3R43A

Akr1c3 complexed with mefenamic acid
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
316
structure length
310
Chain Sequence
b'QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Crystal structures of three classes of non-steroidal anti-inflammatory drugs in complex with aldo-keto reductase 1C3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 117
structure length 310
sequence length 316
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2011-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3r43A00
3P2VA 2IPJA 3UG8A 4NKCA 3CAQA 3GHSA 1GVEA 2IPFA 3WG6A 1S2CA 4GACA 2J8TA 2NVCA 2IKJA 3CASA 1M9HA 4GABA 2PDHA 4ICCX 1RY0A 3UFYA 3BURA 1Z9AA 4JTDA 1JEZA 3UZXA 3GHTA 4PUWA 4JIRA 3R94A 3R8HA 2WZMA 2PDYA 2IS7A 3FX4A 2ACSA 4I5XA 3CV6A 1J96A 3H7RA 5AZ1A 3H7UA 5HNUA 2HVNA 4ZFCA 3V0SA 1LWIA 5JH1A 4WRHA 1VBJA 4JTQA 4GQ0A 4LAZA 2IQ0A 1YNQA 2I16A 2PF8A 3ERPA 3LQLA 4YVPA 2FVLA 4IGSA 3VXGA 5LIUX 1SM9A 1YE4A 5JH2A 3LZ3A 4JIIX 4XO6A 3RX4A 2PDLA 1AH3A 4JQ4A 1ZQ5A 4XZLX 4XVEA 4YVVA 5LIWX 4PUUA 1T40A 3KRBA 3RX2A 3U2CA 1Z3NA 4XZIA 3ONBA 1IEIA 4LB4A 1US0A 2R24A 3R7MA 1AZ1A 4JIHA 3RX3A 1Z8AA 4OTKA 3M64A 4PRTA 4HMNA 4Q7BA 3UZYA 4XAPA 5M2FX 2IPWA 2FZ9A 4G5DA 2PZNA 2CLPA 4R9OA 4ASTA 2PDUA 4PMJA 4YU1A 3GHRA 1XF0A 3O0KA 3GHUA 3WCZA 3LZ5A 1AZ2A 1Q5MA 5C7HA 4PRRA 4DBWA 1ZGDA 1PWLA 2ACQA 4Q3MA 4FALA 3MB9A 3EAUA 1AH4A 4WEVX 1X97A 1PYFA 3LNMA 5LIKX 2QXWA 1EL3A 1EF3A 1S1RA 2IQDA 2P5NA 5LIYX 2C91A 4QR6A 4XO7A 3EB3A 4LAUA 3BUVA 4JTAA 3COTA 1S2AA 1Z89A 1LQAA 2PDBA 4WGHA 2INZA 1QRQA 2R9RA 4JQAA 4WDXA 2INEA 2PFHA 3GUGA 1VP5A 2ACRA 2DUXA 2FZDA 2HDJA 3R58A 1YE6A 1UR3M 2FZBA 4WDWA 2PDXA 2ALRA 1Q13A 2VDGA 3R43A 2A79A 4DZ5A 3V0UA 2PDJA 1MZRA 1T41A 2PEVA 4EXBA 2AGTA 3WBWA 2F38A 2HV5A 1XGDA 3BCJA 4MHBA 2ACUA 2IPGA 1RY8A 3M4HA 3LQGA 4EXAA 2DV0A 2WZTA 4JQ3A 1C9WA 4AUBA 2PDNA 3G1RA 1K8CA 4XVDA 3QKZA 4FAMA 1QWKA 1IHIA 4LBRA 1ADSA 2HE5A 4L1XA 1X98A 4JTCA 4GA8A 4JQ1A 1PZ0A 4XZMX 1OG6A 2PD5A 2PDMA 3WBXA 1YNPA 1AFSA 1RALA 3G5EA 4F40A 3N6QA 2IKHA 3T42A 5HA7A 3LD5A 3N2TA 1FRBA 1A80A 4JQ2A 1R38A 1S1PA 3LENA 2IKIA 3UWEA 2ISFA 4XK2A 2NVDA 4YS1A 4FA3A 3M0IA 3LBOA 2IKGA 4GIEA 3WBYA 4DBUA 5LIXX 3R8GA 3Q67A 3UGRA 4HBKA 3DOPA 3Q65A 4H8NA 3CMFA 4WDTA 4LBSA 3V35A 3BV7A 2PDGA 3UZWA 4QX4A 3EB4A 3D3FA 1XJBA 1HW6A 4IJCA 4LB3A 5DANA 3LEPA 3DN5A 3LUTA 3V36A 2FZ8A 1PWMA 2PDKA 5KETA 4WDUA 4RPQA 2PDFA 2PDIA 2PD9A 3LN3A 4QXIA 1EXBA 2BGSA 2HVOA 2PDWA 1MRQA 3CAVA 2BP1A 3CV7A 2BGQA 3FJNA 4IJRA 3MC5A 4PR4A 1MI3A 2PDQA 3R6IA 1ZSXA 1HQTA 3H4GA 3F7JA 2I17A 3NTYA 2PDPA 4FZIA 4L1WA 4QBXA 3UZZA 1EKOA 2PDCA 2HEJA 3C3UA 5HNTA 4DBSA 4GQGA 4H7CA 3ONCA 4XZNX 4JTRA 3B3DA 1PZ1A 2HE8A 3O3RA 4XZHA 3V0TA 2DUZA 3S3GA 5AZ0A 4GCAA 1X96A 3UYIA 4YVXA 3UP8A 1ZUAX 1AH0A 2FGBA 2F2KA
chains in the Genus database with same CATH superfamily
3VGEA 1H7XA 3QGVA 3RLVA 3CHFA 1D3CA 1K8ZA 2FTYA 4HZMA 1S2CA 2YPIA 1GVFA 4F79A 5C9XA 1XYAA 4FXRA 4CN6A 1YPFA 1PKLA 2L5HA 3FFSA 1PHQA 3WL0A 5FEWA 4K2SA 4UFJA 1JVNA 3TTOA 5LA1A 3UGVA 4FX6M 2I14A 1YLVA 3UZXA 2HS6A 4D1IA 3XINA 4JIRA 1RJPA 1DE6A 5HK4A 4IMAA 1J0JA 2D23A 1OCNA 2ACSA 5K4XA 4Z1CA 1V3IA 4ZQNA 3N2XA 3MBDA 3WD3A 5HNUA 1HJQA 4JGDA 3N12A 2ADAA 3KTCA 4WRHA 4QLKA 1MFUA 2EG6A 2YB4A 1E72M 1O94A 4JTQA 5AFDA 1HKVA 1XLFA 4DNMA 2PF8A 1EPVA 5LIUX 1W2PA 1QI4A 4HT3A 3D3AA 4OU1A 3BARA 5H8UA 1JDFA 2VUNA 4LAMA 2XYLA 3TR9A 5CJMA 1LL7A 1KXQA 4AEOA 4MY1A 3SECA 1Y5WA 2R82A 1OQFA 1ZL1A 3QHMA 3P0WA 3OYZA 2VVNA 3QQ0A 4NP7A 4O1DA 4JHMA 3RJXA 5AC7A 3QRHA 1OD8A 1US0A 1U1UA 3CUXA 3WK2A 4OTKA 3ZWSA 1HN1A 4MLRA 3WUBA 3UZ5A 2B7OA 1IT8A 2ZRWA 5F4SA 4R88A 2CLPA 3UETA 3A4JA 4UTWA 3AXMA 1O95A 3O0KA 2BY0A 4CU7A 3CU2A 3AIUA 2V30A 3G77A 3S1WA 4NU7A 2HSAA 2ZKMX 1AZ2A 3CUZA 1HKJA 4US5D 3UR2A 5D9OA 2XWDA 2D2OA 1EO5A 1E4LA 4B5SA 1H7PA 3I3EA 1I2PA 1FWDC 1M03A 3EWZA 4GYFA 1PX3A 2WJDA 3GNPA 4UTHA 5TQLA 1YW1A 1XINA 1TREA 3FJ6A 4DUWA 2NQJA 1OX6A 4IQEA 4WJEA 3VX1A 2YR1A 4GQBA 1H0IA 2MUCA 3NZQA 4BEQA 3GVVA 2PDBA 2OZ3A 1ML1A 1GOMA 4U10A 3HOJA 4JFSA 3PSWA 7REQA 1LBMA 5GQBA 4ADUA 2GGGA 2E25A 2GL5A 3CB3A 4S23A 1QPRA 3N25A 4JFUA 4JKLA 4C6FA 1YE6A 5I00A 3UWUA 2FZBA 3W73A 2QV4A 4LC6A 5I3FA 4PTVA 4ZB0A 4DI9A 4QISA 2Y1HA 1TMLA 3FYPA 3GQYA 1LLZA 1Q6CA 1H11A 3AWNA 1I1XA 1V0LA 1GONA 4JFVA 3TWAA 4RZ6A 1CGWA 5HUOA 1UD3A 2WKGA 3GYCA 1VFOA 1TUFA 4AISA 3DHPA 1W3LA 1OBAA 4ERAA 3VNJA 1QPKA 5FESA 1YMYA 1AODA 1EP2A 3CTTA 1UWQA 2Q8LA 4KWWA 3SN4A 3SCOA 1JL8A 1GOQA 4JTTA 4FOKA 4NNCA 1PIIA 4HTBA 1ZJHA 3LLXA 4LUSA 3MS8A 4OOZA 3CUIA 2OX1A 1L0PA 5EU9A 3SSZA 3I65A 2DPEA 1EF2A 4Y2WA 3NFUA 1KV5A 3WQGA 2NVAA 4YLWA 3UQNA 4FX7A 1RK6A 3E2RA 3PJUA 4JQ2A 4PBGA 1RLCL 4IP5A 5E70A 2C7FA 2LLEA 4PODA 4MMWA 2Z6JA 1SGJA 4GVIA 3VIIA 1XDJA 4NJJA 1SFLA 4BI5A 1IEXA 2A7NA 1GGOA 3I6TA 3BJTA 3GG0A 4RL3A 3G1AA 1DVJA 1XH1A 4Z2IA 5KZMA 4UQEA 2ZRXA 3IK4A 1EEXA 1OINA 2GFTA 5LNWA 1OFAA 1LQ0A 2J7DA 2VEGA 1PS9A 1AMYA 3TJ4A 2I7GA 2PD9A 2G3MA 5FA5A 4F2TA 2VCBA 3CAVA 3SURA 3AISA 4GWEA 3LBMA 4D8AA 1C29A 3MKCA 4HOWA 2DQXA 1S46A 5KZDA 1VYSX 3UPWA 5DMMA 3WLSA 4MB4A 3CIWA 1HQTA 3B8SA 1JG9A 2WJZA 3P82A 4D2JA 3CWHA 4ATDA 3MSDA 1IGWA 2PLJA 1MXGA 4GZ7A 2CBUA 4Q6XA 4B5XA 5JU6A 3RPMA 2E8ZA 1NM9A 2BMBA 2NXHA 5A8NA 1QFEA 2WLZA 1M6JA 5D09A 1TJ2A 3WK1A 1KW1A 4B2DD 4C6LA 3ZO9A 2Y5EA 3AMGA 7XIMA 4D72A 5AZ0A 1KKOA 1X96A 1VPYA 3IGUA 2QJJA 3IIZA 2NV1A 4PCTA 2CKRA 2E6FA 1B90A 1GOIA 4JTJA 4V2XA 2XU2A 1GVEA 5E6YA 4DUOA 3L5MA 4AZBA 1UC4A 1UYQA 3U5YA 4H9TA 1I0DA 4IICA 4TO8A 6REQB 1NDYA 2DSWA 4BEUA 4A3HA 2PSNA 4S3EA 2CHOA 3W23A 2MNRA 3T08A 3D46A 1WPCA 4PUNA 2QZRA 1X1ZA 3R94A 5AC6A 1Q8AA 1OSEA 2V5KA 3BAKA 1JAKA 1XIFA 5K4ZA 1E4NA 4P7QA 1GKRA 4X0NA 1CNVA 2H90A 4PMDA 1F74A 2GQ3A 4KCUA 2O7QA 4ML4A 4ZFCA 3ITOA 2H8XA 4EPKA 3AXKA 3EXRA 1EYEA 3CUHA 3A6OA 1QU4A 1XYLA 3M5XA 3DI1A 4CQCA 1ZAJA 1NFPA 4QG9A 5HOSA 4GQ0A 3T8LA 5DY3A 4P5UA 2IQ0A 2A7RA 4HHPA 4XZ9A 3SEPA 2FVLA 3M5YA 5BXTA 4HCDA 2VR5A 2Q09A 1QPOA 2ZADA 1SMAA 4WGXA 1F3XA 3CO8A 4UMCA 4D6EA 4UR7A 1BSIA 1V4YA 2OVLA 5CPNA 3TONA 2G5WA 4P7RA 2X8RA 1KFEA 4JR5A 4L4MA 1WE5A 3VM5A 4MJZA 2G37A 3PSVA 4RUBA 1TWZA 2Y5SA 5I5RA 1ONRA 4E38A 4DJFC 2GUYA 3R7MA 5CZSA 4Z0JA 5FL1A 4DJED 4GIAA 4BK9A 1IXPA 2WHMA 1W9UA 2DUAA 3TX9A 4OBRA 2OJPA 3PVFA 3TW6A 4D71A 1J8VA 6XIMA 5HJXA 4P7LA 5C9WA 1XPGA 1TTQA 3HB9A 4K8EA 1GTHA 3K46A 4AWUA 2R1LA 1ZBVA 1WQ5A 1EFZA 1A4MA 1JZ5A 1HKMA 4V1XA 3NM3A 3PWGA 1RCQA 3WLOA 1C93A 3G1SA 3WD4A 2FVMA 4FOJA 3CZ8A 6TIMA 1ZB5A 4WGHA 1TE6A 1QRQA 5AY7A 3GG8A 5JBEA 2QF7A 3DI0A 4MB1A 2P1FA 5I2UA 3WDQA 4KGLA 4D6JA 3B0XA 3F4VA 1KWKA 3EBVA 3AS2A 4FNSA 3SCTA 3AIEA 1BRLB 2PC4A 3FEQA 5EMJA 4PCFA 3AHZA 1YXCA 3QN3A 1R3TA 1FHVA 5C55A 1MUMA 1MZRA 3S1GA 2IXUA 4W9TA 3QR3A 1J6PA 1JIBA 3LLFA 1G7UA 1J6OA 1ISXA 3AHXA 3VNYA 2D1ZA 5JBFA 3LXBA 4L6DA 3TR2A 4GVFA 2HV5A 3CPGA 4W88A 2EXOA 1JD7A 3MMTA 2QV5A 4CEUC 5K3VA 4X9SA 4H9MA 2POZA 2VFIA 4GX8A 9RUBA 3WLMA 1OF6A 3TROA 4AD1A 4WD0A 2HPMA 3EDKA 2J79A 3OP2A 2OR2A 3M44A 4GI4A 1HJWA 2Z1SA 4PC8A 3D0CA 1XP3A 4QE5A 2AKMA 4GA8A 4X2PA 2FHCA 1ZP3A 3WJZA 2RGMA 3WJWA 4EPEC 1H51A 3LD5A 4JYEA 3G0SA 5A3HA 4QQUA 3LGGA 4H8VA 1TPWA 1F9CA 3QR1A 1H7OA 1JJKA 1S1PA 2O7SA 1IEWA 1THFD 2G3NA 4XK2A 1W1YA 4UUIA 4S1FA 1TR9A 2ZUWA 5LA2A 3UR8A 3W74A 9XIAA 1LG1A 4OV4A 4MAZA 2B0MA 3O6CA 3E74A 4LVDA 1JCXA 3R8GA 4L4LA 5HMDA 5DRCA 1FWAC 3DG7A 4HK7A 2GGHA 3BMXA 1BQGA 3W7MA 1P0BA 1YTEA 4MUZA 1ZJAA 1IYXA 4NF7A 4RE3A 3POHA 1HNYA 1KTNA 3M0KA 4I8YA 3BOFA 3EB4A 3R1ZA 1TVNA 2W63A 1WUEA 3W7QA 1UJQA 3P3BA 1ZY9A 1EBGA 2BBFA 1CLXA 2CLMA 2VGIA 3S1XA 3TJIA 4GOAA 4KRZA 4LXFA 3U3HA 1PE1A 4BQ5A 4B2DA 1YX1A 4CNSA 2PDIA 3B0UX 1OGGA 2J9YA 2OO6A 3VKCA 4HNVA 4DVOA 2A5HA 3R8RA 2E09A 2C13A 1MI3A 2O55A 4UNLA 1PHWA 1A0DA 1MMFA 1M7XA 3NO1A 4CNOA 2G0WA 4DELA 5CC7A 2TRSA 3H2MA 3TIMA 1FX6A 2X30A 4JNYA 1HO4A 1XLDA 4MIMA 4DJDA 4GQGA 5CQ1A 1WXYA 1MEIA 1W9VA 1YADA 1SSGA 2E67A 2QHAA 3DFNA 3GSMA 1MXSA 3NYDA 1ZBKA 1O4UA 1RCOB 4WY0A 2QUNA 1I2OA 8CGTA 2VC7A 5CPSA 2FMOA 2SFPA 1OG0A 1JNEA 1AH0A 2X2GA 4W7UA 1BWKA 1U30A 3WQVA 4N0RA 1K70A 2CZDA 2PTZA 3T0AA 3URAA 1QW9A 1QOXA 4GACA 1J0HA 1JUEA 3APTA 3KVJA 2NVCA 3H21A 5GNYA 3PJXA 1P0EA 2Z7KA 1OC7A 2YB1A 3HG3A 1X8FA 4GKTA 3L0KA 3KEHA 3AO0A 1UBSA 4C6MA 3FX4A 3AI0A 2J9XA 1REQB 4OE7A 4M29A 1OCBA 4QDMA 3JUGA 4A4AA 4F8XA 3GR7A 5CPMA 3TC6A 3H7VA 1VAHA 3UCCA 3MP3A 3M0XA 1ITUA 2YZ5A 2QCLA 4A3QA 3URQA 4HQVA 3VNLA 1V3KA 4CD4A 3OQ8A 3N17A 2TPSA 2EG7A 5AC8A 1IEVA 3PUGA 3GW3A 1R3RA 4HCHA 5CZJA 3N9KA 4ZGYA 4I9AA 3EWDA 2VGFA 1K03A 1ICPA 3B0YA 3E0VA 3I4EA 2AAMA 2P3ZA 4J3ZA 3T2QA 3W2NA 3NVDA 2PGFA 3OTRA 2BTMA 2ZRZA 3WLQA 4XUGA 5AYXA 3V5FA 1GWJA 3ZSSA 1MNSA 4KFPA 4O1AA 1FCVA 1GG0A 2OZ8A 3E3HA 3CC1A 4I8DA 3JZEA 1R3QA 1F3TA 4OOUA 4LB4A 2BXYA 5RUBA 3LRMA 2R24A 1V51A 2GQAA 3CS2A 3QPYA 3VKJA 4OJYA 2H9AB 1DIOA 2EPMX 3VCRA 2BVYA 3P7YA 4PL2A 1JPHA 2GOKA 2E0PA 3M9YA 1T8QA 1DJXA 3GYEA 1XYCA 3HBLA 7CGTA 2A3CA 1RVGA 4B90A 1LJYA 4N9DA 3H23A 2QW5A 2HQAA 3N11A 3SQSA 4B5VA 4N9BA 3CQJA 1UP2A 4GYPC 3QF0A 2VFHA 1V03A 5JIPA 5DT7A 2G96A 3EAUA 4WEVX 3XISA 2VURA 3U48A 1EF3A 2QMJA 4PEEA 3TH6A 1GCYA 4F0RA 1M1BA 2VJXA 3VGHA 3PP7A 2QLYA 2NT1A 4CCCA 3ZMRA 1XGEA 2CETA 2C0HA 3CK5A 3LYEA 4JQAA 1SJDA 1KRBC 2ZWYA 3A22A 1Z44A 1C8VA 4C7GA 4YCPA 2FZDA 1OHLA 1XC6A 3PHAA 2G50A 2CLEA 3EDDA 3K4WA 4EX4A 1KBBA 4LWWA 2ISSA 3FA3A 3W75A 1K7XA 4GZEA 2E9BA 3ZFHA 3ARYA 3W27A 2GVEA 4HHHA 1U33A 5C2XA 4I7VA 4DAFA 3GC2A 1TFVA 3S2CA 5I09A 1WDWA 2QCMA 3OHMB 3PPGA 4LCSA 5IOBA 3VX0A 4TIMA 3N29A 2CCRA 3GDTA 4CD8A 4WY0F 4NX5A 4ERIA 4NJHA 2CXGA 3NL2A 5AECA 2BV9A 4GG9A 3QM3A 1UP3A 4CQ8A 4HZ7A 1R8LA 1TPC1 1TJPA 5D4YA 5HWMA 1MRAA 4QJ4B 1SO5A 5C9RA 1XH2A 3W1AA 4E2OA 3KVMA 1TTPA 4NX0A 4FAMA 3CH0A 1K6WA 5HDRA 5JUVA 1ISZA 3BLLA 1FWHC 1XQLA 2EPHA 4BF9A 2ONEA 3MO4A 3ZQ9A 1CYGA 4HYVA 1AFSA 1BG9A 4Q8WA 3G5EA 4AZ7A 4V33A 3N2OA 5GVJA 1B0IA 4X60A 5CC5A 2W0UA 5M17A 1KBJA 2ON3A 3GE7A 4ZEPA 2QNEA 4GXMA 2CERA 5LYRA 3E0FA 1MDRA 3MKKA 1JDCA 5FAGA 2QEZA 1XSKA 1CGUA 4LS0A 3OA5A 3WNKA 1RAKA 4JTFA 2CBVA 4P8UA 1W3JA 5I78A 4HJWA 1F4AA 5XINA 1V0KA 2OPJA 3M16A 1WDRA 4FNTA 1JQVA 1FDYA 4MWAB 2YL5A 4C1NA 2YFOA 2ZA3A 3VYLA 1R5YA 1IT7A 4W89A 3WH5A 3HPFA 3PUEA 1D3HA 1CTNA 3KOFA 3IAQA 3LTYA 1M7PA 2DZTA 3FXYA 2TSYA 3TYUA 2VXNA 4DLFA 1TWWA 1GOKA 1KR1A 1K9FA 4QG6A 3QGAC 1YDYA 4AIEA 3CHEA 3N4EA 3OO2A 3N19B 4WF7A 4DZIA 4OECA 1LRTA 4Y9PA 5HNRA 2WNZA 5HUPA 4OUIA 4MWAC 2Z1VA 5DXXA 3DFPA 4JX5A 3A12A 3UXDA 3H2OA 5FEPA 1KFLA 4NILA 1EHNA 2GYIA 1LDCA 2HNHA 3DGRA 1NOWA 4E4PA 1GPFA 4L1WA 1EUNA 4XWUA 2DJXA 4O1BA 2WV8A 4PB5A 5XIAA 4ZQMA 1MNZA 3G1HA 3U4AA 1D8CA 3RMEA 2X05A 2JEQA 3BXWA 4GC3A 1M41A 2D0GA 2E9MA 1VFUA 1XD1A 4M6QA 1S5NA 1B3VA 1G4SA 3SY8A 3AQUA 1JNDA 1SQ7A 4DNHA 1IGSA 3KZPA 3GHSA 1KKRA 1MFVA 2GVLA 5C54A 2UWFA 3AZRA 1HJVA 2AAAA 2CEQA 5IHRA 2GJPA 4HIBA 1K7EA 3GXPA 3W70A 3C6CA 4D6HA 1AQMA 2IKJA 1JDAA 4CQDA 3CASA 1M9HA 3BMWA 3UBPC 2R91A 4ICCX 3AC0A 3V5CA 4LNYA 3SFKA 3AXIA 1WBHA 3WMSA 1RLDA 3MUZ1 3E0WA 2BLEA 1T8XA 1U1HA 4A3UA 3K8MA 8RUCA 3AUOA 2FPYA 2EKGA 3KDNA 2RFGA 3CV6A 3E2QA 4GKLA 2XVKA 2YDAA 3QFWA 3WFAA 1LUCB 2RAGA 4KW2A 3LCXA 1IWAA 1V02A 3GFZA 4H83A 3W4RA 4XD6A 2FH8A 1M04A 3BK0A 1CDGA 4IGNA 4DPPA 4YWIA 3I7SA 2ATSA 1N8IA 1US3A 1OYCA 4WQ6A 4OIFA 2X0HA 1SZEA 3HQPA 3VDBA 5JH2A 3KWXA 1KQYA 5CSUA 1SYTA 3RLUA 3GXIA 4IUGA 3GU1A 2BXVA 4LS1A 4QQ3A 4GPNA 2H9AA 1T6MA 1HZYA 1VKFA 3KVLA 1F3WA 2BODX 2UV8G 4NT0A 4MYAA 3VM7A 4LT9A 4AZ5A 1UHVA 5KTLA 3BSGA 3QVQA 3ONBA 3N1AA 2QCCA 1YDNA 4AU0A 3T4CA 4KCWA 1YBQA 2C71A 3DKJA 1V08A 3AIRA 6A3HA 3GD6A 3SRKA 5HATA 3WMLA 4GX9A 3P5YA 1SZNA 3P8IA 5CZTA 5HWJA 3W1TA 1JUBA 2PDUA 1LOSA 1J2WA 2WLYA 4AMCA 1GHRA 3BLOA 2QQ6A 3UJ2A 4IG2A 3A4XA 5M3WA 3NL5A 2OWWA 2XDFA 1I8JA 4IPLA 4MAVA 4DEFA 3SUVA 4GUJA 4ZO8A 4NUWA 4LTSA 2DH3A 3NWRA 3B8VA 4GH3A 3FYYA 2XFFA 2ZX9A 3UA3A 1FHUA 4KCVA 2OB3A 2VEFA 3DX5A 4Y9MA 3ES7A 4Q4OA 3EX6A 1GKQA 5J5DA 1Q66A 4FI4A 2VYOA 3GC5A 4ZFMA 3WQFA 4GBDA 3N2CA 2E1DA 1JXKA 3BWWA 4HNTA 1TWIA 4AVOA 4O52A 3VA8A 2J77A 4F66A 5REQA 2WJEA 1ZBCA 3WLKX 4MJ4A 3TFCA 3MDUA 1BSLA 4JTUA 3PZQA 3CO4A 3VO0A 1IT0A 3NQEA 2ZICA 5K7JA 3UNDA 3G2GA 2VENA 3ES8A 3N3MA 2JEPA 4BF5A 4IFOA 3R43A 1EJWC 3TZNA 2D0HA 2I57A 2F9RA 4IGHA 4NIRA 1T41A 5DN1A 3IEBA 3MUIA 5A1AA 4AFYA 3P14A 1JCJA 4X2RA 1RY8A 1POJA 4O18A 2ABBA 4G7EB 5I3DA 3HPXA 1CT5A 2Y89A 3PM6A 4I9JA 4P2VA 3UR7A 3W26A 3DH7A 3DZ1A 2BY2A 2Y5JA 3ARWA 4LU0A 5FJOA 9CGTA 5A6JA 4I3GA 4FXFA 2DZXA 4GYJA 4LRSA 2CLFA 2FZNA 5A6SA 3IVUA 2E77A 2JF7A 3QSTA 3O6AA 2IKIA 3K1DA 2CFFA 2ISFA 3NGJA 1UMYA 3NQMA 4DHGA 3W9ZA 3B8WA 3TSBA 4KF1A 3D47A 3QY7A 2IKGA 4LYKA 1S5VA 3IUDA 5C8BB 3TEVA 4QEEA 3QC0A 1XX1A 4L65A 1DWHM 2ZA2A 3A21A 3CQKA 5LIXX 2C16A 3B8IA 3NOEA 3O05A 4JFWA 1QI2A 3WN6A 3CMFA 4R34A 1RBLA 4NZJA 4PMQA 3PJWA 3MCOA 5JIWA 4AYSA 3SADA 3AMLA 5C70A 3KCLA 3VMPA 3SSJA 3HF3A 4M6PA 1OK6A 1FQ0A 3LUTA 1VYPX 1S3HA 3AALA 2OODA 4TV6A 2A0NA 1FKXA 2DSVA 1CEOA 4CVUA 1IIHA 3RNDA 5C2GA 1XC4A 4C7DA 6ENLA 3ARUA 1HKIA 3M41A 4ZOEA 3IRSA 1HP4A 3PTDA 3VFLA 4KGJA 3T1GA 4D6GA 2ICSA 3G6MA 4MSSA 1J0YA 4NAFA 1FWIC 3N15A 4H2CA 1JGMA 4AXNA 2CYGA 4UR8A 4GE8A 2X1UA 1A47A 1SJAA 5DCBA 2WPGA 1PDZA 5EYWA 5BROA 2QCNA 3NM1A 1UKQA 4J3SA 3TA9A 1XLLA 1WUFA 2GDVA 4XZNX 4A2SA 4LS2A 1PZ1A 1LROA 2DJLA 3WQPA 6TAAA 3OZPA 1KFJA 5A5WA 4RK8A 2KX9A 1LF1A 1KR0A 1W31A 4J28A 3IVTA 1L8PA 4L4OA 2YW4A 4E2DA 1XRTA 4JDYA 4CNPA 1Q6QA 3CH9A 3CHVA 1DXFA 2PWDA 1EZWA 4XQ6A 4IIDA 3M0YA 1SFTA 1JPIA 1EP1A 3EDEA 3CL6A 4LCRA 4H4IA 1EOMA 1RQHA 1LBFA 2O56A 3HGRA 1HGWA 4AHPA 2WJFA 2HISA 2IUZA 4ORMA 5AYZA 1I2QA 5LA0A 1QOQA 2D22A 1EA9C 4HTYA 1FP9A 3R8HA 1K8YA 4MZ1A 4BQ2A 4C65A 4Y8FA 3ZOAA 2FJUB 3CB8A 1CGTA 1YIXA 4Z2LA 1GEHA 4GYKA 3MUY1 3T0BA 1V6UA 4F48A 2QKFA 3W1UA 2WVVB 2PTXA 3R79A 4NQ1A 1JYXA 1V6TA 2GUBA 4Y96A 4RW3A 3IUHA 4G2DA 3G6LA 5BMWA 3TYCA 3NEHA 4CU6A 3THAA 3QV8A 3HFYA 3LQLA 1MW1A 4O4WA 3RPTA 3QPEA 1DKWA 4GNJA 4JIIX 3V16A 3H26A 3LY0A 2W9MA 4EWND 4ZVJA 4R5EA 1F6PA 2UY5A 2VZSA 5EBUA 4JTEA 4YVVA 4E5TA 1KFWA 3C52A 4DX3A 1B9BA 4A3YA 2C1HA 2PGEA 3W88A 3WFZA 4AYGA 2F8QA 1LOQA 2BY1A 1O60A 2OQLA 4ACYA 3MWAA 1VB9A 2O4QA 2BOGX 1QOPA 3G1XA 4Q7BA 3MPGA 5FJRA 4YTRA 4XAPA 2Q6ZA 3NQGA 1E73M 2FZ9A 4LAOA 2PZNA 3LGDA 4AEFA 4GVHA 4GO9A 3FKRA 3E5BA 4ZENA 1G69A 3II1A 2E68A 1DTUA 5A8GA 3SQMA 1XKYA 1UD4A 3OOQA 3ARSA 3WLJA 1H60A 4C1KA 3PG8A 2G95A 3UERA 1ECQA 1XISA 3TAOA 4LEFA 2I5IA 3AJ7A 4RPPA 3SIMA 1S1RA 1K9TA 3LCGA 3PB2A 1IXOA 3NPWA 1Z89A 1LQAA 2Z27A 3ITLA 2IXVA 4QP0A 2QUVA 5K9XA 2PI6A 2VKZG 3ARZA 1RP9A 5BMXA 3ZT5A 1Q6LA 2Q01A 1QR7A 1FWFC 2INEA 3H8AA 3GUGA 2BWGA 2W91A 3A13A 1HP5A 2GQ9A 3HURA 2PURA 3WNPA 3MQTA 1RJRA 2YDRA 3VKDA 3LMYA 4YTQA 4AY1A 4YHGA 2HXTA 3KL3A 1Q13A 3TAKA 1W54A 5DFAA 4G7EA 4AEEA 3U2EA 3G3DA 2A79A 2PDJA 5FOOA 1XLIA 3WEMA 1S5MA 1B4KA 3K30A 4B9YA 4CU8A 3DIPA 4GCXA 1A0CA 1BAGA 1DEDA 1BKSA 2X1TA 4C60A 1E1CA 2GGEA 4IWWA 5CEWA 5CLWA 3MSYA 5SWUA 2QGYA 2EF9A 4XBSA 1QHPA 1IR2A 1E6NA 1WKEA 4KWSA 3QOMA 1B3ZA 4J5NA 3STGA 4XZMX 3PNUA 2R1PA 2NW0A 2YL9A 4JTLA 2CZFA 1ISWA 4X3ZA 5U7SA 5E0FA 3WNOA 1MWOA 2IKHA 3LCFA 3ZJ7A 3WLLA 1IR1A 3N2TA 1SFJA 2WXDM 5GNXA 3BG3A 3MTWA 1T7LA 4JNMA 1KCKA 3GNRA 5LNUA 1JGIA 1VJSA 2ZE3A 4PUJA 1J2BA 3LM3A 4H9XA 1PBGA 4MPQA 3LSCA 3CZEA 3VC5A 1GT8A 1LT8A 1GNXA 3TLLA 4DJFA 2XGZA 3SIZA 3PG9A 4MVAA 4ZQPA 4DQWA 3EKLA 1C7SA 4YWSA 1B4EA 5FJIA 4MOZA 4J3WA 3WF1A 2HPIA 2BS9A 2OELA 3VIKA 4LB3A 3USZA 3LEPA 3DN5A 3TC7A 1UOKA 1C91A 3OLIA 4R9XA 1VJZA 2VM8A 3DGBA 4A8LA 1JYWA 4S3BA 2NXIA 4Q33A 2O9TA 3BW3A 2CU0A 2GUUA 1B5TA 2WM0A 4HP5A 1I0BA 1ZHAA 2P8BA 4H04A 4H6KA 5BU9A 1W9BM 5T9BG 1IWBA 1JF6A 2WVTA 5BXSA 2B7QA 2VR4A 3GO2A 5T8GA 3GFYA 3W1PA 3JW7A 2YFNA 1AL8A 3HA1A 3KRZA 3WF4A 2FQIA 1Q6GA 1BVWA 3B9EA 4M8UA 3NTYA 2ZXAA 4QNEA 2V6AA 1G4TA 4FZIA 3T8QA 5C6MA 3GIPA 2PODA 4GGHA 4KESA 1JCNA 2YJQA 2ZXDA 4UCGA 2HEJA 3CAKA 3TDFA 1UQZA 4XZBA 1UKPA 4QS5A 1WBJA 3HGOA 4DYEA 3KTSA 1R3WA 3S3GA 1AW5A 3VOGA 2UZ9A 4KKXA 4IIEA 5F1UA 3W7HA 1TV8A 4E2VA 1EC9A 2P8CA 5HNNA 3CQHA 2V3DA 3RYSA 1UZ4A 3QY6A 4PGLA 4TTUA 5CBIA 3T55A 4A35A 3W7IA 3TYBA 1GYNA 3W24A 4F2UA 2GVYA 5C9UA 4XAGA 5CG0A 4DWSB 3WELA 1P6CA 2Y62A 1H50A 2QYGA 2RKXA 2A21A 3F4CA 2A4AA 3UWYA 5B80A 3IJ9A 1C8YA 4DF2A 2RDUA 2PTWA 1XIBA 2DSKA 2FTPA 2FKPA 3T81A 3KBSA 2PRLA 4V27A 1W56A 1A5UA 1W32A 4FNUA 1ZJBA 3IJIA 2AQOA 1RVKA 3U9IA 1O5RA 4KMQA 1ENUA 4V15A 5JQ9A 4QDWA 1YTDA 3LCWA 4AC1X 2VR2A 3LTSA 4DWSC 4CQBA 1AA1B 1FA2A 2OZ0A 4LALA 4JX4A 3TTSA 1E1EA 4P8XA 4Q8MA 1POKA 2VFFA 2QPSA 2PS2A 3HZ3A 3S47A 4NJIA 1S2VA 2QULA 4ZR8A 1E6PA 2UY4A 1ZQ5A 3I6RA 2F84A 4YNGA 2A1YA 3W37A 5JVLA 3UJFA 1CXHA 5F7UA 5AHNA 3P84A 3A23A 1FWEC 1Z3NA 4C6OA 1LLOA 1AVAA 4ZOBA 2VHLA 4XUYA 3B4YA 1M5WA 2PMQA 3GKFA 1Z8AA 2ZZ2A 3KS5A 2QIWA 3QW4B 1Q6EA 4QDPA 2NT0A 3QTGA 4DAIA 1XIGA 5I02A 2DT1A 3AUJA 3FSUA 4HK6A 1OX4B 2WWCA 2GJLA 2PBGA 5A6LA 5AHMA 5ABGA 1TZZA 3GHUA 3B9OA 2VEKA 4CCDA 4CD5A 1UR2A 5LNRA 1P5BA 2PCQA 3KBWA 1X8CA 5CGTA 4WVXA 3SCSA 2ZX8A 3L68A 2EQDA 1O66A 3B9DA 3TOPA 3VKAA 4E8CA 1Q63A 1V6VA 3GX9A 5C9ZA 5LIKX 4WCJA 2VDHA 2WW5A 2F6UA 1CW2A 4B92A 3PTQA 3WLNA 1EC8A 4CUCA 3PZUA 2DY3A 3O63A 2VI0A 3WMBA 2DZAA 1JYVA 1KFKA 3OG2A 3QQWA 3U8GA 2INZA 3WYZA 4W7VA 3H2FA 3M7WA 3CYVA 3VIJA 4FIQA 4MDPA 4MKNA 1GQJA 4WDXA 4MWAE 3LU2A 3QLDA 3U4FA 1PAMA 3EX1A 4IUOA 3UA4A 3BW2A 3E38A 1RBAA 5FF0A 3R58A 1HG3A 1UD2A 4TX8A 1UWSA 3PBWA 3SCRA 1VFFA 1XLHA 4Z42C 2XN0A 4XSLA 4Z2JA 1XRVA 4W85A 3H2NA 7A3HA 3P5ZA 3RK8A 1F6KA 5FL0A 5DO8A 4Y8EA 3HV8A 4L56A 4AWEA 4HZ8A 2J27A 5I03A 3FAXA 4ICMA 3EMQA 3AU6A 3F4WA 3BLPX 3W38A 3VKKA 5TBOA 2PE4A 4MHBA 4IMDA 4UFMA 1E70M 3K5XA 3LQGA 1WDSA 4ZQOA 3C2VA 1B2YA 4AD3A 1ZU8A 1TO3A 4JTGA 4M0XA 3B06A 5CJNA 4RE4A 4J4KA 4JICA 1EX5A 1UR0A 4YN5A 3RR1A 5CG7A 4JZ5A 1IHIA 4QG8A 1VZWA 3VCNA 3MT1A 3HTWA 1HGYA 1SVDA 1X6NA 4GJJA 1KGUA 3ABOA 2YIHA 4N9CA 3ISIX 3BGJA 1WXJA 4JYFA 4XSMA 1EWEA 2FLIA 2XJ7A 4MNJA 1BVZA 1YNPA 1HVQA 2GJNA 1BF6A 3AS3A 2FYMA 3N6QA 4NJGA 2JGQA 4Z2KA 4AHOA 4C6IA 1KTCA 3VNDA 1QT1A 3EZ4A 4LGXA 3G3MA 2V5LA 1D3GA 3F5JA 3VD5A 3NPUA 3KS6A 4LCQA 4RLIA 3CMGA 4DBUA 1UWIA 2PAJA 3ZS4A 1J10A 4L64A 3HQNA 3MV01 1KQZA 4CNTA 1FOBA 4UTLA 1KBKA 3UZWA 1UD5A 4NXSA 5D9PA 3DAQA 2R1MA 2YXGA 1M68A 2CLKA 3VOFA 5G4HC 1FKWA 4HU0A 1LYXA 3NQVA 4ICNA 4AX6A 4O8AA 2XZ7A 4C6EA 1H49A 3IJ8A 3GH5A 4JL2A 1ITCA 3H22A 4DXVA 2EO7A 3KP0A 4V28A 4E4UA 3MC5A 4O15A 4PMRA 1W9DM 1ODUA 3IVSA 3VPLA 4Y9NA 4PB4A 2E6AA 2XIOA 1FXQA 3ENLA 3SRHA 3KUMA 4MY8A 4CN1A 3D5HA 4XG1A 4UNKA 4ZQRA 2XPKA 4R27A 1JZ7A 1WZKA 5KEZA 2V68A 3C0JA 3MY9A 3EDJA 3CT2A 3W7LA 2DP3A 4CNNA 3OLDA 2H6RA 4O14A 3OBKA 3BC9A 4H9UA 4HA1A 4HCLA 5XIMA 3LX9A 4ZOCA 3UP8A 2QDEA 3UZJA 2OEKA 1XBXA 5EFDA 2FGBA 2F2KA 4J3XA 3WO8A 4QS6A 2DZVA 1C90A 3KP1A 1JDEA 3IIVA 3LLDA 4N6FA 3FJ4A 4R53A 1B9ZA 1JZ8A 3XIMA 3WG6A 3LMZA 4JN7A 4RCXA 2DORA 4KRUA 4MLJA 3NQFA 3W1NA 5I7GA 1XKJA 2GWGA 4MM1A 1WB0A 2XH7A 2PGWA 4CLMA 4ILSA 2VFGA 1RY0A 5F4XA 3UFYA 5HR6A 4UTIA 3LPPA 2PRMA 2V2CA 5JMUA 4DZHA 3DG3A 5I3HA 1EA0A 3L4UA 3W1QA 1E6SM 1XI3A 1VEMA 3S46A 4TTGA 3GXMA 4KEZA 1LLWA 1XD0A 1XBVA 1O5KA 1H5VA 2DGAA 4D8ZA 5I3JA 1LWIA 3WJSA 2CESA 3C2EA 4XV0A 4DB7A 2QJGA 3KOYA 4PSRA 4IMEA 4BQ3A 4B3KA 4C1LA 4F3HA 1AW2A 4GQQA 3F5KA 3VXGA 3OQEA 2X0YA 4ZTYA 4Z17A 3VABA 2QCDA 3S5YA 1PEZA 4RKAA 4C5YA 2VZUA 3SY5A 3RU8X 7REQB 2RDTA 1RBOB 2W27A 1QASA 4AW7A 3WUGA 4FX8A 2PPGA 2KAUC 1ELSA 3IIOA 3W3OA 1E0XA 5HPOA 3RMJA 4I7WA 3W53A 4IX0A 3L0GA 3L66A 4TQTA 4UC5A 2HROA 3TTYA 4QE1A 5J5RA 5CC6A 1UKSA 1TCMA 4HMNA 4DXXA 1EX1A 2XFRA 3L23A 2PU0A 4D8LA 3QW3A 4G5DA 4Q8PA 1GZ1A 3UU0A 3MA8A 4AZIA 4JY8A 3CV1A 3SO7A 3W1MA 3RILA 3WK3A 3GHRA 1TUXA 4TVUA 1CI1A 4MPKA 3ZT7A 1EC7A 5A6BD 3OHIA 2BOEX 2PP1A 2BB0A 3Q45A 4BI7A 2J8GA 5D33A 4FB7A 2BVDA 4JTHA 3LV5A 1PWLA 4IMFA 4O54A 2ZRUA 4Z1DA 3L4WA 1W17A 4LUSB 2J7BA 2WANA 3MANA 4DYJA 2YLAA 1FDZA 3AZTA 3TTEA 1JPMA 3VIHA 4H6EA 1UA3A 5D05A 3GTXA 4HA0A 2C91A 5CCZA 1ONWA 4DO7A 2CHNA 1GVIA 5LNVA 3E02A 4BI6A 4AIOA 1OB0A 5AC5A 1XFCA 1B57A 4HU3A 5BRBA 1UCWA 3PR2A 2IQTA 3Q94A 2OO0A 4LYQA 5F1VA 5KINA 1BEUA 1PX4A 1EHAA 3QGKC 2WC4A 4QE4A 4K8GA 1QPQA 4RE0A 1K4HA 4KEVA 4JKMA 3L2LA 2QR6A 4NNBA 2V82A 1R86A 1UR1A 4LOCA 1S2TA 3AMKA 5HULA 4DN1A 4QJ3B 2QJIA 4PFHA 4BWLA 2B7PA 3GDBA 4FLOA 1FY6A 2A3AA 2ZA1A 4D1JA 2YA2A 1IZJA 1CBGA 4JKKA 2PWGA 1JPKA 1E3XA 3NG3A 2PTDA 1CXFA 1XHGA 1EIBA 1L9WA 2XG9A 5FSDC 1LORA 3O6DA 4M19A 5HQLA 3NQ7A 3H4WA 5HWNA 2D3LA 1XLJA 1J5TA 1AQ0A 1K8CA 3B97A 1EGZA 3GH7A 3QBUA 1VIZA 2TODA 1Y0EA 2ZRYA 1ADSA 5HMFA 1W3KA 4X63A 3PB0A 3IIXA 1PZ0A 1TPH1 4LPCA 2PD5A 1U2YA 3GWQA 3LI1A 1VF8A 5FF7A 3NJ3A 3BCFA 1XYFA 3ANVA 3PBUA 5EPDA 4F0MA 2DIKA 3KAOA 1A5SA 1FRBA 4S2CA 1BWLA 1F6YA 4B15A 5CGMA 4WKHA 4Z08A 3KLKA 4U3AA 2OOGA 2B4GA 2X09A 5L9FA 2XH0A 3LBOA 1UASA 3OLEA 1VBRA 1JAEA 2YW3A 5KMYA 4IHCA 3VDAA 2DT2A 1HKWA 4HNCA 3DFTA 3KWSA 2WMKA 1XG4A 3KOZA 1JRCA 3PBVA 4OZOA 1OM0A 4O1CA 1R87A 4E8DA 2WCSA 1G94A 3OLGA 1ZTVA 5BU6A 2PDGA 2A3BA 2Q3OA 4ZL1A 1GHSA 3SFWA 4OBSA 2YBUA 1XIJA 1H7NA 4U2ZA 1HW6A 5ABEA 5FACA 5M5DA 2BHYA 3OGVA 3UT0A 4AHQA 1G4PA 1HL2A 3RRXA 1A50A 1XH0A 1AMKA 4NNAA 2EGZA 3GM8A 1VIWA 4LY8A 4RPQA 3NL6A 4KEMA 1W5QA 3MZNA 4I5UA 5A6TC 4C6DA 2E5BA 2AQVA 1Y5VA 4G56A 2DT3A 2WBGA 4GINA 1XIMA 2OWXA 3CV7A 3QHNA 3QFEA 3ZR5A 2RUSA 3T78A 2ZZ3A 3ZR4A 3SRFA 1W8GA 2XSXA 4KIEA 2PDQA 4IX2A 4M1RA 3G8RA 2OT0A 5D03A 1TCDA 2V38A 2Y6ZA 5CZ0A 3GVRA 2PC8A 4IQJA 2DH2A 1X7FA 3T0DA 3LXAA 5E93A 4FR1A 2PDPA 4O16A 2RGLA 4H2HA 2C6QA 4U4MA 3MSGA 1W1B1 1EKOA 1KWGA 1MZHA 3DCPA 2NQHA 3MV11 4LC8A 2ZZ1A 2ZVIA 3L4ZA 3BSMA 1QK0A 1TIWA 1KTBA 1QMLA 4FNRA 4QSFA 4HPHA 5A6AA 3H70A 3W81A 2V69A 4FR6A 3BVJA 4ZO7A 2CZEA 3W76A 2GGJA 5A2CA 2J75A 1H3GA 1E6XM 1G0CA 1KFBA 1UWUA 3S2NA 2ZX6A 4NVTA 4UQBA 1B1YA 4FLQA 1YXDA 1MVYA 3BH4A 4S38A 2VC6A 1J12A 1VS1A 8XIMA 3SN1A 2QCFA 1UOZA 1W5MA 4JEJA 4CNUA 4PUEA 3MYPA 3PANA 1VCFA 3NA8A 1L6SA 4N2YA 1ISYA 3RR4A 2J62A 1UD6A 4LH8A 1PIFA 3SGZA 1OY0A 4IMGA 4EPDC 3JU2A 1TV7A 1QNSA 1JF5A 3INPA 5EL1A 1MO0A 4WX2A 3WD0A 3ZLGA 3LDVA 3TFXA 1R7AA 4MJ2A 1O5XA 3EWUA 3UXLA 4A8RA 4I5XA 1TVLA 1ME9A 3CT7A 5AZ1A 3A4WA 1XRFA 1BXCA 2CHRA 2HVNA 1IZCA 2D20A 1LQ2A 5I6SA 1NTHA 2D24A 4AAJA 1ZPTA 1BVNP 3Q2DA 4K37A 2YCLA 3IACA 2JBMA 4TOQA 3VMOA 1TSIA 2PLKA 4ZSTA 3NZRA 4MG4A 3RO8A 4LAKA 3ERPA 3G22A 2JKPA 3TYDA 4IGSA 3RHGA 3W7EA 2QCGA 1SM9A 3UXKA 2NXGA 1NWUA 4LRTA 3CIVA 3FJLA 3RX4A 2ZXQA 3VZYA 3EA1A 4JQ4A 4R7JA 1W5OA 3S2LA 5A6BA 1K02A 3OVQA 3QSRA 3ITVA 1TTIA 1EB3A 1T0OA 3UXIA 2YCJA 4P8WA 2GVGA 3WKZA 1ZCOA 1Q85A 4FSAA 3O2LA 1IEIA 4XKMA 2YLLA 1BWVA 4O10A 1XCFA 4GH1A 1R47A 4MY9A 2Z00A 3W7CA 1TKKA 4JTSA 3VGFA 1DJQA 3AZSA 5A2AA 4E3TA 4ASTA 3RITA 1W3NA 1ZAHA 5H91A 5FCZA 1GYMA 2ZRVA 2F2HA 3TLQA 1OIMA 2XISA 1VR6A 2E9LA 1Q5MA 4C90A 3V1PA 3S0CA 4PRRA 3W0KA 1Z6KA 5CKSA 3SGGA 2DT0A 3UESA 1YHTA 4J3TA 4I5RA 5TF0A 3LNMA 4G7FA 4GIRA 4MZYA 4D6CA 3RAOA 1BHGA 1UPMB 4XO7A 3TQVA 2D73A 1R46A 3WUFA 1XM3A 2CZVA 4KCTA 3GIQA 3ZXWA 1HIZA 3RDKA 1I9CB 2VWSA 3FNDA 1XPYA 4HNLA 3SUTA 3ZYZA 3TYAA 4IIGA 4W7WA 4ZZ9A 1TQJA 4AD2A 1ZENA 1E4IA 3AIQA 3GW0A 3I7QA 2DVUA 1BGGA 1GQNA 5B7ZA 4FNQA 4AF0A 1WZLA 3PULA 1VP5A 3OBAA 3TWBA 4URIA 4NXKA 1LT7A 4TUFA 3CAWA 4B4FA 4YTTA 5BYWA 2V2DA 3W82A 1RJQA 1SZRA 2PDXA 1JDDA 3FDKA 3NAVA 2VDIA 4GJIA 3UY8A 3FGCB 3WBAA 2XFWA 4CGTA 3V0UA 2G97A 5FF2A 1YKWA 3AXXA 5A94A 1XWYA 2EKCA 4LSBA 3BQ6A 1XLCA 1RXOB 1FWWA 3C3NA 4GI6A 2VGBA 4YMZA 5AYBA 1IF2A 3TQPA 5A6MA 3QXBA 3VAVA 1E51A 2HBXA 3M7SA 1KRCC 2EJAA 5F2GA 3H2AA 4HSOA 3G1RA 1W1A1 2FVKA 1AQHA 4XVDA 1GORA 1VYRA 4C6JA 3CNYA 4Y9AA 4IXHA 4I7UA 2HE5A 3S2JA 5CSSA 3MU7A 4AWSA 1XG3A 4GC4A 2CWXA 4H41A 3QJAA 4TMCA 5D9MA 3WQEA 3LOTA 5E0CA 5FI8A 3LGEA 3BJSA 3TVAA 2WCAA 1KD0A 4OUEA 2HBVA 2V3EA 4JIEA 2ALDA 4REQA 3CZKA 2J6XA 4H19A 1ICSA 1DORA 4L5ZA 1BYDA 3KBJA 2Y61A 4EF8A 4XX6A 5I06A 3DU0A 3VFCA 1P7TA 4WY0B 1EWDA 3IIPA 3PTMA 3Q65A 4JD4A 2OGYA 3OIHA 4ZMGA 4UQAA 5C5YA 2G8ZA 1NEYA 4DJDD 1VEPA 4JTIA 1EQPA 1PTAA 4KBXA 3QLLA 1J9YA 1HVXA 2G4FA 1BTCA 2R8WA 1ZRQA 5DQPA 2XTKA 3P8JA 5GJNA 5JXQA 2JE8A 1PCWA 5AHIA 1DWIM 3FXGA 2ISWA 4ZE4A 4G1NA 5FJTA 4EP8C 1NELA 2Z29A 2OTDA 1V93A 1L6GA 3V36A 1C8QA 3BG5A 3EDFA 2VGGA 2Z1BA 1CGYA 2VZVA 3GTIA 1ODZA 5KETA 3REQA 4DO4A 5CPTA 3K8LA 4X0VA 1OX5A 1HF6A 3DENA 1UZHA 1T99A 4IJRA 4Q8VA 2WHLA 1ALDA 1DXIA 4HK5A 4PZVA 3ZR6A 1OT1A 3BZGA 4NYUA 3FHQA 4NAEA 2BX7A 3BOLA 1EPXA 3WQ4A 2P76A 4GUFA 2A3HA 4CKQA 3FDGA 4J2MA 4FLRA 2VL4A 2X16A 1T96A 1PV8A 4WJ8A 3WDHA 5HBFA 4HN8A 3AICA 5HNTA 1W1TA 3ONCA 3PZ9A 4YIWA 4MNMA 5M1TA 2AMXA 3P60A 4GUIA 2X1RA 4PMOA 2VUYA 4DM2A 1H61A 1TA3A 3HMCA 3QHOA 4UTTA 2FB3A 4P7NA 1CZ1A 2P50A 3WDRA 3W25A 4DRSA 4JBRA 2PWEA 3ARXA 4NJKA 1E9ZB 2C3ZA 3UG8A 3K2GA 3M46A 5AOUA 1FUYA 2IPFA 3DHUA 3WLRA 2R1KA 4DJEC 1CECA 4B5NA 5CBBA 3BAJA 3I3DA 1AK5A 3KOXA 1U5HA 3PAJA 3IV3A 1GQIA 2VX5A 1DJYA 2OLAA 4XD5A 3GZAA 2BNJA 5K2ZA 3TSDA 1ITXA 1UMLA 3M5ZA 3PS7A 1LRQA 3L9CA 1VHNA 4GXPA 1QNQA 5HAOA 4FP1A 4OWGA 2W3ZA 4ROQA 4DUXA 1O68A 4KIRA 4N42A 4H8UA 3EX2A 3RRAA 3V0SA 4WLCA 1DTNA 1QUMA 3P81A 2PWHA 2ZUSA 1XLEA 3ARVA 1VBJA 3R10A 3B0VC 1NQKA 4N4PA 3U7VA 3TXVA 1UUOA 4H9VA 5G4WA 3MI6A 2WO5A 1OF8A 1BYAA 1P48A 4Y7EA 5C2CA 4MYXA 3EWXA 3W2JA 4QJ5B 3IJ6A 3C61A 2NQ9A 4LQ1A 1F07A 2WMIA 3URBA 1Z32X 1Z42A 3BSHA 3T0CA 1L2UA 4XIAA 1H1ZA 1W5PA 4XZLX 4XVEA 1TJ0A 4BR1A 4XD3A 1F8IA 1T40A 3GTHA 1CB2A 4RE2A 3B03A 3NXLA 4HYWA 3IUIA 1PKYA 1O12A 5LKYA 1Q65A 1UKTA 4WK9A 3MW7A 4H7VA 3E0LA 4XAYA 1ME7A 1KXTA 2W67A 3RX3A 1FVPA 3ABQA 2OCZA 1E0UA 2XIIA 2VEIA 5A2BA 5DCEA 1YRRA 1OIFA 1I2RA 2I5QA 3C2RA 4A05A 3WD2A 2VZTA 4B5TA 2YX0A 1X6LA 1WKYA 3GAYA 2QPUA 4YU1A 3GNNA 4JPGA 3S5SA 1JZ4A 3N13A 3KHJA 4JDBA 5CZKA 3FIGA 4UR9A 4AD5A 1OADA 5C7VA 1SFSA 2ZX7A 7ODCA 3GAKA 3EA2A 3ZVHA 3K1GA 5DF0A 5TNVA 3SZ8A 4YYCA 2BOFX 2NQZA 3CQ0A 3PBMA 3PJTA 3W1XA 5CJ5A 1KLZA 2HZGA 1UIOA 3BUVA 4UXDA 3HGJA 3GK0A 4RDVA 2R6OA 5AVHA 3W6LA 4BHYA 1LCOA 3BL3A 3UCDA 3OGRA 1DJWA 1KCLA 3CEUA 1E1FA 3FGCA 1LP6A 1XYMA 4LV4A 4A8IA 4M81A 3EEZA 4RZBA 2B7NA 1KXHA 3NVTA 1TPFA 3GDRA 4C1NB 1AG1O 2F7FA 3BZJA 2AL2A 3C2OA 1A3HA 4W5ZA 1DJHA 2O9RA 4HMCA 1F73A 2TYSA 4A21A 4N6EA 1WV2A 1PZ2A 2E6DA 3S2MA 2E28A 4MF4A 2W61A 3WZ0E 5D2TA 3S6DA 3M0JA 2XUCA 4OQVA 5LNSA 2D3NA 2FH6A 3ABXA 4BY3A 2WZTA 3WBEA 3C8NA 4AUBA 3L4VA 2ZCGA 1KCXA 3GNXA 3GVQA 1EQCA 4AIBA 4HYRA 4NYYA 3GUWA 1OYAA 3RPDA 1N82A 4IPNB 3TOYA 2DU2A 3RN6A 1VRXA 3W02A 3FVMA 3W29A 4MFEA 1H62A 3AIBA 3O7UA 1NP0A 1NP2A 4S3GA 1H7WA 4E3VA 1W91A 3FHAA 2C18A 3A9IA 1TPDA 4M82A 4HU8A 4Q8NA 4QTGA 1FWGC 3DFYA 4GQRA 4XBJA 4XKYA 2WNQA 4JFTA 2J88A 1IIGA 3LENA 1XDMA 1TV5A 1VC4A 2WNNA 3EWCA 1TZ7A 2NVDA 4L6OA 1AD4A 3C4UA 4P7OA 4MFDA 4XISA 3D6NA 3B4UA 3LPOA 4M7SA 4H8HA 4U5KA 3Q67A 3H53A 1EP3A 3VTRA 3VINA 1PKNA 5CPQA 3EWYA 1ZAIA 3V7PA 4RXFA 1LOLA 1ESWA 2YL8A 1LM1A 2ZDSA 1UC5A 4PBEA 3BQ5A 4XBKA 3A24A 5BWAA 3WNLA 2Z24A 3A5FA 5DANA 3ATYA 2JF6A 3H2CA 1D7KA 5CLTA 3WNMA 4CVWA 4Q8TA 4Q4MA 4LY4A 3SUUA 5GJPA 1US2A 3LXCA 1VH7A 3IGSA 3QV9A 4HPNA 4OGZA 3FA4A 3DC8A 5LGZA 1E3ZA 3UWVA 4XTDA 1SSDA 3SCUA 4UOZA 3W7OA 3C86A 2PB1A 1W6TA 4IXXA 4R7OA 1XIIA 1N8FA 1Y8BA 4LUIA 4YHEA 2W92A 1ADDA 2GJXA 3ITCA 1ZSXA 5BWFA 2PU1A 1U22A 3H4GA 1KM3A 4R33A 4V1YA 2X1IA 3GBEA 4JL1A 3ARTA 1TX0A 1CXIA 5LGXA 3VDCA 3P67A 2EEXA 4JAWA 3HMJG 3W1LA 4BCEA 2NLYA 2HE8A 3PF3A 4WSJA 3OZOA 3ITTA 3CXOA 3G1YA 4MNLA 2YKKA 1EJ7L 5G1TA 2Z25A 2PLMA 3TC3A 4UMAA 5AHLA 2VZOA 3HO8A 2VNCA 1WX0A 4F0SA 2WKJA 1JCYA 4NZ4A 3EOEA 1CXEA 4GJ1A 1TB3A 2ZUTA 1R0MA 3QH2A 1VBGA 2ZE0A 1GZJA 4X9YA 1DIKA 1E9YB 4PMNA 1YBQB 2INFA 2PLCA 1I4NA 3RFAA 2FFIA 3E49A 2I9EA 1JR1A 2E5CA 3AHVA 5G2IA 4FOUA 4PE8A 4XIMA 2O9OA 3WH8A 1Z9AA 4B4HA 1JEZA 3W7RA 3GHTA 4AD0A 3EYPA 1UH4A 3M1ZA 1YTKA 1CGXA 2WWDA 4IG2B 4O57A 3L7RA 4O11A 1JULA 1XR2A 3CL8A 4P8VA 4J9JA 4XB3A 1SW7A 4ONVA 4H6RA 3NDZA 2A2IA 4HPJA 5K9DA 1TMQA 4YL2A 2VC9A 2ZWZA 3BGAA 3L12A 3QYSA 4XD4A 4UTMA 2VX4A 1W0MA 1GYLA 2J66A 1KM5A 5IDZA 4HZ6A 1O5QA 4ZXOA 3DBPA 3GDLA 1A0EA 4ORIA 3TN3A 3U0HA 2OGJA 4PMUA 3W84A 3F03K 3KBVA 3NR0A 4OHQA 3GFXA 1XUUA 5LZLA 1DWFM 4MJMA 3WJXA 3ZLFA 3LCHA 2YXOA 1KM2A 1DPMA 2OKTA 3TCSA 2GDUA 4PUUA 4ACZB 5REQB 3W7DA 1FH7A 4IFRA 3N6JA 1PIGA 4J3VA 4XZIA 1W9PA 1UZDA 4H6QA 1VFLA 4AVFA 4B3ZA 1TIMA 4CD7A 2B81A 5CSRA 5IRPA 4ZXLA 5MKGA 3M64A 1R9YA 3BLEA 4K39A 1P0DA 1I60A 3TA6A 2QJHA 5CSYA 3A3WA 4MGGA 1V3HA 2HVMA 1NH6A 2VRJA 2BGNE 3WQWA 1E9LA 4LV9A 1VPXA 4JEQA 5MF5A 2C0AA 3FLUA 2F6KA 4JNZA 4PH6A 2E3ZA 3WNNA 4BZYA 1V3MA 2XH4A 2C1GA 1GKPA 3DBNA 5DCDA 2ACQA 3F5LA 3G1VA 5A8PA 1ZBWA 3A3HA 1E6ZA 3W2KA 3ITYA 3GNOA 4A22A 1X97A 3AHYA 4ADTA 2V5BA 5T26A 1MUCA 4S3AA 3TZFA 5IFPA 1YDOA 1RPXA 1O6IA 2P0IA 5CPLA 3I68A 4JTAA 2QVNA 4GD0A 1C8XA 4PB3A 2QGHA 2DIEA 4UB9A 5HJYA 2PFHA 4HPGA 2EG8A 2HDJA 3DFQA 5BW6A 2GLKA 1EBHA 5IBXA 4WDWA 4E8GA 2CXEA 4GFSA 4W86A 4PUMA 1J0KA 1CLVA 3VD9A 3MI2A 1UWAA 4C5ZA 1K9DA 2FJKA 4S2BA 4AY7A 4UTKA 4IFKA 2NX3A 1B31A 1ADOA 2DEPA 1M01A 4NASA 3WFLA 2ZVRA 2F38A 2XN1A 4M80A 1XLMA 3RXZA 1W8SA 3F2DA 4A3RA 1MSSA 3NQ8A 2VT0A 1P4CA 1KM6A 1VD6A 2Y7EA 2BG5A 3VC6A 4DBEA 1UB3A 2Q8XA 4O17A 3SCNA 2JKAA 2J9ZA 2XINA 1M7JA 4QAIA 3VGGA 1UH2A 1QNPA 4NAFB 1JXJA 5BRQA 3MSRA 3W22A 1PB0A 4J35A 1RZMA 2E40A 1OG6A 2Y8UA 2BASA 5HR7A 1FWTA 3TJXA 1RALA 2ABAA 3M6DA 3BMVA 2E5DA 3PZOA 3VOHA 4F40A 1XCXA 2JGYA 1R38A 3UJSA 1E5JA 3IPWA 2I1OA 3M0IA 1PO9A 3N73A 5I3IA 3ELFA 1RK5A 2V63A 1FP8A 3E96A 3UGRA 3QYQA 1FFQA 3ZSTA 4HBKA 1O7AA 1TRDA 4H8NA 5AKQA 3TYEA 4XAFA 5A8QA 3GU9A 3CPUA 4K68A 3STCA 4I6VA 5D9NA 3U6WA 3CYJA 4LBUA 5BXPA 4B9ZA 4J2PA 4UZUA 5H6HA 5TAOA 1KXVA 2WHKA 1TPVA 3T09A 2FZ8A 1EXPA 3RO6A 3ZLHA 4Z2HA 1W2VA 1VRDA 1BXBA 3LN3A 2YA1A 4PMVA 2YBTA 5ENLA 2Z28A 5LSMA 4L7ZA 3UNTA 2BGQA 2ZC1A 1OFRA 2XSBA 3R5EA 4S3CA 3FOKA 2GSJA 1E71M 3SCWA 4GGBA 3ABRA 1BF2A 5AYIA 1UUMA 4AZGA 4O1EA 4NRRA 4F0HA 4HJFA 3P6LA 1B3WA 4G6CA 3R0KA 1VPQA 4L9YA 1SMDA 1HFBA 3B3DA 3TMQA 4Q7IA 1K1DA 1Q2RA 3WQ8A 4O50A 2O0TA 3NIYA 1TJRA 1ZCCA 1WZAA 5DBUA 1U1JA 3UY7A 4HKPA 4YVXA 4NZ5A 2BFGA 4O19A 2YCEA 3CEPA 4FNPA 3P2VA 4H9ZA 1WOAA 4ZQCA 2QAFA 4ECLA 3O0FA 4YTUA 3W7JA 4AB4A 3CAQA 1RHCA 4DBDA 4EVZA 4IISA 1OT2A 1Z69A 3DHFA 4OT7A 4GZIA 5FIPA 1HXJA 4M6UA 1EH9A 5BOEA 4PL1A 2YDSA 3B40A 4X22A 3W83A 3BTNA 3WENA 3N2BA 5E9AA 4IIFA 1GTEA 3C0QA 3VNMA 2X41A 4YJ5A 2XWEA 3BURA 1UJPA 3DERA 3U2ZA 3L4XA 3KE0A 4EPBC 5I77A 5HMSA 3DFOA 3MBFA 3MHFA 4S3DA 3F4NA 1JZ3A 1DWGM 1P0KA 1YDVA 2UY2A 1DQWA 1VEOA 3H7UA 2V2HA 2ODOA 3HG5A 3MP5A 3GG7A 3O07A 1W1ZA 4AZHA 1LZOA 2P3EA 3LG3A 3SRDA 4J1OA 2XVLA 3RIKA 3VOJA 2YA0A 1OC5A 2CBIA 3LPGA 5HJLA 1NFGA 4ACZA 4DF0A 3KOWA 4UNIA 3ICJA 2XIJA 4GK8A 3NPXA 1YE4A 4XO6A 3DECA 3VZZA 1H5YA 3KZSA 4QIUA 3BANA 3PUOA 3AHTA 3WQCA 1DE5A 1QHZA 1FDJA 3ZJKA 3CWNA 3VUSA 3ATZA 2QIIA 3RM4A 1UQYA 5H1WA 3T2OA 3W86A 1R9ZA 3MP4A 1I45A 3POCA 4QCEA 3AXHA 3AYRA 3UG5A 1BG4A 2Y4SA 1AZ1A 4FK9A 2P88A 3OG3A 5FF4A 2QS8A 3G8EA 3NSMA 2JALA 1XLGA 2WC7A 1XL9A 3A5VA 1DBTA 2OZTA 2ZDRA 3OW1A 4GXWA 3USBA 1GVYA 3TTQA 1CENA 1XF0A 2PA6A 4O0KA 1E1CB 1NJJA 3T07A 3WCZA 1F8MA 3QZ6A 1EEPA 1X39A 2HK0A 1P6BA 1P43A 2V5JA 2XGBA 3OB8A 1NOFA 3WMCA 2QDHA 1KV8A 3NSXA 3BG9A 3FCPA 1R3YA 4QRNA 3LCIA 2PF0A 3OJGA 3ABSA 1ZJIA 4H01A 3QKEA 4PEKA 3F1QA 5BCAA 3DXIA 1XFBA 3UYCA 3PNZA 4QR6A 3EXSA 3FY1A 3ALGA 3BDKA 2I9UA 3S9IA 1RSCA 3KDOA 4H7ZA 4FMVA 2CITA 3VDHA 1JZ6A 2R9RA 1SO6A 4RDYA 3FVDA 2WC3A 1DP0A 3GY1A 4TMBA 2ACRA 3JVAA 3PBYA 3BW4A 4QGCA 3P93A 2A6NA 2VRKA 1VENA 1W1VA 2VDGA 1RD6A 4IL2A 3NQAA 3JRKA 2CW6A 5A6KA 3FKKA 4US5A 1Q2SA 4A6GA 3WF2A 3R0UA 3LSBA 4DJFD 3C2YA 1ZP4A 1VCVA 5EMKA 3U5UA 3OYXA 3EKGA 3GDMA 3IARA 3EOOA 4L9ZA 4M56A 2ACUA 2GK1B 4KH2A 1JRBA 3M4HA 4JQ3A 1XS2A 2PDNA 2ZUUA 2WHJA 3W28A 1TV4A 3VE9A 3RCNA 4GHRA 2QPXA 1XIDA 4MKVA 1D7FA 5M03A 4LVFA 4JS3A 3G0XA 3VUPA 4ZOAA 3CZLA 3FEMA 1KO0A 1CCWB 3SBFA 1JYNA 1OYBA 1F5ZA 2PDMA 4WIWA 1H2JA 3IAPA 2OQHA 1PSCA 3MJYA 4B16A 2C19A 4IQDA 3IJ7A 1YPXA 3IJLA 5DY2A 5EKYA 3B8TA 4ES4A 4FA3A 1RD5A 4U5IA 3THQA 3S4TA 1J4EA 4S39A 3T6CA 4GIEA 3KRUA 2WZHA 5D37A 2PWFA 3NYZA 3H24A 3WLIA 2NV9A 3ARRA 3I6EA 4F0LA 3DOPA 4I6KA 1UR9A 1UKOA 5BXRA 5EMMA 5G2HA 4LBSA 4FO4A 4POCA 3OIXA 4HA3A 4HNOA 2ESCA 5D32A 2ATMA 3RF9A 2WSYA 8XIAA 2W4XA 2HXUA 4W8LA 1Q3NA 2CKSA 5DBTA 5D8ZA 2W6RA 4WUIA 4Y9OA 3WD1A 1E6RA 4WHBA 2XIQA 4RZ4A 2ZC8A 3NNTA 3RGTA 3EPOA 1D8WA 2WVUA 4WSKA 3QEZA 3DG6A 1OABA 5F2MA 3H6OA 3SB0A 3OPSA 3U2OA 2J7GA 2BGSA 2XVPA 2HVOA 5L6UA 1B30A 4Z0SA 2V67A 2W66A 5DMYA 1NOUA 3FJNA 4E2BA 3WSUA 3SGUA 2FDMA 4O1FA 3EPNA 2E4TA 3L67A 3KFTA 5CAKA 1OZMA 1WP6A 4U31A 2YOCA 1HJXA 1PL9A 5FAJA 1FHDA 2BVTA 4NHVA 2AOSA 2DSZA 5F4WA 5JBDA 1D2KA 3C3UA 1VLIA 1A5KC 2RDWA 2FGLA 4H7CA 1JUKA 3TV8A 2CLOA 2XM2A 2Y85A 4HSHA 4XZHA 5EBAA 1FH9A 2A6LA 5B7YA 3ORWA 2ISDA 1FWSA 4UWMA 1ZALA 3WQOA 3PC0A 4LUYA 1V3LA 1E43A 2IPJA 3H2EA 4Q8UA 3KL5A 3VILA 3PZVA 1XIEA 5MHBA 2BY3A 5LXXA 3MYOA 3ZM8A 3S8HA 1G5AA 4EACA 2J8TA 1X1OA 1KCZA 3ZJ6A 1VGAA 3UJEA 3CM4A 1EDQA 1GVSA 2FZMA 3L4TA 2WSPA 4JTDA 3BO9A 3RM9A 1MW3A 2HMCA 2OXNA 2YGYA 3QR0A 4PUWA 3QQ1A 2WZMA 2PDYA 2F61A 2YL6A 2WBKA 4UFIA 3AYTA 4K3ZA 4INFA 4OVXA 1M3UA 4H00A 5DELA 3TXZA 3UWQA 4NZFA 1XSJA 4RDZA 3BPWA 3MMDA 4TV5A 2BHUA 4L1GA 2GJRA 1WDQA 2WMGA 2HJPA 2HNEA 1XLAA 3L4YA 3VIFA 1Q6OA 1GW1A 1YNQA 4PMZA 2HK1A 4WOZA 2WMJA 3FK4A 4O28A 4C6BA 3AJXA 3MMWA 2Z2AA 5FJUA 3UW6A 4DZAA 3HG4A 1CIUA 2C1IA 5DT5A 4RNHA 1NF7A 4Y6GA 3KRBA 2GVJA 2AGKA 2WZIA 4BF7A 1MEHA 3PZTA 4QROA 1G01A 2JK2A 2VCCA 3NL3A 5H8MA 4NI3A 4ZTXA 4QCFA 3RU6A 4HMEA 4HGXA 1K6AA 1FFRA 3WQ5A 2TAAA 3UZYA 1E9IA 5A95A 2Z1KA 6REQA 1M7OA 2VD8A 1H09A 3RJYA 3ANUA 4R9OA 3LPFA 2ISVA 2YDQA 4PFMA 2V5DA 4LNCA 3QMSA 2FFCA 3L21A 3KBMA 3AROA 2XFYA 1OD0A 4O13A 1I6NA 2PP0A 2W79A 3UPBA 3BOXA 3ARPA 4MB3A 1LTDA 4ROPA 1DL3A 2W5FA 3PPHA 3S5NA 4UQDA 1FH8A 3C2FA 5IXEA 5DEZA 5KZ6A 3MB9A 1MQPA 1P1XA 1R30A 3PZIA 1U5JA 1AH4A 1O1HA 1PYFA 1X7IA 4Q4KA 2QUTA 5LIYX 3VE7A 2VO5A 4TR9A 1DJNA 2QAPA 1EZ2A 1PTGA 1S2AA 2OLSA 3LHVA 4YPJA 4Q4SA 1AL7A 3LRKA 3I10A 5K9CA 3LHUA 3FN9A 3MVTA 4CCEA 4MADA 2ZZ6A 4DF1A 4I9TA 1KNWA 1CXKA 4BQ4A 4DJEA 1SZFA 1PX8A 2J13A 5D2WA 2DZSA 1YXYA 1PKMA 2GK1A 1AJ2A 1IXQA 3VIPA 1HL9A 3ME3A 3VK5A 1V6XA 1YPIA 3DUGA 1C9DA 2XN2A 4O0ZA 3W00A 2Y24A 1AW1A 3MVIA 3KL0A 5D30A 2GSEA 5E0KA 3P74A 1EO7A 1EGMA 2NV2A 2V5CA 3HPSA 4K36A 3S42A 1OGBA 1ZZMA 2IPGA 3BLIA 2R1NA 2DV0A 1V02E 3CJPA 3DFHA 1S39A 3AYVA 3E12A 1FHLA 3B05A 4J40A 2QUUA 3R0DA 3RLGA 4RXGA 4BKNA 4WKFA 3W2MA 1A5MC 2MANA 3GTNA 3RCYA 5J04A 4TU1A 3CZGA 1RQBA 2Y63A 3LHYA 2BHZA 2Y7GA 1TG7A 4JYDA 3A9BA 3CGTA 5HA7A 1ONXA 1CX9A 2RH9A 2OYKA 3TN5A 1CLKA 1R2TA 4FEZA 2V3FA 3YPIA 4L9XA 3VIMA 4EANA 4RNFA 3STPA 3Q58A 4FF5A 3V18A 3W2LA 4EXQA 5KITA 5I24A 3LS9A 3LCLA 1BRLA 3CHDA 7ENLA 4C7FA 1SR0A 2P0OA 4NZCA 4QX4A 4ENLA 2PUZA 3D3FA 3KVKA 1TPB1 1XJBA 5AHFA 4J27A 5H8PA 4R7WA 3G1FA 4FIRA 3SJNA 1GW9A 1DWAM 5FEZA 1TPEA 2Z0IA 2YBVA 4EWJA 4AMAA 4WDUA 4JIPA 1L8NA 1S2WA 1R9XA 1DJZA 1EXBA 3P62A 4PTWA 2EPNA 1E55A 4K6AA 2WNWA 3NO3A 5A8OA 4DM1A 5C71A 1ZLPA 3A4AA 3GG1A 4WR3A 3ITXA 3R4IA 3B8DA 3SI9A 1Q45A 3R6IA 5HPCA 1GVOA 1B3OA 3CHCA 1B3YA 2FMNA 2I17A 4CCZA 2OWCA 2A3LA 4UIOA 4QBXA 1EJVC 4PTNA 1BTMA 3WIJA 4HB7A 4B3LA 2A85A 1GJPA 5FEXA 4JTRA 2QCDB 1A5AA 4GMEA 3THCA 4RNJA 4KS0A 2WQDA 3V0TA 4MKSA 1ECEA 1UG6A 3CQIA 1VFSA 1BQCA 1KRAC 1GG1A 1F61A 3PFMA 6ALDA 3HQ1A 5FD0A 3UPMA 1B3XA 2Q8ZA 3O9NA 1V7AA 1VHCA 1QNOA 2CPUA 1UPPA 1F4HA 5HANA 3H4XA 1Q8JA 2NUYA 1EOKA 1W3IA 3V1HA 1W37A 1L6WA 1T5AA 1DQUA 1U5VA 3APGA 3QV7A 3R13A 2XSAA 2GSHA 2Y8VA 4W93A 3VU2A 4PULA 3GRIA 4WXZA 2WYSA 1QDSA 4ZE5A 4DUVA 1FWJC 3S1VA 1UR8A 3UWWA 3LBCA 4JHOA 3W87A 5LHEA 1JFHA 1K4GA 5DXYA 2NWSA 1J96A 3T40A 3N6HA 4PA8A 3TW7A 3HJZA 4UFHA 4H9YA 4CQAA 4Z2GA 1NU5A 2G41A 5BZAA 1EDTA 4RV8A 3TKFA 4MWAD 4PCSA 4GFIA 2OEJA 4EF9A 2OFJA 4LAZA 1J11A 4HA4A 5D2XA 3OU8A 2XH2A 1VFHA 3M43A 4GZJA 1F3EA 5EMLA 3OA3A 1KA9F 3IWPA 4G8TA 2ZTJA 3TMLA 3GVGA 4O4VA 2PCEA 2HS8A 1GZGA 3LRLA 3OZYA 5LIWX 2RDXA 2OEMA 1N55A 3KRSA 1W9XA 3R12A 1MQQA 4RV3A 3CWOX 2Y70A 5E5CA 3CUJA 4UFLA 3UVIA 5FSEC 4C6QA 1Z48A 3WLHA 1OCQA 1LWJA 1WDDA 3BCDA 3DHDA 4IPJA 4LVBA 3TU9A 2XVNA 1OJXA 3DYMA 1H1YA 3MKVA 9XIMA 5TD4A 4JY9A 1K9EA 1TVPA 3H12A 4KFNA 4F4RA 2A3EA 5HQMA 3VZXA 1UP0A 3AYSA 1E0WA 1E0TA 3PY2A 1G67A 2UY3A 3OVRA 3W7KA 1G9HA 3T7VA 5BOFA 3LB0A 2HCVA 3GNDA 3LZ5A 2ZXBA 1HJSA 4UZSA 1IEQA 1REQA 3WH9A 2OLHA 3N4FA 1ZGDA 3T44A 1S38A 4BWLC 4DY1A 4FALA 1SR9A 2J6VA 4L80A 4MDOA 2WSQA 2Q02A 5CXPA 4IGMA 1RUSA 2J25A 3CL7A 2ZX5A 3SUSA 3GR4A 4W4QA 3O6YX 4LAUA 5ABHA 4O0QA 2NX9A 3WL1A 4KWUA 1LBLA 5A8MA 1DHKA 1AD1A 1EGVA 2Z2BA 4RNIA 1TZ9A 4D6FA 2PZ0A 3IANA 3OVPA 1TMHA 7PTDA 3M0HA 4BA0A 4C6CA 1Q7QA 1XLKA 1QW7A 3BLDA 3GR8A 1NDWA 3QZAA 5IFTA 2QDGA 1KGXA 1A3WA 3VCCA 4GYPA 1TE1A 4DPQA 1A5OC 4Q6JA 1W1IE 2OQYA 1NIUA 1A5BA 1J01A 3E1F1 2WVSA 4GVGA 1GUVA 4ZCWA 2GZXA 1DHPA 2G3FA 1YEYA 2EHHA 4FPSA 4ZODA 3UJRA 3VKBA 2VQTA 4QFUA 3T4WA 4DXKA 3RLHA 1DOSA 3FW6A 4EXAA 3WQ6A 2FGZA 3A47A 1QO5A 3GLCA 3FV9A 4W8BA 1RH9A 2OOFA 1V0NA 3AU2A 3F2BA 3VD3A 1N8WA 1FCBA 5C0QA 1ZNNA 2DW6A 2X0SA 1N7KA 3GXDA 4UQCA 3E2VA 4YCOA 4JQ1A 3NQBA 4PMYA 1KB3A 2IW0A 3VMNA 1G6CA 3URNA 1XBZA 2X1SA 1XV8A 4O12A 3T42A 2GWNA 1OFDA 3KX6A 2A7PA 4LX4A 2VOTA 5F2IA 5CAHA 2P10A 1KRMA 1QI0A 1XGZA 1HTIA 4U2YA 3L65A 3HG2A 2WMFA 1QI5A 5T91A 1SZGA 4A29A 1WA3A 3CMJA 5G5IA 3WQDA 4QJ1A 1OFOA 3M0MA 4FXSA 2DDXA 4JIQA 1XXXA 2J47A 3TSMA 1DWJM 4OV9A 4G9PA 4CN4A 5IHSA 4K8HA 2YYUA 5D04C 1MDLA 4IJCA 4GNVA 2JIWA 3UR5A 2J4GA 1K7FA 4M3PA 2YXXA 2Y8KA 2NZLA 2Z4GA 6PTDA 2YSWA 4EKJA 3EA3A 2PDKA 1E40A 2PDFA 1V5XA 3NGFA 4WOQA 1OVDA 4ALDA 4QAWA 2OSXA 4LEQA 1DYSA 1MRQA 2PTYA 2VC5A 2BP1A 3BLKA 2C14A 1M53A 4PSPA 2R94A 3R25A 5CBJA 4UTWC 4N9EA 4NSBA 1LL4A 4KETA 1RP8A 3K8KA 3AMCA 5FKYA 2WAGA 4AZCB 2Z1WA 1JFXA 2YCLB 3F7JA 5CH9A 3BAXA 4HHLA 2FHBA 5D2VA 5DLCA 3NZGA 3W07A 5DX7A 3UZZA 1GJUA 1F2JA 1EJUC 4HNNA 1TX2A 4DBSA 2REQB 4U28A 4R85A 3ZWTA 3NPVA 3GC4A 1C3FA 2QJMA 1SJBA 2HRWA 1QPNA 4U3CA 2O92A 3UYIA 1QHOA 3IJDA 4LYRA 1OFEA 3BAYA 1E5NA 5ECUA 4BS0A 5EMUA 1JD9A 3FA5A 3SM0A 3FSTA 4GBUA 5EY5A 4MWAA 4NKCA 4PYSA 1V6YA 1R3SA 1NWSA 2D2GA 1JPDX 4GISA 1LG2A 1DJGA 1DXEA 2J7HA 3LV6A 3WH7A 2ZOXA 3T2PA 5EA9A 3AMDA 2CNCA 3TN6A 2JIEA 4LUTB 1WKFA 4GABA 2NWRA 2DZBA 2PDHA 2Q71A 3N3TA 2O9PA 1JI2A 1AUSL 2WSKA 3EEGA 4U33A 2BSLA 2JQXA 2WKLA 1KM0A 3UVAA 2VCAA 3CLMA 1JQXA 3C0LA 1OFQA 2WM1A 1XCWA 3H7RA 1UIPA 3UD6A 4HOXA 4WKAA 3VOCA 4UOJA 3G24A 3WH6A 3B9NA 5BOOA 4ZBCA 2ZUNA 1UWTA 3EPMA 4CQ9A 1EUAA 4RX0A 5AYYA 2DW7A 2I16A 3EX3A 1HX0A 4IOTA 1QBAA 3PBGA 3VNKA 1UROA 1QJWA 2NUXA 3LZ3A 3OEXA 1AH3A 4IT1A 1BD0A 2Y0FA 4NZ1A 4I90A 1SJCA 3NSNA 1F76A 2JKEA 2V81A 3O15A 4AF0B 1UW9A 1W1PA 3N18A 3GH4A 1PZ3A 3OZMA 5ABFB 2PBOA 1NWTA 4WSHA 4HMDA 4OFCA 3O06A 7TAAA 1WAUA 4IF2A 1EJXC 3NQ6A 3TUUA 4JIHA 1HL8A 3AOFA 2C15A 2VTFA 4M1BA 4GY1A 4L6HA 2WQPA 1IV8A 4UOQA 1V7YA 1IWPA 1OK4A 4O8RA 1WO2A 3MZ2A 1SO3A 3TNOA 4QEHA 2FPTA 3WF0A 1DJIA 4LW7A 1OEPA 4EAYA 3S9YA 2RJGA 3EMZA 3PK7A 3QTPA 1NY1A 3IJQA 4JCMA 5E1QA 1LUCA 4JXCA 2EAWA 4DBWA 4FHAA 3LA4A 4HNUA 5HINA 1L6YA 1OGSA 2VEMA 2EPLX 4GI9A 3N4AA 3A64A 1GJWA 4GUGA 2EPOA 3TK7A 3IV8A 2QXWA 1J0ZA 1EL3A 5E6ZA 1C7TA 3NQ2A 2X7WA 2V3GA 1R7OA 5T9CE 4QNWA 2WZEA 2VX7A 1J79A 1NWRA 4KWVA 4REQB 2PP3A 1ICQA 5E9XA 1MUWA 1Q7ZA 2RHGA 3ID7A 3SN0A 1QO2A 1P7TB 1G1YA 3N14A 4BJHA 2D2HA 3UWZA 1J0IA 1VLWA 5ABTA 4IIBA 1IE7C 4UQ9A 3UEQA 3DYPA 2ALRA 4Q8OA 2YYTA 5AB3A 2BDQA 3LI0A 3RUBL 4IL0A 4Q32A 3IGXA 1WAWA 4AY8A 4PUKA 1P6WA 4DZ5A 1PUDA 3S5ZA 3L2MA 2PEVA 3S6OA 3WBWA 4US6A 2Z1XA 4AXKA 2ZUMA 1BLIA 1XRSA 1H63A 3O8AA 3REQB 2D0FA 1WOBA 5PTDA 2AQWA 1C9WA 1NVMA 1XUZA 2VFDA 4LANA 5I3KA 3VD4A 1M65A 2V8ZA 3AIVA 2BVWA 2VP8A 4IPIA 3VVGA 3GXNA 2Y88A 3DC0A 4ATWA 3SQLA 4NAEB 1PJ9A 1GVQA 1X98A 4JTCA 8TIMA 3UG4A 1FXPA 4PMXA 3WBXA 2EBNA 1QCWA 4MUPA 1IQ8A 3M47A 2Y2WA 3NO5A 2QVHA 3P0XA 5I79A 1QTWA 3EKZA 5D2YA 2PWUA 4FXJA 4HVXA 1AJZA 4AC7C 3NDYA 4C6KA 4GY7A 4L4PA 2OYLA 1X1NA 3OODA 3F4DA 1FWCC 3WLTA 1V8EA 1CXLA 2D69A 4UFKA 1TA3B 3HJEA 1ME8A 3MCMA 4FS9A 3BLFA 5AVNA 3BGGA 2OU4A 4B5UA 4WDTA 2HWGA 1PCKA 2YCKX 1NDZA 3RCMA 3ZVIA 1RPKA 3PPCA 2VEPA 3BV7A 1YNYA 3GZ3A 3GTFA 1Q6FA 1HT6A 4N02A 2XGIA 2PWVA 3V3WA 4IP4A 2RJHA 3E0IA 4CEXC 3IGHX 3Q4DA 1BPLB 3SCPA 4E0CA 3TJLA 1R3VA 3JS3A 4XZWA 1H4PA 5D02A 1K3UA 3STEA 3L0NA 3EOSA 4AZCA 3RM8A 4UTTC 4A8NA 1ISVA 4F0KA 2PDWA 1XYBA 4M51A 1S5WA 4MTVA 4GIYA 2QF8A 3E9AA 1QK2A 1RA5A 4PR4A 2DSUA 4RJEA 1LL6A 2REQA 1ITQA 4N7QA 3LHZA 4JN8A 1EJTC 1L6FA 1FWNA 2FDSA 2FPVA 1RA0A 3K13A 1H7RA 3O16A 4GI8A 4LJ3A 5AN7A 3MUXA 4LVAA 2Q3RA 3N04A 5HQEA 3B8UA 4HN4A 4RDWA 2ZIDA 1N2VA 2DZPA 4MZ8A 4EK7A 1J93A 2VMFA 3G0UA 4C91A 2WMIB 4UTFA 4RZ5A 3FS2A 4IP7A 3L5LA 2CLHA 3BICA 3HN3A 2C79A 2AL1A 5I0DA 2VFEA 3UG3A 4K1WA 1ZUAX 4GNKB 2O4MA 5CPOA 2X40A 4OBTA 3T9PA 3KCJA 3CIXA 4LUTA 4HSNA 4PUDA 1VBHA 3E2SA 4TVCA 2QT3A 5F2LA 4H3DA 4PRWA 5BRPA 4WJXA 4LFYA 3GXTA 2Z2UA 1Z41A 3KXQA 4UBPC 5I07A 2B31A 1PVNA 3Q37A 1NF0A 4QM1A 4HHMA 4AD4A 5G4EA 1QI3A 2KZHA 2IS7A 3WDIA 1Q4WA 1KGWA 3LHWA 3BAWA 3WDJA 4HD5A 4WZHA 1E56A 1KLYA