3R43A

Akr1c3 complexed with mefenamic acid
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
316
structure length
310
Chain Sequence
b'QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Homo sapiens
publication title Crystal structures of three classes of non-steroidal anti-inflammatory drugs in complex with aldo-keto reductase 1C3.
pubmed doi rcsb
total genus 117
structure length 310
sequence length 316
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2011-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3r43A00
3UZZA 4XAPA 2ALRA 4QX4A 2NVDA 5LIYX 2IKHA 5LIXX 3DN5A 1C9WA 3M64A 4R9OA 2J8TA 3UWEA 1ZGDA 2IQ0A 3N2TA 2INZA 2R9RA 3UG8A 1PZ1A 1YE6A 3UGRA 3VXGA 4JQ4A 2PEVA 4EXAA 3RX4A 2PDLA 4OTKA 2FZ9A 3GHRA 3LBOA 5LIWX 1AH0A 3R43A 1HQTA 4QR6A 2PDMA 2PDJA 4FAMA 4PUUA 2IKGA 2INEA 3F7JA 4XO6A 4LBRA 5LIUX 5AZ0A 2FGBA 3CAQA 4DBWA 4F40A 2AGTA 3R8HA 4YU1A 2F38A 4JTRA 4QXIA 2PDIA 1X97A 5JH1A 3CV7A 3T42A 4XVEA 3LZ5A 5HA7A 4DBUA 4JQ2A 1Z89A 4MHBA 1X98A 4LAZA 4WDUA 3UP8A 2PDGA 2PDWA 4GCAA 4WRHA 4JQ1A 3G1RA 4GIEA 5HNUA 3UZWA 1EXBA 2BP1A 3LD5A 1S2AA 2IPJA 4RPQA 2WZTA 2ACUA 1S2CA 2HV5A 4ZFCA 2P5NA 3O0KA 4AUBA 3LQGA 1R38A 4ASTA 3BUVA 1EL3A 1ZUAX 3H7UA 4HMNA 4WDTA 4YS1A 4XZIA 1Q13A 3M4HA 2BGQA 3UYIA 4GA8A 3R94A 1S1RA 2CLPA 3V36A 3R8GA 3LEPA 3FJNA 4L1WA 3MC5A 4IJCA 4DBSA 1EKOA 1Z3NA 4XVDA 3WG6A 4GACA 2PDQA 2PDHA 4PUWA 2IPFA 2IPWA 3GHUA 1M9HA 1XJBA 1T41A 2PDPA 1Z9AA 1YE4A 1AZ1A 2FZ8A 3H4GA 4Q7BA 1A80A 4WEVX 2HDJA 3R7MA 1VP5A 2NVCA 3R58A 4L1XA 4QBXA 3BURA 5LIKX 3C3UA 3EAUA 2FZDA 5AZ1A 1OG6A 2IS7A 4WDWA 4H7CA 1SM9A 3P2VA 4HBKA 3LNMA 3GHSA 3V0SA 4YVPA 4XZHA 1LQAA 3V0TA 2ACRA 4GQ0A 2IQDA 4PR4A 1ZSXA 4I5XA 4JQAA 5HNTA 1J96A 4YVXA 4LBSA 2HEJA 1IHIA 1PWMA 4JIRA 4XZLX 2PDKA 2IPGA 3LUTA 4JIHA 2PDXA 4GQGA 3LENA 1MZRA 1QRQA 4JTAA 2R24A 2HE8A 1Q5MA 4FALA 1Z8AA 2I16A 4FA3A 3Q67A 3EB3A 1ZQ5A 1K8CA 1QWKA 1HW6A 1T40A 2DUZA 3WCZA 1YNQA 3V0UA 4LAUA 1US0A 4JTCA 1AH3A 2ACSA 4IGSA 3ERPA 3BV7A 2PD5A 4PRTA 1S1PA 3CMFA 2I17A 3LQLA 2WZMA 1PWLA 4XZNX 4JIIX 5KETA 2PDUA 1VBJA 3DOPA 4XO7A 3ONCA 1JEZA 4WGHA 4JQ3A 2DV0A 3U2CA 3RX2A 2QXWA 4FZIA 1RY0A 2PDCA 4EXBA 4WDXA 2ACQA 3WBWA 2IKIA 2PDFA 3S3GA 4DZ5A 2PD9A 4PMJA 1YNPA 3ONBA 4IJRA 3G5EA 3EB4A 2PFHA 3BCJA 1XGDA 4G5DA 2FZBA 4XK2A 1MRQA 4PRRA 2HVOA 2DUXA 1AFSA 4JTQA 4LB4A 3Q65A 3V35A 2PDBA 3GUGA 1LWIA 4H8NA 1MI3A 3D3FA 3GHTA 4XZMX 2HVNA 3COTA 3LN3A 2BGSA 2FVLA 3CAVA 3UZXA 5DANA 3CASA 1GVEA 1ADSA 3M0IA 1PYFA 2HE5A 3QKZA 3N6QA 3MB9A 4ICCX 5C7HA 5JH2A 1RALA 3B3DA 1IEIA 2IKJA 1PZ0A 2PF8A 4Q3MA 3LZ3A 3R6IA 3KRBA 1AZ2A 3FX4A 2F2KA 2A79A 3O3RA 1FRBA 2PZNA 3CV6A 1UR3M 3RX3A 1RY8A 2C91A 3UZYA 4GABA 2PDYA 2VDGA 3UFYA 4YVVA 2ISFA 4NKCA 3WBYA 1AH4A 1X96A 3NTYA 1XF0A 4JTDA 2PDNA 3WBXA 1EF3A 3H7RA 4LB3A 5M2FX
chains in the Genus database with same CATH superfamily
4OBSA 1OBAA 4WOZA 1EJWC 6TIMA 3UPMA 1A5CA 5KZMA 3ZFHA 2C1GA 3DN5A 2PC4A 2YSWA 1QOQA 1CB2A 2VURA 3M07A 4UZUA 3ALGA 3E5PA 3WLSA 3FA3A 3UXKA 1CIUA 2JK2A 1WOAA 3KBNA 1R5YA 1TA3A 2QULA 7ENLA 2O7QA 1SFJA 4E8GA 5HQLA 4HOWA 3E2RA 4CQ8A 3EDDA 3C2FA 3KBMA 2EJ1A 3QLDA 3NM1A 3DH7A 4BJHA 4UCFA 3AZRA 3PZOA 4V33A 2OZ3A 3QN3A 2C6QA 2XZ7A 4CLMA 4IP7A 4CVWA 2RGMA 3DFSA 1HQTA 3EGJA 4Q4SA 2PAJA 1SFLA 2Y8KA 4GXWA 1NF7A 4XUGA 4M29A 4FAMA 3L4ZA 1I0DA 2OSWA 2Z25A 3JVAA 1S39A 4GZEA 5LIUX 5FKYA 3H8AA 1NQ6A 3BMXA 2VTFA 5IOBA 2XM1A 1HF6A 1GOWA 3GM8A 3S1UA 1RQEA 3G3DA 3V1PA 4UR9A 3WLRA 1E5NA 3PB0A 1AK5A 2G97A 4BF7A 4YXGA 4XIMA 4DBUA 4Y90A 4LH8A 5FD0A 4B15A 3MP5A 4JYEA 4CQ9A 1UWAA 1EO7A 4YCPA 4N9CA 1JQXA 1A5LC 4XQ6A 2Y5SA 3ATYA 3LD5A 1UD4A 3VKKA 4RPQA 3FHQA 2DZBA 3W27A 1TPWA 3MKCA 1ZFJA 3QQ0A 1BGAA 1V6TA 2HXTA 2OKTA 2VCBA 3IIXA 4B3KA 4KFNA 1ITQA 2WPGA 1W1TA 3W2MA 5FF2A 4HP5A 4IMDA 3MHGA 4IZGA 3BLDA 1WX0A 2NXGA 4N7QA 1L2QA 3P74A 1YPFA 4XVDA 3IVUA 3B8UA 1CDGA 1X39A 1K8XA 4WK9A 5HXMA 1H0GA 3UA3A 5M1TA 3WL1A 3QGAC 1REQA 5HANA 1T0OA 4NYUA 4N9EA 4HK5A 4ZQCA 3KOWA 2PZ0A 1JYNA 1XR2A 5I3FA 2VRKA 1OGBA 3BAYA 4M56A 3LV5A 3WNLA 1W2PA 4Q33A 4ALDA 4M80A 2D23A 2VOTA 3DGRA 3C3UA 4C1LA 3HGOA 3EAUA 2FZDA 1VQTA 4IFKB 4NU7A 4W9TA 2V0TA 3UG4A 2WMIB 3EKLA 3K46A 1DWFM 5HWNA 1S5NA 4W88A 3LLXA 5FEXA 4N2YA 3LNMA 4XKYA 5CJMA 1H7PA 4H2CA 4LV4A 1XCFA 4GZ7A 1EO5A 1E4LA 4UR7A 1GVIA 4YHEA 1F5ZA 1Q45A 3CIXA 5CQ1A 3S83A 5IHRA 3QMTA 3CLMA 2I5QA 1V3KA 3WQOA 4XZLX 4V27A 4LFYA 2Y88A 3RLHA 2BMBA 2YL5A 1IT0A 3WDRA 1WKEA 3EA3A 4V1XA 3ZR6A 4GC4A 2A4AA 4GNJA 4WJ8A 3APYA 2BB0A 3P67A 4ZQPA 1EHNA 3WLIA 3EB3A 1IZKA 5K4XA 5K4ZA 3KBJA 1X6NA 2VX5A 3VILA 2WM1A 1TA3B 3T0TA 3H2FA 4LVBA 3KZSA 3PPFA 3O1NA 2I56A 2I17A 3NQ6A 4JTKA 3TOYA 5DMMA 1UHVA 1PWLA 4PMVA 1IIGA 2OPJA 4H19A 1K70A 4DWDA 2W92A 1XRFA 3CUHA 2V2HA 3GXFA 2E0PA 1XP3A 4Y9NA 1TV7A 3P84A 4K8GA 1QI4A 4I90A 4WIWA 1A5OC 3L2MA 2A3AA 4M6VA 4IJRA 3EB4A 4KRZA 3RU8X 1M53A 4X9SA 1E1CB 3BG5A 2A7PA 4ZOEA 3UXIA 2Z4GA 2G4JA 4Z0SA 2VQTA 2ZRUA 2J7HA 3NQEA 1V6XA 1J12A 1MDLA 4FNUA 5C55A 2WK2A 3TKFA 4ZA0A 2PGWA 2ZUVA 4UTFA 2HVNA 2PGRA 2C0AA 3BJSA 1BQGA 4F66A 1TX2A 1YTKA 2VGGA 5HULA 1ADSA 4J5NA 3PZQA 1PYFA 3RITA 1MEWA 4AB4A 5LHEA 3UWUA 3LGEA 2QAFA 1QUMA 1D7KA 2OSXA 4XBKA 3MB9A 4J3WA 5M5DA 2ZX8A 3QBUA 4UUIA 3I7QA 1P1MA 4W86A 4BI7A 3ANVA 1PZ0A 4I7UA 1XHGA 1NP2A 5C5YA 2KAUC 1H60A 3W1MA 2A79A 4KWVA 2TSYA 1GW1A 4DJEC 1UR3M 5LNWA 1XG4A 3TYZA 4RNJA 4IFRA 3QR0A 1A5MC 1Z69A 3P60A 3WUGA 5TQLA 3LHUA 4YTRA 4JTGA 3W71A 1WBJA 4GK8A 1HL9A 3THDA 2V2DA 1G4TA 4MB3A 1RK5A 3KWSA 3NQ8A 3KS5A 4W8AA 4XAPA 4GYPC 5C2GA 5EA9A 3L5LA 3N2MA 5FJRA 4DUXA 2JEPA 1UJQA 3C8FA 3F4NA 3GG1A 8XIAA 1Z42A 5DN1A 3GXNA 4O12A 3GE7A 1DTNA 2HTMA 3FGCB 4FK9A 3TA9A 2W5FA 3TYBA 3W75A 3SADA 4F0SA 4BI5A 4A8NA 1TWDA 4LTSA 3VAVA 3RF9A 3W7MA 2CLHA 2I9EA 1XYBA 3THQA 4AD3A 4MPKA 3HPZA 1GYMA 2V3DA 1Q6RA 2VEFA 1R87A 3NQVA 4U4MA 3VTRA 3P5ZA 1RPXA 1TJ1A 2IKGA 1JL8A 1CLKA 4DBWA 2XJ7A 4DF0A 1ZU8A 4QG6A 3FNDA 1WDRA 5U7SA 5EU9A 1F4HA 3B40A 4D8AA 3KS6A 3AIVA 4QXIA 1K7XA 1X97A 1QT1A 4C5ZA 3HG5A 4FNSA 1W17A 4IGMA 2HK0A 3KW3A 2J47A 4DXXA 3T2OA 3TOPA 2XSBA 2OKOA 1RD5A 5I3IA 2VR4A 4Z2KA 4PBGA 1F7BA 3W7GA 1CXIA 3AUJA 3W7LA 5D2WA 3VMPA 2YA2A 2ACUA 4O57A 2J79A 1NWRA 3N6HA 4J3VA 1LRTA 1GVFA 3ZYZA 4MIMA 1GOIA 3GAYA 5CPSA 3I4EA 1QNOA 2VWTA 1KM5A 2FTYA 1Q13A 3PUOA 1HO1A 3M5ZA 3VZXA 3CT7A 4IPLA 1HJWA 4C6CA 4NZ3A 3WBEA 2WMFA 4I6KA 2F61A 5M3WA 1S46A 2ZXAA 5KZEA 3H55A 4MNMA 1PX8A 4OOZA 4U2ZA 3TEVA 3GHUA 4IMCA 1ZBVA 3WD1A 3N2CA 4ECLA 4RZ5A 4ZOBA 2BG5A 1SQ7A 3CHFA 3QH2A 4L5ZA 4Q7NA 1HL8A 3N12A 1GPFA 4QIUA 1HKIA 1KQYA 1XISA 3SRFA 2PTXA 2V5CA 3CV2A 3MP3A 3U2OA 2DP3A 3TN6A 1DJXA 1QFEA 1F3TA 1OABA 3GNOA 3PC0A 4JEJA 4AZBA 2W63A 1YRRA 1LTDA 3W07A 1CLXA 1EBGA 5CZSA 3ARPA 3VD7A 4QJ5B 4K1GA 1HNYA 1H63A 4MUZA 1SMAA 3ZT6A 4TVUA 3BZGA 3O6DA 1GKQA 2ACRA 4DX3A 3TYEA 1YKWA 3WIJA 3IRDA 4XSLA 1J0YA 4DN1A 3B0PA 4KETA 4M19A 4HNOA 3WBAA 3D5HA 4WKAA 2ZC1A 4HT3A 5A8QA 2V2CA 1Q6CA 4JTAA 4D6HA 3MP4A 3JR2A 1DWJM 4F2BA 3VUSA 4E2BA 1B3OA 4RJEA 2UY5A 4L4PA 1D3HA 1XLEA 2OQHA 2H6RA 1OYAA 1FKWA 4BHYA 2UY2A 1IEVA 3W73A 4EXQA 1H1NA 5DBUA 4PA8A 2A3EA 3NO3A 3AHYA 1UROA 1R2RA 1JDDA 1QBAA 3FSUA 3HGJA 3PY2A 4V2XA 1DHKA 4RV8A 1SR9A 2XGIA 4WCJA 2Z0IA 3RUBL 2Z2UA 1GGOA 4XG1A 3WK1A 4HU8A 3KCLA 3M46A 4JEQA 3GDTA 3P0WA 4U5IA 1I60A 2A1YA 3UZJA 2DW6A 3O16A 4GC3A 1W56A 3DZ1A 4GYFA 2OCZA 1AW1A 3RLGA 4H9UA 2GK1B 1H49A 3L68A 5BMXA 1L9WA 3TR9A 4DYKA 3ARSA 5DMLA 2GVGA 1GPWA 3OP2A 1Q66A 4KIEA 5EY5A 2OMAA 3W7HA 1C9DA 2HPIA 3CO4A 3GK0A 3SZ8A 1N82A 4DNHA 4UTKA 1AFSA 4FIRA 3O07A 3R4IA 4GH1A 4D6DA 4MJ4A 3ZOAA 4IFKA 1H7XA 2WSPA 2P50A 1JYVA 3OQEA 4M0XA 2HQAA 3TAOA 1XGZA 2BVTA 1RCXB 4MYAA 2XVLA 3L4TA 1IEWA 4AHPA 1PE1A 1R3VA 2H3DA 2J62A 4HMEA 3HM7A 5LA0A 1E40A 3U2EA 1AA1B 1W5MA 2Z24A 3ZR5A 2WZEA 4PMYA 1S3TC 1V6YA 1W5OA 2WMKA 1X1ZA 3PB2A 1LLZA 3O6AA 4Q3MA 1DWGM 1T99A 3ZIZA 1AZ2A 3WN6A 1PTGA 3N6JA 2PMQA 3GB6A 3AMCA 3A4WA 1UUMA 3FA4A 4D8LA 2JGQA 3LXAA 2JBMA 2CHOA 1K9EA 1V3MA 2VEIA 1BTCA 1CGVA 1I45A 1KFEA 2QAPA 2PDYA 3PNZA 2A6NA 4O52A 2MUCA 2CEQA 4IOTA 4JX5A 2OJPA 3DFTA 4DIAA 5C71A 2NLIA 1BG9A 2PF0A 3P80A 3RFAA 4J4KA 3H7RA 3HG3A 3S2CA 1E6RA 3TCEA 2DZUA 1JRBA 5E9AA 3IACA 1W5NA 3NM3A 4C1KA 3BSHA 1WE5A 1UG6A 3GZAA 2QYGA 3W2NA 3FEMA 2Q6ZA 5FJUA 4K1WA 1UH2A 3NDYA 4XISA 2OEMA 1PZ1A 3W01A 4UCGA 4QITA 3JS3A 2I1OA 4HZ6A 2XH2A 2W66A 2XWEA 3C56A 3A5VA 1FXPA 1P0EA 1AD4A 1KCZA 3BMVA 3BLEA 1BYAA 1LWJA 2XFYA 3NIYA 4O4VA 3CHVA 3CUXA 3WLKX 2FZMA 1NDYA 5H8MA 3RHGA 2P10A 3B9OA 4BF5A 4D6GA 1BWLA 4B5SA 1E6ZA 2D3LA 4EAYA 4XO6A 4LBRA 1TQXA 4WF7A 4XAGA 2P8BA 5FF3A 1H11A 1YPXA 2YCIX 3VNYA 1DWHM 4U10A 1J2WA 5J04A 1SO5A 4L1GA 4UNKA 1LUCB 2PDIA 4A8RA 3WK3A 4JX6A 4NJHA 1J5SA 2QMJA 4J2MA 4H9TA 5JU6A 4MHBA 1KTNA 3ZO9A 3B4YA 1FVPA 3VIHA 3WH8A 2VR5A 1MSSA 1C7TA 4F2TA 2G41A 1EDQA 3KM8A 3VKBA 3LCFA 1XIBA 1V77A 2BP1A 4P61A 1S2TA 1ZS2A 3VNKA 4XTDA 1WDDA 1E6PA 3VUPA 1QJWA 1DBTA 4HNTA 3FN9A 3N3TA 1LCOA 4DNMA 2GQAA 4A8LA 2F6UA 3OBAA 1XBYA 1LQ2A 9XIAA 1GJPA 4H9XA 3SSJA 2XIJA 2DSVA 4RZBA 3HV9A 3N15A 5E0CA 3VDGA 5U4NA 4F9JA 3P6LA 3BOFA 2YFNA 4MLJA 3B06A 1RBAA 1XIEA 3GR7A 4Q8MA 3LXCA 4JFSA 4DBSA 2VZOA 3Q45A 2ZUTA 2DZTA 3I10A 4BA0A 8XIMA 4M82A 4PUWA 3DUGA 3DG7A 3V3WA 4JL1A 4FMVA 4MWAA 1H7OA 5I00A 1XCXA 4Z0JA 2O9RA 2Y70A 3T08A 3VNDA 4PULA 3T8LA 1HL2A 1TIMA 3DHUA 1VP5A 4GFSA 1PB0A 4L1XA 3T4WA 1K4GA 2NZLA 4E5TA 5HUOA 1BQCA 3AU2A 2QJGA 4HOZA 2VQUA 3VGEA 1XLBA 1XC6A 1N7KA 1V8EA 1ENUA 4L9YA 4WQ6A 5HBFA 1VIZA 1HJUA 3W2KA 1XX1A 5IBXC 5CZJA 3TSBA 1GOXA 5BCAA 1UH3A 1ZP3A 3G24A 2ESCA 1LWHA 1JPMA 3M47A 3SUVA 2G37A 1FOBA 1J6PA 4JFVA 1H5VA 1ZALA 4QS5A 2GUBA 3W87A 3B0VC 3BMWA 4LGXA 1SUXA 2D2HA 3O9NA 4E4PA 4LBSA 1IGSA 3BG3A 4GX9A 2RGLA 4O8RA 2H3BA 4PTDA 1GVSA 1SFTA 4JCMA 4DB7A 3GIQA 1HP4A 4CNNA 1QRQA 3BGAA 1QO5A 2Q8ZA 3WJYA 4E8CA 3V18A 4LW7A 1LL7A 3FSTA 5IFTA 2OXNA 3CQHA 1W3JA 3TFCA 4FLSA 3NSMA 4O1FA 4DJFA 3CUFA 4ADTA 3TAKA 1AH3A 2Z00A 2J27A 2J6XA 1W37A 2PTWA 1AVAA 4IGSA 4B3LA 1NFGA 4IIEA 2QDDA 2WWDA 3ZSTA 3C2EA 3QRHA 3BW2A 3CMFA 3QR3A 4GIAA 4G8TA 3VOCA 4DO7A 3CZGA 1SSDA 3PP7A 3EXTA 1UC4A 4XX6A 4XO7A 2ADAA 3FIGA 5BOFA 1QW8A 3DBPA 1YXDA 1L0PA 1W1YA 3Q4DA 2DPEA 2P0IA 3C5QA 1NWUA 2VC7A 4ZL1A 1DJIA 2YCKX 3PPGA 3N2BA 3WQ4A 1XFBA 4HGXA 1ZP4A 4H04A 3BARA 4GKLA 4CNOA 3BCFA 1QOPA 4B4HA 1DJZA 5G4EA 2VNCA 3MPGA 1OYBA 2GGGA 1BWVA 1FDJA 1XQLA 3GX9A 3R25A 3LPFA 5EMYA 1XD1A 2FZNA 4WY0A 2JF7A 1LBFA 1A47A 3GRIA 3NEVA 1RPKA 5F7UA 3GHTA 4NJIA 3NL2A 1VYSX 1CX9A 3ZZ1A 2GGJA 3W7DA 4PUNA 3LN3A 4BEUA 1L2UA 3L4XA 2DZAA 3VIIA 1A0CA 4H01A 1LG1A 3AMLA 5DY2A 4UFIA 2WMJA 4QSFA 5E09A 4ZENA 4H83A 3M41A 5C70A 1FWWA 3T4CA 1RALA 2ABAA 2GQ3A 2OQYA 3HGSA 4GUHA 3BSGA 2PF8A 5A3HA 5A94A 3A24A 3QMRA 1WDPA 2ZICA 2HROA 2ZTJA 1J0IA 1TPVA 3EB2A 2Y63A 3IEBA 1TJRA 4GPNA 2GUUA 2V63A 1X7FA 5ABGA 4NKCA 3K4AA 1ICQA 2GPTA 1EZWA 7REQB 2E09A 2P8CA 1BXCA 3HBLA 4UTIA 5D2YA 3ZMRA 1XBXA 3E2QA 2ZIDA 1W9DM 1UKTA 3M1ZA 2B7PA 4LB3A 1XRVA 2NV1A 1EC7A 1UKOA 3O0FA 3CV1A 2XIOA 4GO9A 1GONA 2ZA3A 4PTMA 4NZ1A 2NW0A 2YXXA 4I8DA 4LC8A 4RZ4A 4C7DA 1E0TA 4MVAA 3KFTA 5AC5A 1HJXA 3W38A 5CPTA 3T78A 5CLWA 3AXHA 2PP3A 5D9OA 1VRXA 3S42A 4PUEA 3NO1A 4JQ4A 4AXKA 4MLRA 3C0QA 1EJ7L 2E25A 3ABSA 2OLHA 2G95A 5IDIA 4OTKA 1KCLA 1ODZA 3WDJA 2HNEA 2BHZA 5LIWX 1NARA 2NWRA 4GLEA 2V81A 4ZE4A 3NDOA 4LS0A 3LRKA 1R2SA 5HATA 3S2LA 4PUUA 2HISA 1RJPA 3MMTA 4BQ4A 4ACZB 2FGBA 3WEMA 3V5OA 1OYCA 1JDAA 3UGVA 3WF3A 4WD0A 4NIRA 4IISA 3VNLA 3AHZA 2F38A 5KINA 2REQB 4H6KA 4GUJA 3B0UX 1AODA 4W85A 1JCTA 1KM1A 3AROA 5A2CA 4JQ2A 3APTA 2PCEA 3A22A 4LAZA 1L6YA 1POJA 4WDUA 3U57A 4FNRA 3N14A 2Y8VA 4CQCA 2XN1A 2RDWA 2JF6A 3QFWA 3ZJ8A 4E2VA 2NLYA 2PBOA 2RDTA 1XLJA 1LYXA 2OYKA 3M0LA 1OCBA 2QPUA 4BR1A 2ZWYA 1M6JA 1JF6A 4TVDA 4AUBA 2YKKA 1U1UA 3NPVA 4YWSA 6CGTA 3GU9A 2G3IA 1EXPA 2YA1A 3H4XA 4WDTA 4C6LA 3QJAA 3SURA 4RDWA 1FWGC 4ICNA 3IIPA 5LYRA 7A3HA 1ME9A 3DI0A 1QTWA 5FSEC 3ARVA 1ZPTA 2EG8A 4W7VA 1MW1A 3H2AA 1OCNA 4XD6A 4YWIA 1JF5A 4GG9A 1KWKA 2EPOA 3HFTA 1AG1O 1P5BA 3TWBA 2FGZA 4NILA 1ODUA 1R3YA 2NSOA 1CGTA 3OHMB 5KITA 4IP5A 4G7EB 1XSIA 3ATZA 3SEPA 4ZB0A 3SFKA 3O06A 3S5YA 3KOYA 4Q7IA 3ORWA 5E0KA 5AC6A 1NH6A 2PDPA 2VFDA 1Q2SA 3FLUA 1YE4A 4GY7A 4PSRA 3GU1A 3NL5A 1PIGA 1WZLA 1BRLB 1A80A 1BKHA 2WW5A 1MXGA 1QPKA 5I79A 1WXZA 4AH7A 5GJMA 2YCJA 1CXKA 2HNHA 5F4XA 5BRQA 1TPDA 4FLOA 3EOUA 1R85A 3RR1A 3PWIA 4C6BA 4HMCA 2W27A 1KLZA 2DT3A 1U22A 1U5VA 3MWCA 5D03A 1OFBA 1WAWA 3DDMA 2MNRA 1WPCA 3PF3A 1Q6FA 1Q6OA 4UMBA 3VNMA 3A5FA 5A8GA 1OF8A 1NSJA 4CQDA 1JXKA 4BWLC 3HPAA 4QNEA 2DU2A 4AZCB 4C6EA 1IHIA 1R9ZA 3IJDA 3H2EA 4ERAA 2GUYA 1UKPA 2AMGA 2A7RA 3CO8A 3M44A 2HRWA 1TVPA 1XIGA 4C1NB 4IGNA 3Q94A 4PB3A 4MSSA 3MBDA 3MSYA 1O5QA 2I9UA 2WVUA 3FCPA 3TWAA 1PCKA 2GOUA 3GXIA 1F61A 1K8CA 1QWKA 3DU0A 3STPA 3GG7A 5AC8A 2PB1A 4O0ZA 1UP0A 2CHRA 4P7LA 1FBAA 3V0UA 3GIPA 1QO2A 5HOSA 3ZSSA 3VKJA 3AYSA 4P8VA 3W0KA 1ICPA 3CZEA 5CPLA 1CZ1A 2J7BA 3SQMA 4X2PA 3QZAA 2Q3RA 3CUJA 3O05A 3ITOA 4BEQA 4CD4A 1ISWA 5BU9A 3H26A 3BG9A 3C4UA 3M5YA 3W37A 1R3WA 3AMDA 1K9TA 1IEQA 3LXBA 1EX5A 2E1DA 1VBRA 2CXGA 1JCXA 3FXGA 5CGTA 5A6TC 2EG6A 3LMZA 5REQA 4B5VA 3W9ZA 4C1NA 2WKLA 1EEPA 2FFIA 4NAEB 3S3GA 2PD9A 1EQCA 4LUSA 1BRLA 4S3KA 1XL9A 4IX2A 4IL2A 4DPPA 1W3NA 2WNZA 3SRHA 2V6AA 2D0GA 1KB3A 1VFSA 1XIFA 5A8MA 1UIOA 3MMDA 3PBGA 3D3FA 3YPIA 1DEDA 2YDRA 4UR8A 1IV8A 2C7FA 1OF6A 2XVGA 4JTTA 1NOFA 4YCOA 3CAVA 3CTTA 1YPIA 1B4EA 1CTNA 4FB7A 3C2RA 4IMGA 1F2JA 2EXOA 4XIAA 3QKZA 1IXPA 1TVLA 2VI0A 3HB9A 1BVWA 1O5RA 1E6NA 3CQJA 5JH2A 2GK1A 2YGYA 4JYFA 4MY8A 3L2IA 4DUWA 4HU3A 4GQQA 3WLOA 4CKQA 3UF9A 1QOXA 3F5JA 1FXQA 2BVYA 4RR4A 4TVCA 3FAWA 1QHPA 4NY2A 4GBUA 2VEMA 2ZZ1A 1O95A 3B9EA 3BSMA 5CG7A 1M3UA 4LYRA 2WHJA 4KEMA 3U6WA 1ZTVA 4Z2JA 1PL9A 2DQWA 2G8ZA 4HMDA 3APGA 3GC2A 2BHYA 2E3ZA 2ATMA 1TTPA 3DG6A 2PDNA 3NURA 5BWAA 3IJ6A 4PL1A 3GH5A 3WNPA 3NGFA 5LNUA 4H2HA 4R34A 4S23A 2PWEA 2YJQA 1A4MA 4FNPA 1HVXA 4CU7A 1ZY9A 4GZIA 2ZBTA 1GT8A 1ZGDA 2IQ0A 3KBWA 3GDRA 3AZTA 2X1IA 2R9RA 1GORA 3CZJA 4GH3A 2XVPA 5DT5A 4ORIA 3RRXA 5A6AA 2YW3A 4KESA 4RL3A 2HPMA 1G7UA 1TR9A 1ZRQA 3THCA 1ALDA 4REQA 3STCA 1K1DA 3UWVA 4ZFMA 1JCNA 2E4TA 3UG5A 3LCWA 4O1CA 3GUWA 1Z48A 3AXKA 1QPQA 2OOFA 3GW0A 3HJEA 2QIIA 1GJWA 1SO6A 4GHRA 4N9DA 4W5UA 1WQ5A 4QQ3A 1VIWA 2YDQA 5REQB 4Y9MA 2OG9A 1IF2A 1D3CA 1UPPA 3IIZA 4I9AA 4O1DA 4LUSB 3G1YA 2POZA 2DSWA 1B3WA 5D8WA 3VPLA 3WQVA 2GSJA 2PU0A 2F6KA 4JS3A 3E38A 1GWJA 4O4WA 2OGYA 3EX1A 4LS1A 3UXLA 3GWQA 2E68A 4AY7A 1TPUA 1TE1A 3PUEA 5A8PA 2PDGA 4FXFA 4C6IA 1XC4A 5AECA 2XZ9A 1GYLA 1UA7A 4UTJA 1UD3A 1EXBA 2HSAA 1G9HA 3WEOA 1XLLA 3TJLA 1RBOB 1MQRA 2P5NA 2Y62A 2ZX5A 4B5WA 4ZQOA 1IWPA 2Y24A 4RUBA 4ZBCA 1VENA 3SFWA 3EPNA 1CXFA 4MWAE 3PZIA 4V15A 3ARYA 4S2CA 5HJXA 1JAEA 2D24A 1UYQA 1G1YA 1YDOA 3NQFA 5GJPA 4Q8QA 4ZOAA 3OZPA 3WUFA 2NQHA 5GNYA 3H24A 3GXTA 1NDWA 1EKOA 1UZ4A 1DWIM 1UD2A 4XKYB 3M16A 4FP1A 2GQ8A 5AHEA 3AZSA 3L65A 3W82A 2PDQA 2WJEA 3VOIA 4C6NA 2I7GA 4DUVA 1W3LA 2VD9A 1JYWA 2GDQA 2Y8UA 4EPDC 1M01A 3K4WA 5BXSA 1AZ1A 5GVJA 4N4QA 5HR7A 1ML1A 1KR0A 3R7MA 2O56A 1DJHA 3R0UA 3BURA 3CU2A 3AS2A 4RW3A 4I7WA 4O28A 3FYYA 4C7FA 1J0JA 1OGSA 1UR1A 2Z1WA 3UWQA 3UEQA 5ENLA 5JMUA 3SUWA 4IPNB 3CK5A 1S2VA 4H7CA 3F03K 3TSDA 5AB3A 3I6TA 3QGKC 3KRUA 3NQCA 1BTMA 2YCLA 3TA6A 4AD0A 2D2OA 4MGGA 3KVJA 1I2RA 4NAFB 1DL3A 4DO5A 3C2OA 3R2GA 3V0TA 5CPQA 2V69A 3WKZA 3DHPA 4MZ8A 4MUPA 3R0KA 1YEYA 3WY1A 4NSBA 4ZO8A 1A0DA 3TDFA 2NQJA 3WDPP 3W7KA 4TTGA 2ZZ7A 3H12A 3AJXA 2V5KA 2VEPA 2ZZ3A 3T0DA 3ABXA 1FKXA 4XD4A 4H7ZA 2R24A 4U3AA 4IPPA 2I14A 1Q6EA 4R85A 3SGUA 5AHLA 1MUMA 2G4FA 5TD4A 2Y5EA 2OWXA 4D1JA 1PJ9A 1D7FA 3KWXA 2D2GA 3AS1A 3BDKA 4E2DA 2V82A 5C9UA 4AVOA 3A9BA 2X8RA 1X8FA 3W86A 2G3MA 2AGKA 1V51A 1A4LA 3ARZA 3R89A 3VZZA 3AIEA 2Y7FA 1LOLA 3GVWA 5DEZA 3V75A 2PRHA 4HU4A 3LQLA 1KM3A 2QDGA 4YTUA 5FEPA 4KT2A 4GI4A 3UJ2A 1IT7A 1TFVA 1FA2A 1VKFA 2EPMX 3LRMA 1CECA 1RVGA 1DE5A 3W1UA 4QLJA 3NOYA 3LYEA 4A3UA 3WH6A 3P7YA 2ODOA 3U2CA 2TAAA 4RE3A 1TPB1 1TUXA 4K7VA 2V3FA 4IL0A 1A5NC 1VCVA 1VC4A 2HZGA 2NX9A 3UT0A 3POHA 1YNPA 5DFAA 1QXLA 2QCGA 3TX9A 3BCJA 2FZBA 4AISA 1EP1A 4HK7A 2Q8LA 4XWUA 3N2OA 3NNTA 4UQCA 3I65A 2ZVRA 3QY8A 1TKKA 1TMLA 2V5DA 4ZB2A 1KA9F 1O7AA 3TMQA 5EBAA 4P7QA 3E0WA 1KRAC 4AY1A 4YN5A 4J3ZA 3QTPA 1KQZA 4PMDA 1J5TA 2VRJA 2XTKA 3TH6A 2FHBA 4CNUA 3ID7A 4R53A 4QM1A 5F1UA 1TPC1 2X1SA 3VGHA 3GY1A 1FWAC 3MZ2A 5K9XA 3FKRA 1IEIA 4LVDA 3U7BA 3P14A 3NR0A 1TTJA 2Y7DA 3PTKA 2NXHA 4D1IA 3AS3A 5I5RA 5CZ0A 2CHNA 3B9DA 3ZVIA 1ELSA 1RY8A 5KZ6A 1SR0A 4GX8A 1TPFA 4DWSD 3N73A 4JOMA 1E9ZB 4BQ5A 2EG7A 1TELA 4L6DA 1A50A 5HMSA 3ECQA 4JTDA 3E74A 1MO0A 1E0UA 1OC5A 1GK8A 1SSGA 9XIMA 1I2PA 1NF0A 2VGFA 4KGJA 1UWUA 4IM4A 1F05A 3UY7A 1I2OA 2J8TA 3T09A 2BX7A 3QFEA 3EMCA 3TC3A 2ATSA 3QV7A 4LALA 3EMQA 1DQUA 3PG9A 4FPSA 4B91A 5CLTA 3F4WA 3PJUA 1Q3NA 2BBFA 2OTDA 4FX6M 2GGEA 3VD4A 1BF6A 2PCQA 3UBPC 1PPIA 1H61A 3GQYA 3UY8A 5I77A 3LB0A 3LTPA 1YX1A 4UTWA 2GSHA 3N11A 3U0HA 1WKYA 3KTXA 2DORA 2AKMA 1J93A 1UZ1A 2AGTA 3RM4A 4F40A 3PSVA 2XGZA 1DQWA 4QDMA 4H8UA 3KL5A 5LXEA 4DM2A 3C2YA 2QMKA 3A3WA 3G77A 2NUWA 1XV8A 2VR2A 3FAXA 3LG3A 1Q8JA 4B5TA 3T0BA 4E2OA 2FYMA 2L5HA 1QNPA 2UWFA 3VIMA 4WRHA 3UWZA 4YNGA 3QC3A 1XPGA 2J25A 4UTMA 3O6YX 1S2CA 3VGBA 3LQGA 4HPHA 1R0MA 1R38A 4ASTA 1HJSA 3PBMA 2XFFA 3E02A 4B9ZA 4IICA 2GWGA 3MWAA 2PU1A 3QM3A 3PPHA 3K8KA 2WMGA 4E6MA 5IHSA 3RM9A 2AL2A 3M4HA 2CU0A 2D0HA 1W2VA 1TV8A 1Y0EA 3EX4A 3GD6A 1NP0A 3EWCA 1H2JA 4PFHA 4G7EA 3PNUA 3VC5A 1FDYA 3KUMA 4B9YA 1X6UA 4AZ6A 1DORA 1Q6LA 3GH7A 2E5DA 3VOJA 3WD0A 2PWVA 4GACA 2OZ0A 1M9HA 5HMDA 1XJBA 3GW3A 4CVUA 5C9XA 2Q71A 1WXYA 5J5RA 4Q22A 2UZ9A 4F0RA 1ZBCA 2V5LA 1TV3A 3NZ1A 1GTHA 4K38A 3N9KA 4O53A 3MY9A 1K8ZA 1B2YA 4O18A 3FW6A 2C19A 2VCCA 4UTTA 5GNZA 4H9ZA 3MSRA 5GJNA 1OG6A 2JALA 1UR8A 1A5AA 4LUJA 2A2IA 3RK8A 3M6DA 2VWSA 4DI9A 1XLHA 1J2BA 1TCMA 1VAHA 5H91A 2PWGA 4UQEA 1JJKA 2DDXA 3BGGA 1KXTA 3U5YA 4O11A 2GVYA 4UFKA 5A5WA 5HNTA 1B1YA 4N0RA 3H23A 2R14A 3A4XA 3FOKA 3K8LA 1Z41A 3GTNA 1Q85A 1VD6A 4GNKB 4GXMA 3Q58A 1EC9A 1I0BA 3CQ0A 2IPGA 4JIHA 1LROA 1WO2A 2PDXA 3H21A 4O50A 4GQGA 1PXGA 1AQHA 2VZTA 1NDZA 2WLZA 3W4RA 3ARRA 2P1FA 3UJSA 2Z26A 1DYSA 2CZVA 3SECA 3L5MA 2BOFX 3VD3A 1ZQ5A 2IXUA 4PCFA 1HW6A 1HJVA 2QUMA 2YYUA 1P1XA 3B4UA 4BQ2A 2QGHA 4HPJA 3MW7A 1CB7B 1S1PA 2E77A 2VM8A 1IGWA 1JZ6A 1M1BA 1VB9A 3ZWTA 3DECA 3E0IA 1XICA 5KETA 1XDJA 2PDUA 2J77A 2MANA 4LCQA 2BXYA 3NSNA 4JN8A 4GY1A 4L6HA 2J6VA 3TONA 4JDYA 3DFNA 4LWWA 1K7EA 2ZXQA 2FPTA 5CH9A 3GKAA 4Y9AA 1LZOA 3GNRA 2QPSA 4YYFA 3UERA 4AIUA 3LK6A 4MZYA 1UW9A 3DYMA 1GQIA 3DFQA 3C86A 3UESA 3WF2A 3FK4A 2W0UA 1CGYA 3EWWA 5FJJA 5JQ9A 1NOUA 1LOSA 1LJYA 2C16A 4I8YA 6REQA 2C14A 2DZXA 4LEQA 4GWEA 3QQWA 2XFWA 1OY0A 4KCVA 3MKKA 2VZUA 3N6QA 1GYNA 1BXNA 2ZDSA 3O63A 2JIWA 5CC3A 1RQHA 5DXYA 3FV9A 1U5JA 3TYUA 3BXWA 3B8IA 1A0EA 1XYAA 3B3DA 4NZFA 1X1NA 1G94A 4S3FA 4PEEA 5CGMA 4C6OA 2WSYA 3BGJA 3GXMA 3FX4A 4IGHA 4EF9A 5HQMA 1OX6A 1L6SA 2WNQA 3PS7A 1VS1A 1BG4A 1DJGA 4DAFA 1YIXA 2ZUMA 2CPUA 3S2JA 3P8JA 2EJAA 1O5KA 2CLOA 4WOQA 5T26A 4JICA 5BYWA 2IQTA 1I2QA 3D46A 3IARA 5T9BG 3BVJA 3VD5A 4TOQA 2ZZ4A 4TIMA 4DVOA 1W3IA 4MOZA 2D69A 4NJKA 4R7OA 3WNMA 4UOZA 3GVGA 2IKHA 5B7ZA 3SUSA 2C79A 1ME7A 3ITCA 1QHZA 4JNMA 1OT1A 3WF0A 3NO5A 1IWBA 4JFTA 2YBVA 3BO9A 5J8LA 3QV8A 4A21A 1TPH1 4QGCA 1TV5A 5H1WA 3V1HA 4NNAA 1UCWA 1V02E 3QW4B 4K8HA 3F2DA 1HTIA 4QR6A 2E1WA 3WEZA 3MHFA 4UIOA 1OG0A 5A2BA 1BVZA 1W1VA 3OJGA 1WDQA 1SZNA 4LQ1A 2Z7KA 1ONEA 2Q8XA 1ZHAA 1RCOB 1GQLA 4F2UA 3WDIA 3W72A 3WK0A 1O60A 3IS4A 3CUIA 3R8HA 2J7DA 1H62A 1BLIA 3HA1A 4IIBA 1UZDA 1O1ZA 3UPBA 3RYSA 1G0CA 4AZIA 3W70A 1WAUA 2VHLA 1V7YA 3TYCA 3LHWA 1UD6A 5JIWA 4ORMA 3WH9A 1Z89A 3TTQA 1X98A 3CQIA 3I3DA 4UOQA 3W74A 4O0QA 3VIPA 3PHAA 1TMHA 3RN6A 3EKZA 3SIZA 1YLVA 1EPXA 1HJQA 4A3YA 3VMOA 4ZO9A 3S1WA 4ZFCA 4RPPA 5JBDA 1ZLPA 3LGDA 5A8OA 1LOQA 3QOKA 2NQ9A 1QNQA 3B9AA 3VDAA 5FCZA 3MHUA 5IBXA 2Z28A 5E9XA 2BGQA 2RFGA 4Z17A 3U2ZA 3G1HA 1HXJA 3WLLA 3MCNA 4GVHA 1EJVC 3T55A 4QDWA 4U33A 1MFUA 3SJNA 4LF1A 4L1WA 3KCOA 2NT1A 3ARUA 2BHUA 3CIVA 3VDHA 3FVDA 1UR9A 3SR7A 1AMYA 1EH9A 4MADA 1RHCA 3GG8A 2WB5A 5JXQA 3CZKA 1F6YA 4LY4A 4WHBA 1K02A 2H9AB 4XAYA 2BY1A 3P61A 1XG3A 4IF2A 1KFKA 4Q7BA 1UOZA 3I7SA 3TCSA 3FA5A 4FOKA 4M3PA 1FTXA 4X0VA 2Y4SA 1DJQA 3W1QA 3EWZA 2PLJA 1OFOA 3GU2A 1W9VA 2GJLA 4S3BA 4KIRA 2GDUA 2DFAA 2ISSA 3T0AA 3W84A 4PMUA 3HPSA 5LHFA 4AFYA 2H8XA 3J7HA 4HIBA 3F5LA 2ZUNA 3WNKA 2QV4A 4MMWA 4GBDA 2Y7EA 4IXXA 3RLVA 1HKVA 4YVXA 4DRSA 3DKLA 1UMYA 4R7WA 4EIVA 1OK4A 3U4FA 3WD4A 2VC6A 4V28A 3RXZA 2CZEA 3VFCA 4IQEA 2PDKA 5GPRA 1QCWA 4EX4A 1GTEA 1X1OA 3PBVA 4Q4RA 4UXDA 1FCBA 3B05A 2C18A 1PDZA 2CERA 4B5NA 1H7WA 4JHMA 4S2BA 4M6UA 1GHRA 4X63A 5ABFA 3MUY1 3IJIA 1UJPA 2X41A 4DWSB 5AOUA 3II1A 4PUKA 3VKDA 3OGVA 4KH2A 4UQAA 4D6JA 3H70A 1AJ2A 3L67A 4HNLA 1C29A 3BCDA 2A3LA 3M0ZA 1FWCC 4ENLA 1EJSC 3PUDA 5EL1A 5FJOA 3QPYA 2E40A 4BI6A 3BQ6A 2WPBA 3HN3A 4ADSA 1MVYA 3AICA 4KGLA 1JDCA 1XDMA 3XISA 5T9CE 6A3HA 2V5BA 1JDFA 1A53A 2CZFA 2Q09A 1VBGA 4E3TA 3UA4A 2AOSA 1V02A 4AEFA 4C6PA 3PZMA 4GY0A 4DZ5A 4PMJA 4S39A 1ZBWA 4J9JA 2POTA 3ITGA 3S9ZA 5I6SA 4AMCA 1E70M 3UW6A 4GCXA 2X7WA 2DUXA 2WSRA 1LWIA 2VENA 3TFXA 2YL6A 3UCCA 3RCMA 4HYWA 2YFOA 4Q4PA 1X38A 3LHVA 4HHPA 3PAJA 3NFUA 3UQNA 4DQWA 2QKFA 3TV8A 4GIRA 5BXRA 2H9AA 4S3JA 5BWFA 1MNSA 2F8QA 3MKVA 3MUXA 2X42A 3WFLA 4RCXA 3NQ2A 4CUCA 5K9DA 4PMNA 4NF7A 5C9ZA 1FHUA 3E2SA 4AQLA 7XIMA 3RDKA 5EKYA 1M41A 1I1XA 2VVSA 5KZDA 4H9VA 2CESA 3W1XA 4WUIA 1JUKA 2PC8A 4AW7A 5DXXA 2AKZA 1UQYA 4QEEA 4XBJA 4PMXA 3F2CA 2C91A 1RK6A 2A21A 4PH6A 1V4YA 2X30A 4EVZA 1W3KA 4YVVA 5IRPA 1ITUA 1AH4A 4D6IA 5HR6A 3WDQA 2RUSA 4WVXA 2ZZ5A 3KRSA 5A2AA 4QS6A 4U2YA 4AC1X 4ZGYA 4PUMA 1XGEA 3FEQA 4CNPA 2ALRA 1MEIA 4AIOA 3ZT7A 1C9WA 3TYDA 3HZ3A 3WENA 3OA5A 4F0KA 2OOGA 2VGBA 4L7ZA 1F76A 4GMEA 3T8QA 2G96A 2EAWA 1EX1A 2YXOA 2RAGA 3ITVA 3M0HA 4EXAA 1JPDX 1ISZA 1J4EA 5C2XA 3W7CA 2WAGA 4QAWA 2PLMA 3ZXWA 4MJMA 3WYZA 3N25A 4G9PA 5LA1A 2CZ5A 3LBOA 4AIBA 2W4XA 1ZJAA 4HN4A 2W62A 5CBJA 3WSUA 2F9RA 3PZGA 3QYQA 3OGSA 4JIEA 5D9PA 1VPXA 1GJUA 6ALDA 4NXSA 4PL2A 4LBUA 4FX7A 1HGYA 4V1YA 3TTYA 2BFGA 3CAQA 1V0LA 1K6WA 2X05A 4YU1A 5AYXA 2WO5A 5F4SA 3OODA 1DE6A 4MY9A 3OEXA 5AFDA 2CNCA 1FH7A 1RQBA 4KMQA 4M8UA 3SCSA 1Z7AA 4MWAD 2J24A 4HJFA 4NAEA 2BXVA 4PUJA 4GCAA 1CBGA 5HAOA 2XVNA 4S3GA 2JE8A 2ZFAA 3LV6A 3GYCA 1US3A 2CKRA 3NOEA 5T8GA 1B90A 1F07A 2FVMA 4M7SA 1PO9A 2PRMA 1XLFA 2ON3A 4DJFD 4GI8A 1JCJA 3B8WA 3TC7A 3T44A 4UTLA 1RA0A 2AQVA 4YJ5A 1XRTA 4NZJA 3ABQA 4LX4A 1V03A 2Y5JA 3MCMA 2CLPA 2W61A 1XD0A 3HPFA 3SUTA 3R8GA 4EANA 2Z1XA 3S8HA 2BASA 3OYZA 5D4YA 1AQMA 5TBOA 1GG0A 1XYLA 4HVXA 1V7AA 2JKEA 2IPFA 3S5SA 4KRUA 4Z1AA 1W5PA 3RMEA 4IFOA 4I9TA 3B0XA 2J7FA 3BW3A 4P8WA 2FZ8A 2PE4A 2ZA2A 3SI9A 3R58A 3WNOA 1Q4WA 2QUUA 4JAWA 2OODA 4CN4A 1ISYA 3EXSA 1EP2A 3VOFA 3R5EA 2O7SA 4BK9A 4TTUA 4WDWA 3CHCA 3H2NA 4LU0A 4TMCA 2X1UA 1SM9A 1MMFA 1MW2A 4HPXA 1EGVA 3DC0A 3W25A 3IGXA 1UKSA 1WKDA 2WBKA 1XI3A 3EX6A 1XW8A 5MKGB 3WLNA 4GQ0A 3VCNA 1W9XA 2WZIA 1ME8A 4KS0A 3WMBA 3BAIA 5PTDA 4HD5A 3KAOA 5JBEA 3QEZA 1T7LA 4J7RA 3PJTA 1TZ9A 5A6BD 1YTDA 2KX9A 1IR1A 2UV8G 1XH0A 3NQMA 2D73A 1IXNA 1Q6DA 4NT0A 1V3LA 1KGUA 5CBBA 1WB0A 2P0OA 1W1IE 6PTDA 1Q5MA 4HPGA 5E0FA 1V0NA 3MI3A 3WFAA 3AQUA 4EKJA 1FP8A 5ABEA 1XKJA 2I16A 1OINA 4ZQRA 3M0JA 4HA3A 3SCUA 1BSIA 1XIIA 3G1VA 4KERA 1OZMA 1OFEA 3TJIA 2R91A 3TTSA 2O4MA 1YNQA 1XIJA 3BV4A 5HMEA 2ACSA 2A85A 4QRNA 4X22A 4KCWA 2JEQA 3LCXA 3ZR4A 2ZDRA 4Q6XA 2FTWA 3MV11 2E6YA 1PKLA 4Z1CA 2O55A 5KEZA 1BFNA 5CC6A 4HZ8A 5CKSA 1PZ2A 3GFXA 1JEZA 3MYOA 3W1LA 1H1YA 4NI8A 3T07A 5I3KA 4QJ1A 2BVWA 4OHQA 4DY1A 2QXWA 4B5UA 3A6OA 4EXBA 4H8HA 5I2UA 3SUUA 2C1IA 3G1XA 3OZOA 3CTLA 4W8BA 1U33A 1FHDA 4CD8A 2HVOA 3LOTA 5K2ZA 4AZGA 4CNTA 2PDBA 3OOQA 3DESA 4H9MA 1A5KC 2D3NA 3VMNA 1PAMA 1UD8A 4IPIA 1O94A 5FEWA 3NQDA 2FJUB 1ADOA 4AZ5A 5H8UA 2Z2BA 2WC4A 4QFUA 3K1DA 2QUVA 1YDNA 3IPWA 1GZGA 4JR5A 1YHTA 3ITXA 1NY1A 2D0FA 4NVTA 4QAIA 2HE5A 4HA0A 1V79A 5AYIA 4RNHA 1XYFA 5FOOA 3U4AA 4JBRA 3FFSA 4KWSA 3LY0A 3AXXA 4PTXA 3W7QA 4O1EA 1WCGA 4M1BA 1FWIC 3GAKA 2QEZA 3KRBA 3TVAA 4XAZA 4WSKA 3CV6A 4UNLA 2EKGA 4O0KA 5DCEA 2J75A 3QOMA 3GS6A 3UFYA 2DVUA 3AXMA 2ISFA 3R10A 4P5UA 3GBDA 3SY8A 1C3FA 2YX0A 5KTLA 1LL4A 2GJXA 4OKDA 1BVNP 4GJJA 4TX6A 4NP7A 3LPPA 1LUCA 4O1BA 5D37A 3VKAA 3PK7A 2DIKA 5HPCA 4P7OA 2CLIA 1FH8A 5C8BB 4CU8A 1F6KA 3FYOA 4EPKA 2CLLA 4PE8A 4R9OA 3W2UA 3G18A 4DJFC 3N2TA 3URAA 1H1ZA 4JYDA 6ENLA 3C61A 3OG3A 1MDRA 7REQA 4DF1A 4IJBA 3UJRA 1UMLA 3OYXA 4FIQA 4FXRA 4ZEPA 4O54A 5FACA 2HK1A 4ZO7A 2OGJA 3GVVA 1MYRA 2PLCA 1G4SA 2VZVA 3CLWA 3OA3A 4DJDD 1MFVA 3VA8A 4RDZA 5F2MA 1XINA 5B7YA 1X7IA 1XLCA 2ANUA 1HFBA 4LF2A 1QDSA 3CT2A 1H7RA 3GBEA 3WL0A 3K2GA 4JHOA 3T81A 3HQOA 1B9ZA 1HG3A 5D30A 1DJWA 5D38A 5IM51 2W79A 2ZUUA 3CYVA 2QCDA 4UFHA 1A5SA 2RKXA 4I9MA 4ZTXA 5G1YA 4TX8A 1D8WA 4XTIA 4W7WA 5CSRA 4AVFA 1W31A 1JPIA 2C1HA 1QI0A 3VGDA 3PFRA 3WLJA 1DP0A 1HZYA 1KFWA 3CJPA 3NPUA 3PTDA 3FDGA 1B3XA 1EJRC 4YIWA 4A3HA 4TV6A 2J7CA 3G3MA 4LYQA 1F3EA 3MVTA 2DY3A 1XIDA 3PZUA 1TX0A 3W83A 1VZWA 5A6SA 1TJ0A 4M6PA 3VE7A 1UP3A 3W3OA 2B7NA 3SN1A 3BLOA 4OZOA 3W2JA 3KP0A 1SMDA 2Q01A 2WHKA 3DXIA 1XYZA 3LGGA 4F3HA 5D2XA 6XIMA 1MNZA 3WLMA 2VC5A 3WNNA 2WJFA 4MG4A 4YS1A 5FF4A 1MWOA 3MU7A 4JY8A 3BK0A 2Z6JA 5EMUA 3MMUA 2DQXA 4PRWA 4YLWA 4CD7A 1DXIA 2FH6A 1KRCC 1OJXA 1WZMA 3GC5A 4JCLA 1VFOA 5B80A 2E9BA 5BRPA 2NXIA 2VX6A 2SFPA 3EDFA 2WQDA 1TTIA 2XH0A 2Q3OA 4Q4KA 1GZJA 3BLPX 1Z44A 3TJ4A 4AG0A 1GQKA 3TQKA 1ITCA 1MEHA 4UNIA 3L4YA 3LTSA 1QI2A 1ZAHA 3G8EA 1GNXA 1JFXA 1T41A 4OJYA 3RGTA 3A64A 2OWCA 1P6WA 4O19A 1YQ2A 4IIFA 1LQ0A 2PBGA 1E56A 1HKJA 3AHXA 2Z29A 2YPIA 3I3EA 3S4TA 3MTWA 4C6QA 1OCQA 4YPJA 4US5A 4GUFA 3UCQA 3E49A 3UCDA 3FYPA 2C13A 3ZQ9A 1CPUA 2PLKA 4S1FA 1QI3A 1JR1A 4RK8A 1R9XA 4GVGA 5HJYA 3KL3A 5RUBA 1OX5A 1OZQA 1UIPA 4JNZA 1BD0A 4IQDA 3NZQA 3SW6A 2WJZA 2EPKX 1E3XA 1LQAA 4HU0A 2YYTA 2O92A 4PR4A 4DJEA 3UWYA 3DHFA 2Y2WA 4Y8FA 1F9CA 2RJGA 3UR5A 5A1AA 1BXBA 3W7RA 4Q8PA 5CPNA 3MO4A 3URNA 2VYOA 3BJFA 2RH9A 1TPEA 4FALA 1QNRA 1ONXA 1P48A 5CEWA 2QLYA 3LTYA 1E55A 4UTTC 3VDCA 2DUZA 3OBEA 2FTPA 1SZGA 3EXRA 3UJFA 4BF9A 1V6WA 3G1FA 3KOXA 2WXDM 3QY7A 4JTCA 3PFMA 3SQLA 1A3XA 5CPOA 3LHYA 1T8QA 3AYVA 1VEPA 3N2XA 1T96A 4QJ4B 3V7PA 2V67A 1KBBA 3W24A 4RE0A 2Y1HA 3D6NA 4FOUA 1VH7A 3CUGA 3NYDA 3M0KA 3PR2A 1B31A 4ZO6A 1NQKA 4A6GA 4OT7A 1UB3A 5TNVA 3VGGA 2I57A 2ACQA 3K4DA 3QGVA 4A29A 3JU2A 4KCUA 5CAKA 1MW3A 1W54A 2PURA 4FOJA 4UFLA 5ECVA 3NZRA 1RH9A 3NPWA 5IXEA 2F2HA 1TIWA 3GTFA 3LBMA 2WOQA 1KM6A 3UG3A 2R6OA 3QSTA 2QUNA 4FF5A 2PGFA 4XZMX 2BY3A 1KFLA 1NWTA 3AUOA 1I75A 2VC9A 2PRLA 3QR1A 3PTMA 5JUVA 4GFIA 1G4EA 3MSDA 7PTDA 1UKQA 3GFYA 2Y0FA 4JTEA 2CWNA 1TWWA 3RRAA 5I09A 2YL8A 4YYCA 1AUSL 3TNBA 3GO2A 1AMKA 2D2JA 1U83A 3IUHA 1GCYA 1KKRA 3MJYA 3P62A 1E72M 1JPHA 1DXFA 2WVTA 3TTEA 4BS0A 3VX0A 4MKNA 1XLKA 4RZ6A 2V30A 3AU6A 5EFDA 3UR2A 1XLGA 1XUUA 3HOJA 4MKSA 2TYSA 2QJHA 2XN0A 3AYTA 3VCRA 3H6OA 4HQVA 1GOQA 4D9PA 6TAAA 2OQLA 3OIXA 1TR1A 3JZUA 4QROA 5FJPA 1M7JA 3WJWA 1Y7VA 1RA5A 4GINA 5FA5A 2ZYFA 1FWFC 4LOCA 2W67A 3NVDA 3W1RA 3IUDA 1EWEA 3DYOA 1G6CA 4ACYA 4WXYA 1QK2A 3NL3A 2QDEA 1C8VA 3B9NA 1EEXA 4K36A 3RIKA 4CN1A 3TZFA 3SCWA 1BPLB 3GNNA 3WD2A 2Y61A 1V08A 2ABBA 2FB3A 2PDLA 2CBUA 4B3ZA 4FS9A 3OLIA 1ITXA 4D6FA 3GTIA 4POCA 1LRNA 4NZ5A 2YA0A 5IDZA 4F4RA 1R3TA 1JGIA 2R1PA 2VFGA 3BICA 1CXHA 1PX4A 1YDVA 3NA8A 4UTHA 1WXJA 4WJEA 3WLPA 3E6EA 2INEA 3PUGA 4DYJA 1WDSA 2DT2A 5DQPA 2DH2A 5GNXA 3C3NA 1E73M 5L9FA 1R7OA 3NXFA 2ZOXA 2WMIA 1E4MM 2E5CA 1VBUA 3UR8A 2VDIA 3T9PA 1CENA 4X2RA 1EOMA 1AJ0A 4E0CA 1G5AA 4NJGA 1OC6A 1VCGA 5JH1A 3CV7A 1BYCA 4FSAA 3OVQA 3TP4A 3UNDA 3VVGA 3GSMA 4AU0A 3TLLA 4NUWA 1LDCA 1DTUA 1OD8A 1WP6A 1EYEA 4L80A 4AAJA 4KWUA 2AL1A 4HOXA 3E0LA 2FPYA 2OVLA 4IX0A 5BOOA 3WFZA 1C7SA 2P76A 3ZS4A 1OGGA 4US6A 5BXTA 2IPJA 4ES4A 1UWRA 2WZTA 4LRTA 3RU6A 2F7FA 3E3HA 1UBSA 2PP0A 2BXZA 4HMNA 3W7IA 3R11A 4QDPA 4Z2HA 3GH4A 2V5JA 1K77A 3DC8A 4W87A 3S2MA 4Y6GA 3KDNA 3N17A 3ARQA 2O9OA 1S1RA 3V36A 3STFA 2ZVIA 4G2DA 3EWXA 4H1ZA 3FJLA 3MC5A 3DKJA 3OQ8A 2FPVA 3HJZA 1SVDA 1QATA 3A13A 2WVVA 2XSXA 3NQBA 3USZA 1FWBC 1J6OA 3VKCA 2PDHA 3D47A 4QEHA 2IPWA 4UTUA 2CW6A 1MQPA 3LHZA 1VF8A 3CAKA 3HV8A 2EPLX 4TUFA 1Q4NX 2G3NA 5G2IA 3RILA 3V16A 2ZC8A 1TREA 1ONWA 1C90A 1E3ZA 2G3JA 3Q37A 3LLDA 1V0KA 3G1AA 3HFYA 3VM7A 1E6XM 3WLHA 3DFPA 2CLFA 5AN7A 2VEGA 3P0XA 1GKPA 3CS2A 4J3UA 5G2WA 2EGZA 3QKEA 1QPRA 4FHAA 1ONRA 1IE7C 6REQB 3PG8A 1R3SA 2XVKA 2X09A 4ZODA 4PB5A 4JNYA 4Q8NA 4XZHA 1G7VA 3S9IA 1G01A 2JKAA 2V8ZA 1FWRA 5E70A 4L6OA 5DLCA 1W5QA 4HZ7A 4WSHA 2AQWA 2WANA 3KVMA 4QQUA 4NL1A 4IQJA 1JZ5A 2W6RA 3KX6A 3UXDA 5TAOA 1ZCCA 1ZAJA 3QY6A 2J4GA 3M7SA 4LVAA 2ALDA 1TTQA 2ONEA 3KLKA 2HE8A 3BZJA 1NM9A 3W1TA 2ISVA 4A3QA 3I3BA 1HN1A 5FEZA 2BZNA 1E1CA 4Y2WA 5DBTA 4EPBC 1R46A 3REQA 1US0A 1QAPA 2PS2A 1OFPA 4Z1YA 3FY1A 4C6KA 3AMKA 5CZTA 2PD5A 1RBLA 3ABRA 2WM0A 3WZ0E 1FCUA 1G67A 3DFYA 3FDKA 1XCWA 4LY8A 2VFEA 1VJSA 4JIIX 1VJZA 2GGIA 5CBIA 1V6VA 2RJHA 3B8DA 3MSGA 4E38A 1MXDA 2VDHA 1V5XA 1O6IA 3I6EA 3MO7A 3C0LA 5MHBA 3E5BA 2JGYA 3VI2A 3IAQA 1RY0A 3ES7A 1W9BM 2DSZA 2TPSA 2FDSA 4DHGA 4A8IA 2YBTA 1TO3A 4PEKA 1FH9A 4D72A 4ONVA 1JAKA 1DHPA 4A05A 1MZHA 3A4JA 3G5EA 3RG6A 1K03A 3K1GA 2DVTA 4K6AA 4NNBA 2CC0A 1VFFA 3V35A 4PMZA 1PKNA 4W8LA 3A9IA 4JPGA 3SB0A 3VM5A 3W6MA 4DEFA 3I6RA 1I2NA 2V3GA 3EDKA 4H8VA 2CBVA 2GDVA 3HTWA 7ODCA 2ZE3A 4Y9OA 4JTUA 4DWSA 3WQFA 1OHLA 5HDRA 5C6MA 4PTNA 3ISIX 1KC7A 5A6JA 5JVLA 3AMGA 3CIWA 4F48A 1W0MA 3AIUA 5CZKA 1N2VA 4AZ7A 1SW7A 1WZKA 3EMZA 4ML9A 2QNEA 4ATLA 1B9BA 4XZWA 4FLRA 2A5HA 1LLWA 3LM7A 4BCEA 2OELA 4MNJA 3WD3A 8A3HA 3AJ7A 4JTLA 5C54A 1A5UA 3VINA 1AD1A 4YTSA 2GOKA 4GJIA 4O17A 2H90A 2CZDA 1HVQA 4I5RA 3K8MA 4A2SA 5A69A 4ICMA 2C15A 1NFPA 5M2FX 3QHMA 3EOSA 3D3AA 2X16A 5I24A 2WKJA 2DIJA 2NVDA 4NXKA 4WJXA 4I7VA 3DAQA 4LCRA 1F3WA 4GE8A 2INZA 5F2LA 4AEEA 4F0MA 1MUCA 3O7UA 1OEPA 3HG4A 3ABOA 2GQ9A 4QCEA 4TXEA 2QHAA 4NZCA 4PBFA 1GVRA 3VXGA 4L9XA 2V3EA 1QU4A 3S5OA 1DOSA 3REQB 1XLIA 2WCSA 4DF2A 2H8ZA 3WELA 3C6CA 3EWYA 5ABFB 3EX3A 2GSEA 1PYMA 1DKWA 5LGZA 2PDJA 4J35A 1Y65A 2FIQA 1OFRA 3SSZA 4NX0A 1D2KA 5AC7A 3NQ7A 3EKGA 2IUZA 1TRIA 5LXXA 8TIMA 1NFBA 3TQPA 1R9YA 3M0XA 1I8JA 1M65A 4YHGA 4G1KA 2WVSA 1SO3A 1QK0A 3U48A 3JUGA 5I0DA 1BYBA 1SJDA 2A0NA 4IHCA 1YMYA 2E67A 9CGTA 3PZNA 2VCAA 4FLQA 2AQOA 1E15A 3NWRA 4NYYA 2J9XA 2R8WA 3NPXA 1K9DA 1JUEA 2ISDA 2ZRXA 3UZWA 4M5PA 4OWGA 1GKRA 5BRBA 3ELFA 3QVQA 3STEA 4W5ZA 2QCDB 4JIPA 2WWCA 1ZNNA 2WHLA 3NDZA 1OWQA 1EDTA 1RLCL 3W02A 1ZUAX 1TCDA 4HTBA 1O5XA 1IT8A 2XUCA 3ZVHA 4D71A 3IUIA 2OU4A 3DENA 1KR1A 3PM6A 4MB1A 1EC8A 1SU5A 4X61A 3UYIA 3NG3A 4DI8A 3VYLA 1V6UA 4WSJA 2B0MA 4GQRA 2WVVB 4J3TA 2B7QA 1AQ0A 5TF0A 2BY0A 1O1HA 3MT1A 3CHDA 3WG6A 4S3AA 3BAKA 3Q2DA 4GVIA 2QJIA 2BODX 4QE1A 4XAFA 3LNPA 4CN6A 2QCEA 1ESWA 3PANA 1BAGA 1GVOA 3H4GA 1U1JA 2VT0A 1JZ7A 1Q65A 1UH4A 1A3HA 4JTJA 4FNTA 4HSHA 4QBXA 1OK6A 3HIJA 2VL4A 4JKKA 1MW0A 4HNNA 4W93A 5ECUA 5M17A 3R1ZA 4MJZA 4Y96A 5CPMA 4D6CA 3MUIA 4AZCA 4PCSA 3LERA 4FR1A 3ENLA 4LANA 1NU5A 2J8FA 3P93A 1U5HA 1LG2A 1BKSA 3S5ZA 4BQ3A 3TXVA 4MF4A 3WQCA 1IYXA 1GQNA 3LHTA 3HG2A 1LBLA 1TJPA 3EZ4A 4KF1A 4BFAA 3MI2A 1HUVA 4QISA 4I5UA 1AQFA 3BOXA 4JIRA 2EBNA 2IW0A 5F2IA 3CPRA 4A4AA 1ZL1A 4AXNA 2JQXA 5EMKA 1B30A 4WY0B 1QW9A 1LP6A 4JL2A 4WXZA 1XLMA 3LSCA 1M7OA 4JD4A 2C0HA 4OU1A 3WDHA 1W1PA 1UOKA 3RM8A 2Z2AA 3GR8A 2GL5A 3MS8A 2WMHA 1NAL1 5A6MA 4AVNA 1YTEA 3N4EA 3USBA 3BLFA 2YIHA 1REQB 1DJYA 5XIAA 1QNVA 1WV2A 4DAIA 3KZPA 1DIEA 1H7NA 2J88A 4HTYA 3GVRA 3CH0A 4QLKA 2XG9A 4WGHA 3ARTA 4DXVA 4Z1BA 1EF2A 3SY5A 2E5BA 3C2VA 4K2SA 3SAZA 2OYMA 4AF0B 4CQBA 2VOMA 3WBWA 3G6MA 1DVJA 2YB4A 1Q7ZA 3LPGA 4AHQA 1VFTA 4RDVA 4MTVA 1KO0A 1B0IA 2PFHA 3STGA 3XINA 3QQ1A 2J9YA 3KBVA 1PDYA 2GFTA 4PRRA 2ISWA 3CGTA 4XZ9A 3Q65A 1EDGA 1KBJA 4LSBA 1H50A 4H8NA 3OPSA 3CB8A 3PBYA 5I03A 4QJ3B 2D1ZA 2VUNA 4RDYA 1EJXC 5DMYA 1Z32X 2YCLB 1KFBA 3MUAA 1T6MA 3V4BA 4IH3A 3QPEA 2YBUA 3PZTA 1VEMA 1TQJA 3THUA 1UR2A 1MXSA 4PFMA 3TW6A 2A3CA 4ICCX 4S3DA 3L4VA 3EDEA 5LA2A 3T1GA 4MNLA 4S3EA 4RV3A 5C7VA 4PMQA 3T6CA 3SM0A 4IMFA 4R33A 4TX9A 1PEZA 3CL6A 4KKXA 4KRTA 3S1GA 2GGHA 4GYKA 2RDUA 3WBYA 4EP8C 1PSCA 1E1FA 1YDYA 5LSMA 2Y85A 3H2CA 4JDBA 4UFMA 3F1QA 4JTSA 4UQ9A 2HCVA 4OIFA 1FDZA 3L0NA 4K8EA 3QZ6A 3P5YA 4XD3A 3TTOA 4GIYA 1PX3A 4DXKA 2BY2A 1G4PA 1PBGA 3NAVA 1JXJA 1QR7A 1UR0A 3N9SA 5HNNA 5K7JA 3L0GA 5AY7A 1TVNA 4WGXA 1WKFA 3HQNA 3WQEA 4LCSA 2YZ5A 3B8VA 3O8AA 4ZQNA 4DYEA 4ZXLA 4P7NA 4H6RA 3VIGA 4MDPA 3L4UA 2HMCA 1UQZA 3ITLA 1VCFA 1OX4B 2OZTA 3SRDA 1KBIA 4J2PA 2D20A 4K7YA 1HKWA 3VNIA 1F74A 5T91A 1F8MA 2VXNA 5C0QA 2J78A 1U2YA 3GNXA 3O2LA 3QTGA 1OX4A 3DHDA 4QE4A 1EHAA 3R43A 5H8PA 2DVXA 4Z42C 3ZVHB 2BLEA 1RJQA 4AWTA 1PKMA 2PDMA 1Q6GA 1RVKA 3P81A 1EIXA 2WLYA 2KZHA 3M6YA 1XIMA 2XWDA 3W23A 3TN4A 3B03A 3HMJG 4B92A 1AL7A 4OV9A 3T0CA 5CSSA 1CGXA 3AS0A 3TW7A 3TMLA 1PTAA 1F6PA 4N6FA 3QHNA 4HHMA 4LYKA 1P0BA 4J28A 1AL8A 1EP3A 3W7PA 1M5WA 3CC1A 3N4FA 1T5AA 2NSXA 1OFDA 3TK7A 4LEFA 3TLQA 4G7FA 4YTTA 2QZRA 4X3ZA 1Q63A 2QCNA 1P6BA 3UP8A 1JCYA 2G0WA 1J11A 3VOGA 3DYPA 5FL0A 3N1AA 5I23A 4REQB 5G4WA 1QI5A 6XIAA 2CLEA 2HV5A 2JIEA 3NL6A 4XZBA 1E4NA 4QG8A 4XUYA 5D9NA 3BUVA 3LM3A 3BQ5A 1EL3A 1JD7A 2PODA 4EK7A 4CEUC 1AW5A 4C90A 4D6EA 5BROA 2DZSA 3L4WA 3G2GA 4HA4A 1S2WA 1QHOA 4EACA 2OYLA 2CKSA 1UPMB 2ZA1A 1Q6QA 7TAAA 4GA8A 2CETA 2C71A 3EA1A 3G1DA 1QVBA 5HQEA 4OVXA 4GUGA 3SGGA 4N02A 3NUKA 3CXOA 3FJNA 1TYGA 1FY6A 3LX9A 4WR3A 5EMMA 1V3JA 2NQLA 3ZLFA 1K6AA 3KL0A 4FNQA 4S38A 2E9MA 4ZE5A 2VP8A 3SCOA 4TU1A 2C3ZA 4MB4A 1JULA 2VUYA 3L66A 5FJTA 3KTCA 2TODA 1F3XA 3E9AA 2WV8A 3SJ3A 3LCHA 3DFHA 2VVNA 3CH9A 4IP4A 1JDEA 2Z27A 3W28A 4BZYA 3W7JA 4WEVX 3OVGA 2HDJA 4PCPA 2DT1A 2QIWA 1O68A 3LRLA 4LAMA 3M7WA 1JZ8A 2FGLA 1FFQA 3IJ8A 3POCA 2TMDA 3AALA 3N19B 2B7OA 2X0YA 1XH2A 2IS7A 4ZTYA 2XN2A 3PJWA 4OUEA 3OVRA 3AIBA 2ZUSA 3QC0A 3GHSA 4EAMA 3V0SA 3TUUA 3WQWA 4YVPA 2CIPA 1KLYA 3MQTA 2IQDA 3LMYA 3CZ8A 1V0MA 4I5XA 3WK2A 4PCNA 2UY3A 2WSQA 2ZCGA 1C91A 2XM2A 1LF1A 3NZPA 2HEJA 4XSMA 1H09A 3PPCA 3ITTA 4MDOA 1K7FA 4AD5A 4NQ1A 2PI6A 3ZLHA 3GZ3A 4O15A 1RJRA 1KV8A 1XH1A 1BWKA 1MZRA 1KCXA 4LJ3A 4PTVA 3TN3A 2OEJA 3W81A 3AXIA 2CBIA 4WX2A 4O14A 2AAAA 3NQGA 3S46A 1KXHA 1XLDA 1C8QA 1OFQA 3TQ0A 3L23A 4MWAB 1T8XA 4PN2A 3NXLA 4OQVA 4JTIA 1JQVA 1ECEA 4KBXA 2NVAA 5G1MA 4AHOA 4C6MA 5AHFA 3BV7A 3ALFA 3AYRA 1TG7A 1FQ0A 1B57A 5AHIA 1CGWA 2E8ZA 5I3HA 1HX0A 3LPOA 4HYRA 4XZNX 5FAJA 4NG3A 1C8XA 3BJTA 3GG0A 1K4HA 1W9PA 4XB3A 5F2GA 4DO6A 5A6KA 3GVQA 1LT8A 1KKOA 1H4PA 4NZ4A 1EJTC 5ABHA 4BWLA 4CCZA 1PKYA 3QXBA 3NEHA 4IUOA 4JFWA 1RCQA 1PHQA 2VO5A 3ONBA 3LCGA 4RLIA 1JGMA 1E43A 2ZXBA 3IGSA 2VKZG 3V5CA 4DZHA 4MYXA 4W84A 4ZZ9A 4AC7C 3GC4A 3BANA 3OTRA 3GUGA 3P3BA 1NELA 2DJXA 2V68A 3M0VA 1XFCA 2BS9A 2BVDA 2ZWZA 1HT6A 2BNJA 2BGSA 2E28A 2EPNA 5DANA 1GVEA 3M0IA 3VZYA 4Q32A 2PTYA 4LNCA 5CSUA 4GVFA 3OLDA 2R1LA 2B81A 1GHSA 5C7HA 4H9YA 3PWAA 1XRSA 4FXJA 1WYIA 2XINA 3F2BA 4JKLA 1E6QM 3A3HA 3CPGA 5D9MA 2J7GA 2QGYA 5EBUA 3LZ3A 1ZBKA 4R27A 3VNJA 1ZENA 4QTGA 2HXUA 5FF7A 4E4UA 2WQPA 4EE9A 4CEXC 1I9CB 3RX3A 3HF3A 3AHTA 5BW6A 5HNRA 1TUFA 1UWIA 2NUYA 1O4UA 3DCPA 4O10A 1WUEA 1UWQA 3UJEA 4XBSA 3WH5A 2A3BA 3P82A 4L4OA 3BW4A 2P53A 4MZ1A 3UWWA 1SZRA 2FQIA 2YDAA 4GXPA 3GDMA 1W9UA 2YL9A 2JKPA 3IK4A 3CL8A 2FFCA 2DW7A 5G5IA 3FVMA 4H3DA 1POKA 1EUAA 2XU2A 2VX4A 2AAMA 4H7VA 5EPDA 2X1RA 3KOZA 2NT0A 1IZCA 1UUQA 3IWPA 5L6UA 3GHRA 5FF0A 2VJXA 4ROQA 4TMBA 1FX6A 3PN8A 3WF1A 3VC6A 5G1TA 4Z2LA 1H0IA 3KHDA 4LPCA 4KEUA 4I3GA 4ZVJA 5KSWA 4HA1A 3MCOA 4R7JA 5AZ0A 2XISA 3DGBA 2E7FA 1QPNA 3SQSA 4HZMA 4LAKA 1HIZA 3F5KA 3R12A 3U9IA 1SO4A 1ZZMA 4JHZA 3PJXA 3MV01 1GOMA 3LCLA 4WKHA 4GUIA 2EPHA 5BU6A 1J0HA 4NAFA 4H6EA 4MPQA 2J7EA 4IPJA 4F79A 4Z2IA 1XSJA 3N04A 7CGTA 4JQ1A 2ZX9A 4AY8A 3G1RA 4B2DA 2VFHA 3ZM8A 1CCWB 1OVDA 1FWTA 3WLTA 3ABZA 4DJDC 2OX1A 4IUGA 1S2AA 2GWNA 3BAWA 5J5DA 3CWNA 4GRSA 4Y9PA 5D05A 4HKPA 3LDVA 3I7RA 3H2OA 1W3HA 2ZZ2A 5BMWA 1KBLA 3CB3A 1UP2A 4XZIA 1W1ZA 1CNVA 3WH7A 5EMLA 3QW3A 1U1HA 1CLVA 2OT1A 4BY3A 1E51A 4UFJA 3FGCA 1ZJIA 1A49A 4N4PA 1N55A 2ZRVA 3A47A 4CU6A 4H00A 1XBVA 4P2VA 1KFCA 3IK2A 1CYGA 2PGEA 1Z3NA 4ERIA 4OBTA 4J3XA 3EPOA 3HURA 3VFLA 2CCRA 3L5AA 1B3YA 2ZRZA 4C6DA 3BLIA 1ISVA 3IIVA 1KM4A 1Z9AA 3L9CA 1BGGA 1EOKA 4J27A 1DV7A 4LAOA 4A35A 1PS9A 5LIKX 1V93A 3EOLA 3N3MA 1SJBA 1GEQA 3IGHX 2OT0A 3OLGA 2X2YA 1YBQB 3MZNA 1Y5XA 4OV4A 5DELA 3SCNA 3U3HA 4HHHA 1W1B1 3P2VA 3OVPA 1XM3A 3VIOA 4A2RA 1M7XA 1R8LA 1AW2A 1RUSA 5E5CA 1B54A 1IZJA 3T05A 1GG1A 3N29A 5DF0A 2Z1SA 4RNFA 1PHWA 3L12A 2XIBA 5LZLA 2QF7A 4M24A 3IJQA 4IG2B 4US5D 4PMOA 3A3XA 2XYLA 2QQ6A 4P8UA 1FFRA 2HS8A 4DELA 1J18A 4PTWA 3TXZA 3G1SA 2W9MA 2FVKA 4KQNA 2NV2A 3AFBA 2ASHA 3URQA 3WJXA 3DERA 1IR2A 1TZZA 1H41A 2YW4A 3RNDA 4FA3A 1R47A 4TQTA 2BSLA 4AYSA 1EZ2A 3IV8A 1T40A 1A5BA 3CWOX 3QMSA 2CITA 3GYEA 4O8AA 4UMAA 3QF0A 1TE6A 3RPTA 3H7VA 3BC9A 3OW1A 4PRTA 4AWEA 1BYDA 1TSIA 4CGTA 1E9IA 3IRSA 3NSXA 4X0NA 3W1PA 5ABTA 3W26A 4LNYA 2BWGA 2YLLA 2XSAA 1B3ZA 2X7VA 1AJZA 3AWNA 2GJNA 3FHAA 3DOPA 2NX3A 4B16A 3ITYA 1E0XA 3H4WA 4UOJA 1FUYA 3VIKA 3F4VA 4U28A 3SN0A 4KFPA 1PVNA 1A3WA 3T2PA 4FZIA 1IEXA 1VFUA 1OM0A 2WC3A 1XYMA 4C6JA 4IQLA 4GYPA 3S6TA 1XGDA 1UUOA 3WQ6A 1OCJA 4XK2A 1MRQA 2QJJA 3WJSA 4GJ1A 1HP5A 1VLWA 4DJED 4LB4A 1DIKA 3ARXA 1KFJA 1JI2A 5H6HA 3NGJA 1CWYA 4ACZA 5I07A 5AYYA 4G6CA 3UYCA 2XHYA 4IMAA 3W6YA 1W8GA 3R13A 4FI4A 2XIIA 1JUBA 1P4CA 2WBGA 1HKKA 5BZAA 1EA9C 2QCLA 3VK5A 1R7AA 2XIQA 2EEXA 4DZAA 5CGQA 4FXSA 5CJ5A 1Z6KA 2VZSA 3OGRA 3ICJA 4E4FA 1FWSA 1W1A1 4MWAC 2VELA 2IKJA 4WKFA 2QJMA 4IXHA 1KTCA 4IMEA 4DJDA 4UQBA 2VFIA 1S5WA 3VU2A 5DT7A 5XINA 1DIOA 1FRBA 1JRCA 1NIUA 2PZNA 3B8TA 1P0NA 5EYWA 3BTNA 4AEOA 3A4AA 4G1NA 1Q7QA 1I6NA 4C65A 3GDKA 1R30A 3QLLA 3W88A 3RAOA 1JCMP 2VDGA 5C9RA 4JFUA 5FESA 4JX4A 3HQPA 1I4NA 4MAZA 3AWOA 3IVTA 3DG3A 1JIBA 3TJXA 3UZZA 5I02A 4NNCA 3DIPA 3TR2A 1QASA 5LIXX 3ZJKA 3WUEA 3AIWA 1PV8A 1VBHA 3UWEA 1UR4A 1VPQA 3H22A 4IT1A 2Z1BA 1E9YB 2TRSA 3UG8A 3W1AA 2IXVA 5FL1A 1EJUC 3VOHA 4QNWA 3PVFA 1YE6A 4K3ZA 1FWHC 2PEVA 4LYPA 1J0KA 3ZWSA 4CQAA 1ISXA 1E0WA 3CM4A 1LM1A 1JFHA 3VO0A 3KOFA 3UVIA 1GZ1A 3QHOA 2BTMA 2F84A 2HJPA 3FJ6A 4FX8A 3IIOA 4ROPA 4AX6A 2VEKA 4MKVA 3M43A 2CXEA 3OG2A 3M0YA 1M04A 3PBUA 3VD9A 2J66A 4U31A 3F7JA 3GNDA 1XDLA 3CBWA 2YOCA 4HCLA 2Z7GA 2Z6IA 3PZVA 3WQ8A 1I1WA 3K5XA 3GIYA 3TZNA 3K30A 1EA0A 3SO7A 1V3IA 3B0YA 3LZ5A 3TE9A 2JFEX 4TR9A 2DZWA 1WBHA 2HBXA 2QCHA 3UNTA 1EQPA 1Q8AA 1J10A 2HVMA 2PDWA 1XWYA 4IIGA 1VFMA 2QUTA 1DJNA 1KD0A 4KWWA 5HNUA 3LA4A 3PWGA 1KRBC 1LBMA 2FDMA 3G0UA 3KVLA 4BKNA 4LXFA 3R0DA 4EWJA 4HSOA 1JD9A 2NUXA 1KM0A 3DX5A 2O9PA 3H7UA 1YW1A 4OBRA 1XS2A 1SZFA 1OQFA 4R3UA 1SJAA 2OWWA 1YXCA 4UWMA 4N9BA 1WA3A 1JVNA 2QVNA 4JN7A 1E6SM 1MUWA 3PBWA 3MBFA 3KVKA 2QJNA 3LEPA 4IJCA 1L6WA 2G3FA 2BDQA 2E6AA 5AHNA 8CGTA 1ECQA 1XKYA 5EFFA 4Q4OA 3ARWA 2V9DA 3EWDA 4JTHA 4KWOA 4L56A 1JNDA 5JIPA 2DZVA 1GUVA 4M51A 3VDBA 1TWIA 2BOEX 3VGFA 1GOOA 4JY9A 3W7OA 1BSLA 2EF9A 5SWUA 3N4AA 2QVHA 1D8CA 2UY4A 4H6QA 2YLAA 4B4FA 1FHVA 3AI0A 3OHIA 3A21A 5AZ1A 3URBA 1PIFA 1YYAA 5KMYA 4Q8VA 1VPYA 3IJ9A 4HBKA 4ZMGA 4EPEC 4JZ5A 1VFHA 1R3QA 1VRDA 3M5XA 4LC6A 3IV3A 3GR4A 1OB0A 1JCLA 4HNUA 4H4IA 3GTHA 1W3TA 1PTDA 2BV9A 4GYJA 4KW2A 3UZ5A 4JQAA 1J96A 2I5GA 5A95A 4UTWC 3NCOA 4NI3A 2PTZA 2FHFA 4X9YA 3SCRA 2O9TA 3LUTA 3S1XA 1H3GA 3SCQA 1FWEC 3FKKA 5LNSA 1DQXA 3NQAA 4TV5A 1LT7A 4RE4A 4LS2A 4AWSA 2WNNA 4PCTA 3M0MA 4HHLA 7TIMA 4ERGA 1VYRA 1FWJC 1SW3A 1TWZA 3WCZA 1QW7A 5F4WA 1P43A 1Y5VA 3IJ7A 3CL7A 3KBSA 1JZ3A 3AAMA 2EQDA 4XV0A 3KTSA 4DBDA 4L4LA 3ERPA 3MA8A 2WJDA 4Q4MA 3G0SA 4RW5A 1SYTA 3RLUA 1B5TA 1GVQA 4PYSA 4QP0A 5D2VA 2PWDA 3A23A 2WZMA 2INFA 1L8PA 2VX7A 3CEPA 1VBJA 1GEHA 1V3HA 1YXYA 3E1F1 3EYPA 3SBFA 4DM1A 1XLAA 5CG0A 1RZMA 3TN5A 1RV8A 4PC8A 3OBKA 3OZYA 2J8GA 2Q02A 3RJXA 3N34A 2IKIA 3LSBA 5EMJA 3UR7A 3TROA 5A6BA 1UASA 4F0HA 4ATWA 3LS9A 1GOKA 2OSYA 4MNKA 1JNEA 1JYXA 1OSEA 4W7UA 1IQ8A 1S38A 1ZB5A 4L64A 1IIHA 2QDHA 2HWGA 4JTQA 3RO6A 1LRQA 2YZRA 4GD0A 2Y6ZA 3HQ1A 1MI3A 4ZOCA 2O0TA 1YBQA 3SIMA 2ZUWA 5EB8A 1UWSA 3KP1A 1QNSA 4UB9A 1BHGA 4DUOA 3COTA 4HN8A 3UZXA 2DEPA 3CASA 2WC7A 3FXYA 2YCEA 5MKGA 4LVGA 5AKQA 4IG2A 1CXLA 2ZX6A 4ATDA 3I4KA 1SJCA 5FI8A 4KFOA 1EB3A 4KEVA 1S5VA 1RXOB 3FJ4A 3H54A 4KCTA 2DH3A 3EA2A 4DO4A 5I3DA 3R6IA 3S6OA 3ZT5A 4KEZA 1VR6A 3QPZA 5E6ZA 3IANA 4E8DA 3GDLA 2F2KA 3QYSA 3KLLA 1KCKA 2QF8A 1DXEA 3VABA 2Z1VA 3EWBX 5I3JA 1RR2A 5BNKA 1OT2A 4O13A 5AYBA 5D09A 4WZHA 1CT5A 1EF3A 2CBJA 4U5KA 3G22A 3P8IA 3OB8A 4O16A 3CYJA 4QHRA 5CJNA 1KTBA 1UA3A 4QX4A 3M64A 3RCYA 2QV5A 1X6LA 4OUIA 3AHVA 1ZJBA 2E6DA 1CW2A 4HPNA 3XIMA 1PZ3A 3UGRA 1KV5A 2ZXDA 9RUBA 3WQ5A 1SZEA 3RX4A 4MFDA 2EHHA 2R1MA 2GJRA 4RXGA 1SGJA 2A6LA 1TZ7A 1AH0A 1JG9A 1XBZA 4L9ZA 4LUIA 2PSNA 4Q6JA 2DJLA 3CQKA 1XQKA 3BPWA 3CZLA 1RD6A 1KGWA 3VIJA 3NVTA 1UWTA 5HUPA 1KRMA 3INPA 3G0XA 2WCAA 1KWGA 5LGXA 1M7PA 4K68A