 3ERCA 1A0OA 1ZX1A 3R0QA 1N6RA 4UM8B 4P93A 2PX3A 4J16A 1REQB 5AXDA 2AEFA 3QU4A 2P9CA 1RXUA 4QOHA 3U61B 4QUBA 4BP9A 3SEZA 4RPHA 4LBVA 1EDBA 3QOFA 1TKRA 1K8XB 4EHIA 2PJUA 3ZBUA 4F1WA 1QZZA 1YUMA 4R5MA 1OR8A 4DV5B 3RB8A 1ZY2A 1X9IA 3NV9A 4P3OA 5TGZA 4BWGA 2DHRA 4OSPA 3GQBA 2CXRA 3SVZA 1JL3A 2VNIA 4QFMA 2JBHA 1MH9A 3ICVA 3QP9A 2YYZA 3HRIA 3O2JA 4DXAA 1F8GA 1SA0A 2HV9A 4NR0A 4Y1EA 4BNWA 3WDKA 1Q0ZA 2ZG6A 5DN6D 3KQWA 2F9LA 3CSDA 1YL5A 1PJZA 3CWZA 4YCDA 1DTWA 3PC6A 5HF6A 4UARA 5J1TB 1PKEA 3JQBA 2IY9A 2IVZA 5FWYB 4R1LA 1CUUA 5FJIA 2LD4A 1YRHA 1CZUA 5LMZA 3WC4A 4BWVA 1J06A 4L78A 5EJ6A 3EF1A 2CGEA 4BDSA 2YDXA 4QBHA 1JMYA 1ZSYA 4Q00A 1MMFB 3O93A 3AU8A 2C5BA 3PP8A 4QSMA 3OCZA 1UIRA 5DVZA 1E3EA 1DAHA 5JY6A 2Y99A 1ECGA 3F6YA 3PNOA 3QE4A 2OC9A 4EG1A 1FP4B 4B4VA 4LSZA 5DGXA 2C20A 2P4HX 3EPLA 2JGEA 4QDOA 1Q1AA 5A5VA 4S0ZA 3VZQA 5IJ9A 2ODPA 4LJ9A 2J5RA 5K6AA 2PL3A 2NUTB 2V3CC 4I6EA 4YRDA 1ODTC 2GLUA 3EF0A 3GUVA 3WQBA 1J2JA 1E59A 2AF3C 3D7NA 4G5HA 4Q3EA 2YHSA 5GJWC 1LEHA 5EHZA 1S8AA 3HCOA 3RFXA 5DEIA 4PZEA 2GTHA 5DTMA 1AUQA 3TSOA 4P1ZA 3K92A 4CM1A 4MARA 2VWPA 4GX2A 5HUQA 2J4DA 3EDMA 3NIWA 1NY5A 1IG3A 1NQWA 3E4DA 3FGOA 4UEKA 4OKIA 4QUDA 1M2FA 3W9UA 3JD3A 4JI4B 2C8VA 3OQOA 3E7XA 2IZ1A 4A15A 4EGQA 1XVAA 4DVGA 1QGED 3FHCB 5T8KC 4TS4A 2G4VA 4EUHA 2FPPB 2YFYA 4DDVA 5LYJB 4G63A 1D8TA 3K0SA 2IWHA 4I2VA 2JLYA 2FV8A 4DG8A 1TLTA 1LDGA 4FDVA 1D03A 3O8BA 1KEZA 2NUBA 3BD6A 3UBTA 1KQ3A 2OBYA 2YDYA 3H2SA 5G40A 4Y7DA 3DFKA 5LP6A 3PPVA 2FDRA 2HU8A 1VL5A 2CDRA 2R5FA 4Y2PA 1U0GA 3SU8A 3W1VA 3I6BA 1UC9A 4F85A 2QL9A 3ZLUA 3TQTA 2Y6UA 4BB9A 3KLNA 3JD2A 4C03A 4RF5A 3R3JA 1JALA 4FEEA 3IYLW 4UBOA 1BU5A 2CVHA 3LS2A 2GVNA 4GR5A 4RIIA 4GMFA 5JARA 1H85A 3OQHA 1MZPA 5GJBA 3O38A 1Q74A 1H3EA 1CUGA 4W5JA 2Q3HA 3O4VA 3H13A 4F7WA 1RKXA 3CSUA 3HB1A 3KOUA 5LR6A 4AC9A 5CVDA 3KT0A 4UPVA 3B9QA 3VH1A 2ZDGA 2XTAA 3OQ6A 2PKWA 4QBIA 1JPVA 4S35A 4LX0A 4G84A 3LUPA 4C5AA 5DHTA 1Y48E 4ZVUA 3BBPA 3G8CA 3V8NA 2OCDA 3O83A 1QYIA 1WCIB 3OQIB 1CUSA 2ONCA 1KBQA 4DLUA 2Y4OA 2EXXA 4DC1A 6REQA 1GSHA 1I8TA 2UYQA 1KJIA 3O91A 5M34A 4EB8A 5EFZA 1UQTA 1O4VA 1W6RA 2WUFA 2LXNA 3KYCA 4MINA 4XWGA 3MTEA 5DX0A 1JMKC 3F4KA 3OEED 3KCNA 1Y1KE 2JHPA 3ETGA 1M0EA 3PQ3A 1HMYA 3FTDA 4N48A 3MWYW 3KAQA 1W48A 4QT4A 4YT2A 2WB4A 3TW8B 3UV6A 2FMIA 1P5HA 4QBGB 4J1QA 3DFFA 1QRSA 3LOPA 5FWXA 3MEQA 1RVDA 2XX3A 4FGKA 5HK8A 1W59A 5AW9A 1N5IA 3GVXA 1H4TA 1KVRA 4W9RA 3GDOA 2PWAA 2DJ5A 3MJVA 2GKGA 1Z22A 4Z49A 5TLSA 5J3JA 3BZWA 4YP6A 3RSCA 5FHRA 2EZUA 1I13A 2D7JA 3DW3X 3V9AA 3KSAC 2DTXA 3D5TA 4IHJF 4PX5A 2A9OA 5K9ZA 1H4SA 4XGNA 4XCQA 3D0KA 3T6KA 1CU1A 5AWFC 1D9ZA 1FNCA 2GQ0A 1IIBA 4QUIA 5LQSA 2OD2A 5HS6A 1NF8A 3GLGE 4XR9A 1R4MA 2GJAA 3EG9A 4JBIA 4P33A 1WETA 2IH5A 3NJ8A 4O63O 2R96A 1FA9A 5LQCA 4UUMA 1RLMA 1MLDA 2BE7A 1WUJS 2YW2A 4NBKA 2LE0A 3M49A 1I2AA 1QXSA 2VHVA 2H48A 2XW6A 5A3VA 4N03A 3ZLTA 5I4BA 5I7VA 2H4HA 4QDUA 1E3WA 4LDQA 5GV8A 4RKQA 2VF2A 2VIIA 3WRYA 3B6IA 4ZU1X 5FNVA 1N2CE 2Z1DA 3A70A 3DTVA 4GOJA 3UCEA 2VQFB 4KREA 5E0KB 2OVBA 5BN5B 1FTSA 1YVEI 4YYEA 4FFMA 2GKOA 2IKQA 3LC2O 3OE4A 1WPXA 4H59A 3VM6A 4TQAA 3RVDA 4LXHA 4HTFB 5I01A 3ZDCA 1M2GA 3CLRD 2EDAA 3TGWA 2K2QB 3GG2A 4QHSA 3TO5A 1LBTA 3TKLA 3UKJA 2IGTA 4C43A 4DNXA 4DREA 5FX2A 2HWXA 4AMGA 3N8KA 1CQIA 4DT1A 5TMPA 3CXUA 4HS9A 1OIVA 3NTQA 1IHPA 4JVOA 5A9SA 4AZSA 2Y67A 3ZTTA 4IRUB 2DFLA 1TLFA 4TLBA 2PUTA 3E6AA 3NHPA 3Q11A 4S0XA 3CURA 3OMXA 4ENQA 2Q8NA 1KDVA 2EF0A 4FYMA 4PZZA 3MPUA 4L16A 5E3JA 1NBME 3DXXA 4I5IA 4B44A 2O8EA 4BIMA 1J2YA 2R00C 2GM9A 4QEDA 3BHIA 4W1SA 4DLSA 4RK4A 2VNSA 2NSYA 2VUSA 4AKSA 3FAKA 2HNAA 2R86A 4GLOA 5CLHA 3L1HA 5HBGA 2UU9B 4H27A 2RKBA 2WAXA 3OFJA 1VJTA 3C74A 4ZO4A 1ZXBA 3AUTA 3RQSA 2VJQA 4BO0A 2GPBA 1PYGA 4MVJF 4Z4HA 4UQLA 1W4RA 1ZN7A 2G9QA 3HWSA 3NT5A 4Q4JB 3ZLJA 3RNOA 1NYLA 4J4HA 4CTNA 2XYQA 1R2QA 2H4YA 3OJXA 4WLOA 3IHWA 4X6UA 4N8SA 5TRTA 2PMKA 3WBJA 5KOHA 4PAGA 5K0SA 1KTVA 1DCKA 3B6JA 1N8SA 3GJTA 3R0IA 4YMIA 3ZWOA 2O2GA 3NWPA 3WZMA 5DO9A 3F3SA 2GERA 1PZNA 1RBZA 1AKWA 2WZDA 3L02A 3R44A 1X2BA 3C1TA 4RJ2A 1Q16A 3C7DB 4FMBB 4PZ9A 5F78A 4CGYA 4D4LA 2POCA 3ESYA 4Y1RB 4ZCSA 3RH0A 1KGDA 2P75A 4BMXA 1CDOA 2WQZA 1XCPA 2CL7X 3AM3A 3DP9A 1V0JA 4M98A 5AKXA 3ZY5A 1WABA 4WLVA 2DBQA 1AV7A 1NGSA 4HN9A 2HYDA 5HIKA 2HSZA 5KZMB 3MRSA 3GUYA 2C94A 1Z5UA 2FUG6 5J2UF 3FNQA 3MUNA 4OHVA 5AJYA 3I37X 1YCHA 3E9RA 3WGYA 2ZRQA 1I2MA 3FVQA 2A5JA 2X9GA 2R1UA 3QHQA 5K2MA 4DV4B 3OQ1A 2Q6KA 2QBYB 1T1GA 3QJ5A 1SB8A 2WSIA 3R7WB 1KXZA 3HVJA 1ZD3A 3IHTA 1QVZA 3JR7A 5JXWA 5DI3A 1WQ3A 5FOXA 3OP4A 1D0IA 2W48A 4QLOA 4WOKA 1C9YA 3NIGB 1RSZA 4Z9XA 1FDTA 2ZSBA 4UNSA 4FW8A 4U7WA 4CIBA 3EMVA 1Q22A 5AI4A 2WP8J 1EZ4A 1HDZA 2HM7A 5D01A 4V02A 2PXCA 3LO5A 1Y4DE 2REQA 3TRFA 5I8PA 4BQNA 1QQ7A 1T5DX 3O8RA 1M34A 3VO9A 4IL5A 4UNRA 1VPEA 2NYRA 3C87A 3GN2A 3ISTA 4UXJA 3ZNPA 1XVVA 2ORVA 5AH0A 1P2FA 1XK6A 3PHLA 4HAWA 4NC9A 4CQNA 3AJRA 3ORQA 3WLHA 1BFKA 4TM7A 4YP7A 5I4KA 3X1YA 4B73A 1X2EA 1C80A 3T5MA 3IX7A 3U3OA 4CF4A 4TXLA 2YJ6A 1HXHA 1WV1A 1ADBA 4GKJB 2BTQA 3IOYA 3FZGA 4OMFG 2V7QA 5L3VA 2W2MA 2J9GA 2AF4C 2QD3A 4PRKA 4HQFA 1LW6E 1PJBA 1ZW1A 1E69A 3JQEA 3OHPA 3F7OA 3D6UA 3WLSA 1ZCFA 3MMPA 3T5DA 1DAMA 1DKLA 1U0EA 2YWCA 4E3ZA 2ZZNA 2YXBA 2PRZA 3E3AA 1J33A 2KI5A 3KK0A 4BECA 2W6MA 4ZCIA 3MCZA 3SE0A 2XNJA 4KPUB 1YHNA 2XQFA 4BO6A 5CA1B 2C61A 3I6ZA 1PUJA 3ROEA 1JHZA 3FKSD 5FB3A 1P0FA 2IW1A 4UPDA 3EHDA 1YR3A 4GOLD 1DC4A 4IBOA 2E18A 2W6ID 1GJRA 2JIOA 2F9FA 4IGIA 1JHXA 1OE0A 4K9PA 3ZHCA 3W04A 2BMEA 4JMLA 1TB4A 1Q3HA 2YVAA 4A8JA 6NULA 4H0NA 2CHFA 3M6LA 4D8VA 1JFLA 1CJTC 3B51X 1ZN8A 4BZWA 1I3CA 2WF5A 5HKBA 2EQ5A 2YJGA 4DV2B 3FCCA 5DWDA 3QOWA 3UB2A 4LDPA 2OZLB 1ZLXA 1E18A 2FN3A 3EXHA 1UM8A 4UULA 2HX1A 3H05A 3GLFA 5D7BA 2I2BA 1DC7A 2J6BA 4B3CA 1B1CA 3DPUA 3GLHB 3CLRC 4WJZA 3PUZA 1DBIA 1PNQA 5FQNA 2FFJA 4R6XA 4HRVA 1UBRS 2OV2A 5FRDA 1B00A 2EEPA 1TM2A 1YRLA 3A1SA 4IDGA 2P2CA 4M1MA 4QU9A 1NMYA 4RV5A 4LGYA 2J46A 1YZVA 4CT0A 4MUNA 4JYCA 4BVAA 4QVIA 2DKNA 2PYDA 4FMCF 3D6TB 1OH7A 3OFSA 4GT1A 4HZGA 3IAS6 4O3MA 2O8BA 5DOZA 1WLSA 2A1UB 3P2EA 3RS8A 4XEHA 1JEOA 3AJ8A 3DEFA 1X80A 2IHTA 2XDYA 3GNQA 2O4CA 4ZT2A 1YE3A 2Y4NA 1A76A 1UUFA 3JYOA 4NOKA 5JBNA 2Y0EA 5ARBA 3VSDA 2ZIAA 4FOLA 5H3CA 1PQ4A 3ODGA 2AW3A 2EW2A 1XJQA 2CEAA 2ORYA 1DXOA 3K0AA 2WHQA 1OUMA 3W90A 1C8KA 3GBVA 3PJRA 1JVNA 1E9DA 3R24A 2B7CA 1A9QA 2GTPA 3JQAB 4NNPA 4KVGA 5IM5A 3M89A 1EVJA 1OU4A 4K6MA 2I71A 3TI7A 3N5CA 3EPPA 4UVGA 4EB0A 1M66A 4YV1A 3KKOA 3OZUA 4TMTA 1YT5A 3TRHA 6LDHA 3PYLA 1QO0D 2AOUA 3MRVA 1A8SA 3GPDG 4EKYA 1E9EA 1UK9A 3UB4A 3RJ5A 3OI7A 2P2NA 4PFQA 1DL5A 1A5AB 3GLIA 3G5AA 3MS2A 4DLNA 1G5FA 2EDCA 1YQUA 2OBNA 2WUVA 2AEJA 2YZ7A 1XZQA 1Z0KA 2CLMB 3AFNA 5JAMA 3ZGZA 3HP4A 1YR6A 4MX8A 2WC1A 1E3SA 1PJ8A 1QB7A 2KX7A 1LC3A 2XIQA 3AHGA 2ZOSA 4U8HA 5FR1A 5AM2A 2OQ2A 2JAOA 1Z75A 2J3LA 4WBNF 2CCJA 3MCVA 1PD1A 1Y37A 3QPWA 4LFAB 3HS3A 3TKAA 4CIVA 4DSTA 1U6JA 3ANXA 4B6OA 2CXXA 1KO8A 1Q7GA 3A6GA 2AVNA 1QZUA 4ZYZA 3AFIA 1O97C 1GR1A 2NU6A 4GDMA 1K6XA 4UAGA 1SD1A 1XTBA 5AXAA 5HMMA 1N2SA 4QECA 4EARA 3EXFB 1F9AA 4W7HA 4FLEA 3LE8A 4CMBA 3W6OA 3BFPA 1NF2A 2XUGA 5CDSA 1Q0QA 2BM0A 2FLWA 5AKIA 4HL6A 1PGJA 1HA3A 4G26A 4RMHA 4TTQA 4QJIA 2WTXA 5HKKA 4XYLA 2XZPA 3QI2A 1N78A 3T7SA 1UWCA 2C82A 2J0UA 4CM3A 1SCUB 4OHCA 5EJFA 5A3QA 2QMHA 4LXUA 2XF8A 3TG2A 2YVLA 2HHAA 2DPHA 3W3AA 1V5IA 1FFWA 1LY1A 1Y3FE 3DXFA 4KAXA 4EATA 2RG1A 1U94A 1YASA 1YULA 2QN8A 2K4MA 4LF5B 4CMCA 2HT6A 3CA8A 2J09A 1EWYA 4F4CA 4KGVA 5KYXA 4QFDA 4AJKA 4OBWA 1G19A 2QD1A 2RKOA 4U4AA 4EYSA 3SNHA 3HCBA 1E6LA 1NBOA 5DK6A 3ITDA 2RJOA 4DTCA 1OCEA 2ID8A 1PO7A 4LYHA 2XE7A 4MVJP 1WCXA 1BOOA 3RWBA 2DB3A 4LJRA 4XZ3A 3GHHA 3T7KA 2ZP1A 3TYXA 1KHTA 2NZJA 2ZPTX 3N0TA 3HZRA 5ALRA 1A71A 2ATVA 2HOQA 3KJHA 3PITA 1TYBE 5J63A 4BKPA 4BMNA 3AF6A 1K89A 1GIAA 1R6BX 3FGPA 4M53A 5HRAA 5B4VA 4BN4A 3GDGA 1GYPA 3QTLA 4CLHA 3R5KA 3S2SA 3FKQA 1Z12A 4RFVA 4TVSA 1XA4A 1ZH8A 2KBEA 4HT3B 5A04A 5K09A 1K8QA 4LNUB 1D6MA 2CHVA 3MSCA 1ZUNA 2H1OA 4KPYA 2OXRA 2CFSA 3HZOA 1R0XA 4Y2TA 2FSVC 2AB0A 4ROTA 2CLHB 3TX6A 3TG8A 1QX4A 1KEWA 3ZZNA 3MMXA 2Q45A 1LPAB 1R7RA 3QVGA 4KLAA 1TOAA 1E99A 2JHFA 4NCXA 2VT3A 3LAWA 3PEYA 3W9BA 3OZEA 4JN6B 3WICA 4CW7A 4UZFA 1WE2A 1XQVA 1V6AA 2L0XA 2NN3C 1CZHA 4XD2A 4FINA 4KR7A 4QNMA 1D04A 4PG8A 4YRZA 3FCOA 4W1QA 3AI7A 3MS4A 3FNRA 4YJKA 3L8CA 1VHDA 2QX7A 4X61A 5DGHA 1S2DA 1GFIA 1UPFA 3ZGLA 2JFYA 4TQGA 4QICA 2R3SA 2XUZA 5F9HA 2H4ZA 1ONNA 3BRWD 1UPCA 3O4IA 4B6PA 2XOKA 4ZMSA 1Z6QA 1GA6A 3S6JA 3DGFC 4IUBS 1O1YA 1HQCA 1RR6A 2F3TA 1PG0A 2FB9A 1WKCA 2JCSA 3MVEA 1PR5A 1ECBA 3NEAA 4C6HA 1EIZA 4HZUA 1KI7A 1ZCZA 2R25B 4KYUA 1FMTA 4UC0A 4ZU3A 2QLTA 1LW7A 4FMDB 3LFTA 4HPWA 1SCKA 2JGFA 4J90A 4Z3DA 2YHBA 3AFGA 1B15A 3BHNA 4IIUA 3FI0A 4AVYA 5BNTA 1C7RA 2C78A 3AHEA 4LZJA 3EIFA 1S89A 3CTMA 4ZEOA 3CEPB 5HW0A 1JEYB 2O7RA 1ZU4A 3DMTA 4M9UA 1BVYF 3GFRA 1KPIA 3FMPB 4KMRA 1RRMA 3CR3C 3T9BA 4CCSA 3DFMA 2FSIA 3ZDQA 4G2TA 4OFBA 3NP7A 3GDHA 2FFAA 1LF0A 2HCBA 4Q05A 1M1UA 2JFPA 4R9NA 3UXYA 1TQ4A 3AF0A 4XQ0A 5B58C 2WT9A 4DLXA 3S29A 2X0EA 2PWZA 3SC2A 4NFYA 1CUXA 2QTAA 1NHGA 4A6XA 2NUAA 3K3PA 3NVKI 4AFNA 1FS5A 1RC8A 1YU9A 1BE0A 1FQJA 1MB2A 1NKSA 4P3NA 4Y2HA 3A3KA 4R84A 5EP3A 1Z16A 3VVCA 4KQEA 5L3SB 1BS1A 2E4AA 2GPJA 2IZ7A 1E4YA 1W0KA 1WPRA 3IAM1 4HUQB 4F96A 1G5RA 1SD2A 2TSYB 4OB8A 5EZYB 2BKAA 5FLEX 4B3RB 3LG2A 5CGQB 1K98A 2J5KA 4O2AF 1LK0A 5WRFA 5D5PA 2NVOA 1T9ZA 4MRMB 2G72A 2IYAA 1DLIA 1O89A 2BPOA 1D4FA 1W75A 1TNDA 2NV6A 4P4UA 2QV0A 4RZIA 5ELXA 4JY7A 1DFGA 2AC2A 4I7EA 4NZPA 5COQA 1GCGA 2C95A 3DBRA 3CRNA 1VIMA 1C7ZA 1T2UA 2X8WA 4J1NA 1HF3A 4Q3CA 5JNTA 1VG0B 1PWXA 1V3UA 2L42A 3HKBA 3CONA 5FI0B 1QZXA 3JQ8A 1G2PA 5EUBA 1RWKA 1G6HA 3O2QB 4FBGA 4I3GA 2WJYA 4DLKA 4MWOA 4EO7A 3DBIA 4JJGA 3HXMA 2ENUA 3O9ZA 2R65A 4D4KA 3VC1A 1LDEA 3TJZA 4NK4A 2PHZA 1CZOA 3EZXA 2IIVA 1SXJB 3GMTA 3PD1A 4UMDA 2HA4A 2G40A 3H5AA 3QENA 4MPDA 4O1IA 3LXUX 3W2GA 1C1XA 1T3SA 1JV2B 3I04A 4UNQA 3KPUA 3OECA 1YFJA 1RPZA 1E5LA 4LOIA 3BTSA 1LFDB 4FEAA 1UEXC 1JHOA 4YS6A 1RWXA 2MINA 2GLXA 3C8UA 2V03A 4XB2A 1YJXA 3DZHA 1C41A 3KEQA 1T4DA 5CEEA 4FCWA 5ITVA 4I5GA 1XRMA 4PHFA 1F2DA 5A62A 3GN1A 4PNPA 3KR2A 1JBQA 1W4ZA 2ZSDA 3BVPA 3BD8A 3L0BA 4ISBA 3WXBA 1EFRA 4EHKA 1SC6A 1DRWA 3ON5A 3PC3A 4HS4A 1Z6AA 2YWDA 1FTWA 3OKCA 5DM60 3O3OB 1V6SA 2PSSA 1KAQA 4IOKA 4BX0A 4I50F 5CNJA 5EUQB 1KC3A 4IFEA 3U19A 2DM6A 1DI0A 3E9EA 5IBPA 1C9EA 3R3WA 4LYEA 4JLJA 4QUEA 1HL7A 2FOLA 1M7HA 1WG8A 2CXOA 3LY5A 4LPKA 3DZCA 3HU2A 3M4XA 2G1KA 1PL6A 4RTSA 4E33A 1FNMA 1X7ZA 3CKMA 1YZQA 4O4JB 4HNTA 4G01B 5LZ4A 4FR0A 3Q7QA 4KAJA 1NU6A 4OY3A 4BUZA 1QH1A 1YVUA 2QG4A 3UTCA 1AG9A 4PBRA 3WV5A 3PTLA 4OHBA 5AVZA 2PL5A 3ZDZB 4C4RA 5B6PA 4LJLA 2PUHA 3QOYA 3TXXA 4PG4A 1G8MA 5AIBA 3KJGA 3JWIA 3BGOS 1FFAA 2F2TA 2I99A 3N2KB 2BBWA 3QFTA 4DKJA 3LCRA 2B2NA 1YOVA 5AUNB 4AQYB 4KZKA 3A6LA 1HEYA 3ASVA 4UUQA 1IY1A 1R66A 4OA8A 4EVRA 3VKUA 5FUQA 2O0KA 3HR4A 1WNFA 3I12A 3UG7A 3ZJ4A 3B2NA 4J1TC 3V8BA 3MAAC 4YMTA 1EM8B 3FYDA 4C3OB 1XVTA 3NHAA 2H5EA 4QC2A 1XHLA 4JLOA 3KHUA 3PIRA 1SPXA 4TSKA 5IN5A 1SC9A 1NNUA 2Q0QA 3VHQA 1FP7A 1OTHA 1U7UA 3PPIA 4M87A 4Q1CA 2G80A 2WMDA 4R9UC 4LHXA 5DU2A 1Q11A 5CB4F 3UPUA 2DWCA 1FYXA 4KC0A 2G09A 2BTOA 2IE0A 2DBYA 2XF2A 5AW5A 3H4IA 1ZP6A 2Z4SA 1M34E 1DQNA 4FT4A 4PSAA 2WIBA 3HDQA 3F2IA 2WABA 2CLLB 3EULA 1YOBA 3DEZA 3PQDA 4FI3C 5TEVA 2VK1A 1Y33E 3WP1B 3OFND 1AY0A 3WLKX 1NUSA 3MELA 3C14C 3R5FA 4L74A 2PY6A 3ZCXA 1EX9A 1CS0B 3E9MA 4PR3A 3L4JA 4NCJA 3CX6A 2IYYA 3NFRA 1E2EA 1XN1A 2XRYA 3OLVA 3IIEA 2BHRA 5ES4B 1EA7A 1WL8A 1MO4A 3NVAA 4BZPA 3CIFA 3N7AA 5KDDA 2BMWA 4Y67A 1T8PA 1CE8A 1Q44A 2HMSA 4MQ4A 5F73A 1GGNA 1RJFA 1Z88A 5E4JA 5GINE 3QF4B 5K3EA 2BFCA 2Q3CA 5JI2E 5JXJA 1EGVB 4D0GA 2QJFA 3MGCA 1MVOA 5IKOA 5JNRA 4KWHA 1WTCA 2SKDA 3W6ZA 4AULA 2H2AA 3G82C 4O2BB 3WLAA 3WDLA 4D9GA 2WG0A 4TMYA 5AW3A 3BG5A 1Q50A 2ZJ4A 1XLWA 2BOVA 3F4BA 1OPRA 5CYPA 2HPAA 4B4KA 4R2LA 5KTYA 3CH5A 1U2DC 3NIDB 2GYWA 4PIVA 1A2OA 2QVYX 4GEGA 2SECE 1I0ZA 3PNBA 4DRXB 2J41A 1ESEA 2GEDA 5A2QA 4DV0B 3SVTA 5EKXA 5CIWA 2A1TS 4KAFA 2D0PB 5EHQA 3QEAZ 1P4AA 3ZQ4A 1H0HA 4PLPA 3C41J 3I9JA 3OPVA 4TRNA 1P4SA 1RWQA 3B9PA 3EUAA 3UMBA 1ZD2P 3P9CA 4QODA 3U1VA 4FE4A 5DV9A 2Q3EA 1Z73A 4IVNA 2GFIA 2XYHA 1Y3CE 4U6SA 3GLFE 4MAMA 2YZNA 3J81A 3COYA 1EWVA 3OJLA 4G97A 5CFNA 3H9UA 3WDMA 2P6MA 4QARA 3WL5A 5E7JA 2XWJI 2J9XB 3NHSA 4Q3DA 4WKPA 2PRIA 3LPDA 3WYNA 5I7EA 5ICEA 2HMTA 1NKTA 3P2OA 4G0MA 1KOGA 4Z0TA 1LC0A 2BZ0A 3E35A 1QP0A 1ECFA 4KEAA 1U9JA 1NLYA 2X3YA 3UMCA 2NAFA 4GU5A 4NESA 3IEMA 5FOTA 2NT4A 1EB8A 2R7KA 3ZDAA 3F5FA 2A9RA 4BFWA 4ZEXA 2NO7A 2Z4RA 3ZGYA 3BFKA 3KOYA 1HKHA 2Q27A 2O5CA 1WQ1R 2J5XA 3C39A 4M4SA 2H54A 1O0SA 3W5IA 1A9YA 3K9GA 3KYDA 2G9UA 3AU9A 3TVDA 3HFJA 4EY8A 5P8WA 3T4PA 4EFDA 2OUKA 1SKUA 2NADA 2ST1A 4KHPB 1SVWA 3TCKA 1XMXA 4XM1A 1GUAA 1Y6RA 4XWTA 2C1EA 3K4QA 3I9MA 1SHJA 4LE1A 4AUKA 1YR7A 3TJMA 3K32A 3TWOA 2H1FA 3KVNA 2DH6A 4N6GA 1GV0A 4IKEA 4OP2A 4MW9A 5IMSA 2VTKA 2IKSA 3UFXB 2FPIA 3E8MA 3JYHA 5IC5A 2OHVA 1TAUA 2HXYA 5ICMA 4YQZA 2ZCUA 4Z1MD 1O95A 1K8ZB 1XTZA 4OIMA 4DV3B 3QWFA 4L8YA 2FN9A 2WJ6A 3WB0A 3DP7A 2I34A 4FXOA 4JLMA 4LJAA 4CDRA 4WL0A 4Y6PA 5K2OA 3KP1A 3LUKA 1K06A 5JYDA 4ZVKA 1SIOA 4G41A 4BPRA 3P71T 3GLIE 1L5ZA 5EJIA 4H60A 1EESA 1WAMA 2ZB8A 3BDVA 3F8SA 1Y9EA 2IOFK 2DP4E 4JUCA 3CF4G 1T3HA 2CL6X 3IMEA 3ODPA 4NCHA 5IVPA 2JAPA 5JH7B 3ID6C 4XQ9A 2I2CA 3G5UA 4W1PA 1Z13A 2EWVA 2DE0X 4P4TA 4GMGA 4MS3A 4X60A 4DPLA 3VFDA 3EY4A 5CR9A 4M36A 4QELA 2O3UA 2YN0A 3KSMA 3S99A 2OWEA 4HATA 1RLOA 1DO2A 4EA7A 1BN6A 1KNXA 4HLUC 2OZVA 2XMGA 4MNTA 3ZWVA 1SQ5A 3LBIA 4GC9A 1NZDA 2VP3A 3TSCA 1TJPB 1E79D 1O77A 3MWJA 1NM5A 1YA8A 3JR3A 5T3YA 5BWBA 4HH3C 4OA5A 3EFOA 4Q16A 1Q7BA 3L8GA 4X1YA 5FEMA 5GOTA 4A2WA 1X8LA 3MJHA 1CIPA 1GR0A 4QWWA 4TYQA 2DLNA 1L9XA 3RIMA 3ZTWA 2C29D 2I1VB 4MA5A 1SGWA 4R8SA 4Y6RA 2GFHA 2WM2A 1N5RA 2R7NA 1SC3A 2G8NA 2W00A 4BKUA 1DKRA 2BSAA 4Q9IA 4GMKA 4UHEA 1JDBB 4ACAA 2YMLA 3F6RA 2EX1A 1YJAA 2ZIFA 1ZH4A 3ZCRA 4YMWA 3TK1A 2PRSA 1FUEA 3COVA 3G1WA 5DLQC 3I4FA 5DP1A 4RQAA 1M1XB 2ETVA 4JZKA 4AJEA 5JLAA 3NHMA 3OU2A 4CM8B 2BMDA 3K1AB 2WY2D 3K5PA 3RT9A 5F1YA 5KVAA 1NP3A 2ET6A 1NG1A 1CY7A 2IUFA 2QENA 2VDKB 4CKCA 4UNPA 3IBCA 2AJBA 3HBMA 2O05A 3DCJA 3DE3X 1M1NB 4W82A 2JEZA 3KPWA 3TFWA 2JANA 3DBVO 3AY3A 3WGUA 1A9RA 3BFXA 3WHIA 1KY4A 4XCXA 1DT3A 5FA6A 1T4CA 4NG5A 3INRA 4OL0A 2NV2B 1R1DA 5AW0A 4ARIA 5GIPE 1QGDA 2QTVA 3FDZA 1XJ5A 2QR5A 1DTSA 1GNVA 3ORRA 1GLNA 2FMTA 1CY1A 1LX6A 3PFIA 4JC5A 3HJAA 4V0RA 4ZHSA 4JKOA 4RY8A 3TLEA 4B9AA 1LDYA 4M76B 5KYTA 2FP3A 3HEBA 2WMNB 1C8VB 1DC6A 3ZWAA 4JT8A 1EP2B 3EGVA 2HYIC 1WD7A 4IEFB 3HXLA 2JJ1D 1MEJA 3WHLA 5L4SA 2NQTA 3C8DA 4FYPA 4CKXA 3K9FC 2HWWA 2I2FA 5HQ3A 2QMOA 4GLFA 4PQRA 5TIIA 4G0WA 5JAQA 2A92A 2FYTA 2GZAA 1K3TA 1JAXA 3W4KA 1XAIA 3DTTA 5I8ZA 2CN1A 3VYWA 4DIBA 5B7NA 1FU7A 4UJ3A 5FBVB 5MGBA 3R9KA 1FSPA 3AXTA 4A0RA 4NBWA 3TLGA 1USKA 4UNIA 2B98A 5DBIA 4FFLA 1PX2A 2H4XA 3NJRA 4P7FA 2N9UA 2JGDA 2JD2A 2FQ1A 2D1QA 2ZUUA 4IXNA 2FNAA 3R3XA 3J80A 3COWA 4MB0A 3GGOA 4NYIQ 4CKZA 4RC9A 1M8KA 4KQFA 4LW8A 1U3TA 2IHBA 5IAOA 1MPTA 3LLMA 3OOWA 3ZQ6A 3AUAA 4BJHB 1AHPA 3NBFA 4IXWA 3TRIA 3AM1A 2W70A 1HV8A 1N7HA 1NSYA 4ZVNA 3STYA 3PTZA 4RIFA 3VPDA 2CV1A 2IPMA 3T95A 1QOZA 3HBLA 3JQAD 1CXZA 4RK6A 3I9FA 4L6AA 3FOAA 1NBHA 4NLLA 4ZCPA 4RBNA 4BFVA 3G23A 3S1AB 2XOEA 3HFRA 3GVHA 3I9V1 1I9GA 4N7JA 4DMFA 2WEKA 4XWOA 5AW1A 3EHEA 1RACA 1RAHA 2QUJA 5IARA 8ABPA 5KKNB 3GT0A 2QRVB 2OV8A 4O4HF 2HLDA 1ONSA 3KKZA 2WVHA 5T3UA 3LBHA 1ORWA 3VISA 1QTQA 4EMTA 3EPHA 4RHFA 3K8YA 5A71A 4V3BA 4PAOA 1TJNA 3KLBA 4M21A 2VZ0A 3GFOA 4IYJA 2PBRA 2QQFA 2X6TA 3IAAA 1RW4A 4K03A 4TTPA 3KX2A 3VR6H 2FWMX 2AKYA 3K9NA 2IV3A 1JJBA 3G2OA 3PRKE 2I29A 2F55A 4EJSB 3ZDFA 1ID8A 2VHUA 1ID1A 1L5MA 2AYYA 1EGAA 3AJAA 1P8JA 3K1YA 4TV9B 1QG4A 3MUEA 5IHPA 2WHEA 2ZS9A 4Q4AA 3DDOA 3ZWKA 1XA3A 1RT9A 4CL2A 1F20A 3WS7A 1XG5A 4Q0MA 5IXSA 2I87A 4WOCA 5AQEA 4C7BA 1RYEA 2PD3A 1JHAA 2NYVA 3ECCA 4A6EA 2H07A 3GOQA 3O1HB 4NZYA 5TMDA 3SXUB 3CCFA 1GILA 2OFXA 1PFKA 2C5AA 3JTMA 2WD7A 4B0PA 1Z7YA 2BRUA 3JRNA 1N0VC 4MAFA 4EKDA 2CFTA 3C3JA 1M74A 3V5NA 3KQQA 3TIGA 3VU9A 4DR2B 2W8BA 4GOXA 3P97A 1Z18A 5IASA 5EVCA 2BWJA 1AGXA 1R8SA 2QG6A 2QM7A 4K8OA 1XZDA 2JCVA 3IP7A 2QI9C 3Q6NA 4X6YA 4TLLB 3CH7A 4UATA 1QVVA 5LA6F 3X2SA 4ZCMA 3IPCA 4BRZA 3LRXA 2JG3A 3TQQA 2JIMA 3GUZA 4UM5A 4TMKA 3WIOA 4B0OA 3QSYA 2PUJA 1E2BA 1GVNB 4YV0A 3G9XA 1C50A 4GYWA 3H2YA 5C8VA 2ZE8A 2FPUA 1KE2A 4Z9YA 4BLRA 2X8JA 4BVKA 5KNBA 4K26A 4E03A 1WW3A 2FK7A 4JLNA 5DKFA 3Q15C 3SF8A 4C6TA 3EIXA 1SVIA 2R4TA 4GX0A 3LNTA 4OLHA 5CYFA 2IEIA 3SI7A 1QH0A 2NXCA 2GSWA 3BS4A 4EQ6B 3PZRA 3L41A 2XUFA 4D02A 3HUDA 3QU5A 3H8SA 1NBEA 1L5HA 4BO5A 3W6NA 3L07A 5DSXA 4HBGA 4DCCA 3VR3D 2OD7A 1QWSA 2I03A 1R8YA 2PVCA 3HR8A 2GCOB 1DOAA 4NATA 5T6BA 3ROGA 1TJ3A 2C7VA 4NBUA 2C3MA 4ZQEA 1W96A 4R0NA 5EWLB 3GVCA 3WK7A 5D86A 2UZ4A 3PDIB 2F8TA 3NCTA 3HN2A 3S5UA 4QXRA 5B3JA 1GZUA 4QRHA 5IH3A 1IATA 3BFJA 2WNSA 4QJBA 1QRDA 1S01A 2PUFA 4P84A 2XQIA 2GKSA 4L73A 5JCOC 4RM2A 2UYCA 4WXHA 1FFGA 3OTQA 3QPBA 4TYPA 4NF2A 1NOIA 3SGLA 2PRJA 1YK0A 2JJ8A 1OYVA 3JS5A 4YAJA 3BIFA 5REQA 4W9MC 1KH3A 3EVBA 3PENA 2MCFA 1U02A 5D7NA 1QYWA 4KYIB 3V97A 2WVGA 3INNA 2VJCA 2JFGA 2VHZA 1UJ5A 1CJBA 4RSMA 2PUBA 4BC1A 2H4JA 3FZNA 3QKRA 4PBTA 3RK4A 3W3ZB 4BE9A 5I7FA 2XHEA 5EZ6B 4KITB 3THOA 3N53A 1W35A 4KDRA 3C16C 3LDGA 1SCQA 1GPAA 5CA0B 3K2BA 4P2GA 2PUEA 4DCGA 3AVWA 2OLEA 2EVWX 3DV2A 3QWBA 4FX5A 4ND6A 3VR4D 5CTAA 4FJ0A 5DASA 5JNWA 1SXPA 1Q57A 1J8VA 2OOKA 3LC0A 1G7RA 2WJZB 4RX1A 4UCWA 2QJTA 3HDVA 3U1BA 1VHQA 1E1QD 1Y89A 3L7LA 3OA0A 1XZNA 3KQYA 1HH4A 1N1GA 3OZAA 4G1CA 4FEYA 3K1JA 4OOFA 1WPGA 3B20A 1NV8A 2G67A 3KT3A 4M0CA 1XJWA 1ADJA 4HB0A 2PSDA 3T4XA 1UPAA 1EGQA 2I7VA 1PS8A 4O5OA 4BFLA 4BNTA 1QIEA 3A9TA 1A77A 1PT5A 2BL4A 3I5AA 4P54A 4US1R 1OC4A 1WUYA 1L7OA 3LLCA 1JEEA 3O3MB 5KQSA 4OXXA 3AEKA 1QF7A 4L51A 5EOVA 4CQMA 1O87A 2XUOA 2H1WA 4R1OA 4WFJA 2OK7A 4ZVQA 3W3AH 3LVFO 4C1BA 3VJKA 1SIUA 4FGWA 4AKIA 5DNUA 1NDQA 2AXPA 2RHMA 2ADOA 3WLIA 1PZHA 1KK0A 2C98A 1P74A 4NYIR 1OGJA 2GCNA 1ULTA 3OKFA 3WAJA 4OBBA 1Q14A 4REMA 4O4LA 4C7OB 5DMHA 5H7XA 1WW2A 2HW8A 1AN0A 4PX3A 3SWWA 2RAPA 1S96A 1O7JA 3PNKA 3I6IA 1PS0A 3RS3A 4O4IA 3WNQA 3K70B 3OZGA 1MXHA 4MW0A 4P0TA 5DDIP 4BEBA 2GJ4A 3AR5A 3TBFA 4QQKA 1SXQA 2VRWA 3BJMA 2PLAA 1PWZA 4UE3S 4BO7A 2UXDB 1JMVA 3PUYA 1OLSA 3AF4A 5E9WA 4IIJF 5JMOA 1QQTA 3B9BA 2HGSA 3IKVA 2CDBA 4PZCA 2QD4A 1YA6A 5DXFA 2Q8PA 4JU8A 3KUXA 3TFQA 3TOZA 2QZJA 2ID4A 4Q1FA 4KYTA 2QQEA 1WHTA 2I55A 1EVLA 1DKNA 1SXJD 3I8OA 3D4BA 3RIYA 5AD1A 6AT1A 1ZIDA 2CVQA 4OEHA 4EUFA 2A78A 3LH5A 1C1HA 4BQIA 3E82A 4XGIA 4K46A 4BV3A 3KSZO 4R3UC 5LB4A 1P2BA 1Y5RA 3K8ZA 4KFSA 2HPZA 4S1VA 4Y2QA 5TPWB 4E5MA 2O0MA 3DE4X 2G7ZA 3W4IA 2DBVO 2WF8A 4MDFA 2QE6A 3TBKA 1QG0A 1X87A 4HDNA 2A86A 3T7AA 3CVOA 1RPAA 4R81A 4ZV4A 4UE2A 5K8LA 2MYNA 1BTOA 4Z86A 4OLAA 1LK5A 2R7LA 4D9BA 4AY6A 1I5RA 1X8JA 2GEFA 2QZSA 3IPXA 4FLFA 1LLFA 5A7GA 2YS7A 4PIMA 2P77A 1F0KA 2ARKA 1WDKA 3QEMA 3T5TA 3TJRA 1F2VA 1IB0A 3S40A 5B1YA 4HNAA 3C6YA 5AR1A 2GWRA 1RMQA 4QZVA 1JWLA 4ALKA 2YX1A 1XFDA 4CG2A 2CXUA 4U9IS 1GCAA 3OZFA 4FDUA 3UHAA 3HJCA 2BFBA 4EG5A 3HKEB 4KUGA 1BEEA 4Y1GA 1GPKA 1F0PA 2G82A 3JPWA 3WMGA 2HJHA 1AUVA 2FE1A 1MGOA 1UF9A 4PZLA 1GQYA 1MIOA 2BCEA 3RC1A 4EH1A 2WHPA 3IP5A 3KQUA 4QOSA 1UINA 1C30B 2RDMA 2ZJAA 2AEEA 2EBWA 3VAYA 1P5JA 2FXVA 4O2RA 3ASUA 1IWPB 3DZDA 3KLPX 2MU1A 2OHOA 1USIA 2CLFB 4XRGA 4MQBA 1JT9A 1MO5A 2ATEA 5CBKA 3MCAA 5LMUB 2JZNA 3M3HA 4AY2A 4FEGA 3MRXA 1KAEA 2PUVA 3AEUB 4V03A 3OESA 2ZVPX 1S3FA 2Q5CA 3JALB 3LKBA 3NHWA 4XB6B 3MCWA 3RRMA 2J3EA 2VCEA 1VJGA 3L7KA 4IRMA 2C1ZA 3GLSA 1E2QA 3D64A 3DV9A 5DZSA 2NZ8A 3UQYS 4YPVA 1G38A 1YQQA 4QTXA 7MHTA 1A97A 1C9DB 3G02A 4LJ7A 3TPCA 5JAOA 5DT9A 4MH0R 3NW9A 1E60A 1NWCA 4OQZA 4M1KA 2WD9A 1OB2A 3GT7A 3GGSA 2WJAA 4ZYLA 4HN4B 5JD6A 3VA7A 1P7VA 4KNYA 4PN3A 1AKEA 2V7PA 3RVMA 3JWHA 3VC3A 3BMCB 4XD7D 2BZSA 3ISVA 2ZPAA 3CZ5A 1N3BA 1GTRA 4HFRA 1FRQA 3DOUA