3R43A

Akr1c3 complexed with mefenamic acid
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
316
structure length
310
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Crystal structures of three classes of non-steroidal anti-inflammatory drugs in complex with aldo-keto reductase 1C3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 117
structure length 310
sequence length 316
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2011-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3r43A00
3ONBA 4WRHA 4YS1A 4DZ5A 5M2FX 2PZNA 5JH1A 3N2TA 3UWEA 2HE8A 2PDPA 5LIWX 3KRBA 1R38A 2PDCA 2WZTA 1QRQA 3R43A 1VP5A 4R9OA 3UZXA 2HE5A 3S3GA 3CMFA 3LZ5A 2I17A 3UG8A 1AH0A 1ZSXA 5LIUX 4XZNX 2DUXA 1X96A 4JQ1A 3WBXA 3UFYA 3G1RA 4NKCA 1XF0A 4OTKA 3CAVA 1AH3A 1K8CA 1PZ1A 2VDGA 2F2KA 3DOPA 3O3RA 1AH4A 2PDXA 1ZQ5A 3MC5A 4FAMA 4LB4A 4JIRA 2PDBA 3V35A 2CLPA 5DANA 2HDJA 1US0A 3GHTA 3BV7A 2IKJA 2IQ0A 3O0KA 3FJNA 3LQGA 1X98A 1RY0A 4XVDA 2FZBA 3V0UA 1OG6A 4XZMX 2ACQA 4JQAA 1Z3NA 4FZIA 4JQ4A 1EF3A 3DN5A 2C91A 2PDMA 3R8GA 3CASA 1Q13A 1IEIA 2PDYA 1Z89A 5KETA 1YE4A 1SM9A 4Q3MA 2IKHA 1YE6A 3BUVA 5AZ1A 4DBUA 4PRTA 4JTDA 2ALRA 4JIIX 4JQ3A 1XGDA 2HEJA 4LAUA 1J96A 3UZYA 1Z8AA 3LEPA 3WBYA 2PDUA 2ACSA 4XK2A 2BP1A 2ISFA 3R94A 1HQTA 3NTYA 2HVNA 1S2AA 3RX3A 3H7UA 3MB9A 4IJCA 4XO6A 4I5XA 3EB3A 3N6QA 3M64A 3P2VA 3D3FA 3LN3A 4XVEA 4JTAA 1S1PA 1FRBA 3H7RA 4GQGA 4L1XA 1T41A 2J8TA 4EXBA 3R8HA 4PUUA 4JIHA 4LBRA 2INEA 4DBWA 3UGRA 4HMNA 5AZ0A 2FGBA 4XZHA 3M4HA 4PRRA 1T40A 4YVPA 4GACA 4XO7A 1EL3A 1RALA 3R7MA 4FA3A 2PDGA 3ERPA 3CV6A 1UR3M 2IPFA 5LIYX 2HVOA 3VXGA 4PR4A 4RPQA 1Q5MA 2ACRA 3Q65A 2DUZA 3GHRA 2BGSA 3R58A 3WBWA 3CAQA 5HNTA 2PDJA 4L1WA 2IS7A 3BCJA 3CV7A 4XAPA 5C7HA 4WDUA 3V36A 4YVXA 1C9WA 1YNQA 4EXAA 3LNMA 1JEZA 4IGSA 3COTA 2PDFA 3WCZA 4GA8A 2HV5A 1LQAA 2PEVA 3LENA 4QXIA 4WDXA 1PWLA 4LAZA 2IPGA 4F40A 2INZA 1MZRA 3U2CA 4G5DA 2PDQA 3V0SA 4PUWA 4DBSA 4Q7BA 1A80A 2FVLA 4YVVA 1YNPA 4HBKA 2IKIA 4WDTA 3C3UA 1LWIA 1ZGDA 3LUTA 2PDHA 1HW6A 2IPWA 3UZZA 3EB4A 4MHBA 2IQDA 2FZ8A 2FZ9A 5HNUA 4LB3A 3FX4A 1GVEA 4QX4A 3V0TA 1Z9AA 2PD5A 3T42A 2IKGA 3WG6A 1RY8A 4WDWA 1S1RA 3GHUA 2R24A 4PMJA 3LZ3A 3G5EA 1XJBA 2PDWA 4H7CA 1AZ1A 4AUBA 4ZFCA 4GIEA 5LIXX 2PDNA 1ZUAX 2P5NA 3GUGA 3UZWA 4GCAA 3RX4A 1QWKA 2IPJA 3UYIA 3B3DA 3UP8A 2QXWA 1EXBA 3F7JA 4GQ0A 2R9RA 1S2CA 4LBSA 2PDIA 2FZDA 4JTCA 1PYFA 3LBOA 2PDLA 1AFSA 5JH2A 5LIKX 3Q67A 1MI3A 4WEVX 3LD5A 4YU1A 4QR6A 2F38A 1IHIA 4JTRA 2WZMA 4JTQA 4JQ2A 3ONCA 1MRQA 4GABA 3QKZA 2ACUA 2PF8A 3LQLA 1AZ2A 1M9HA 2PFHA 1ADSA 1PZ0A 3R6IA 2A79A 2AGTA 4FALA 4IJRA 3GHSA 2DV0A 1EKOA 1PWMA 3H4GA 4XZIA 1X97A 4XZLX 4ASTA 3M0IA 2NVCA 2PDKA 4H8NA 4ICCX 4WGHA 3EAUA 5HA7A 2NVDA 2PD9A 4QBXA 2BGQA 1VBJA 3RX2A 2I16A 3BURA
chains in the Genus database with same CATH superfamily
1VPQA 3K4DA 2XGBA 1V0KA 1CENA 2QDDA 4NP7A 3GDBA 4BHYA 3GXTA 4FEZA 1ZJHA 4LX4A 3U3HA 4DX3A 3DFHA 1O7AA 1QRQA 4W7VA 2WQPA 3ZO9A 1UC4A 3KEHA 4JTKA 3W28A 4HMCA 1R7OA 5CAKA 2CLLA 4NT0A 1R5YA 1ITXA 4UQEA 2DFAA 3WL1A 3N9RA 4A35A 1ZAHA 2FB2A 2BVYA 1C9DA 4MKNA 3N3MA 1OD0A 2GZXA 3EX6A 2XH2A 3CAWA 3L23A 4DNHA 5I5RA 1ONXA 3W7OA 3IVSA 1BQCA 1BQGA 4CLMA 2YJQA 2DJLA 3FIGA 2JGQA 1XQLA 3TMLA 3LHYA 3L7RA 4AWUA 3L0NA 1W9VA 5E9AA 4CU6A 1HO1A 4ZQCA 5LNVA 1GTEA 2OVLA 2NT0A 4RNJA 2B7QA 2NXGA 1Q65A 3GTXA 4PN2A 1RBLA 3DI1A 3ARVA 1CI1A 3N6JA 3W7EA 4DYKA 3DN5A 1BPLB 3GG7A 1FWCC 1XDJA 1ME7A 2DSKA 1V8EA 3VOGA 3G18A 1E9LA 1Q6LA 4FK9A 1KO0A 3U5YA 5H8PA 4QLLA 2D0HA 4JIIX 5A8GA 1XLBA 3GVWA 3LEPA 1EJRC 5CGQA 1C7TA 4DNMA 1RP8A 2R8WA 1V6YA 3L67A 3GG1A 4GX9A 3AHTA 2X7VA 1RH9A 4QG9A 3GDKA 1O66A 3WLRA 3L9CA 4GZ7A 3P84A 2ZRYA 3L21A 3NQFA 5K9DA 3PBYA 1E1EA 3B9EA 4LVBA 4DZHA 1DJXA 2Y2WA 3M64A 3A4JA 4S3CA 1TZZA 2J78A 1LORA 1S3HA 3OG3A 3VX1A 3W7DA 4WF7A 1C93A 4D6EA 4JOMA 1GW1A 4TR9A 1VS1A 1VZWA 4A2SA 3UZ5A 1XR2A 3MT1A 3PG9A 3RM4A 3AMDA 1JCMP 2WMHA 1R87A 3ZXWA 2H9AA 4D71A 2PRLA 1S2VA 4IP4A 2DSWA 3SY5A 1P0BA 3S46A 1P0EA 1DOSA 4S2BA 3THDA 4E8CA 1E6XM 3ATZA 4HMNA 3NR0A 1K7XA 1DE5A 2WVUA 2FGBA 3PWGA 2DVXA 2OX1A 1SQ7A 3LPFA 4Y9NA 3W7CA 3DBNA 4UTFA 3S0CA 3W9ZA 1WZLA 2AL2A 3OLIA 1V51A 3VKBA 2PDGA 2Q71A 5BWFA 4BWLC 4RL3A 1GPFA 3NWRA 3AHYA 3WDPP 2AOSA 4G7FA 1Q5MA 3DC8A 4RV3A 5JBEA 1VFFA 3GHRA 4DWSA 4LYQA 3GE7A 3TSMA 2HISA 3W88A 3PBMA 2HCVA 3BSGA 2A3BA 2QCDB 4LALA 4AQLA 4DUWA 3N34A 1H41A 1PV8A 2B7PA 2IXVA 4JX4A 4A05A 2QJIA 1QPRA 1KM4A 5C7HA 5CZJA 3FW6A 3CIVA 2XGZA 3R12A 4MDOA 3GM8A 5MF5A 1NQKA 4XWUA 1U5VA 1YNQA 2J77A 3NZPA 3EKLA 1KM1A 3EOSA 2FZMA 2PDFA 1J0IA 3BAJA 4KETA 2VOMA 3RCNA 1EP1A 1UP2A 3L2IA 3XIMA 1JUKA 3PUGA 1A47A 1K9EA 2DIJA 4A6GA 4UR9A 1EC8A 1KLZA 4ZQMA 5A8MA 1DJIA 4AC7C 1KFJA 3TLQA 1MQPA 5JMUA 5EA9A 2EKCA 2PZ0A 2W62A 3K4WA 2O9OA 1RA0A 3G1SA 3TWBA 3QV6A 2J7EA 3GKAA 4WDTA 3VZYA 5CSSA 2QUUA 4ZB5A 3F5JA 1R7AA 2H8XA 4C1NB 3TTQA 1FCQA 3M1ZA 1P6WA 1TKKA 3QV7A 3N4AA 4UTLA 1ISYA 1S5VA 1GORA 3MSRA 1HKMA 4WJXA 1XDMA 1E4LA 4EAMA 3K8MA 2WCAA 1IT0A 1L8PA 1UCWA 3DG6A 4XD3A 1KM6A 2QF8A 3GH7A 5KITA 2NUYA 4UQ9A 2VURA 3AXKA 4Q6XA 9XIAA 4JHOA 1DQWA 2YDSA 3IV3A 3RMJA 1WAUA 3DKLA 3C6CA 1YNYA 1BGAA 4WJ8A 3HV8A 2PDNA 1JVNA 5HUPA 3HFYA 3U2ZA 4GCAA 1IIGA 3NPXA 4GXWA 3B0UX 4AU0A 2R1KA 5TF0A 1HFBA 3MZNA 6XIMA 3B9OA 3IPWA 1S2CA 4HA4A 5A8NA 1E0XA 1F6KA 1RCQA 3W81A 2BG5A 1FWFC 1ZNNA 4UFLA 4LNYA 1US3A 3E38A 3NYZA 4JZ5A 4GFIA 2Q02A 1IHIA 3NSMA 3MMDA 3T40A 1MRQA 1H7RA 1WZMA 5KZDA 4GGHA 1LL4A 4WSJA 3HG5A 4O15A 2Z26A 3M43A 4C6QA 1AL8A 3WNNA 1O5KA 4TV5A 2REQA 3K1GA 5DQPA 3N1AA 3E2QA 3H6OA 2Y5JA 2Y6ZA 3G3DA 2EPKX 4XZWA 5TIMA 3W1LA 3THUA 4MNLA 4AX6A 5AC8A 5FF0A 2AL1A 3T8QA 1GEQA 1BTMA 4HPJA 1QK0A 3M0YA 3TLLA 3QSTA 3R25A 2P3EA 4PUJA 5DLCA 1RA5A 4MTVA 1PYMA 4HP5A 3PUOA 1XUZA 1T7LA 2OGJA 3WUEA 3ONBA 3W2MA 5FEXA 2CBUA 3W7HA 3HG2A 4BFAA 4Y9PA 4ADTA 3B4YA 1M1BA 1M53A 1EA9C 2WC4A 2NQ5A 2ZUSA 2JE8A 3RF9A 1HKKA 1VBRA 1H1ZA 1M3UA 2YBTA 1ZAIA 3W2LA 2BY0A 3M6YA 4B5VA 2I17A 2YFNA 4ZSTA 4Q4MA 3AHVA 1OFQA 4JHZA 1CNVA 4Y9AA 1TB3A 4IX0A 1TO3A 3QOKA 1VIWA 1IWBA 2YIHA 4R7JA 4K7VA 5DXYA 3C0JA 4I5UA 1VHNA 1J10A 4BA0A 4GKTA 4W85A 1K8CA 2EPOA 3QTPA 2VDGA 3BPWA 2WANA 4LB4A 3NA8A 4L6HA 2EO7A 2YA0A 4Q8WA 2X1RA 4ES4A 2XU2A 3N2BA 3L68A 4E6MA 1V3LA 3GHTA 1BF2A 4J3ZA 3T78A 3CMJA 3AHZA 4JN8A 1EX1A 1Q13A 3KBMA 3ZLGA 1XKJA 1Z89A 5FACA 4ATDA 1U33A 5C6MA 1C91A 1QDSA 3NQDA 4F66A 1OFDA 3EBVA 2X30A 3RDKA 4QS6A 1XLDA 5AN7A 5CSRA 1K9TA 3C0QA 3O2LA 1PB0A 4AD4A 1EJTC 3C5QA 2PDUA 4I8DA 4M5PA 4GO9A 2BP1A 3I7SA 1HQTA 2BZNA 3LG3A 2GVLA 1AD4A 1H09A 3A5FA 2W63A 2EPNA 2C1GA 1I6NA 4PUEA 1DVJA 3ARRA 3EB3A 3GVQA 3SZ8A 3SCVA 4UNKA 3TOYA 4S1FA 2GJRA 3GY1A 1XINA 3D3FA 2CLFA 3RIKA 3DENA 4XV0A 4B4HA 5CGMA 2HNHA 3AALA 3D0CA 1T41A 1XH1A 3L66A 3SCSA 3K4AA 1SUXA 4DJDC 1OCQA 2ZXDA 4KWUA 3EOEA 4M8UA 1RD6A 5D32A 4HSOA 1XLLA 1S38A 1AG1O 2E3ZA 4JIPA 4UMCA 3B4UA 3MI3A 4AD5A 1GZ1A 3L4YA 3M5XA 1C90A 3M41A 4KRUA 2KX9A 3DBPA 4Z1AA 5D4YA 3WH8A 2Y7FA 4DJFC 2YOCA 1SR0A 2NV1A 3VYLA 2WZEA 2BGNE 4DI9A 2UY5A 4RE3A 3TAKA 3SRKA 3DFPA 2V2HA 5M5DA 3PZGA 3SCPA 2W27A 3OLDA 3P3BA 1KV8A 4ZXOA 1I9CB 4CN1A 2BGSA 4GXMA 1XG3A 4C90A 2HK1A 4N4QA 2WVTA 1DWAM 5K7JA 3WBWA 2P53A 1BHGA 4HNUA 4TVUA 1PEZA 3KOXA 1V02A 3W87A 2QKFA 4UFMA 3VC6A 2IS7A 5C9WA 1WP6A 1SYTA 1W37A 1AQMA 4F9DA 4ZTYA 4D6DA 1JPDX 2NWSA 4DEFA 4IZGA 2XJ7A 5T9BG 4Z1YA 2J27A 2VD8A 1SZNA 4ADUA 2WSQA 2VTFA 1VJIA 2IPGA 4R33A 3A47A 2E8ZA 2VGBA 4HK6A 4L1GA 2VR4A 5K3VA 5FF2A 3BJSA 3M0MA 1GKRA 4M1RA 1TREA 1A80A 1GOXA 3WK0A 4WHBA 2G97A 3PPFA 4GIRA 4Q8PA 4BKNA 2JALA 1LF1A 1WQ5A 1FXPA 1TMLA 5E09A 4ALDA 1V7YA 2OGYA 4S3AA 1DWHM 5DY3A 1P48A 3FX4A 2GGIA 2VUYA 1DP0A 3U0HA 4A21A 1Y5WA 1KBIA 1ZS2A 4BQ3A 1V6TA 3SQSA 4GI9A 5CJ5A 1TPVA 1IYXA 3CUXA 3CEUA 3BLDA 4EPBC 3UJ2A 1SU5A 2R24A 3ZQ9A 1QWGA 3E0VA 3G5EA 3IIOA 4BZYA 4IMDA 2J47A 2XVNA 1ZZMA 4RXGA 1A5NC 4E5TA 4JTHA 1PE1A 1YX1A 3T0CA 3ZWTA 4MF4A 3TA6A 1P1MA 5FJPA 1OX4A 2BXZA 2HPMA 2INFA 2ABBA 3PZIA 4REQA 1ZBVA 1DE6A 2I5GA 2OLHA 4AZHA 1ZP3A 1OVDA 1JXJA 1XHGA 3VKDA 3GAYA 3M7WA 4J3SA 3EDJA 1I2PA 1ZLPA 5I3FA 1V93A 3SBFA 1FWNA 1RP9A 4GKLA 1G4EA 5BZAA 3PTKA 4QDMA 1O60A 3LD5A 4GINA 2OYKA 3SCUA 3W26A 1TE6A 1PCKA 1R2RA 4HNTA 4B5SA 1NEYA 1QHZA 2CITA 3TN5A 2V5DA 4OVXA 3B9AA 3SUVA 3B0YA 1WDDA 5HMDA 1TIWA 1YADA 2V5LA 1EJSC 1US2A 4W4QA 1HGYA 2E4TA 4JR5A 5EGRA 4LGXA 5DEZA 1RJRA 4NNAA 2OB3A 4H9UA 3VU2A 1HX0A 1L0PA 4ACYA 4HSNA 1H7PA 1A5KC 4RUBA 1QBAA 4O8RA 1I1WA 3OLGA 4FNSA 1RJQA 1VIZA 1M7JA 4AY7A 4PA8A 2BBFA 2DT3A 2GUUA 3S2CA 4G8TA 3SCQA 3UWEA 3W76A 1FHVA 3FA4A 3C2RA 3FAXA 3WFAA 4O52A 1GKQA 4LUTB 3TIMA 3E0WA 3R43A 1F07A 4C6IA 3QV9A 1DJZA 3WMSA 2ZCGA 6A3HA 2PWVA 2OSWA 2QVNA 1RK5A 1YKWA 3C0LA 4DJFD 4Q8OA 4X3ZA 1G5AA 1X38A 4GI6A 1UR8A 1HT6A 2DUXA 3LI1A 3PSWA 1VR6A 5A94A 3N2CA 2BNJA 1QI0A 3G0SA 3UFYA 1UWSA 1JDFA 2HROA 2Z28A 1G69A 3KLLA 4GX8A 5C54A 3E9AA 2EBNA 1ZENA 2JEPA 2DIEA 2GDQA 3AO0A 1B4KA 3OOQA 2OEMA 4UZSA 4NX5A 3H7VA 4NZ5A 2HDJA 2IQ0A 3Q58A 2BHYA 4BQ2A 4RK8A 4C6KA 2WM1A 2ONEA 4LYPA 1JAEA 2UWFA 1OEPA 3S5OA 3CASA 4CU7A 1PPIA 4YTUA 5D8ZA 2DZUA 3EKGA 1DQUA 3QZ6A 2VZVA 4JTJA 4PCTA 2QJMA 5I09A 5FI8A 2C6QA 2CESA 2D24A 3B8TA 1C92A 2HEJA 3L2LA 3UXAA 3HIJA 5F7UA 3VIMA 1VD6A 1Q7MA 3TFCA 4R88A 1P6CA 2Y61A 1M7PA 4X60A 1TVNA 3H54A 7PTDA 1XIEA 3B8WA 2OELA 5CJNA 2DQXA 4X22A 2LLEA 3QHNA 3DERA 3WO8A 3LCWA 2G41A 1LL6A 1XLFA 1C8VA 4CNNA 1JPIA 5IXEA 1S2UA 1V0LA 5LA1A 4Q8NA 3NGFA 2Q09A 2J8TA 4I90A 3T09A 5CC3A 3BAIA 2DQWA 3BW3A 2W9MA 1KXHA 1LWHA 2E8YA 3FEQA 1BRLA 4PSRA 4C7GA 4A4AA 2V67A 3IIZA 2VR2A 4WOQA 3ABSA 1V6UA 3TJLA 2ZWZA 4QSFA 2E9MA 1SMDA 3MUCA 1OX6A 1CXHA 5BRBA 4AYSA 1XS2A 4M81A 4YLWA 2VCBA 2FB3A 3TP4A 1N82A 1F3TA 4EOUA 2JGYA 1GT8A 3EWWA 5D33A 1DWGM 3SW6A 2YDRA 5JXQA 1A5UA 5BROA 5U7SA 3C8FA 3OHMB 4I3GA 5DBUA 3RHGA 2OSXA 4QDWA 3W6LA 3G1HA 4DO6A 3R89A 3GW3A 3CAQA 3GFZA 5HBFA 4K1WA 8A3HA 1GQIA 4D2JA 3P8JA 2F61A 4LS2A 5ABGA 4JFWA 1XL9A 4ZO8A 3MBDA 2YA2A 1K4GA 4L9ZA 1X6LA 2ESCA 4LUIA 4PMUA 4UFHA 4GOAA 1PL9A 3MZ2A 2C19A 4MPKA 3GRIA 3WEMA 1SFSA 5CKSA 2QCGA 1E70M 4RDZA 3TC6A 3BXWA 4YN5A 3TH6A 3KS6A 3M5YA 5FOOA 1H1YA 1EH9A 1IEWA 1UJQA 2PDQA 1KRAC 1B3ZA 4A8RA 3S42A 4INFA 3C3NA 4GUJA 5I3IA 2DORA 1XGEA 4S3DA 3H2MA 4QJ1A 1KLYA 3W73A 3EB4A 2WPBA 4I8YA 3EEGA 3RK8A 2WHJA 1YIXA 4W93A 4XUGA 2W3ZA 3LLDA 3DEQA 4NY2A 3ANUA 2NQLA 3KDNA 1Q6QA 4J3TA 4NILA 1QOXA 2PD5A 2QHAA 1KXVA 5IHSA 4CD7A 4GLEA 1CLXA 3XINA 5G2HA 1QW7A 3H26A 1WNOA 3SGGA 3UA4A 4JTSA 4JDYA 5DCDA 3UWVA 2R94A 3BLPX 2VYOA 3ANYA 3POCA 3QYQA 5C2CA 4A29A 3LCXA 1E6QM 4CD5A 1A3WA 1UD6A 2ZX5A 1QHPA 2C3ZA 1EEPA 4NI8A 1UROA 4WKAA 5LA2A 5HJXA 4JY9A 1RV8A 3KBVA 2ODOA 4GIAA 3NM3A 2HMCA 2CWXA 1IQ8A 3GVRA 2WHMA 2G37A 1YMYA 4KWSA 1PYFA 1KWKA 3JR2A 4O16A 1JAKA 4O0KA 5LXEA 2X09A 2Z2UA 3SI9A 4V33A 2FMOA 3DHFA 1HKVA 2V2CA 1TFVA 4IPLA 3T2OA 3UERA 3D6NA 1RPKA 1H0GA 4IFRA 3EDFA 3GAKA 5K4ZA 1Q66A 2FHFA 3P14A 4LRSA 1M68A 1QOQA 3OPSA 2AGTA 1PSCA 3QPZA 2V8ZA 4IGNA 5KZMA 2B31A 2WMKA 2G3IA 4AWTA 4MLRA 5EBUA 4QTGA 2DUAA 5A2BA 4IIDA 1MVYA 3HZ3A 4ICCX 1UR2A 3VD4A 4Q4SA 5HA7A 1TA3A 3UWWA 4HTBA 5AC5A 4GJJA 3W7NA 1GVQA 2WCGA 1AJ0A 3E2VA 3AUJA 3BG9A 1MNSA 4QJ5B 4JKMA 5HJYA 3HFTA 3WIJA 4OU1A 3TCEA 4R85A 2C13A 1BLIA 2ZRWA 3MCMA 4HOXA 5D37A 4YS1A 3U4FA 3PZVA 1ODZA 4RZBA 1F3EA 4OHQA 1ZBWA 3A4AA 2RUSA 2Z24A 5JQ9A 4HHMA 1XFCA 4GYPA 1E51A 1X7FA 1R9XA 1LLZA 1F7BA 1TTIA 3W1PA 3R10A 2W5FA 3USBA 3IJ6A 4LS1A 3AZRA 3NVDA 1U5JA 3WD1A 2F9RA 3FAWA 1UD8A 3UESA 1HP5A 1D8WA 4GCXA 1HJSA 7CGTA 3KZPA 4U4MA 3FDGA 3CTLA 1QO2A 4RZ5A 3NDOA 3W74A 2PS2A 1GOOA 5A8PA 4K8EA 2YCJA 3W7GA 1CEOA 1Y8BA 1D2KA 1Z44A 2A1YA 2V5JA 1J5TA 2VC6A 4PBFA 1KBKA 4G7EB 4AZIA 2UZ9A 5A5WA 3WX7A 4TV6A 5FL1A 3IGXA 3GBDA 3S5YA 2QV4A 4ORMA 3WFZA 4LWWA 4TX6A 3ZIZA 4ZVJA 2YL5A 3S5SA 1K3UA 3ITTA 3WQFA 5D02A 2OZ0A 5DANA 5C9XA 1GVSA 1HL2A 2GK1A 3ME3A 1QASA 3BSMA 3K5XA 2FZBA 3V0UA 4XZMX 5ENLA 1HKIA 5J8LA 3S5ZA 1RCOB 2PB1A 4FNPA 4JPGA 5DCBA 5AKQA 3EWBX 1QNVA 2O4QA 3M07A 1UZHA 1F61A 1YE4A 1T6MA 3LPOA 5AZ1A 2RAGA 2YKKA 1NARA 4MZ1A 3L2MA 2WZHA 8XIMA 4DF2A 4YXGA 3VGGA 3LSBA 3CZGA 1LOLA 1V6XA 3VIHA 3APYA 3EA1A 3V7PA 1G01A 1RR2A 3W27A 2E77A 2V5CA 3W29A 3QMTA 4OV4A 3B8SA 3NGJA 1XCWA 4D6JA 4D6CA 2ZA2A 6ALDA 3EGJA 3BMXA 4MJ4A 2ATSA 1UKSA 2X2YA 4CQ9A 5A8OA 3GK0A 4QSHA 3VNLA 2ZVRA 3R0UA 1ISVA 4E8GA 5CZTA 3AWOA 1W0MA 5JBFA 3IRSA 2E40A 1JQXA 2PWDA 2OPJA 5JIWA 3PK7A 4LBRA 3K46A 3MCNA 3AXMA 1UKPA 2ZKMX 3ES8A 4C1KA 3NZGA 1TUXA 4P7RA 1JCJA 5I2UA 4PRRA 2XM1A 4BI7A 4EWJA 1FCBA 2XFRA 3BICA 2AQWA 4DF0A 4QISA 4XQ6A 3LY0A 4E2OA 4A3QA 5DT5A 5K4XA 1EDGA 3TAOA 2OU4A 4AH7A 2XH4A 3IUHA 3B8UA 1KFWA 2BOFX 3GWQA 1A3HA 1I0DA 1H0IA 5DELA 4KWWA 2NLIA 5EBAA 4XAPA 3OEXA 3IJ9A 4GO8A 4JL1A 4WDUA 2FPTA 4H1ZA 4QHRA 3BCDA 3W1AA 2OZ8A 3VDCA 5FJOA 1TRIA 3HMCA 3TOPA 3LENA 3P67A 4A2RA 2HK0A 3PBWA 4ATLA 1O95A 3MQTA 1XYZA 3QHOA 4AISA 4C65A 4B5NA 4GC4A 1KCZA 3GDTA 5HATA 3EX4A 3QGKC 4U2ZA 1E3ZA 1TPUA 4IUOA 5CGTA 3B8IA 3B04A 4UR8A 4BS0A 3WQVA 3CUJA 4H9TA 1KV5A 1J0KA 3VK5A 1XIHA 2HPIA 3TSDA 2QPXA 3A23A 3GR8A 3TYDA 4ZB2A 4ZE4A 3NZRA 1NDWA 4Y9OA 1QTWA 5HR7A 2PA6A 3E2SA 3VUPA 3EWZA 4CN6A 4L64A 2A3CA 1NM9A 2FIQA 4N9DA 3EXSA 1NDVA 3MHFA 4XZ9A 4BI6A 4BEQA 4IIGA 1F3XA 1B9BA 1EZ2A 2G3FA 4UOZA 4J40A 1E9YB 4AIUA 1IF2A 4D8LA 2YA1A 2J9ZA 4QQUA 3BMVA 2E6AA 4JKKA 2YYUA 2JKPA 3U7VA 1KCKA 3FOKA 4QRNA 3VCNA 1EXBA 1ZHAA 1VJZA 1JDCA 2CWNA 5AYYA 2CC0A 1YPFA 2PDIA 2FVKA 1WA3A 2I9UA 5I79A 4UTIA 3EWYA 4IWWA 1XW8A 1ZPTA 3ZWSA 2VEPA 2EPHA 2Z2AA 3QR1A 3TC7A 1OB0A 2ZIDA 3HQOA 4IX2A 3A21A 4Q33A 4QR6A 5A3HA 3W02A 2FJUB 3E6EA 5E5CA 1V79A 4FIQA 1N55A 3WQ5A 4ROQA 4UTKA 5CLWA 2PF8A 3V5FA 3PFMA 4DY1A 1UJPA 1PZ0A 2DZVA 3O6AA 5D03A 5F1VA 2E6DA 2E1WA 5E6YA 3GHSA 1SO6A 3VMOA 1I2QA 3MI6A 4A3YA 5FJTA 2PRMA 3UJRA 1GYLA 1JNDA 1FWWA 2QT3A 3U7BA 3TUUA 4ASTA 3HPFA 5CSUA 1VFTA 2Z25A 2J6XA 2NQHA 4BF5A 2Z1XA 3L5MA 3TQVA 3HJEA 2NVDA 1KGXA 4N9EA 3PJUA 4AFYA 4KRZA 3H2NA 3K8KA 3STFA 3NPUA 5F2MA 4DELA 3BWWA 1W2PA 5FAGA 4ZCWA 5EKYA 3KRSA 4YJ5A 7TAAA 1B90A 4YHGA 5I3JA 2JF7A 3ID7A 3MWAA 4R9OA 2D0FA 2OSYA 1S5TA 3BMWA 2P76A 3WJZA 1K9FA 2FZNA 3PFRA 2DW7A 5CCZA 3SY1A 2CNCA 3KVMA 3DDMA 1F74A 3PVFA 4KH2A 1OFAA 1HXJA 3OGSA 3WJXA 4BWLA 2ZZ5A 3UA3A 4DWSD 1T96A 2Z4GA 2WVVA 4S2CA 1K70A 4FAMA 3JZEA 1M03A 4R7WA 3WQDA 4HCDA 3NQ6A 3PJXA 6ENLA 2GQ8A 2C14A 4LUSA 3LPPA 1J01A 2VOTA 4CEXC 1RLCL 4DIAA 2ISVA 4AXNA 5IDIA 1Q85A 4IM4A 1R30A 1ZBKA 2A7NA 3NSNA 4V27A 3EWDA 3BG5A 1XBVA 2PDYA 4HMDA 3WD2A 1JD7A 3KWSA 1EGVA 2E1DA 2A0NA 4H3DA 3W71A 1GHSA 4QFUA 1XP3A 4QITA 4JL2A 3LGEA 5HNRA 4WIWA 2ZUNA 3E0FA 1E0UA 4N6FA 1OX5A 1RD5A 2HBVA 3W7RA 4DI8A 1RZMA 3C2VA 3EPMA 1PKMA 1YHTA 1X1NA 3RCMA 4IJCA 3CYVA 4A3RA 3TYEA 1OCJA 2X1UA 3CZLA 1VBUA 4U28A 3QSRA 1QVBA 4MFDA 3CZEA 1W1VA 3A3WA 1LDCA 3R1ZA 5GNYA 3ZFHA 5FF7A 3SUSA 5KZEA 1SO5A 3C86A 1LQ0A 2B0MA 4PB3A 5D9OA 2ZC1A 4EXBA 4H8UA 2A3HA 3MP5A 1CGUA 3KP1A 4D72A 4NZ1A 1AVAA 3BJTA 2INEA 3NO1A 2WYSA 2QCHA 1KW1A 2WPGA 4XZHA 1EL3A 4FA3A 4C6DA 4RR4A 2TYSA 3CK5A 1AODA 1FDYA 2XDFA 3QW4B 4FXFA 4YWSA 5LNRA 2HVOA 1F2JA 4KIEA 1FWRA 3TTSA 4RPQA 3T2QA 2RHGA 1FFRA 1J8VA 3VGFA 3SN0A 3DAQA 3VNMA 2D1ZA 2FHBA 4JD4A 3R0KA 4XZBA 2J8FA 4D9PA 5I24A 3URBA 1IXPA 4Z2GA 1AW2A 4GVHA 3EMCA 3IRDA 5CEWA 1V3IA 4ZO7A 4MJZA 4UQDA 5EFDA 3RO6A 3LBMA 2FYMA 3U48A 3TJ4A 3T1GA 2Y7GA 4LH8A 1LJYA 2GSHA 2ZZ3A 3BO9A 2XG9A 4Y6GA 1EQPA 6TIMA 1AMYA 1OT2A 5HOSA 1JD9A 3ZR4A 2FVLA 2VL4A 1N2VA 1L2QA 3KVKA 2CPUA 1LBFA 1KFKA 2IKIA 2WJZA 3TN4A 4MB5A 1KM0A 3GNXA 2IQDA 2F2HA 3EX2A 3QJAA 2PTDA 3PTMA 3AYSA 3W86A 1FP9A 1X39A 3LERA 4N2YA 4Q7NA 3M7SA 1MQRA 1C3FA 5A69A 1EWEA 1MSSA 3A5VA 2D23A 1EZWA 1LROA 4QX4A 4F2BA 1R3RA 5K2ZA 3T42A 5A6BA 1LBLA 5DMYA 1TZ7A 1PDYA 2DZPA 2BXYA 1B2YA 4U2YA 5T91A 2NWRA 3LZ3A 4XD5A 2ZICA 1QI4A 3KTSA 3F4WA 4AX7A 4HK7A 3UY8A 4E4UA 1M5WA 4MIMA 1B57A 2GUBA 2GDVA 5IFTA 1Q4NX 1G4PA 3RX4A 1PZ2A 4NASA 4Q7IA 3AICA 3NDYA 2HBXA 5CC7A 5FSDC 4J35A 1KXQA 3FYPA 4GQ0A 4FF7A 5TQLA 3VPLA 4Q22A 3PY2A 1R3TA 1XPGA 5E0KA 3MKCA 4O8AA 3N3TA 3H55A 2C15A 2VFIA 1QW8A 3CWNA 1XD1A 1M04A 3DFTA 4Q8MA 4I7VA 3UF9A 2OZ3A 4M24A 2OG9A 4JTRA 1W1PA 4AC1X 3KS5A 3WBAA 5H6HA 2O4MA 4LW7A 1DBTA 4ZOEA 4R9XA 3UEQA 2YSWA 5LNUA 4KEVA 3ENLA 4C1NA 1GQKA 3Q45A 4O53A 5TAOA 1FDJA 4LRTA 5G2IA 4PB4A 1B3XA 3HQPA 2X1IA 2QJJA 1EWDA 3VZZA 2DV0A 3KCOA 4MB1A 1NTHA 5I3HA 5ABTA 4LUJA 3K30A 1R9ZA 4O1DA 1M01A 2V9DA 1XRFA 5HQEA 2NVCA 5H1WA 3OG2A 3KWXA 3CB8A 2VVSA 3TQ0A 5REQB 4QLJA 2X05A 4RPPA 1FWDC 4DF1A 5AOUA 5KEZA 4L5ZA 3RPDA 1UUOA 4MKVA 2QR6A 4NSBA 3GQYA 2WSRA 3AROA 3CPUA 3WEZA 3EZ4A 1MWOA 1V02E 5JU6A 1GZGA 1QI5A 3SECA 4CVWA 2QGYA 3OYXA 3NYDA 3NXLA 1GOIA 1XFBA 4WY0A 1ZALA 3EWCA 5E0CA 3GIYA 1VP5A 2BHZA 4O10A 3QM3A 3PUDA 3S3GA 5F2GA 1UA7A 4EXQA 1XLIA 4G6CA 1DXEA 2XVLA 1UMYA 1ADDA 1S39A 5F4XA 5JUVA 3DG3A 4PMYA 2RGLA 1QR7A 4IP7A 2PDXA 2WOQA 1G7UA 4UUIA 3QFWA 4O1CA 3N15A 4M80A 3SADA 4DWDA 4TMBA 1UB3A 1RQHA 4C7DA 2Y8VA 3BLKA 3LQGA 1RY0A 1XD0A 4I6KA 1A4MA 2XFWA 3T6CA 3FJ4A 3OP2A 3RFAA 2PCEA 4NZJA 1TV5A 1JULA 4MAVA 4OBSA 1LRQA 3M47A 3VGBA 5AC4A 4HNCA 2X41A 4MG4A 5C2XA 4RE0A 4QNWA 4GZEA 1VB9A 1GCYA 1YE6A 4YPJA 1UQZA 4NXKA 3WH5A 1KBLA 3EPNA 3FVDA 4JDBA 4LAKA 3ATYA 2JBMA 4YWIA 1E55A 2QEZA 1TSIA 3V18A 1GZJA 1XLJA 3UNDA 4I9TA 4GRSA 3LM7A 4AMCA 2E9BA 3ALFA 2WCSA 1UOZA 4Z2HA 1UP3A 2XINA 1E72M 4K3ZA 3OW1A 4X9SA 1X1OA 1X7IA 4RDWA 4B5TA 3O9NA 4DLFA 4DLMA 2O9TA 4N0RA 1XICA 4O0QA 3CUIA 2NQJA 3KTXA 3M9YA 2FDSA 4XIAA 4AWSA 5I00A 4FXSA 3KBSA 5HQLA 3C61A 8CGTA 1UW9A 4O28A 4UWMA 4NHVA 2Z1KA 4ONVA 4J5NA 3GIQA 4G56A 1JL8A 3QQWA 4DVOA 3KBWA 2BDQA 3MKKA 1L6FA 4GJ1A 3CV1A 3MBFA 4UXDA 1D3HA 4F0HA 1XRTA 3GZ3A 3WYZA 5IOBA 2POTA 4YVPA 1HJQA 1HJXA 3PN8A 3BOLA 1RALA 4FO4A 1I1XA 1M7OA 1K7EA 3RRAA 4V28A 3M46A 3I3DA 5I0DA 4A3UA 4N42A 1CLVA 4XISA 2PWGA 2OT1A 3SDOA 2F7FA 3PTQA 2QAFA 2CIPA 1Q7ZA 1P6BA 4J3UA 1KFBA 4U10A 1NJJA 2PF0A 2ZUMA 4PL1A 2YCEA 3NPVA 4Z1DA 4L1WA 4J7RA 1EHNA 4HHPA 2GJLA 3V36A 3WD3A 1EF2A 3LNMA 2NUXA 3VD5A 4KCTA 2G3NA 5HINA 2DSVA 4GA8A 4AVOA 1LRNA 1XLKA 2NQZA 4EVZA 4WDXA 2EAWA 3L4UA 4DWSB 4IIHA 2ATMA 3I10A 1R86A 1RHCA 3UBPC 1L9WA 2WWDA 1L2UA 1O1ZA 2OMAA 3EX3A 2P50A 4IH3A 5EMLA 4IQJA 2H8ZA 5SWUA 1DHKA 3GDRA 4TIMA 4O19A 1E40A 1VAHA 1TZ9A 1YNPA 1ZJBA 3TR9A 3WLTA 1VHCA 1E5NA 2ZE0A 1LWIA 1K7FA 1FWJC 3GLCA 3GXFA 3K13A 3DYOA 2FZ8A 5G5IA 2ZX7A 2VI0A 2YBUA 1GGOA 5GJMA 2QDGA 1XYAA 3QKEA 1T5AA 2GQAA 5AYIA 1OIFA 1QPKA 4L4LA 4EWND 4NXSA 4WCJA 2J4GA 3B05A 2WMIA 1YLVA 3NQEA 4YCPA 3BLEA 4CVUA 4XTDA 3P62A 2Q3OA 3AYTA 3AXXA 1JZ8A 5A2CA 3PZMA 2DSZA 2XVKA 3S1XA 3G1AA 4ML9A 3VKJA 2FGZA 1V0NA 5CPTA 4H4IA 4B4FA 4LYKA 2J8GA 4JX6A 2GVGA 2CBJA 3SRHA 4F8XA 5AHMA 1TV2A 3D46A 4DQWA 5IBXA 1BVZA 1SJBA 1BWKA 4AZGA 3TZFA 3QOMA 4MUPA 4O0ZA 3C0SA 5XIAA 3F7JA 5LZLA 1SFLA 3PBGA 5GNZA 1UWTA 3MUY1 4O1FA 2GGJA 2ZX8A 4WEVX 1U83A 4F2TA 1IXOA 1JYWA 1LTDA 3DFOA 2EQDA 2Z0IA 4WR3A 3WF2A 5AY7A 3UXKA 4QLKA 4XAZA 2Y85A 3RITA 4JHMA 1WOAA 5E1QA 3LQLA 3ITLA 2PFHA 4O17A 1E4NA 3NEHA 4O57A 2VEMA 3U2EA 1P43A 1O94A 4IJRA 3I6TA 3DIPA 1N8FA 3WDRA 3LV5A 2Y5SA 1XBZA 1EKOA 5H8MA 4RLIA 2J9YA 1J18A 3PNUA 4F4RA 5PTDA 4XZIA 4CEUC 1MEIA 1A4LA 3SSJA 1QXLA 4AIBA 2ADAA 1QUMA 2V38A 3WLPA 4UNIA 3TSBA 3B06A 6TAAA 1W8GA 4MVAA 3EOUA 1WKYA 1RK6A 3TXZA 5ABEA 3SAZA 4KCVA 4WY0F 1VPXA 4GUIA 1N8WA 3JUGA 5C9ZA 1CW2A 5M2FX 3CWOX 1W1ZA 3BGJA 1IXNA 4ACZA 4JTEA 4XAFA 3KHDA 4OIFA 2HE8A 1VC4A 1UD5A 4GYPC 3WEOA 3AYVA 4EF9A 1JCXA 5HXMA 3LDVA 1KA9F 1SW0A 2TSYA 4GUGA 4UCGA 4L4PA 3G6MA 5EMKA 2QLYA 4LF1A 1SGJA 4M56A 3RR1A 2DT0A 2ZUVA 4W5ZA 3DYPA 4IQLA 2D73A 3H2EA 3TYZA 3N12A 3TYUA 2NXIA 2CW6A 1B31A 2JQXA 3TTYA 1V77A 3CH0A 4Q8UA 4GY1A 2HZGA 4AVFA 2WJEA 1C8QA 3LCHA 2HVMA 4PUKA 4R34A 1HZYA 3W1NA 1FQ0A 2F2KA 3T4WA 3NL3A 4IHCA 2DY3A 3PBVA 3NZQA 4HB7A 3M0XA 2ABAA 1J4EA 4MAZA 3VIPA 2Z00A 4PCNA 1M7XA 1XIFA 1X98A 2ISSA 2DH2A 2J7DA 2ACQA 2YW3A 5GJNA 2J7HA 2GJNA 4WUIA 2EF9A 1ODUA 4ZMGA 2OJPA 1REQA 4Q3MA 5BNKA 3T05A 3PAOA 4PRTA 2VCCA 4HIBA 2DT1A 3HBLA 4JTDA 4WSHA 3VIKA 3ZSSA 3THCA 1XH0A 3PB2A 3W7PA 4LUTA 5L9FA 3NTYA 1KKRA 4Q6JA 1RBOB 4LUYA 1OWQA 1E6PA 2XUCA 2VQTA 1FCVA 2D69A 3CUZA 5I3DA 4J1OA 4L4MA 1TX2A 3MUAA 2WO5A 5AYXA 3C2FA 1PXGA 3LN3A 3W85A 4XVEA 3W7MA 3REQB 3CUHA 1S1PA 1EJUC 1HIZA 2RFGA 1OY0A 2VD9A 4OWGA 1MXSA 3PTDA 2WMFA 1J0HA 1DIOA 2Y7DA 2V30A 5FA5A 2F6XA 4E0CA 3S6DA 2YL9A 5G4WA 3RCYA 4C1LA 1EEXA 4PULA 4UOQA 4EAYA 3A22A 1PX4A 2DVTA 3M0LA 3HG4A 1SSDA 5AZ0A 4ZQOA 1R46A 2PODA 2Z6JA 1V3HA 1H63A 4Z2LA 4M6PA 3WJYA 3VE7A 4MJ2A 1DORA 4Q32A 4LANA 2H6RA 4DM2A 1MEHA 2BLEA 4FNTA 3ZS4A 1Q4WA 2B7OA 1VFSA 2QF7A 4GH1A 4L65A 4AXKA 4JY8A 4RZ6A 2J6VA 1QNOA 2ACRA 1WBJA 4F79A 3E2RA 2FKPA 1A5LC 3CH9A 2V69A 5BU6A 3RM8A 2BOGX 2EPLX 1VFHA 3T81A 4TVCA 3HPXA 5AC6A 4FX8A 4HK5A 2X0HA 2EKGA 4AEOA 1SJAA 2BY2A 3O6YX 1H7OA 3C56A 2VKZG 1XSJA 1VBGA 1EP3A 1LT8A 1Z7AA 3URNA 1EOMA 1W3NA 4M0XA 1L6SA 3ARZA 3GS6A 4KW2A 1EX5A 1EA0A 3V0SA 1MXGA 4N02A 1CXLA 1PHQA 5B7YA 5D2WA 3V1PA 2I1OA 3ABQA 1QNQA 3OVGA 4AF0B 3UY7A 1BG4A 1DXIA 1W5NA 1DJGA 1W5OA 4CCCA 3OIHA 3USZA 1UPPA 4EPDC 4LU0A 2GL5A 3M0HA 2XPKA 3W2JA 5BXSA 3UXLA 2VUNA 1A0DA 2Z7KA 1E6RA 3G0UA 4LB3A 2CU0A 1KR0A 1K02A 3OVRA 5H91A 3TVAA 1D7KA 1JYVA 3B8VA 2A3LA 3IIVA 3L12A 3AISA 8XIAA 2WAGA 3GHUA 3VINA 1WZKA 4JFTA 1XJBA 2OKOA 4HHLA 3N29A 4FF5A 3AI0A 3W2NA 3LHTA 1XLHA 4KPLA 2ICSA 2VDHA 2ZRUA 2VWTA 4EANA 1TVLA 2XVGA 3S4TA 2PSNA 1TVPA 1NOWA 3A13A 4MOZA 1S3TC 3VD9A 1I60A 5ABHA 4RE2A 1QNRA 2VMFA 4LBSA 5LYRA 1HGWA 4Y90A 3F2CA 2FZDA 4JTCA 5GNXA 3LLFA 3OZOA 1UMLA 3E0LA 2DW6A 3H24A 3INPA 5D09A 3GNDA 2QS8A 2OEJA 3AS3A 1H5VA 4QE5A 2YLLA 3LLXA 2YBVA 2A3AA 2WZMA 2VC9A 4LOCA 5A6JA 1E4IA 4JXCA 3PPGA 2FVMA 4REQB 1MZHA 4AAJA 3N2XA 3GG8A 2ZE3A 1AZ2A 4ZZ9A 1NSJA 1F8IA 4UTTA 1UG6A 4F2UA 1HUVA 4Y8FA 3AIVA 2WKLA 3MMUA 3HMJG 3WENA 1PZ3A 1HN1A 4PTWA 1FP8A 2C1HA 3NQ7A 4GYFA 3TN6A 3TROA 1UWIA 4H8NA 3OVQA 3L4ZA 4RDVA 3UYCA 1PAMA 4U31A 3M44A 5BU9A 1XH2A 2GGEA 4JFUA 4TUFA 5J04A 1ELSA 4UFKA 3SQLA 2WWCA 4F0RA 1LYXA 2BB0A 1JCTA 3TMQA 5C70A 1A0EA 4OFCA 4OECA 4S3JA 1XYCA 4FOUA 1VCFA 4YYCA 4IJBA 3PZ9A 1TV3A 1J6PA 3N4FA 1ALDA 1K4HA 4Q4QA 1VENA 5HAOA 1XBYA 3II1A 1E1CB 3RYSA 3R79A 5LIWX 3BVJA 4ZFMA 3GBEA 3ZJKA 3EX1A 3FXYA 1E15A 1LRTA 1MW3A 4KF1A 1OFOA 1KWGA 3OZMA 2PTYA 4NL1A 5I03A 1W9UA 1V0MA 3LZ5A 5C5YA 3GX9A 2BASA 3CJPA 4NJIA 4C6NA 1G0CA 2CXEA 4BQ4A 1ECEA 3GD6A 4KEZA 2X42A 2QDEA 2OXNA 4CNTA 5DCEA 2YCIX 4HU3A 4JNZA 1T8QA 4NKCA 3T0AA 5GQBA 4OTKA 4EPEC 1Q6CA 2BY3A 4AZ7A 3WQOA 3HTWA 2Y4SA 3BG3A 1QATA 2Z1SA 4AWEA 2PDBA 4FHAA 5BOEA 1YXDA 1BD0A 1TCMA 3B0VC 2IKJA 4L6OA 1WX0A 1KFLA 3M16A 1K6AA 4F0SA 3W07A 1E71M 3BZGA 5K9CA 3AJXA 4P8UA 4ENLA 3OA5A 4JEQA 4FNQA 4D8AA 3WQGA 1GQJA 4NG3A 3RRXA 4ZGYA 4DZIA 4CNUA 3WD4A 2RJHA 3N9SA 3T2PA 3DXIA 3PBUA 3A12A 1JYNA 3IEBA 4LAUA 1QI3A 3VI2A 2YGYA 3ARXA 1QT1A 3H4WA 2XIJA 4Z42C 1SZFA 1DTUA 3H7UA 3BW2A 4IP5A 1JPMA 4AHQA 3A4XA 4C6PA 2CBVA 2V3EA 4KEMA 1TR1A 1CGXA 4XSLA 3N04A 1W9XA 2O7SA 1ICSA 3RLVA 3TYCA 4LY8A 3NOEA 4LPCA 3KOFA 3TFXA 5CPMA 1KCXA 1FRBA 1WDWA 4G7EA 3N18A 3HPSA 3QFEA 2OLAA 2GJXB 3A3XA 4KS0A 1HKJA 3IJ8A 4XAYA 2VO5A 3VNKA 2BFGA 2BXVA 4AZCA 4H04A 5CZ0A 1LQ2A 2NXHA 4Z2KA 3M0JA 4DBWA 3GC5A 4GUHA 1PO9A 1UR0A 5F4SA 4BF7A 3UCCA 3WDQA 4FP1A 4W8LA 1H7NA 2DJXA 4L9YA 1QNSA 3R7MA 3HJZA 3W38A 3U8GA 4IGMA 3AXHA 5HPCA 1TELA 1ZP4A 3QEZA 3VD7A 3P5YA 1HG3A 3WK1A 3TQKA 1BRLB 4N7QA 2O9RA 5DY2A 3KCLA 4RXFA 4WQ6A 5D2TA 1GTHA 4NAEA 4NJHA 3U5UA 1JG9A 3BQ6A 4MKSA 3D3AA 1HJVA 1DWJM 3LXAA 1HTIA 2VRQA 4O50A 4ZL1A 2QJGA 4IMAA 2CBIA 3G77A 1DIEA 4QGCA 3EKZA 3I6RA 4G9PA 3M0VA 4ZR8A 3WNPA 1GNXA 3LCFA 4HPHA 4N9CA 1O4UA 2PGEA 1VEMA 4D6IA 2XYLA 1QW9A 1QJWA 1F05A 5HMFA 5LNWA 1MW0A 2PTXA 3NIYA 1UWQA 4YVVA 1NF7A 4DO4A 3EA3A 2ON3A 4GBDA 1ZGDA 1B3OA 4BJHA 1L6GA 2RDTA 3P81A 4PH6A 2DIKA 3QTGA 2UY2A 4Z08A 1IZJA 1P0KA 4AIEA 1GVYA 2A85A 2VM8A 3BLIA 4L6DA 1K8XA 1TWSA 1EDQA 4Z2JA 2BX7A 2DH3A 2IKGA 4QCEA 1W56A 4F0MA 1RY8A 2E6FA 3EDKA 4XX6A 2V3DA 3WQWA 1MFVA 1JDAA 4H7CA 2YL6A 1H2JA 4O4VA 1AZ1A 3H2FA 3OJGA 3RJYA 3B97A 1YTDA 3CU2A 3HURA 1FWSA 4ZFCA 1W9BM 1OHLA 1IEXA 2ZZ4A 5F2LA 1NU5A 5CBJA 3SN1A 4ICNA 1UHVA 1TPB1 3DI0A 1XCFA 3AMKA 4DJEC 1KB3A 1TWDA 3UYIA 2ASHA 4DN1A 2E5DA 1GKPA 1KRCC 2CXGA 2R9RA 1FVPA 4GI8A 3E0IA 1JDDA 4QG6A 4Q4OA 3WLMA 2CHOA 3MMWA 3QRHA 2XH0A 4N6EA 3W00A 4O18A 4PMRA 4YU1A 4B9YA 3TC3A 4NZFA 3K2GA 1TG7A 4MGGA 3V16A 3UG3A 2ZA3A 3CT2A 5KSWA 2EGZA 1XDLA 3GTFA 5CPLA 1KTBA 2NSOA 1BKSA 3NJ3A 3JU2A 3TK7A 3PULA 1QFEA 2Y24A 3LRKA 4KRTA 2V6AA 4P7NA 1AK5A 3LS9A 3MA8A 3CZKA 5DFAA 3AU2A 3W70A 3N11A 2VELA 3I65A 1Q6OA 3H4GA 4H6RA 3BJFA 3HGJA 7A3HA 5D9NA 2VEKA 3FYYA 4IMEA 3A9BA 4AEFA 2OQHA 1TTQA 4PRWA 2ANUA 4LY4A 5LXXA 2FH6A 4MB4A 2J9XA 2DZAA 2VFDA 3FDKA 3GU1A 9CGTA 3MV11 3BURA 3VKKA 4H8VA 1KKOA 3UR8A 5DRIA 4D6HA 1HKWA 4MNMA 2JFEX 1KGUA 3NQ8A 4UZUA 1W1TA 1XGZA 4OT7A 4WRHA 3SUTA 4DZ5A 4K8GA 1THFD 3MSDA 1CTNA 4PMNA 1W8SA 2V3FA 3W7LA 4BR1A 3V75A 1E43A 3L4TA 4LS0A 3ZJ7A 3OIXA 3QN3A 1KNWA 2EHHA 4JNYA 2YB4A 3FVMA 1A5OC 2XM2A 4HJFA 1U1HA 1HJUA 4ZOCA 2GSEA 2YL8A 3LGDA 3TCSA 1ZCOA 3CC1A 3PNZA 2HS8A 4HN8A 5LIUX 2WC3A 2G4FA 2PBOA 3HV9A 2H3DA 2X7WA 3RN6A 2CCRA 1G7VA 3VA8A 4ATWA 1OGBA 4X0NA 1EXPA 1EC7A 1XF0A 1FWTA 2G0WA 3TW7A 2P8BA 5D9PA 3VE9A 4OJYA 2VT0A 2WJFA 1XYFA 1OG0A 3WD0A 3H2OA 3LTSA 2P0OA 4OZOA 3B8DA 5BCAA 3PAJA 3HA1A 3MVTA 4Q4RA 1Q6DA 1NDYA 1UASA 4E2DA 3P74A 3GXMA 1Q6FA 4KGJA 2QZRA 4FZIA 4YCOA 4M51A 1BGGA 1LLOA 2XIOA 1TMHA 2QPUA 3DFNA 3R8GA 1IXQA 2QUNA 1QPOA 5C9UA 2NX1A 2J13A 3ABOA 1YTKA 1KTCA 1R47A 4C5YA 1XGDA 3WQCA 1J96A 3PJTA 1DJHA 2GK1B 3AIUA 4KFNA 1KXTA 3RLUA 2QAPA 3R94A 4FOKA 5FL0A 4JTFA 1JGMA 4NJKA 1BXCA 1YBQA 3DCPA 4QNEA 3N6QA 3VIFA 1MFUA 4I6VA 2NZLA 1FWHC 3EWXA 1OFPA 2SFPA 1G9HA 4H7ZA 4JTAA 4DAFA 1QAPA 5A6BD 1GK8A 3DECA 4X63A 3H7RA 4GQGA 1TJPA 4L1XA 3I4KA 1EC9A 3ZJ6A 1E56A 3BAYA 1TQJA 2QIIA 1OT1A 4MY8A 1XCXA 3KAOA 2OWCA 1ISXA 1K77A 3UGRA 3LA4A 1KGWA 3VO0A 1OC7A 1D3GA 3CAKA 3TKFA 4XO7A 4XKYB 4UQAA 1I75A 4P8XA 4CQBA 1PKNA 1KD0A 4AW7A 3ARQA 5CC5A 3IACA 5K9XA 3W1TA 4ZEPA 3S1VA 2TMDA 4H9ZA 4UOJA 3O0FA 1EPXA 1TTPA 3FSTA 3LPGA 3GTHA 2EG6A 4NVTA 4PMOA 3U2OA 3OODA 3SSZA 1ITCA 4ZTXA 3EMQA 5E70A 1W1IE 3FSUA 2PDJA 3GNNA 4O12A 1NY1A 3H70A 1ZU8A 1ZFJA 2XWEA 1DQXA 3N2OA 4MDPA 3ZSTA 1VLWA 1IZCA 1MUWA 2ZA1A 3S6OA 1QMLA 2HWGA 4ZODA 5XIMA 1AW5A 4IGSA 4XG1A 3F4VA 3OHIA 3PPHA 5BRQA 5M3WA 4QE1A 3O1NA 1CXKA 4G5DA 2G3MA 2J75A 3MUIA 4HNVA 4PUWA 4PCSA 4UB9A 3ABRA 1XC6A 4Q7BA 1JRBA 4DYJA 4W86A 3UWUA 3MKVA 2A4AA 4V1YA 4O14A 4MHBA 3PC0A 4LTSA 2UBPC 4W84A 3AS0A 2PU0A 5I77A 2QYGA 3RILA 3GUWA 5HMEA 3OVPA 2QQ6A 3S83A 2Q3RA 3R4IA 4M6VA 3V0TA 3O6DA 1DJYA 1AQFA 1Z9AA 4DZAA 4IG2B 2PC4A 3KXQA 3WG6A 1RVGA 3VOCA 4CCZA 4PEKA 5CH9A 3VIIA 4DJDD 1OM0A 4LC8A 4HZ7A 4HJWA 1PDZA 3F4NA 4K36A 2XSBA 3ITXA 3KRZA 1PUDA 1J2WA 2A3EA 4KWVA 4X2PA 3E12A 1DKWA 4DO5A 1XXXA 2W0UA 2A6NA 2XIMA 1PVNA 3QGAC 4UTUA 4LVFA 1J6OA 1NH6A 4TVDA 3APGA 3DGRA 2VX7A 5IBXC 4BCEA 3MUZ1 4JEJA 3CMGA 3VABA 3SCRA 4QM1A 4CQDA 2ZADA 1ZL1A 2VFEA 2RDUA 4GNVA 2WM0A 4IPNB 1E1FA 4K1GA 2XISA 3RAOA 3CO8A 4H9YA 4JCMA 2R14A 1F9CA 1U22A 1FKWA 1ML1A 2OO0A 4H6EA 1UBSA 1OINA 3S1UA 4KESA 3ZT5A 3H21A 3KL3A 4ILSA 3ONCA 4GABA 2PPGA 1RQBA 4AZ6A 3GC4A 5AB3A 3R6IA 4IUGA 2WKJA 1OFRA 1ICQA 3BLOA 1O5XA 3UWYA 1NIUA 1EHAA 5G4HC 2BMBA 3KL0A 4OUIA 4RV8A 2W4XA 4LAOA 2V68A 3P80A 1SR9A 1YPIA 4XZLX 5I7GA 4RZ4A 1NAL1 2W92A 3NFUA 4FOJA 4H2HA 3W1XA 3VCCA 4G1KA 1CGTA 3EAUA 4C6BA 2QCFA 1UUMA 3S2NA 3TTOA 1XYBA 3BAXA 4TU1A 4TTGA 3ELFA 1VCGA 1JXKA 3KBNA 3HU7A 3NOYA 4PTXA 2W6RA 3RO8A 4CKQA 3ZVHA 1BSLA 1AQ0A 3MJYA 1VYPX 2EG7A 2G8ZA 4PSPA 3VILA 2YX0A 1GW9A 1P7TA 1VPYA 2PZNA 3VOJA 1Q7QA 4WX2A 1TQXA 4PBGA 4IXXA 4W9TA 1GYMA 5FKYA 1FHUA 3SO7A 1E6SM 3IAQA 3OLEA 3KHJA 2HQAA 3A3HA 2WZTA 4LCQA 5F2IA 2HE5A 1G6CA 1RPXA 1BXBA 4UQBA 1UIPA 3PZUA 3AIBA 2I5IA 4DPQA 4TXEA 1VF8A 2P0IA 2WHKA 2WNNA 1OQFA 2CZDA 1X96A 5EU9A 3W72A 3LHZA 4IQDA 4NQ1A 3S47A 4JYDA 4MYXA 1SW7A 3GO2A 3QLLA 1PZ1A 3W22A 3PM6A 1AH4A 3PUEA 3QPEA 3V5CA 5E9XA 1UP0A 1RBAA 1AA1B 4L4OA 3W53A 4QAWA 4PCFA 1DJQA 3THQA 4HKPA 1FHDA 4YTSA 1W1B1 2XVPA 4NIRA 4PTNA 1RAKA 3CV2A 3PHAA 4NRSA 1V6VA 2OYMA 2VRKA 5HDRA 5IRPA 5MKGA 1PX8A 3ZM8A 2YPIA 4HCLA 1UZ4A 4W89A 2AKZA 3LCLA 1ONEA 2IKHA 4K37A 3VFCA 5CZSA 2V5KA 2WVVB 3I7QA 4J2MA 5F1UA 5G1TA 4FX6M 4AD2A 4DO7A 2O9PA 1AMKA 1L6YA 4JICA 3BLLA 1E3XA 4HTYA 4UTWC 2ZXQA 2ACSA 3GXPA 1FXQA 1FDZA 3APTA 4IPJA 3U6WA 3U9IA 1Q8JA 4YNGA 3KUMA 3WF0A 4IGHA 1ADOA 1B3WA 3GVGA 2ZWYA 5EMMA 1SVDA 3SB0A 1X1ZA 4LJ3A 1H50A 1AQHA 3QBUA 4PFMA 2XZ7A 4WKHA 3G1XA 3UU0A 4P8VA 4DXVA 3CQIA 2ZTJA 2P10A 2G50A 2YFOA 1A5AA 2QCEA 2ZVIA 3SCWA 3QLDA 3BGGA 3IK2A 1Z69A 2I7GA 3R2GA 1SFJA 1TPEA 3E3HA 4FNUA 3JRKA 4YMZA 5D2VA 5CPSA 3G1FA 4UTHA 2C8NA 1NWTA 3ERPA 2PU1A 3VTRA 3VXGA 4UQCA 4PR4A 3S2JA 4Y9MA 2DDXA 3POHA 1JI2A 3Q65A 2RKXA 1JCLA 4GVIA 3DC0A 2NX9A 1GVFA 1BYAA 3ABXA 3WNKA 1CZ1A 2I14A 2VFFA 1ZRQA 2WHLA 1CB7B 3KP0A 5EL1A 3GKFA 3CHCA 3BARA 3W2KA 1YRRA 3NG3A 4W7UA 2ZZ1A 3WSUA 4FR1A 4XIMA 1Z6KA 3JVAA 1C9WA 3COTA 5HULA 1DTNA 4ZA0A 1FWEC 4OKDA 1LQAA 1NOUA 3A9IA 1H49A 2OWXA 1T99A 3HGSA 5H2ZA 1QPNA 2W61A 2P3ZA 3DHUA 5AFDA 1GONA 8TIMA 4DUOA 3W1QA 1AL7A 3STCA 1FX6A 2CKSA 4HNOA 2O55A 1A5MC 3WLKX 1CGWA 5CG7A 3IIPA 3LOTA 1RCXB 1HW6A 2HTMA 4GJIA 4ML4A 3VMPA 1ENUA 2C1IA 3KFTA 2XIQA 2ZX9A 2Z7GA 2V81A 3F5LA 4KCWA 1ICPA 3GXIA 1HJWA 5HNUA 1JF6A 3M5ZA 1GVEA 4RDYA 4PYSA 4F0LA 1H7WA 1R2SA 2GDUA 1QOPA 3G1VA 1JFXA 3FHQA 4QCFA 1JUBA 3T08A 1PTAA 1YTEA 4JTTA 1BFNA 2XFFA 1TX0A 1JUEA 6PTDA 1DYSA 3DUGA 3XISA 2P5NA 3LHWA 2PLCA 1A5BA 3TONA 4DB7A 1VH7A 3G1DA 4PEEA 2Z1WA 3VCRA 4XSMA 1EP2A 3TJXA 4MY1A 3L0KA 1J93A 3WF1A 4DPPA 1UZ1A 3LBOA 2ZYFA 1RLDA 4MWAA 5BXRA 1ISWA 1CWYA 3NQCA 4UBPC 2VGGA 1POKA 2E67A 3VKCA 1QPQA 4I9JA 6CGTA 2TPSA 1CDGA 3ZYZA 3WDHA 1E0TA 3QKZA 4Q4KA 5C2GA 1W9DM 7REQB 1RXOB 1WKFA 1HL8A 4LFYA 2VENA 4QJ3B 3NQ2A 3UR7A 2PGFA 4UTTC 3IARA 4O13A 3AQUA 1GJUA 3IIXA 1WCGA 2AGKA 1PWMA 1TMQA 3QC0A 1TJ0A 3JW7A 4FI4A 3VNYA 2FGLA 5GJPA 3QXBA 3TDFA 2CYGA 3LX9A 5FJRA 6REQB 3S9YA 5HUOA 4QDPA 4JNMA 3PPCA 3GIPA 3W83A 3G8EA 4GBUA 3HB9A 1IE7C 5BOFA 1P1XA 4GPNA 2QUTA 5A6SA 1J5SA 4S23A 3E96A 4JIEA 2J24A 1Z42A 1M41A 2FMNA 3N4EA 1LWJA 6XIAA 3F4CA 3KRBA 1R38A 4H8HA 3KBJA 4Y8EA 2C71A 2GVYA 5CAHA 4K2SA 3MU7A 2VJXA 2WZIA 1JPHA 2WSYA 1LBMA 1UWRA 1DHPA 4CCDA 3W6MA 3A24A 1Q6GA 2PAJA 2PUZA 3NL2A 1XQKA 1MDLA 7ODCA 4XZNX 5ECVA 1KM5A 4CU8A 1AJ2A 2PC8A 3KX6A 3OO2A 1J0ZA 1N8IA 5A1AA 5AECA 3GTIA 4WY0B 2XZ9A 5LHEA 1VBHA 5GPRA 4AG0A 4S3EA 3MC5A 4WSKA 3TEVA 3LM3A 4W8BA 3DFYA 5CZKA 1CGVA 1PHWA 1QK2A 3V35A 3P6LA 5AC7A 2ISDA 2ZTKA 2DZTA 3V1HA 3O0KA 3FJNA 3CQJA 4D1JA 2XH7A 2WNZA 3L5AA 1EF3A 2JKEA 4RJEA 2WKGA 2W67A 4PODA 3MPGA 5BXPA 4GH3A 3TR2A 3WBEA 3VIJA 4KQNA 3BUVA 3ES7A 1EB3A 4JTLA 1F8MA 2ALRA 4JQ3A 3UXDA 3AS1A 1ITQA 2R1MA 2ISFA 1O12A 3SFKA 2GSJA 3G2GA 3MB9A 4WJEA 3FN9A 4XD4A 4XO6A 3ZLHA 1X6NA 4I5XA 2VEFA 4H6KA 5J5DA 1H7XA 4NI3A 1ZTVA 1XLCA 4O1BA 4J27A 2Z2BA 5AHNA 3VD3A 3VM5A 3CM4A 1WXZA 1XIJA 1IEQA 4KCUA 3VOFA 1FWAC 3TXVA 3KVLA 5I02A 1RJPA 3BV4A 1C8YA 2I57A 2FH8A 3SGUA 2EEXA 4JIHA 2YXGA 1S5MA 4HQVA 4D6FA 4EE9A 1XIGA 2UV8G 1EJ7L 3EDEA 2IXUA 1DWIM 4F48A 1S46A 4HCHA 3P0WA 1F3WA 1GVOA 2FQIA 3NL6A 4C6EA 2PWUA 1UH4A 4EP8C 2YCLA 3YPIA 4QJ4B 3S2MA 4CN4A 2Q8XA 4H01A 1S2TA 1DL3A 3EEZA 4XBJA 3TJIA 2D20A 4LVGA 4NNBA 2VP8A 3O6CA 1FH9A 3FGCB 1ONWA 3FJ6A 1HVXA 4CD8A 4KIRA 3RXZA 4DYEA 4H19A 5TNVA 3R58A 4U5KA 2VVNA 4KMQA 1MYRA 3GZAA 3TA9A 2MUCA 3ARUA 1XLEA 3OTRA 4L56A 3PB0A 2CZFA 4H41A 4B91A 2QIWA 4WK9A 3S1GA 2GYIA 1DJNA 1SJDA 3I7RA 1GYNA 3QC3A 2Y0FA 2OLSA 1JEZA 2VDIA 2HV5A 1J2BA 4UR7A 1EYEA 4O11A 3REQA 4XBKA 3WQEA 2J7GA 3ARYA 3WZ0E 4TQTA 2VGFA 1B30A 1LOQA 3UT0A 2QDHA 3LXBA 2WC7A 3CO4A 3U2CA 4C6JA 2AKMA 3R11A 2BOEX 2J25A 3VDBA 3G24A 1BEUA 1WB0A 3EOLA 3SM0A 3C3UA 1W32A 3LUTA 1IWAA 4MLJA 1S5NA 1TYGA 3AWNA 4NJGA 3UZZA 8RUCA 2J88A 1UD3A 4ADSA 2X1SA 1VLIA 3LHUA 2Z29A 4WLCA 2RH9A 1WDPA 5CJMA 9XIMA 3R13A 2H90A 1Y0EA 4XB3A 5HQMA 4H9MA 4WXZA 2F6KA 4O4WA 2YB1A 1WOBA 4DHGA 2UY4A 3IJ7A 4C6CA 4C60A 2BV9A 3ARTA 1ZB5A 4JN6A 2OOFA 3NQGA 2CLIA 1PIIA 3SCTA 4EX4A 2O56A 1JRCA 3ITYA 4JN7A 3SEPA 1F73A 2CLKA 3KCJA 3F2DA 3ALGA 1NWUA 4GIEA 3ZR5A 1R8LA 4PL2A 1SZGA 3WF3A 1PX3A 4DXXA 1KM3A 2WMGA 2DZBA 1TRDA 4FLQA 4AD0A 1EUNA 2WMIB 3WNLA 1ITUA 4IICA 2ZFAA 4LNCA 3IJQA 3NQBA 2VR5A 1QHOA 2NT1A 4UTJA 2J7FA 4NAFA 3B0XA 4PTDA 5I07A 4JX5A 1XKYA 4M19A 1UBPC 2OFJA 5AHFA 3VDAA 1LG2A 3OU8A 4AF0A 5LSMA 2Y1HA 4NZ3A 2WW5A 4QQ3A 4JQ2A 3MWCA 5EPDA 1V3MA 1P5BA 3G6LA 5FSEC 1VFLA 1ADSA 4E2VA 3CZ8A 4UMAA 3RG6A 2WK2A 3VX0A 1WE5A 1XIMA 1EGZA 3K1DA 3NVTA 3MMTA 4K8HA 2C0AA 3B9NA 2ZRZA 1PKYA 2JF6A 1FOBA 1XIDA 4BQ5A 1G4TA 3GXDA 2GOKA 1HL9A 1NELA 1LZOA 1WKDA 2Y5EA 3LTYA 3SRDA 2WSKA 3VM7A 1IGSA 3AFBA 3WQ8A 5HR6A 3EDDA 5H8UA 1DEDA 3BTNA 1BWVA 3CXOA 2E68A 2WLZA 3EXRA 3L4VA 1D9EA 1FHLA 4B3KA 3AHXA 5LKYA 5CBBA 3L0GA 1D8CA 1VYRA 2Y63A 3FKKA 3VIOA 3SY8A 2CERA 3SCOA 5IHRA 1L6WA 3MDWA 3C2OA 4GK8A 4R27A 1SJCA 4LEFA 1IWPA 3UG8A 1AH0A 4S3KA 2FFCA 5D04C 3SQMA 4HPGA 2D22A 4C5ZA 2YLAA 1R3VA 4ACZB 4JQ1A 3RPTA 1W1YA 3AIRA 5A6TC 4A3HA 3GG0A 3CGTA 3W7QA 3CAVA 1AH3A 5I3GA 2FLIA 1D3CA 3GTNA 3O3RA 3QPYA 4IFKB 2PGWA 2VFGA 2FPYA 2OWWA 1F76A 4KGLA 3FHAA 3BOFA 4JQ4A 1S2WA 3KVJA 1SPQA 5LA0A 4B3ZA 2VFHA 5AHEA 5T9CE 3MTWA 4QROA 4MMWA 1Z32X 3L65A 2OKTA 3JS3A 3TWAA 2BVDA 4P61A 2QUVA 3TZNA 3S9IA 1W5PA 3VFLA 1Z8AA 1E1CA 2C79A 1TJRA 1LUCB 3CHFA 3NDZA 2NX3A 4UC5A 3RJXA 1TV7A 1S5WA 1SO3A 4JFVA 3W7KA 4KWOA 2ZDRA 3UR5A 1REQB 2PTWA 1H3GA 1UC5A 2Q8ZA 2OQLA 2E28A 4Q4PA 5BXTA 4J4KA 1SMAA 1XUUA 1SZRA 3STEA 2GJPA 3HQNA 3RM9A 4MPQA 3GR7A 4GE8A 2YR1A 3PZNA 3DX5A 1D7FA 2EXOA 2VZUA 5D38A 1UR1A 4NUWA 2GGGA 3H23A 3PZOA 1W1A1 4MM1A 2CZ5A 3A4WA 1LT7A 5D8WA 3UW6A 5HPOA 3BK0A 2QCDA 3M4HA 5BMXA 4IMFA 3IJIA 4P5UA 2TAAA 4S3BA 1UR4A 2E5BA 3O8AA 1T8XA 3E02A 4DJEA 2L5HA 3UXIA 1XPYA 4W7WA 1BAGA 3MYOA 3DHDA 4W88A 2ZXAA 1BKHA 4H9XA 1FCUA 1SO4A 3C2EA 3HG3A 4Q8VA 4KFPA 1HP4A 2ZZ6A 3WLNA 1OCNA 3N19B 4IISA 5D2YA 3GU9A 5FEPA 2VCAA 1HVQA 2NW0A 1VEPA 4LYRA 4GQRA 1XLAA 3ARPA 5DT7A 3MDUA 2QUMA 3QGVA 3UQNA 4JTGA 2DP3A 4EXAA 2ZXBA 1EUAA 1K8ZA 3OB8A 4LQ1A 4P8WA 2JEQA 1UIOA 3BSHA 4H9VA 2GLKA 2PEVA 3KTCA 3CUFA 2CLOA 1FA2A 4WVXA 1JNEA 1OIMA 3WLHA 3W25A 1E0VA 4NJJA 2GJXA 2CLHA 1BTCA 1DIKA 1MZRA 5EFFA 4LV4A 5EB8A 1MDRA 2VXNA 4I7WA 3PS7A 4HBKA 4I9MA 2B7NA 4XKMA 3H2CA 2P88A 1KCLA 3IGHX 1VFMA 2IPWA 1M6JA 1EQCA 3IUDA 2D2HA 3ZR6A 5ABFB 1Y5VA 1FWBC 3SURA 5FIPA 2FZ9A 1E73M 3VNDA 5B80A 2Q8LA 2Z27A 4WKFA 4HVXA 3MO4A 1EDTA 2OT0A 3IVUA 3MSYA 1XLMA 3SGZA 2O92A 4WDWA 3W23A 1VFOA 4LAMA 4US5A 5GVJA 5I78A 2RGMA 4PMJA 5B7ZA 3NXFA 4CNOA 2R1PA 3OGVA 4CUCA 4J9JA 4IMGA 1NF0A 3WH7A 4M29A 3PP7A 3F1QA 3VAVA 1VRDA 1XG4A 1XI3A 1R0MA 1NVMA 4M3PA 2DZXA 1R85A 3P5ZA 3IWPA 3BZJA 3N17A 1PTDA 4B2DA 4RW5A 3ICJA 2CKRA 4IXHA 3E74A 2QNEA 4WGXA 3CLMA 2F6UA 5HNNA 2D3NA 5DXXA 2JIEA 1FUYA 2R6OA 2PP3A 3I68A 3WDJA 3QZAA 4P2VA 5FEWA 4HYWA 4K6AA 2YXOA 3EB2A 1IV8A 1MI3A 2QJNA 2OODA 4WD0A 1CIUA 2AQOA 1OC6A 2ZC8A 4OOUA 5E0FA 2PCQA 4Z1CA 1R9YA 2WVSA 2ACUA 3CB3A 2KZHA 4RW3A 3I6EA 2BY1A 1OF8A 3CL8A 1F4HA 3KZSA 2QW5A 1FKXA 1FWGC 1UD2A 2BWGA 2QMJA 1YEYA 2VWSA 3TYBA 5EY5A 1I4NA 2TODA 1MUCA 4CQAA 1X97A 1TPWA 5DBTA 1EOKA 1TUFA 3IK4A 3ISIX 4L61A 2OYLA 1EO7A 4NF7A 2ZRXA 3Q37A 2WQDA 5D05A 3VZXA 3DFQA 1SW3A 3RLGA 2I16A 1W3TA 1WDSA 1Q3NA 3FKRA 1EJVC 2WXDM 3WY1A 3P61A 4HD5A 3HN3A 3AZSA 4Y7EA 1HO4A 3RNDA 1Z48A 1E5JA 4EK7A 2GWGA 1EJXC 4H00A 3TN3A 1MQQA 3W01A 3S9ZA 5KTLA 2PDPA 1GHRA 3W37A 1CLKA 2CEQA 1OF6A 3E5BA 1IR1A 3ITGA 3W6YA 3NEVA 1F4AA 2XN0A 3N9KA 4P7QA 3VDGA 4LVDA 4GQQA 5E6ZA 3AZTA 3O06A 4Z0JA 3QYSA 3V3WA 1E4MM 3I4EA 2GPTA 2I56A 2XHYA 3MANA 4HSHA 1EIXA 4PFHA 4X9YA 4A8IA 1MW1A 4FIRA 3FYOA 3WMCA 2ZUUA 3HOJA 1OZQA 1A50A 3G1RA 4YIWA 3GW0A 1NWRA 3P93A 4J3XA 1UH2A 3MP3A 4KBXA 3UWZA 1Q63A 1K1DA 2PLJA 2H9AB 4N4PA 3AXIA 4PUNA 2PLMA 1KQYA 2QMKA 1WXYA 4XBSA 1JZ3A 2GQ9A 1R6WA 3OA3A 1JJKA 2D2OA 1V3JA 3BV7A 4GVFA 4B3LA 1WUFA 3M6DA 2Z6IA 3TU9A 1R3WA 1JFHA 3MHGA 4X0VA 1Z3NA 4OBRA 2O7QA 2J7BA 1EBHA 4AY8A 1E6ZA 4GYJA 3UPWA 5KETA 2AL2B 3IS4A 3LRLA 3GNOA 1OSEA 3PZQA 2VX5A 5DX7A 3QMRA 2NVAA 1I2OA 1SSGA 2OO6A 2EG8A 2AAAA 1KBBA 4UFJA 4ZOAA 5DF0A 1XM3A 3WBYA 5DRCA 4HNLA 1JZ2A 1W2VA 4XK2A 1JIBA 2B4GA 3NQVA 1GPWA 2XN2A 2HVNA 1GQNA 3NURA 3DG7A 3RUBL 3MUXA 5FJUA 1OFEA 5C9RA 4UFIA 2OX4A 3KOYA 4AEEA 2BSLA 1V6WA 3QMSA 1ZCCA 3UR2A 2TRSA 1OADA 4AMAA 1G67A 9RUBA 1CGYA 1G94A 4B92A 3FCPA 4UMBA 4LCRA 5XINA 3R8HA 1CB2A 4EACA 3VNIA 3QHMA 1YW1A 4U5IA 4M82A 3FV9A 5BRPA 3R0DA 1FFQA 3WQ6A 1XIIA 5C7VA 5M1TA 5HWJA 2FJKA 3QVQA 4EF8A 5CXPA 1OD8A 2BS9A 3WJWA 3MHUA 1V4YA 1UKOA 4POCA 3ECQA 2FTYA 3H12A 4Z2IA 4Q8TA 4NU7A 3CV6A 2IPFA 3DYMA 1JPKA 4V15A 4EIVA 5G1MA 4JBRA 3O05A 1NFPA 4AZCB 1O5RA 2E6YA 2R1LA 3BCFA 1W6TA 1A0CA 3LHVA 1A3XA 1Q6RA 4A8LA 3OZPA 3D5HA 3S5NA 2C18A 3RU8X 2ZZ2A 1RQEA 5FEZA 1TCDA 1RUSA 2I9EA 4S3GA 1PTGA 1PIFA 4AIOA 5AHLA 1CECA 2V82A 4KKXA 1UPMB 1XSIA 4OBTA 1I2RA 2I5QA 1IIHA 2Z1BA 4DXKA 4K38A 3EPOA 3O15A 4Z17A 1FH7A 1PWLA 1W3IA 2OEKA 5BWAA 3VUSA 1XRSA 1YQ2A 5FJIA 4AHOA 3FXGA 4PTMA 4NAEB 4F40A 4H7VA 2INZA 4O1AA 1J0YA 3CQHA 3T44A 4DBSA 5C8BB 2PGRA 2DVUA 1C29A 4V1XA 4QEHA 3A64A 4J2PA 4OUEA 3TYAA 1TWZA 1O1HA 5TBOA 1WUEA 1I0BA 3PANA 4FNRA 4XKYA 3I3BA 5T26A 1XWYA 1XYMA 1UH3A 3DFSA 4U3CA 2D3LA 1G1YA 1CCWB 1VKFA 2REQB 1BYDA 4PBEA 3N14A 1H60A 1LOSA 2HRWA 4IIFA 3LXCA 4L9XA 5KINA 2X0YA 1GOQA 2YDAA 3AC0A 5AVNA 3OBKA 4E8DA 2PDWA 1XC4A 2XN1A 4FX7A 4IPIA 4KFOA 1OZMA 2Y70A 3UPBA 2J79A 2IQTA 2HS6A 4HOWA 3UPMA 3FJLA 4C6LA 4C7FA 4JGDA 3W1MA 1Z41A 3GUGA 5HJLA 5LGXA 3CL6A 2QVHA 1POJA 4ERIA 2VX6A 1U1UA 5FJJA 5D30A 2IUZA 5EMUA 1B3VA 3G22A 4J3WA 4PGLA 2FFIA 3LMZA 4DWSC 4IFOA 3RGTA 1M65A 1GVIA 2PP0A 2A7PA 2X16A 3AAMA 4MWAC 3BOXA 3S1WA 1CT5A 2MANA 3STPA 1SZEA 3ARWA 3NO5A 1MO0A 2F38A 3VDHA 1YDVA 4R5EA 3TV8A 4PMQA 3QQ0A 1WV2A 3MYPA 1W3JA 2QCLA 5CQ1A 4EPKA 3KDOA 3DHPA 5AYZA 3GFXA 4XD6A 4M1BA 4C6OA 4XAGA 2Q6ZA 2YYTA 3VGEA 3PF3A 4M6QA 3AMCA 4IG2A 2Y89A 3OBAA 4ICMA 3M0IA 4UTWA 2PDKA 4ROPA 1JGIA 3IV8A 5DMMA 4WGHA 2VC7A 2Y7EA 4KERA 3QY7A 3CHEA 2PD9A 3UD6A 4C6FA 1WZAA 2BGQA 1GEHA 4QAIA 1VBJA 4ZQNA 3W7IA 3FY1A 4ZO9A 4MFEA 3WDIA 5A6KA 5BOOA 4ZENA 2G95A 3HQ1A 1XBXA 1GOKA 4LXFA 5RUBA 2J74A 4HZ6A 4PUDA 1XLGA 5T8GA 3G3MA 5L6UA 3QY6A 3OBEA 3T07A 3SR7A 1YDYA 2PRHA 3LI0A 3WLLA 1U1JA 2DZWA 5HK4A 3AIEA 2AAMA 3DH7A 3UG4A 1DJWA 4HA3A 1RVKA 2PBGA 4HU0A 4S38A 3CWHA 2V2DA 4CQCA 2JK2A 4Y96A 2XWDA 3GYCA 4B15A 4JTIA 3A6OA 4NNCA 4FLOA 5G2WA 4B9ZA 5U4NA 1JDEA 1VRXA 3O63A 4HT3A 4ZQPA 1WAWA 1PCWA 1ZQ5A 1TPFA 4JIRA 1W5MA 4PZVA 1O5QA 3SIMA 2CLPA 3OGRA 1WDQA 1Q2SA 1US0A 1B4EA 1UKQA 3QQ1A 1A53A 3VNZA 1MNZA 1PJ9A 4GHRA 4XVDA 1OK4A 2DPEA 1KC7A 1OG6A 3GU2A 2BODX 4GXPA 1LL7A 4GMEA 3TTEA 3TQPA 3NUKA 5AHIA 2C91A 3VKAA 2PDMA 4AVNA 2G3JA 1XX1A 4OQVA 4AZ5A 1B5TA 3PG8A 1JR1A 4HOZA 3OQEA 3QF0A 1PS9A 3UNTA 5FF3A 2QULA 1B3YA 3LU2A 5DMLA 3FK4A 3OQ8A 4HN4A 4GG9A 3GFYA 3E49A 1ZJAA 1NQ6A 3URQA 4ERAA 4HA0A 2AMGA 5FESA 3CPGA 3JZUA 1VEOA 2D2JA 2DSUA 1W3KA 4UCFA 1GQLA 1MMFA 3P2VA 4ZOBA 2R82A 4MWAE 4AYGA 3BGAA 3WFLA 2R91A 2Q01A 3G8RA 2PWEA 3NPWA 4CD4A 1B0IA 4S3FA 4A22A 3GYEA 1LLWA 1ECQA 4HA1A 4PUUA 3VC5A 1L8NA 4GZIA 1YBQB 3CIXA 2G4JA 5AVHA 3BC9A 4HYVA 3WH9A 4GISA 5CLTA 2E5CA 3NQAA 3VGHA 3LMYA 3UJSA 5DO8A 1OBAA 4NZCA 1T40A 3IJLA 3T7VA 4NYYA 4AZBA 1NWSA 1X6UA 3O16A 1G4SA 1VQTA 1UR3M 7ENLA 2C0HA 5LHFA 3RMEA 1OGGA 3WMLA 3CYJA 4MWAD 4EKJA 2A2IA 2VRJA 3WK3A 3C4UA 3UZJA 3BDKA 1QNPA 3WKZA 4TX9A 3FFSA 1DWFM 4P7OA 1EFZA 2MNRA 3TE9A 4F0KA 1OABA 2DGAA 2V0TA 3BCJA 4U3AA 4I5RA 3CV7A 1OGSA 5TD4A 3R5EA 3LTPA 5I23A 4GI4A 4D6GA 1OX4B 2RJGA 2QCMA 2Y8KA 3AIQA 3G0XA 4HYRA 4L80A 4CCEA 2OQYA 1I45A 2B81A 1NFGA 4LAZA 3L4WA 5C71A 4MJMA 4DRSA 4QS5A 1QO5A 4JKLA 3WUGA 1ESWA 3T0DA 5DMNA 1YPXA 3KOZA 1J79A 3THAA 4MZYA 4GYKA 4WZHA 2PDHA 3ZOAA 3IGUA 3EMZA 2P8CA 3QH2A 1E6NA 3WNMA 2GGHA 5M17A 1FTXA 2VZOA 1PIGA 3AOFA 4AB4A 3DZ1A 3CT7A 3H53A 4UIOA 3B03A 4BI5A 4PTVA 3ABZA 1S1RA 4IL2A 1QBBA 3QR0A 3F03K 2ZDSA 3D47A 3GNPA 4ECLA 1EGMA 1Q45A 3IANA 1GJWA 3T0BA 3GVVA 3LB0A 4RNFA 3SCNA 2CZEA 2HSAA 2VGIA 2V63A 4AUBA 3UJEA 3WELA 5J5RA 1BYBA 1FH8A 1BVWA 3B9DA 4FSAA 4IOTA 2A5HA 4MNJA 5HMSA 3MV01 4MUZA 2VNCA 4GY0A 4IPPA 2QXWA 3U57A 4LF2A 4AD1A 4URIA 3WK2A 4IIBA 2XIIA 3WLIA 1AFSA 4FS9A 3OZYA 3Q67A 5A6AA 1JYXA 2HJPA 4TMCA 4QE4A 2VZSA 3LGGA 3ZT6A 4W87A 4V2XA 2YXXA 3MS8A 1W17A 1M9HA 1W91A 4E3TA 2G96A 3T4CA 4BK9A 4LT9A 2IW0A 3CZJA 4FALA 2GVEA 1A49A 2XFYA 5IFPA 5BMWA 2IMRA 2VZTA 5EMYA 1TIMA 4DBDA 3UCQA 3MCOA 1GWJA 2WBKA 3MP4A 3FA3A 1F6YA 1UA3A 2XGIA 4C6MA 1KRBC 4LV9A 1NFBA 2E09A 3RX2A 2YZ5A 1B1YA 4HZ8A 1ISZA 2QGHA 5FAJA 1YXCA 2XSAA 5I3KA 3H8AA 1TPC1 4GC3A 1W3HA 2FTWA 3MVIA 3GDMA 4Q8QA 3CHVA 4HGXA 1LM1A 5JH1A 2PE4A 1BXNA 5HWMA 2Z1VA 3W75A 2BHUA 1TJ2A 4CNPA 2GFTA 4M6UA 4JFSA 2G5WA 2CLMA 1QI2A 3GR4A 3QY8A 1XV8A 1IR2A 1EYWA 2X2GA 3LK6A 1U5HA 3LCGA 1ME9A 3ZVHB 1V3KA 4DAIA