3R43A

Akr1c3 complexed with mefenamic acid
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
316
structure length
310
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of three classes of non-steroidal anti-inflammatory drugs in complex with aldo-keto reductase 1C3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
total genus 117
structure length 310
sequence length 316
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2011-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3r43A00
3UZYA 2PF8A 3UWEA 4HBKA 5AZ0A 1OG6A 3MB9A 1AH0A 4WDTA 3N6QA 3BCJA 2INEA 3ONBA 3CV7A 3WBYA 3EAUA 3R43A 4NKCA 3UZWA 2PDYA 4XZMX 1EKOA 1S2AA 3WG6A 3RX3A 4EXAA 3R58A 2PDBA 3UZXA 4XZIA 3DN5A 4IGSA 5JH2A 1Q13A 3UGRA 1US0A 3BUVA 3LENA 4LAUA 2IPFA 2FZDA 2PFHA 3F7JA 2ALRA 5JH1A 4PRTA 5HNUA 1XGDA 2INZA 1UR3M 4QBXA 2PDNA 3UP8A 3D3FA 3C3UA 1YNQA 3GUGA 1EL3A 2BGQA 2IKJA 2F2KA 4GQGA 3WBWA 2A79A 2NVCA 2QXWA 5LIYX 3Q67A 4XAPA 4OTKA 1R38A 3M4HA 4GABA 4IJCA 4HMNA 1Z3NA 4XZHA 3V36A 3LQLA 2DUZA 4JTAA 3G5EA 2AGTA 4AUBA 3M64A 3ERPA 4EXBA 4JIHA 1T41A 4YVPA 2ACQA 1QRQA 2NVDA 1ADSA 3V0TA 1Z8AA 4G5DA 5KETA 1A80A 4QR6A 3H7UA 5HA7A 3M0IA 4PUUA 3BV7A 1YE4A 3V0SA 4H8NA 4ZFCA 2IPWA 1GVEA 3LBOA 4YVXA 3UG8A 4PMJA 4LB4A 1LQAA 3LN3A 4XZNX 2ACUA 4JIIX 1VBJA 2IPGA 4GCAA 3R6IA 4L1WA 1RY0A 2HE5A 1ZSXA 2IPJA 1AH4A 3NTYA 1X96A 1YE6A 3WCZA 3CAVA 2C91A 2R9RA 4WDWA 1PZ0A 4QXIA 3UFYA 3U2CA 2J8TA 1ZGDA 3CASA 1RALA 1VP5A 4JTCA 1MI3A 5LIXX 3S3GA 2ISFA 1FRBA 4WRHA 4FA3A 5AZ1A 2FGBA 1MRQA 1Z89A 3FX4A 3DOPA 4GACA 1AZ1A 2PDJA 4FAMA 3P2VA 2FZBA 2HVNA 4IJRA 1Q5MA 4YVVA 5LIWX 4XVEA 2PZNA 4JTDA 2PD5A 4WGHA 2DUXA 1AFSA 1S1PA 4Q7BA 1M9HA 4DBWA 3GHTA 3UYIA 2WZTA 3QKZA 4WDUA 3V35A 3VXGA 4F40A 2FZ9A 4GIEA 1XF0A 1SM9A 1AH3A 4JTQA 4JIRA 3LQGA 3KRBA 3LEPA 3ONCA 3UZZA 4GQ0A 2IQ0A 4L1XA 2IKGA 4FZIA 1T40A 2IKHA 1X97A 2PDHA 3RX4A 1MZRA 2HDJA 3MC5A 3LNMA 2PDQA 2PDMA 1PWLA 2PDKA 2R24A 1K8CA 4YS1A 2F38A 4MHBA 4LAZA 2VDGA 4XK2A 5LIKX 1PWMA 3WBXA 1IEIA 5HNTA 3RX2A 2BP1A 3O3RA 3GHUA 1PZ1A 4XVDA 2PDCA 3R8GA 1IHIA 3LUTA 1EF3A 4JTRA 2PDXA 4FALA 2BGSA 1JEZA 4GA8A 2I17A 4DBSA 2DV0A 4RPQA 2I16A 2PDPA 3G1RA 2FVLA 3H4GA 3O0KA 3R7MA 5C7HA 3FJNA 1J96A 2PDIA 2PD9A 4WDXA 1PYFA 2ACRA 3LD5A 4YU1A 2IKIA 4R9OA 5LIUX 2HE8A 4JQ3A 2ACSA 3EB3A 4ASTA 4LB3A 3CAQA 4XO7A 2PDFA 1S2CA 3N2TA 4JQ4A 5M2FX 1S1RA 2IS7A 3COTA 4Q3MA 3CMFA 4PUWA 4DZ5A 3LZ3A 4ICCX 3EB4A 4QX4A 3GHSA 4DBUA 2IQDA 1QWKA 3H7RA 4LBSA 3Q65A 4PRRA 4PR4A 3GHRA 5DANA 3LZ5A 2WZMA 2PDWA 4XZLX 2PDGA 3B3DA 4JQAA 1AZ2A 1X98A 1EXBA 1C9WA 1ZQ5A 2CLPA 2HVOA 2FZ8A 2PEVA 3BURA 3CV6A 4JQ1A 4WEVX 1HW6A 1YNPA 1Z9AA 3T42A 2P5NA 4I5XA 4LBRA 4JQ2A 3R8HA 1XJBA 3V0UA 3R94A 1HQTA 2PDUA 1RY8A 1ZUAX 4H7CA 2HEJA 4XO6A 2HV5A 2PDLA 1LWIA
chains in the Genus database with same CATH superfamily
3ARTA 4FX7A 7TIMA 3GXNA 4IWWA 3G1FA 5HAOA 3SY1A 4E5TA 1LLZA 3OQ8A 1M6JA 3SO7A 2ZYFA 2FKPA 1DJNA 2GFTA 2I56A 4PMNA 1OM0A 2J47A 3VOFA 3EKLA 5BYWA 2VC9A 2X1SA 2WZHA 1O5KA 2V5LA 1EYEA 2CW6A 3BZGA 3SCQA 3A3XA 2WAGA 3GVWA 5G4HC 3ENLA 4HCDA 3VIJA 1JXJA 4O54A 2Q8LA 4ICNA 4A3UA 3OODA 4BHYA 3FCPA 3LM3A 3SUSA 3CHFA 3E0WA 3BPWA 3W01A 3G24A 1FCQA 1MNZA 1CPUA 1UG6A 4EWJA 3D3FA 2Y62A 1K8ZA 1MXGA 3SQMA 3MP5A 1OF8A 3EA3A 1WDSA 1UQZA 2WVSA 1JZ2A 1HL8A 3BGGA 4B2DA 1H09A 1L6YA 3AUOA 4EX4A 3W00A 3VOJA 3P5ZA 2GQ8A 3AS3A 3AFBA 3NQ6A 1K03A 4M80A 2GJXB 1JYWA 2QDGA 1MFUA 3OVPA 2V30A 3QGVA 3WSUA 4MFDA 4HZ6A 2C0AA 2E25A 2QS8A 1V6WA 3EPOA 8XIMA 3EB2A 3RNDA 5HULA 1H5VA 2OSWA 2E6DA 4EXBA 2XWEA 5KZMA 1GQNA 1AVAA 4XBJA 1UASA 1GHSA 4Q8QA 4QS6A 5CSRA 5EA9A 2OQHA 2YLLA 4NZCA 1XC6A 3BVJA 2FZMA 2G3NA 4B5SA 1QPQA 2WLYA 3C56A 3NGFA 4QR6A 4CQ9A 3PR2A 1E3XA 4W88A 1EOMA 1CCWB 3P6LA 4HCLA 4L1GA 1QU4A 1QI2A 5FSDC 1NQKA 4LB4A 3LNPA 3AICA 1YDOA 2W4XA 2BG5A 2V5KA 1PPIA 3W7GA 5IDZA 1GYNA 3MSGA 3VNZA 1K9EA 1HKJA 2ADAA 2D22A 3VTRA 1R85A 4NX0A 3AXIA 1JYVA 3RLGA 1YQ2A 3NQFA 3CO4A 1TX2A 3KTCA 3MJYA 1YDVA 1RP8A 3NSMA 1UD5A 4H4IA 5CXPA 4W5ZA 3MVTA 3THUA 2FGBA 4RV3A 5D9NA 2DVXA 4N0RA 4NJJA 2POZA 3UPMA 1NWRA 2GVEA 3W22A 2WW5A 3AI0A 2ICSA 4YVVA 4HK6A 2J62A 1K70A 2GJLA 2X09A 4JTUA 1V3IA 4RE4A 3AIBA 3PUDA 1XIBA 1XYCA 2LLEA 2VR2A 3UR7A 3W7MA 4UTTA 2PPGA 3A47A 2PD5A 1TB3A 2GGHA 4LCRA 1JJKA 1F9CA 3GE7A 1ITXA 4AEFA 2CLEA 3LHZA 2QV4A 3PBMA 1MFVA 3L0GA 1SO6A 3PPCA 4I8YA 3C3NA 2FZ9A 2J7GA 4F0HA 3LQGA 1AQHA 3G2GA 2PP3A 3L4UA 1O60A 1WXJA 4TX6A 2DORA 2ZXBA 3LA4A 1RSCA 4HZ7A 5DBTA 5G2IA 1S5TA 1VYSX 3EKGA 3ZSTA 3VZXA 4GO8A 4GO9A 1XYZA 3NA8A 5AC7A 4LCQA 4H6RA 4HTBA 2Z1BA 3HPZA 3TFXA 2Z2AA 2WCSA 3S2JA 4QDMA 1GKRA 2PTDA 5I2UA 4WLCA 3O6CA 1IEIA 3GU1A 1RD6A 1MW1A 3UG3A 5CLWA 4REQA 3VFCA 2NUYA 4QJ5B 4Y9NA 4DPPA 1B54A 3WFLA 4AIUA 4DO5A 5CGMA 2XIOA 4FS9A 5D9MA 1ICPA 2I16A 3NOYA 3VKCA 2WSQA 3G1RA 1JG9A 5DXYA 4CNNA 3O0KA 3N4FA 1A5LC 2FFCA 4AYSA 2Y5SA 3WLIA 2OO0A 1FHUA 3QHOA 4O52A 3TAKA 2RDTA 2WHLA 4JQ3A 3CAQA 4AH7A 4HU0A 1RBLA 4ZA0A 5I03A 2QCNA 3QR1A 4L4PA 4GIRA 3CZJA 2X1IA 3W53A 2I14A 1JI1A 2WZIA 1OGBA 3LZ3A 4YCPA 4PMDA 4QG6A 1AL8A 4QCEA 4AMCA 4JS3A 3OZYA 2Z2BA 4DJEC 2CLLA 3QY7A 3TFCA 3ES7A 4LBSA 3KP0A 4BK9A 1N82A 3GHRA 3S2LA 1M7OA 3M43A 4Q8UA 1CW2A 2WZMA 2Q8XA 1IT7A 3P5YA 3FEMA 1XG4A 1NJJA 5EBAA 4IFRA 3R10A 4B16A 3VC5A 2GQ3A 3P84A 3DHFA 3U57A 1P6BA 1UUMA 1KM6A 1FWFC 1JUBA 2CWNA 4Y2WA 3IJLA 2BS9A 2ATMA 4I5XA 3F5LA 4AXNA 2Y6ZA 1BXBA 4HNLA 2HSAA 1B9BA 2ZZ2A 3L2MA 4U31A 3ZJ6A 5I79A 3DXIA 5A8QA 4E8CA 1DV7A 4H7CA 4JDBA 1KBBA 2AAAA 5IHRA 2BODX 4MDPA 2CHNA 2JQXA 1UZHA 5I3JA 1D3GA 4A3HA 3W1MA 4AX7A 2F6XA 2QUVA 4Y9OA 1AH0A 3EMQA 1V08A 3GC4A 3KLKA 5C6MA 1ZU8A 1NWTA 3IGSA 3VK5A 5HJXA 4IQDA 3WG6A 2PUZA 3CU2A 1ZP4A 3RX3A 4EXAA 1WDDA 4NAFB 4PCNA 4C6QA 4M82A 2V0TA 4XG1A 3H12A 1IQ8A 3O0FA 1ADDA 4K36A 1UP3A 1FP8A 1R3SA 4KETA 4LAUA 3VOCA 3GRIA 1UUOA 4IIEA 2V3EA 4O1CA 4QLLA 3E2VA 2A7PA 3DFYA 4IUGA 5AHIA 2PGFA 3AXKA 5CJ5A 1U1UA 4FSAA 2D20A 5DEZA 2NWSA 1LOQA 1W1A1 3CB3A 2YL9A 4MPKA 3W0KA 2E09A 1PS9A 1L6WA 2JEQA 1BYBA 1FWWA 4YXGA 1OF6A 2AQOA 3MDUA 4FIQA 4GABA 4IJCA 5F2GA 3WUFA 3GTNA 3RJXA 3ITLA 4H8VA 2AL2B 4MLJA 4FMVA 3DU0A 3W6YA 2DSVA 3R0KA 5BRBA 1DQUA 1KXTA 3FS2A 4ADTA 3NXLA 1SVDA 4UTWC 1Q4WA 4UTJA 1Q7QA 1W9PA 3V0TA 2ZXDA 3MDWA 1KM2A 1G6CA 2UY4A 4ENLA 4IMDA 1A80A 3L67A 4F79A 3VM5A 3FAXA 2DDXA 5AC5A 2ZDRA 1OHLA 3M0IA 2I5IA 2ZZ7A 3PSWA 1SZGA 3WN6A 2WVVA 4ZFCA 1P1XA 2E67A 3ISIX 4MAZA 1YPXA 3T08A 3TEVA 1E0VA 1ITUA 4XZNX 3QPEA 4A2RA 3T8QA 4E3TA 3K1GA 3MV01 3U2OA 4UFLA 1VLIA 4UFKA 3FGCA 2XHYA 3HN3A 4L1WA 2ZX6A 4HT3A 1RY0A 2IPJA 3WLRA 4HIBA 1X96A 4A29A 5E1QA 1E56A 3LGGA 1C7SA 4H7VA 3EWDA 1DXEA 3MO4A 4L6OA 1WAWA 4HB7A 3M0LA 4XKYB 1AQFA 4QROA 4GNKB 1JQXA 1QOQA 1UP2A 3UFYA 3VOHA 3GDMA 4O28A 5FF7A 4UTTC 3SUTA 1R9YA 1BWVA 3FLUA 2QCMA 3GG8A 1YLVA 2Q3OA 1MRQA 3FX4A 4QLJA 4LYQA 1CXHA 5IDIA 4MY1A 1ISYA 3W7KA 4DJFA 3ZIZA 4LU0A 3QHMA 1TKKA 4WSKA 4QSHA 5AHMA 1TV4A 3TYCA 3C2FA 3EWZA 4QJ3B 3M41A 3TXVA 6CGTA 1G67A 1LG2A 1V6YA 4UC5A 2D0HA 1FVPA 1V6UA 1RA5A 4Q7BA 4C6KA 3SRDA 1GOXA 4XD6A 1UP0A 1GZJA 4DAFA 1NDWA 2GOUA 3P93A 5FF2A 5BCAA 2WVUA 1EB3A 4EF8A 4F40A 2YFNA 1FWEC 3E0FA 3LRLA 2AL2A 3CIWA 4GJ1A 1TREA 1TYGA 3ONCA 4BQ5A 4DYKA 3T0TA 3UWQA 2XIIA 4ZMGA 2YDRA 4UUIA 2YX0A 3CAKA 3PZ9A 1VIZA 1H63A 2PZ0A 2FH8A 3KEHA 4ZO7A 1TVLA 1J0HA 3RX4A 3VDBA 1VFLA 1EP3A 3G1HA 3IANA 2IMRA 3S83A 1KO0A 4ZOCA 4LT9A 5HMFA 3S9IA 1HL9A 4O0ZA 3THCA 1LL7A 3ZOAA 1CXLA 3F4WA 3M16A 2I57A 3QPZA 4CD5A 4XK2A 1HVQA 4Z1YA 2Z6JA 2G50A 5GNZA 2P10A 4A8NA 1THFD 1WV2A 1TPB1 1WUFA 3HQNA 3GVGA 3U7BA 4HYVA 1TPWA 3PULA 4W84A 2E5BA 4DIAA 4IM4A 3URQA 2NSOA 3BANA 5BRPA 2RDWA 4JFWA 4K3ZA 4RUBA 3RU6A 1L8NA 4KRTA 5DFAA 3EXRA 3P3BA 4ORIA 4AMAA 1P4CA 3UGVA 1XFCA 4FOKA 3OP2A 2VEKA 2YDAA 4C6PA 5C7HA 4UNKA 1PTGA 4GMEA 1TX0A 2VC7A 4JN7A 5C9UA 3W2NA 4UR7A 2CLIA 1UD8A 3S2CA 4NASA 3BWWA 1OQFA 3T0CA 3TW6A 2OWCA 3WL0A 1NH6A 5E93A 4C6FA 3ZJ8A 5EU9A 1GCYA 1ME8A 3W72A 4YTSA 4XTIA 4Z1DA 3JU2A 3UR5A 3J7HA 3QMSA 4YJ5A 1B3XA 1REQB 3W75A 1QWKA 1RXOB 4KQNA 1VLWA 1O7AA 3H7RA 4U2ZA 4TX9A 2GDUA 4TU1A 4MUZA 2FGZA 3N18A 3T1GA 4FNPA 3ARRA 3S8HA 5U4NA 1AZ2A 2NQ9A 3LV5A 3GM8A 1B1YA 1HKKA 1EXBA 4AY8A 2QF7A 1MUWA 2WK2A 3VABA 2NXHA 3FHQA 1VHCA 4JD4A 4E8DA 1IR2A 1ZENA 4FNUA 3VD5A 2GGGA 2PLJA 3DKJA 4Q4PA 1TQXA 1GQKA 4MTVA 4RE2A 2EEXA 1TV7A 4D6DA 4DRSA 3A12A 2WXDM 4LAOA 1G94A 1XJBA 4MLRA 3GNOA 1QNPA 5L6UA 2VGBA 4X2RA 1R3VA 4CNTA 2XSXA 3BC9A 2INFA 1SW7A 1GOKA 1NVMA 3W7RA 4CVUA 1OGSA 2C15A 1EJRC 4MWAE 2XGBA 4WDTA 1EFZA 2WMJA 4IP4A 4RCXA 4OV9A 2HTMA 3NXFA 4LEQA 2QDHA 3CGTA 2CITA 2VOMA 3H70A 3BDKA 4DEFA 2PDBA 1VB9A 2B81A 4BEUA 3KDNA 4WY0A 1W9VA 3QVQA 4RK8A 4UZSA 6A3HA 3EMZA 4I9MA 4A6GA 2DQXA 3NDYA 1M7XA 2C16A 2WQDA 1FCBA 3CS2A 1VFSA 3QTPA 3BW3A 2NQJA 4KCVA 4Y9MA 2VFEA 1UR3M 4TUFA 1C92A 2PURA 3D5HA 8A3HA 4AZ6A 2GVYA 5C9WA 3NM1A 4U2YA 2GPTA 2D73A 1TPC1 1QASA 3QMRA 1F61A 3K8MA 4DJDA 1EC8A 1GQJA 2QXWA 3FNDA 3GIPA 4I3GA 2PTXA 1TTPA 2ZOXA 1U1JA 3Q58A 4MGGA 5FA5A 5TBOA 3G1SA 1DYSA 2G96A 3CUJA 1TJ2A 4RE0A 1JIBA 2EKGA 2DUZA 4S3GA 5E5CA 1POJA 3ZT6A 3E49A 4AX6A 3W07A 2ZZ5A 2VL4A 3QRHA 3PUEA 3RFAA 1VEMA 4JAWA 4JCLA 3M46A 2ACQA 2WQPA 5EGRA 2ZQ0A 2NV9A 2X16A 4Z42C 2OZ0A 3MHUA 1UD3A 5KETA 3VIOA 2XFRA 3RF9A 4PE8A 3KVJA 3R2GA 4QS5A 1TJ0A 3KL0A 4PUUA 3R8RA 1XH0A 1UH3A 7XIMA 2XYLA 3GDKA 2IPWA 1HKVA 4LPCA 2QZRA 3NZPA 4YPJA 4MJZA 3GFXA 2QCEA 2NUXA 2W61A 3ATZA 4Q4RA 2X42A 5I3FA 4KMQA 4A3RA 5D32A 2NX1A 1EP2A 2NLIA 1G4TA 2ON3A 3LHWA 2E77A 4HMEA 3DG7A 3B05A 4JY9A 4KF1A 2XDFA 3CLWA 2BNJA 2EG6A 4S3BA 4M0XA 4US5D 3RAOA 5XIMA 1MI3A 2AQVA 4QE1A 2ZVIA 4EANA 3N2OA 4WRHA 4FAMA 3CUGA 3MCNA 1CLKA 1DTNA 3UWZA 1QW9A 4MWAC 3CJPA 1EPVA 4NT0A 2OB3A 1M41A 1ZPTA 3KOWA 5A8NA 3HV8A 3CEUA 1C29A 1ELSA 1IYXA 2E6FA 4B9ZA 4ROPA 2ZFAA 3MY9A 4XAGA 4B9YA 2ABAA 4BI7A 2HQAA 3GHTA 4G8TA 1TELA 1AA1B 2Y7GA 2EPKX 3BG3A 2ANUA 1G1YA 3NQ8A 1UHVA 4JR5A 1VH7A 1J18A 1JUKA 4CU6A 4GI9A 3DERA 2JE8A 2IUZA 3KRBA 2Y7FA 1TIWA 3V5CA 1PVNA 1C9DA 5EMKA 1I9CB 1XCWA 4TQTA 4FZIA 3F2BA 2XGZA 2ALDA 4IG2A 3UJ2A 1K9FA 4KEUA 2ZX8A 1MZRA 1F3TA 4YWIA 4CGTA 3B8VA 5T26A 3VCCA 3JW7A 2VD8A 1KQYA 1WKYA 3VNKA 1EDTA 1KR0A 2OEJA 2A21A 3G1AA 3GG1A 4TX8A 3ZLHA 4HPHA 1EC9A 4GYPA 1UWIA 1WB0A 5LIKX 2QLYA 4F48A 4HPJA 5A8OA 1RJPA 3CQJA 4M19A 4LTSA 3TZFA 3EGJA 1OD8A 2PTYA 3WBXA 4BF5A 4MWAA 4XVDA 3TV8A 1TE1A 1R2TA 4B5NA 3FJLA 4WKHA 2EAWA 2PDXA 1E1CA 9CGTA 3OLDA 3DGRA 1XBXA 4DWSC 4WD0A 4Q6JA 1A47A 2OEKA 1JCXA 1MXSA 1K1DA 1C8YA 1UKSA 1W9BM 1FQ0A 1M68A 3DFNA 3OIHA 3SCSA 1BYDA 1XYMA 1DVJA 5I23A 2YR1A 3P81A 3KRUA 2XIBA 2YDSA 4R7OA 4Q7NA 1QHPA 3MHGA 5CH9A 3LD5A 3H2EA 4D71A 4AHQA 2CU0A 3SY8A 3SBFA 1IWAA 3I6RA 1HFBA 1OX6A 2UY2A 5FJIA 4H9ZA 4TMBA 5EPDA 4K7VA 1BEUA 1FY6A 1H1NA 3PAJA 3ARWA 4IMCA 3W1PA 1XSJA 2FPTA 3RRXA 1H62A 2PGRA 1EHAA 2IQTA 1EWDA 2QQ6A 2BHZA 5CZTA 4AYGA 5A3HA 2JALA 2A5HA 4CQ8A 4AD2A 1FA2A 3PWAA 1A5AA 4JQAA 1MRAA 4RZ4A 3RLUA 2YBUA 1UR1A 3PS7A 2Y61A 1OX4B 3GWQA 3URAA 1VC4A 4WSHA 1MW0A 2VGFA 3RILA 5ABGA 4KWOA 3W7NA 1UD4A 2FLIA 4URIA 3A5FA 2DIJA 2QPSA 3AYVA 3S2MA 2GVGA 4DUXA 4R27A 1CTNA 4ZQRA 4C6MA 3UQNA 4Q8NA 1BAGA 3MBDA 3IAPA 4G1KA 3IACA 2OLAA 3CUZA 1LYXA 2QJIA 1LWIA 3SSZA 3UA4A 3N12A 3AROA 4MIMA 1D7KA 5JMUA 3R25A 2Z1XA 3EYPA 4LUSA 3W82A 4HHPA 3VGFA 1OADA 4ONVA 1LUCB 2E68A 2VEPA 1FWNA 1EKOA 4KRZA 2WCGA 3TN6A 2J6VA 3IIPA 3UZXA 3PJWA 2FPVA 3NSXA 4PTDA 1IIHA 4W7WA 3RGTA 1XUUA 4WCJA 5DBUA 4AVFA 4GBDA 4GKTA 4LANA 2FZDA 2ALRA 3N13A 3EX1A 3GZ3A 4AWSA 1J0KA 2PCEA 3KTSA 1A50A 1ITQA 3VD4A 2QW5A 3PN8A 4TVDA 2QUNA 1W1IE 4JNMA 5GNXA 3P61A 1L6FA 2YB1A 1EL3A 2PS2A 3EPMA 4L4LA 1R3YA 3B4UA 3DYOA 3O07A 2H8ZA 2RDXA 3SSJA 3H6OA 4ZO8A 3LI0A 3ZFHA 1GHRA 3W74A 2Y8UA 5M1TA 2HROA 1VQTA 1VS1A 3FHAA 1DJIA 4XUYA 3LPFA 4Z0SA 1EJTC 5DRCA 5AC8A 2YL6A 4K8HA 2C13A 2O9PA 3BLKA 2CWXA 3LQLA 3QMTA 4J4KA 1EPXA 4WQ6A 1MW2A 1DEDA 2ZUMA 5AHNA 3HG2A 4E2OA 3K30A 3R11A 4JFUA 1JGIA 4S3FA 1GT8A 1ZTVA 2NVDA 2FIQA 3QPYA 3AAMA 1KRMA 1S39A 1EXPA 1VBUA 4PH6A 1T6MA 4KKXA 4CCCA 3PZGA 3TOPA 4E4UA 1CYGA 3CT2A 3MI6A 4GI6A 1X8FA 2O7QA 2OJPA 2Z29A 3BV7A 2CXGA 3WJZA 2J66A 4H8NA 3ABXA 4ACYA 4GFSA 3SJ3A 1OIFA 2WB5A 4KRUA 3LBOA 4M6QA 3PZNA 1V3HA 4FB7A 4ZZ9A 2XFFA 2YIHA 1TFVA 4NY2A 4B91A 4UTHA 3MUCA 4AY1A 1DWJM 1UW9A 1KCLA 1E4LA 3AIEA 3KOZA 5HMSA 4ZQNA 1YE6A 4RJEA 5CC7A 1UR2A 1K4GA 1OD0A 1W3TA 2WLZA 3TH6A 2BXYA 4FXJA 4YTQA 4O1FA 3A4JA 2VX5A 5AYZA 2MANA 2ZICA 4FA3A 4NF7A 1ENUA 3B9NA 3VIMA 1GQLA 2VWSA 2A3EA 3QY6A 4LFYA 4JTFA 1SFJA 1ZAHA 3T78A 2D2OA 4HA0A 3VE7A 1RQHA 2PZNA 4JBRA 1V93A 3A9IA 3F4DA 1LP6A 1GJWA 1UIPA 3RDKA 2G37A 4O1DA 2DUXA 2VVSA 2NX9A 5F2MA 3UYIA 2KAUC 1D8WA 2ASHA 1EDGA 4Y8EA 2AGKA 4KESA 2W5FA 4MUPA 3ZQ9A 4CNOA 3UZZA 1I45A 4UQAA 1V8EA 2VEGA 1XDMA 3H8AA 3LPGA 2J78A 1C91A 1SZEA 3MP4A 3PBYA 1X97A 4JL1A 4BEQA 4CCDA 1GVRA 5H1WA 5LGZA 5AFDA 3SR7A 5EYWA 3S9ZA 3PB2A 3NQVA 1HJUA 2YCLB 5E6ZA 3QV8A 4GYJA 2OTDA 1JF5A 5DMLA 4DF0A 4RNHA 4N2YA 2WJZA 1ONRA 1KKOA 1Q6DA 1BSLA 1F76A 3GR7A 3NM3A 1X38A 1F2JA 1GKQA 3BGAA 3P8JA 1J0YA 4S3CA 3DECA 3O3RA 2WSRA 3CPRA 4WKAA 2O92A 1R2RA 2IXUA 4Y9AA 3ZMRA 3E38A 2C8NA 1TV2A 3CQHA 3UJRA 1F73A 2ZE0A 2D2GA 3ZZ1A 3BJSA 2A85A 4JGDA 4NZFA 4AIBA 3LGDA 7TAAA 2X30A 1VIWA 3H2FA 3EWWA 3UCCA 3CWHA 1G69A 1VFUA 3WF2A 4GC3A 1J96A 1RK5A 4ZO9A 3PTDA 4HU3A 4NQ1A 4BY3A 4FXFA 3EB3A 4OJYA 3W7EA 2QUMA 2ZRYA 3NL2A 4DAIA 1EC7A 3GH4A 1KTBA 3GUWA 2DSKA 1B31A 3L4TA 2Y7DA 3BAWA 2YFOA 1T7LA 1FWCC 1OJXA 1A49A 1HG3A 5AECA 4PBFA 1XH2A 3MMUA 3VINA 4J7RA 1IEXA 1UWAA 3EDDA 4PUDA 2QV5A 1H7XA 1U5JA 4AFYA 3LXCA 1RK6A 3UWWA 2DT0A 4DYEA 1WKFA 5CLTA 3LPOA 3PM6A 2CERA 3TAOA 4IQLA 2PC8A 4TV6A 2YPIA 3B9DA 2J77A 5CPLA 4CKQA 3OHMB 1C9WA 3K5XA 3PZQA 4PUEA 2XIJA 5FL0A 1XGZA 2PEVA 2XVNA 2QGHA 2WC7A 2XFWA 1XRFA 3IJIA 4LF2A 3IUDA 1U30A 3RCNA 1SR0A 3AHVA 4Q8VA 5HMEA 3HPXA 3TR9A 3H4WA 4PCTA 1TA3B 1RPKA 1XIIA 1H11A 2GJRA 3NQGA 5G2HA 1LWHA 1RCXB 3CL8A 2B7PA 2YW4A 4UTIA 3PNUA 1W9XA 2QCHA 3UA3A 1XL9A 3KOFA 4HBKA 5K3VA 4J28A 2DZTA 2VYOA 2Q02A 3PG8A 1H61A 4A8LA 4D8ZA 3AYRA 1E1FA 3RCMA 5D4YA 1S2UA 2QJHA 3ZWSA 5KITA 4R5EA 3WY1A 3PZMA 5REQB 1O66A 1PIGA 3KP1A 5FJJA 1Q2RA 4X9SA 1SFTA 1U83A 5F4WA 3W73A 3IGXA 4H8HA 4KERA 7ENLA 2WVTA 4GNJA 5ECVA 2BHYA 5DY2A 3G6MA 1E5NA 1UJPA 3W70A 3C3UA 2VUNA 3M5VA 1Q6FA 3OO2A 5LA1A 4AZ7A 4KH2A 4IP7A 4H04A 2IKJA 4OU1A 4OECA 2Y2WA 3VM7A 3ZYZA 4RE3A 3TA6A 2QCDB 1J11A 1SW3A 1OVDA 1T8QA 5J04A 3WJSA 1OC6A 2WCAA 2A3LA 1JYXA 3CQ0A 3CUIA 3W2JA 3TMQA 5F1UA 4HPXA 5FF0A 3W1TA 4JIHA 4QQUA 3B8SA 1O5XA 4M6UA 2V69A 2YZRA 4IL0A 1DWAM 5DN1A 1PDYA 4W7VA 4I8DA 1PEZA 1GONA 3AHTA 1KTNA 4MAVA 1L2QA 1IF2A 2X2YA 4L9YA 2BGNE 1PAMA 2PMQA 1K6AA 2E8ZA 3CC1A 2J7FA 1PX3A 3U8GA 2V5DA 1PL9A 2OSXA 5D2TA 1PBGA 2WKJA 1CT5A 3KOYA 3S5YA 2VR5A 3HGJA 4U10A 2OCZA 5K4ZA 1DIOA 4GIYA 1XQLA 3KVMA 4G7FA 4XISA 1G0CA 3HU7A 5DT5A 5EFDA 4Q4SA 4L6DA 1R6WA 2OX1A 3WF0A 5D2VA 3OQEA 4X61A 5FF3A 3KS6A 1HJVA 3P62A 4DWSA 3H55A 1P0NA 3UEQA 5MHBA 1Z7AA 4M81A 5ABHA 2CIPA 3ECQA 3ICJA 4DVOA 2GJPA 3EX4A 1A0DA 3STCA 3XIMA 4MJMA 3VMNA 1TMLA 1KB3A 4D2JA 1NELA 4LUJA 3T81A 2H3BA 1WDQA 4B2DD 4LVDA 5LIXX 1QTWA 1FRBA 1WYIA 4Z2JA 3L5MA 4UTLA 3QN3A 4HKPA 3GNDA 4S39A 1J0ZA 3WQ6A 3P74A 4OE7A 2YB4A 3BJTA 4UQEA 4O50A 4QIUA 1ODZA 4AF0B 5J5RA 3S0CA 3MCOA 3B8UA 4O1EA 5CPQA 4M1RA 1MWOA 3B9AA 1XIFA 5DF0A 1HVXA 5F2LA 4TVUA 3A4AA 1AQMA 3K8LA 3QKZA 1ME7A 3WO8A 1V0LA 3TMLA 4U28A 4FOJA 5FJRA 1PSCA 2C6QA 4L80A 1RLCL 4BF7A 1QR7A 5KINA 5KMYA 5C71A 1P7TA 4EWND 4GQ0A 3C8FA 3SECA 5AY7A 1EZWA 3KZPA 3MVIA 3SCWA 1W6TA 2VC6A 2W63A 2HNHA 3G1XA 3PG9A 1XRTA 2E1DA 2WNNA 4GG9A 4CD7A 3ARUA 1WZMA 3TTQA 2R24A 3W2MA 1WO2A 4QJ1A 4Q32A 4NIRA 5D09A 1F07A 4GINA 4C6CA 1HGYA 3W7IA 1JPKA 3NG3A 3IUHA 4K7YA 3V7PA 3BOLA 4DN1A 1BVNP 3GHUA 4PRWA 1UC4A 3U9IA 4XD3A 3W2LA 1KC7A 4DXVA 3A64A 4GXWA 2V67A 4AD0A 1YPFA 1JRCA 3K4DA 4J3TA 3O63A 4Z1BA 2G95A 3NO3A 2ZTKA 4RPQA 3UPWA 4YN5A 3VAVA 4DXXA 4ZTXA 1LL4A 4Y8FA 1DWFM 2AQWA 2O0TA 1DJQA 3MSYA 5I24A 2ACRA 4K8EA 3B04A 3NZ1A 1UKQA 3MT1A 3MPGA 2ACSA 3OU8A 4AWUA 3BAKA 3DC0A 5CG7A 4I6KA 1Q6CA 2ZRVA 4OBSA 4HD5A 4RNFA 4F3HA 1Q6OA 3MZ2A 1KR1A 5M2FX 3MYOA 1S1RA 3T9PA 4DBDA 4E2DA 2WNQA 2XISA 1PE1A 3BQ5A 1YIXA 4NZ3A 5D38A 2Y8KA 5CCZA 1SFLA 2QVHA 3TVAA 2IQDA 3LM7A 4RX0A 3TZNA 1KFLA 2HNEA 3ZXWA 5DANA 4D1JA 5BWAA 3EDEA 4EOUA 2PDWA 4JTGA 4CEXC 1UJQA 4Z1AA 4DF1A 3TW9A 4MOZA 2VGIA 1F05A 1TRDA 3K2GA 1X8CA 1JR1A 1X98A 2BY1A 3V75A 4EKJA 4CVWA 1KNWA 3EWBX 4D72A 2E6YA 1B5TA 3FA3A 2PWHA 5TQLA 3LGEA 4WEVX 3TDFA 1QNVA 2X1TA 4QRNA 1H3GA 5BU9A 5JIWA 5BOOA 3VKBA 5A8MA 1GJPA 3FW6A 4L4OA 4JEQA 6XIMA 1KFCA 4OUIA 3GH5A 4F9JA 1Q8AA 2D2HA 3WD3A 2A4AA 1TZ7A 1WDPA 5I0DA 4J3VA 1PCWA 3S1GA 1YADA 2WMIA 1PKYA 3LCXA 1LOLA 4JTHA 4PMUA 4FNRA 4XO6A 3W7OA 4Y90A 3ZVHB 4HNVA 3NJ3A 2OT1A 4DF2A 5JXQA 2HXTA 3W2UA 1US2A 1H7WA 5FEXA 4W86A 3S5SA 3AIRA 3IPWA 3WJXA 3BCJA 1A4LA 4PB5A 4CN6A 4MKNA 3CH0A 4W89A 3ALGA 1EJ7L 1XFBA 3L4XA 5DQPA 4LXFA 1Q13A 3ARSA 2YCJA 2RH9A 1R9XA 2O4QA 1DJWA 5BRQA 3NO5A 3OJGA 3THAA 3IJ8A 2FMOA 1OGGA 2F9RA 2IPFA 3TXZA 4JDYA 1ZZMA 3KBNA 5CPTA 3T2PA 4F2TA 4KWSA 3WH7A 3SUVA 2G4FA 3PBVA 4OWGA 3M5XA 1OFQA 1ME9A 1O1HA 5JUVA 4MPQA 1W91A 3P14A 2ZRWA 3AZRA 3VCRA 1L0PA 5CKSA 5HK4A 1XM3A 3QV6A 3WBWA 2A79A 4DX3A 3IEBA 3F03K 3Q67A 1SPQA 5FEWA 4OBRA 4GGHA 3MBFA 4EACA 2VVNA 2QCCA 2WNZA 1KLYA 6REQB 4FEZA 4FLSA 1DJYA 1XKYA 1A5CA 4O11A 3I3DA 5EFFA 4YVPA 1GTHA 2WWDA 3U48A 1JPIA 2VFIA 2YA1A 1ADSA 8RUCA 2O4MA 4QGCA 3FJ6A 3EPNA 4Q4OA 4W8LA 4W5UA 1CLVA 1NOWA 1KFJA 3KTXA 4GOAA 3ZJKA 5HA7A 4RNJA 3VA8A 2VCBA 4ZGYA 2PP0A 4L5ZA 4K38A 2PCQA 3KWXA 1LZOA 1OWQA 2OLHA 1HN1A 4LVFA 3PANA 2JF6A 2VZVA 4TOQA 4S38A 3S42A 2G3JA 1GQIA 3UXKA 2QPXA 1XRSA 4NZ5A 4F0LA 2A7RA 6TAAA 4C7DA 3VI2A 4O0KA 2R9RA 4R7WA 4UMAA 1IT0A 1EGMA 3ABQA 4MZ1A 9XIAA 4NHVA 2REQA 4LYRA 2J8TA 1BTMA 3CASA 3TA9A 5LA0A 2AAMA 5AHEA 3M0ZA 4UQBA 3DFSA 1LBMA 1JCLA 1UZ1A 4IX0A 5I3IA 2BFGA 3L4YA 4PEEA 1JPDX 3BCDA 2O7SA 3LHVA 1HKMA 3NWRA 2BLEA 2E9LA 1ZCOA 1DWIM 1M04A 3E9AA 3W1AA 2F61A 2W0UA 3B8IA 5DLCA 1ISWA 2UY5A 1PIIA 1TVNA 1QBAA 3CTTA 1KGXA 3DYMA 2ONEA 3UJFA 3OLGA 2VFFA 1H5YA 3LB0A 3KM8A 2DZWA 1A5BA 2V2HA 5DELA 1QHOA 5H2ZA 2A3HA 3LEPA 3BG5A 3ZJ7A 1D9EA 3BW2A 2W6RA 2EQDA 2ZUUA 4CQBA 1P1MA 4LS0A 3KZSA 4MB4A 1E51A 4GXMA 4LALA 4NU7A 4L61A 5XINA 1J79A 2Q09A 3W02A 1FH9A 3JUGA 3OW1A 3TC7A 1B3YA 5FD0A 3VYLA 1K8CA 2GWNA 2FGLA 2V68A 3RO8A 1F3XA 4AEOA 4QSFA 2QULA 5JBEA 5C8BB 1Q2SA 2Z1KA 3MU7A 2TYSA 3EEGA 2Z28A 1A3HA 1KM5A 1UUQA 2BTMA 2DT1A 4XAFA 1FKXA 5H91A 6ALDA 3FDKA 4O1BA 5CPMA 1VCGA 1EH9A 1FXQA 2D3LA 2EPLX 4ZB2A 4FK9A 3G1YA 2WHKA 2PD9A 4KEMA 1CGTA 3TC3A 2CLKA 1CGUA 3LMZA 1UB3A 5TD4A 1PZ3A 3D47A 3PBGA 3QKEA 1RQEA 2BASA 2BOGX 3VIIA 1O5QA 2IS7A 3COTA 4NYUA 5HNRA 4GVFA 1QFEA 1EA9C 2QGYA 3BO9A 1A5SA 2VRJA 1P48A 1PKMA 4QAIA 4LQ1A 5LYRA 2V63A 6ENLA 5BXSA 1T0OA 4QJ4B 2X0SA 5BXRA 3NL3A 4RXFA 1EBHA 3QYSA 1VBGA 1G7UA 3V16A 2UWFA 3B8TA 3BSGA 4H9XA 5D37A 1W1VA 5CPNA 3EXTA 2E9BA 3NZQA 3DFHA 3QLLA 1Q85A 4K1GA 4RXGA 4H1ZA 7A3HA 1UC5A 1MQQA 2F8QA 1GVFA 3BH4A 3P8IA 1C3FA 2YA0A 3I7QA 2FZNA 2J8FA 3AJXA 1OG0A 4E2BA 3O05A 3F4NA 3JS3A 1ML1A 4WSJA 4PMOA 4I9TA 2NQHA 1UKOA 1ZB5A 1X6NA 1AW5A 4LNCA 2R1PA 1Q6QA 3L2LA 3UR2A 3OG3A 1QATA 3CUXA 2YCLA 3W1NA 4XWUA 4UFMA 4DJFC 3W81A 3UWEA 5FSEC 1BD0A 3I6TA 4L9XA 4W85A 1CXIA 2JKPA 2Y70A 1DTUA 2XVLA 4G56A 4Z2LA 1NAL1 3NDOA 4UTUA 4L7ZA 4G7EA 1S2AA 3L2IA 2CHOA 3N11A 1O5RA 3VDAA 4CQCA 4KBXA 3OYZA 4IGSA 3VCNA 5ECUA 1KGUA 2OOGA 1XIJA 3VPLA 3WK1A 2HXUA 4C65A 3LU2A 4WF7A 2OKTA 3BUVA 2IW0A 5CBJA 2OGJA 1NQ6A 2OZ8A 4JHOA 4HMDA 1OCJA 3VGDA 3U7VA 1F6YA 1JI2A 2E8YA 1M01A 3JR2A 1I2QA 4PSRA 4OFCA 3UP8A 4HN8A 4LSBA 1CZ1A 4HNNA 4PMZA 3AU6A 3W7QA 2BGQA 4N9CA 1OX5A 4AB4A 1H1ZA 1F7BA 4JNZA 1H50A 3KUMA 4BR1A 4OOZA 2NVCA 2OX4A 1BYCA 3DI1A 5A5WA 3T8LA 3HQPA 4M8UA 3ANUA 4BJHA 4F66A 1R38A 3M4HA 2DIEA 4MSSA 4AAJA 5D04C 3VD3A 2YCIX 3BLOA 3QQ1A 1V4YA 3EX6A 4Q4MA 4JL2A 4IIBA 3VKDA 4RW3A 3L23A 1YPIA 4MADA 3GVVA 3BE7A 2P8BA 2NSXA 1UBPC 1QRQA 1RJRA 4PN2A 5IM51 3VKKA 4LUTA 1Z8AA 1A53A 1F5ZA 1MNSA 4US6A 2OPJA 2D23A 3FYYA 4ORMA 1VF8A 3TCEA 5HR7A 2E4TA 3CHCA 3TN3A 1NOFA 4YMZA 3K13A 3TSMA 1JNEA 4BFAA 1ONEA 1TJPA 5DT7A 4Z1CA 1GUVA 2X41A 2NQZA 3KL5A 2ZUWA 2CLHA 1ZL1A 3VMPA 5CZKA 5I07A 3HQ1A 4HA4A 3BTNA 3T2OA 4CD8A 5SWUA 1O1ZA 1VEOA 2VNCA 2DT3A 3WDJA 1UWQA 3ARQA 1KXHA 4H7ZA 2YGYA 3RLHA 3R5EA 3OBKA 1C7TA 3HIJA 4GX8A 4P5UA 1DP0A 3TC6A 4MFEA 1JZ7A 4U3CA 1QI3A 1PZ0A 2ZZ3A 3Q2DA 1GZ1A 2C14A 3PWIA 1JGMA 2OOFA 4CEUC 4R9XA 1X6UA 3DOPA 3P2VA 1XBZA 1FDZA 1Q5MA 4UOZA 4DO4A 4LWWA 3W26A 3T7VA 5LIWX 2XZ7A 2VP8A 3TW7A 3BV4A 4H01A 4MNKA 4C90A 4U5IA 4RZBA 3W83A 1DWHM 2DZPA 1EIXA 5CZ0A 6REQA 3IRSA 1FUYA 3GS6A 5FESA 1R9ZA 4O10A 4IX2A 3WELA 3V35A 4GPNA 1UCWA 5I3DA 1JQVA 1W0MA 1GGOA 3NFUA 4Q8TA 5CAKA 4DZAA 4JYFA 1XBYA 1EF2A 1M65A 2Y0FA 2HCVA 2BVTA 1CIUA 2DH2A 3II1A 4QG8A 1FWHC 4CN1A 4DWDA 3SCNA 3PZIA 1P6CA 4K68A 1UA3A 2HBVA 4J3UA 4IFKB 1S2TA 3TIMA 3KX6A 2HDJA 1RH9A 4HMCA 3JVAA 4E4FA 2PDQA 2PDMA 1HZYA 4Z2KA 3TKFA 3RYSA 1GEHA 3N73A 2VTFA 1CLXA 1N2VA 3WDHA 1B4KA 4I9JA 4YTUA 1KV8A 3OGSA 3AMGA 3W1UA 4GQRA 3C2VA 1PWMA 3FOKA 4F2UA 4UMBA 3QSTA 2GSEA 3DYPA 1BWLA 1ONWA 5ENLA 1TTIA 3UY8A 2EPNA 1F74A 2POTA 4CU8A 4ZXOA 3NGJA 4CCZA 4QAWA 3HPSA 3VIKA 3PAOA 3PJTA 4TIMA 1JCJA 1LTDA 4NJKA 2VD9A 3MUY1 3ZVHA 2JIEA 1TUFA 2WJEA 1VYRA 1FBAA 1VR6A 4JFTA 3U2EA 1Q3NA 1KA9F 1NP0A 2OELA 3VOGA 5FAJA 4U3AA 1JCTA 1TMHA 3SGZA 3HURA 3CAWA 4GE8A 1VFTA 3NQ7A 1S2CA 4TXEA 4C6LA 1TTQA 3WUEA 3AALA 3FXYA 4M7TA 5HWJA 2ZRZA 2RJGA 3CMFA 3SIMA 1YX1A 5FEZA 3QZ6A 4LVGA 4S23A 4EPBC 4O18A 1V5XA 3HV9A 5LHEA 1ONXA 3LZ5A 1X6LA 4H9YA 4PZVA 1E71M 4FP1A 1RZMA 4E6MA 3W88A 2RJHA 3BAJA 4PMXA 3AHXA 2OVLA 1DHKA 5C70A 4ATWA 3BW4A 4AIEA 2G97A 1EWEA 3DBNA 1ADOA 1GYMA 2VO5A 4AZ5A 5C0QA 1X1OA 4MZ8A 3CV6A 1E9YB 2WO5A 2V5BA 3VNMA 5ABEA 2ZC8A 1KCKA 5PTDA 3QF0A 4V15A 1RR2A 4C6NA 3TROA 3WMCA 2OLSA 2XWDA 4CQDA 4US5A 4LUTB 1S3TC 4AWEA 5CEWA 5C54A 1SR9A 2NV2A 4ZO6A 3HA1A 4O53A 4WK9A 5HQEA 1TWZA 4XD5A 3ZR6A 4ZQCA 3FK4A 3P67A 3FJ4A 4I7UA 2DZAA 3LCGA 3WX7A 2DH3A 3B40A 3FYOA 1QI0A 1ZHAA 3KS5A 2G3MA 2QIWA 1A5UA 3N3TA 2PWGA 3MB9A 1VJIA 5CJNA 5DMNA 2HPMA 4HGXA 3EAUA 4NKCA 2Q6ZA 2BSLA 2XN2A 2GVJA 3R58A 4M3PA 4P8WA 1UR4A 3W7DA 4Y7EA 3QR0A 4R88A 2VKZG 2CPUA 4NI8A 2BV9A 4XAZA 1EDQA 4X2PA 1NP2A 3EDKA 3MW7A 3W7JA 1H60A 5BROA 3JZEA 4PRTA 4JFSA 5HNUA 1XGDA 1Z44A 3VX0A 4PTNA 1ZJBA 2QNEA 3H2MA 4Y6GA 4QFUA 2VZUA 2ZRUA 3GUGA 3GDRA 2JF7A 4DJED 1EYWA 4WUIA 1EX5A 2GJNA 5G5IA 3QZEA 1XKJA 3LY0A 4GFIA 1OFEA 3W23A 1GVQA 4Q8OA 3MKVA 3STFA 3TE9A 5F7UA 4W8BA 1OINA 3HM7A 3EWXA 4NXKA 2GUYA 3GW3A 2I5QA 3R1ZA 2VX7A 3ERPA 4JIPA 3LTYA 1TJ1A 4DUWA 3F4CA 3WYZA 1T41A 4HPNA 2ZUSA 2GWGA 4UTFA 3FAWA 5TAOA 1O94A 2I5GA 1UIOA 5CSUA 1LQ0A 4J27A 1XLGA 3EXSA 1NWUA 2GQAA 4RKAA 5HINA 2EGZA 5A2CA 1CENA 5LKYA 1A3WA 3OPSA 2Y89A 2VC5A 3EZ4A 1QAPA 1GVEA 4K1WA 4ZQOA 5EMLA 1CXEA 1W2PA 4DHGA 1KQZA 4FNQA 1QVBA 1WCGA 4PULA 1HTIA 2A2IA 4AC7C 2WPGA 2IPGA 3XISA 1WE5A 5BOEA 4A8RA 3L4ZA 2PTZA 4O15A 3NTYA 1NFBA 4HOZA 3E02A 4M6VA 4CD4A 3AJ7A 2QYGA 4ERAA 1UROA 4ZE5A 4JTCA 1KTCA 4IOTA 3QYQA 3S3GA 4M51A 1VFFA 1I1WA 1YTEA 5BW6A 4Q8MA 3AMDA 1AZ1A 3N4AA 4LNYA 3ZR5A 5E0FA 4R3UA 3MI2A 1E6RA 2HVNA 5D03A 1TV5A 1FWIC 1MUCA 4A2SA 1R0MA 2E5CA 4LS2A 3UXDA 2RHGA 3N15A 4YYFA 1UOKA 2EPHA 4QTGA 2GSHA 4FR6A 4M29A 3U4FA 4ZE4A 3ZT5A 1H0GA 1TV8A 2ZA1A 3T40A 2C18A 4HHMA 4ECLA 1C8VA 1S46A 3FXGA 4KWUA 5D9OA 1OSEA 4TMCA 1IXQA 1QI4A 4XB3A 3L0KA 3VXGA 5IHSA 5C9ZA 3ABSA 4HU4A 8XIAA 1SZNA 4LUSB 3SJNA 1LT7A 1VZWA 3PJXA 4LCSA 3VUPA 1PDZA 3CPGA 1UR9A 3BXWA 3GK0A 2VFHA 1QK2A 1IT8A 5C7VA 2E3ZA 4GH3A 3F5KA 3VNDA 3QQ0A 2X2GA 2PDHA 3REQA 3MANA 3L12A 1B9ZA 5HQLA 2YYTA 2QPUA 2TRSA 5REQA 2V81A 2X8RA 1PKNA 1RJQA 2PRHA 1S2VA 1J2BA 2BMBA 3CK5A 4N02A 3BAYA 4IGNA 3ZS4A 1IZKA 2OGYA 1TWWA 4JY8A 1GORA 3LDVA 3BSMA 1V3KA 1KXQA 1EQCA 3W37A 4CD6A 2I7GA 2BGSA 3TYAA 1VRXA 4POCA 4H9MA 5K2ZA 1KFEA 3SW6A 1E70M 5D8ZA 3KVLA 4IMAA 2NZLA 2PDIA 4OKDA 5C2CA 5K9DA 3CIVA 4LUIA 3M0YA 5CJMA 3C4UA 4S2CA 5LIUX 2HE8A 1NDZA 4B3ZA 2V82A 3SFKA 7CGTA 1XGEA 1YTKA 2J6XA 3WLOA 1TRIA 3TLLA 2JGQA 3BOXA 1Q6EA 5I7GA 3N19B 4MMWA 1SO5A 3MO7A 1ITCA 1XYAA 4EAYA 1VBHA 3EB4A 4V28A 1GJUA 1IGSA 4YLWA 2I9EA 1M7JA 4PODA 4PRRA 4I5RA 3GYEA 1W5NA 4BWLC 5EMYA 2GGJA 2J9XA 1MEHA 2PWEA 4XZLX 4JTLA 4GLEA 1LLWA 3BLIA 2BZNA 4H6EA 1MDLA 2EG8A 3IIZA 4MWAB 3QHNA 1ZQ5A 3L4VA 1DIDA 3CB8A 3U4AA 3CM4A 3QW4B 1LBFA 1TCDA 1Y8BA 1H4PA 3ZT7A 2ISVA 5FACA 3SY5A 3IAQA 4Q8WA 5FF4A 1W37A 1K3UA 4JQ2A 3S6TA 1OZMA 3HPAA 3H4XA 4GJIA 5AYYA 2E5DA 2WSYA 4Q4QA 3WJYA 2B0MA 3DG6A 3P80A 1JNDA 1HQTA 4PTXA 3W7PA 1R7OA 4XBKA 3QTGA 1I6NA 1ZCCA 4H6KA 4Y9PA 1FH8A 2P0IA 1V0NA 3CV2A 3WEMA 4GRSA 1JL8A 4JX4A 3HJEA 4HK5A 3M44A 1GVYA 2INEA 4MB1A 5DO8A 5IBXA 3UZWA 1QNRA 3LX9A 2YZ5A 1R87A 1JDEA 1ZAJA 4KPLA 1UMYA 4P61A 3TJIA 2YXOA 3GNNA 1JFXA 4LW7A 3UGRA 3CWNA 1US0A 4HSHA 3CQKA 5LA2A 4M7SA 4YIWA 1E9ZB 1KFBA 5J5DA 3WFZA 2ZTJA 3WUBA 2C71A 1R8LA 3GX9A 1E6ZA 4UB9A 2QUUA 2XSAA 2PDNA 1Q7ZA 3L5LA 3GC2A 3HG3A 3RIKA 2H9AA 5C55A 1V79A 4K8GA 5HJYA 1YW1A 3C2YA 4NXSA 1EUNA 4AZCB 3NPUA 2OT0A 2Z7GA 5CPOA 5D30A 3ID7A 4FLQA 3PZTA 3W84A 4JIQA 4L4MA 5HNNA 4X60A 2X1UA 4C6IA 3BJFA 3GVRA 4F8XA 2HZGA 4EP8C 4CNPA 2SFPA 1ICSA 3CV1A 2J7EA 3BG9A 3ANYA 3VILA 4PB3A 4N6FA 5C2XA 4IQJA 1XSKA 5BXTA 3GNRA 1HUVA 1TMQA 4GK8A 1GG1A 4DELA 3TSDA 3N17A 3N2CA 2RUSA 3R0UA 2GUUA 4OUEA 3WKZA 4LF1A 3E3HA 5DX7A 2WVVB 2ZE3A 4P8VA 1MMFA 3HFYA 3TX9A 5JQ9A 3H7UA 3WK0A 2CZDA 3A4XA 2E9MA 3R79A 1I2PA 1TVPA 4H3DA 3S2NA 3W6MA 3KWSA 1G7VA 5CBBA 1I0BA 1VPXA 4B5XA 2E7FA 1E6XM 2CZFA 3HB9A 4DB7A 2DT2A 3EKZA 1F8MA 1W1PA 4N6EA 4JIIX 1ESWA 1D8CA 4XKMA 3M0JA 4JTTA 3GH7A 4H2CA 1CDGA 4MVAA 1LRQA 3LS9A 2WZEA 1DBTA 1HP5A 4DPQA 2PODA 1AD1A 2VQUA 3GSMA 2C91A 2NX3A 1KLZA 1OFPA 4WDWA 2Z00A 2ZZ6A 3WNOA 5AHLA 3IRDA 2CLMA 3UY7A 5C5YA 3ARZA 2Q01A 3OZOA 4YTTA 4BZYA 2XH4A 1Z89A 2X1RA 2BVWA 1QK0A 5BZAA 2XJ7A 2V5CA 3NQMA 3G3MA 1W56A 3QOKA 1PTAA 5DRIA 2YDQA 5FCZA 3UXAA 3C8NA 1NM9A 3NDZA 4E2VA 2XH7A 1TWIA 3WLNA 3ANVA 3GTFA 1Q7MA 3GU9A 3GVQA 3KXQA 3E2QA 4HU8A 1XLMA 1KCXA 3GDBA 1HJSA 3V18A 3O2LA 3PHAA 2V3DA 2HK0A 3ALFA 3CTLA 1VKFA 3WLSA 3N9SA 1SUXA 4NAFA 2ZDSA 1TPFA 1R2SA 2VEFA 4Z08A 2PC4A 3FVDA 4M1BA 3CZLA 1G01A 4OBTA 2DPEA 2B7OA 2X7WA 1B90A 1NF7A 1FFQA 4KS0A 1OFOA 1QJWA 3NOEA 3NQEA 3MC5A 4V33A 3RLVA 1EX1A 3OA3A 3APYA 1OEPA 1V51A 4MKSA 1E6PA 1WP6A 4UMCA 3U6WA 4IP5A 4GX9A 3HJZA 4MHBA 4AHOA 4CNSA 1FDJA 2QJGA 4ROQA 4U5KA 3HGRA 1JAKA 2DJLA 1OCBA 5D2WA 3WQ8A 3BLLA 5D33A 3GAKA 3A13A 3WQVA 1NFGA 1ALDA 1KWKA 3C6CA 1F6PA 3WUGA 3PUGA 3DESA 1DOSA 3NURA 4H83A 4WY0B 3L21A 1T8XA 2C1IA 4LJ3A 4XZBA 4AF0A 5ABTA 1XYBA 3MMDA 1C90A 4M5PA 2VEIA 1CWYA 4JOMA 1UPMB 3TONA 4B90A 3IIVA 2B7NA 1HO1A 2YLAA 4M24A 1TWSA 1JD9A 2RFGA 2JK2A 1JCNA 2VZOA 2PDFA 3RM4A 3EX3A 4JQ4A 3GBEA 3QC0A 2QR6A 2GOKA 3TWBA 4F9DA 1GOQA 1UQYA 4DO7A 4WVXA 2PWDA 3R12A 1RBAA 4DUOA 3RO6A 2Q8ZA 3ITVA 2A0NA 3VNIA 3TTYA 1P0DA 3VD7A 2O9OA 4PCPA 3Q65A 2J79A 3AU2A 5FJTA 3T0AA 2WOQA 5G4EA 3ZR4A 1Z41A 3TYUA 4B4HA 1L6GA 3B3DA 2OEMA 2VFDA 1TPH1 4RZ5A 4O4WA 2ZA2A 4NZ4A 1RA0A 3GAYA 1E6NA 1CB7B 2DU2A 1UKTA 4OT7A 2QJNA 2FDMA 2H6RA 4A21A 3GIYA 4GQQA 3GU2A 4ZBCA 3ZLFA 1B3ZA 1NTHA 3W24A 3U2ZA 2G8ZA 2Z26A 2Y1HA 4INFA 2PA6A 2F84A 4GZIA 4FX6M 3VNJA 2ABBA 5I00A 2GGEA 3KBVA 3GFYA 3EDJA 2ZZ4A 3UT0A 1WBHA 3EOOA 1W2VA 2C19A 3GTIA 4NAEA 1LRTA 4GCXA 1KBLA 4IXXA 3A3HA 2Q71A 5A8GA 1FOBA 1Q6LA 3G22A 1FX6A 2EHHA 3I6EA 4ZB0A 1KFWA 4C6OA 5A6BA 1XD0A 1LRNA 1TJRA 3WH8A 4O19A 1SO3A 3GNXA 4TV5A 1G4SA 3SCVA 4QP0A 3V5OA 2W66A 1B30A 4H00A 4XZIA 3W27A 1JD7A 1XIMA 3ITOA 3LOTA 4DJEA 1HL2A 4WOQA 1XXXA 2G41A 1ZBCA 1RBOB 2VWTA 4XIAA 3DHUA 3UWUA 3RM9A 1QMLA 3PC0A 4UR8A 2R1KA 2PU0A 4KCUA 4B15A 3IVUA 1AQ0A 3UXIA 4PUKA 2VXNA 1Y5VA 5CAHA 2HS8A 2INZA 4GGBA 2PAJA 4WJ8A 3M9YA 1WKEA 4IG2B 3Q45A 4W8AA 3ARXA 1F3WA 1QOXA 2WBKA 2V9DA 2Z2UA 3KBSA 3LERA 3O6DA 4A4AA 2JKEA 3I7RA 1AW1A 2BOEX 4IH3A 1HP4A 1R47A 4DO6A 4IL2A 2YSWA 2P76A 2CZ5A 5BWFA 1XYFA 1W5QA 4HN4A 3MWAA 2EJAA 2D24A 1VD6A 1QW7A 1IZJA 2Z7KA 3WQWA 4E8GA 1E0UA 3SURA 1V02E 3E5PA 1BWKA 5ABFB 4EPEC 3LK6A 4IGMA 3I68A 3RJYA 3EOEA 1BG4A 3WQCA 4NJIA 1JDCA 1OK6A 1DHPA 5BXPA 3NQCA 5A8PA 1KM0A 3AZSA 3LI1A 4HNCA 5CGQA 4YL2A 2UV8G 3IV8A 4PMYA 4LUYA 4U33A 1RCOB 3LTPA 3RM8A 1BVWA 4XX6A 5DMMA 2F6UA 2V3FA 2C7FA 3LRMA 3V1HA 3CT7A 1W8SA 3W85A 1ZJIA 3UU0A 1W5OA 1JDFA 5G1YA 4MYAA 1B0IA 3DDMA 3NIYA 3MWCA 5E9XA 1SJBA 5AHFA 3M0XA 2BDQA 1R30A 4UIOA 1DKWA 2XIMA 4Z2IA 4IIHA 1I2OA 2J24A 3O7UA 4XBSA 1WOAA 1ZSXA 4AQLA 1AH4A 4GI8A 4RR4A 5L9FA 3CAVA 3IUIA 3LPPA 2JKAA 1TV3A 3KAOA 3U2CA 4J1OA 4QNWA 3R13A 2OZ3A 3MKKA 3RRAA 3VIHA 1N8IA 1UWRA 1SSGA 2AMGA 3TSBA 2GL5A 1VGAA 3UNDA 1IR1A 4LRSA 4IPIA 4PUJA 5AZ1A 3GTXA 3WH9A 2WM1A 4Z2HA 1XD1A 2GDVA 1TPDA 1AW2A 5B7YA 1TUXA 2H90A 3NYDA 4JZ5A 3WLKX 1EJUC 3RPMA 3OTRA 2P88A 2WC4A 1FKWA 3MA8A 3KBWA 2H9AB 1JPMA 1VFMA 1TTJA 4GJJA 4HSOA 1WXZA 3OIXA 3VKJA 1OFBA 3N9KA 1G4EA 3LCFA 1S1PA 4ATDA 4IFKA 1SJAA 2J27A 4ADSA 2WJDA 4JCMA 2PTWA 5A2BA 1BQGA 1XLLA 1RD5A 5AC4A 1J2WA 4NI3A 3SGGA 4PBEA 3T0DA 1EJXC 3SRKA 5M17A 4H9TA 1W1YA 3N6HA 2AOSA 3CUFA 5CC5A 1I4NA 1V02A 1QW8A 5CQ1A 4B3LA 2VCCA 3N2BA 1QBBA 4D1IA 2F38A 2QDDA 2WKLA 1UD6A 3W4RA 1IZCA 3LXBA 3RX2A 2BVYA 4GZ7A 1A5KC 1P0BA 1PUDA 2BX7A 4EPDC 1RHCA 1W5MA 4HYRA 1X1ZA 2VZSA 3IK2A 5CC6A 4N42A 4C5YA 2XIQA 1H7OA 3SIZA 1E4NA 1FWJC 3GC5A 2VOTA 3QH2A 1EO5A 4KIEA 3GB6A 3C61A 3M7SA 1XLAA 1A5NC 4DI8A 4LH8A 3KBJA 1PYFA 3E0LA 3QXBA 5LNSA 2EF9A 2D69A 3MI3A 3QGKC 4R9OA 2D2JA 3QEZA 3PVFA 1XUZA 1CX9A 1Z6KA 3MJMA 3SDOA 1OC7A 4J3SA 1XP3A 3RR4A 4V2XA 4FIRA 3DZ1A 4QDWA 5BNKA 1P43A 3UF9A 3QFEA 1K7XA 4XZWA 1BYAA 2PSNA 4PUWA 3WDIA 4NUWA 4XD4A 3KBMA 5CBIA 1ZBKA 1JYNA 4GY7A 3S46A 1UZ4A 4PTMA 2QF8A 2X05A 4GHRA 1SZFA 2B4GA 1EJWC 4GI4A 5G4WA 3KCOA 3SCPA 4PTWA 1NIUA 4WKFA 3V4BA 1VAHA 4UOQA 1GPFA 3ITYA 3W3OA 2EO7A 4DUVA 1K77A 4HCHA 4AZHA 1XLFA 7PTDA 3IJ6A 4JFVA 4AVOA 3GXPA 1GOWA 4AZBA 1YNPA 1BGGA 3DUGA 5HATA 1WOBA 3TCSA 2PWVA 4BQ3A 4HOXA 4JHZA 3Q37A 2G3IA 5CZSA 3V0UA 1MYRA 4IMGA 3QQWA 1US3A 1S38A 4F0KA 2GQ9A 1H7PA 4E0CA 2J74A 2PBGA 2V2DA 4X63A 2XH0A 3I10A 4LYKA 2HEJA 5A6KA 2HV5A 3AC0A 7REQA 1P0EA 3PZOA 4HOWA 4JYEA 2OR2A 2WANA 3W29A 5BMXA 2FHBA 3WF1A 1R86A 3UZYA 3VDGA 3WNKA 4PMVA 3PBUA 3H2OA 1LF1A 1OG6A 3AIQA 2R1NA 1QWGA 4ACZA 1JZ4A 3PJUA 2CCRA 1Q8JA 2PDYA 4N9DA 4ZFMA 4XAYA 3SI9A 3CUHA 3GYCA 3N2MA 1OCQA 3VVGA 4O17A 3GKFA 2R94A 3TR2A 3W86A 1SMDA 3NR0A 3DN5A 4PGLA 1VRDA 5A94A 3WMBA 1RAKA 4FX8A 2ZWYA 3SM0A 4W87A 1ISVA 3IJDA 4IISA 4PA8A 4IJBA 4RW5A 1V7AA 3MP3A 4JTKA 1ICQA 3NO1A 2GVLA 3C52A 2W79A 4FF7A 4MNJA 1O95A 3HFTA 1FHVA 1KGWA 4LVAA 1CECA 2YKKA 4AD4A 2WJFA 1TZ9A 3FA5A 3WFAA 3W28A 1Q63A 4GY0A 3UNTA 1VBRA 3WZ0E 3PNZA 2OKOA 1LJYA 2E0PA 3VDHA 5LIYX 3MV11 5JIPA 1LUCA 2CC0A 1CNVA 1ZJHA 4OHQA 4ZB5A 1KRCC 3WLTA 3PPHA 1N7KA 1RCQA 2XN1A 1ZALA 4HZMA 3G5EA 4AUBA 1BF6A 1E43A 4Q4KA 4QLKA 3SRHA 1REQA 2J13A 3CMJA 2CXEA 3FY1A 1XDJA 2OSYA 1E5JA 1JZ3A 1BSIA 3DC8A 5AB3A 4H19A 2JGYA 3VD9A 1W17A 3E6EA 2B7QA 2NQLA 4WXZA 2PRLA 2F6KA 3WQ4A 4HP5A 3URBA 4JHMA 4L9ZA 4IPNB 1ZNNA 2HISA 1BRLA 3V0SA 2VRQA 3WD4A 3ITXA 3NYZA 5E0KA 1M3UA 2GSJA 4GY1A 3UG8A 4H8UA 1HNYA 4ML9A 4D6EA 5C9RA 1XSIA 2J7DA 2VHLA 3MHFA 1JZ6A 1GPWA 2G4JA 1XLCA 1H51A 3MQTA 1N8FA 2GJXA 4IIFA 4OZOA 3OYXA 4J2MA 4O16A 3DBPA 3R89A 3KHJA 3QFWA 3U5UA 3NQ2A 1BF2A 1SZRA 3GZAA 4UTMA 1RALA 3ZO9A 4MF4A 2ISFA 1GZGA 1YKWA 4YHGA 4JN8A 2PDJA 3BLFA 4GZEA 2CKRA 4FO4A 4PSPA 1K9TA 3W7CA 1YXDA 4RDZA 2D0GA 1XIEA 4AIOA 4GUFA 2R8WA 3NPVA 4GXPA 2ATSA 1XIDA 1VEPA 4WGHA 1B3VA 2UY3A 2P3ZA 1AFSA 1W3IA 2FTPA 2EPMX 2PU1A 2ZZ1A 1NU5A 1QNQA 4JTIA 1LWJA 2QAPA 3G1DA 3UZ5A 3VUSA 3WENA 5LNUA 3D0CA 3RMJA 4AXKA 1AMKA 1XF0A 4DXKA 4E4PA 4MY8A 1K4HA 1AH3A 4JTQA 3RR1A 3BLEA 3AQUA 1R3RA 4UZUA 2NUWA 3SB0A 4P8UA 1AL7A 2R6OA 6TIMA 3FKKA 3CXOA 1Q6RA 1CI1A 1FWDC 2O9RA 2WPBA 3DHDA 3NL5A 3CLMA 2TSYA 2WYSA 4J3WA 5IXEA 4ZQPA 3L65A 4BQ2A 2Y7EA 4YHEA 1FCVA 1CXKA 4EIVA 3B06A 1XLJA 3L9CA 5F4SA 1VJZA 1G9HA 1DQXA 4LAZA 2WBGA 5F2IA 2DZXA 3WLMA 2YCEA 2AKZA 4IXHA 3L7RA 3O8AA 1PZ1A 3NVTA 3I4KA 5JVLA 2A3AA 3KE0A 2JFEX 3QJAA 1F3EA 2OU4A 4BS0A 1YXCA 2XUCA 4BCEA 2X40A 1TPEA 2VM8A 2PLCA 4GA8A 2I17A 1J5SA 3TK7A 4AD5A 2VGGA 1C8XA 2PE4A 1F6KA 3LXAA 4ES4A 1OT2A 3FIGA 3KRSA 3QOMA 5TIMA 5FJUA 1XWYA 5FKYA 1I2NA 3SN1A 1KV5A 1NDVA 1ZRQA 2ZUNA 1KD0A 4LB3A 1D3CA 1RVKA 3BAXA 5GVJA 3CL7A 4V1XA 4F4RA 4DY1A 4YCOA 4BI5A 2FH6A 4FLRA 4NG3A 4AD1A 3K4WA 3O6YX 4DZ5A 5AKQA 3BZJA 3WK3A 5ABFA 2WM0A 3MMWA 4J5NA 5HPOA 2P50A 3VIPA 2WMKA 3N3MA 2F2HA 4O13A 4ZSUA 1MQRA 4G6CA 5AOUA 1PB0A 4ICMA 3P0WA 5AYIA 1DXIA 1NF0A 3RG6A 2XFYA 3GW0A 5EMJA 5E70A 3LYEA 4IUOA 1XLDA 3TWAA 1BHGA 5I02A 1BRLB 3GIQA 3WF3A 3I4EA 1PIFA 2GLKA 4TR9A 3AS2A 1WXYA 2NT1A 3H22A 2OYLA 3VIFA 3DIPA 1TR1A 3TUUA 3UETA 3T05A 2DW7A 3QZAA 1IE7C 1VJSA 3AYSA 4PUNA 7ODCA 3K4AA 4CU7A 3MUZ1 3FV9A 2Z1WA 4UWMA 2PLKA 2ZIDA 1HKWA 3CZGA 5I09A 3OLEA 3QBUA 3VNYA 3S1WA 3LCWA 4R7JA 1J01A 2O55A 3ONBA 4JKLA 4A35A 1KCZA 1RPXA 4NNCA 1WDRA 3GG0A 4ZOAA 1IEVA 3IVSA 1BXCA 1UMLA 4AW7A 3FKRA 1OYCA 2VEMA 3PFMA 4NAEB 1E15A 2V2CA 2W9MA 3E74A 5E09A 2XVKA 3GG7A 2HPIA 4CLMA 4L64A 2RDUA 3THDA 5EB8A 3AXMA 3CHDA 1O6IA 3CO8A 2FVKA 1TZZA 2OWXA 4C7FA 4DNMA 1X39A 3G1VA 2H8XA 1XC4A 2WMFA 3IJ9A 4GKLA 1ZFJA 2BHUA 1BFNA 3FA4A 3UYCA 1PKLA 4AD3A 3HO8A 1EUAA 2GDQA 1M53A 3MYPA 1FHDA 2HS6A 5DXXA 5FJPA 3LHYA 5U7SA 4IIGA 5LHFA 4C1LA 1K6WA 3V36A 1I75A 3UW6A 1S5MA 2PWFA 3HF3A 3AIUA 5BMWA 3M0HA 1KBJA 3C5QA 3BAIA 3A6OA 2R91A 3GNPA 1CGYA 1TR9A 2GK1A 4B5UA 2GYIA 4W7UA 2JBMA 3W38A 2W92A 1VFOA 3DCPA 3MTWA 4JTEA 4AHPA 3XINA 1OCNA 4ADUA 1XW8A 1PCKA 4ZVJA 2BXVA 2V3GA 2CYGA 1JF6A 4P7OA 4A22A 4QDPA 1Q4NX 1YXYA 1VPYA 3WNLA 1V6TA 3USZA 4J40A 1E3ZA 4X0NA 4NJGA 2J9ZA 5G1MA 3T07A 1AK5A 1GW9A 3M0MA 4D8AA 3PPFA 3UJEA 3N2XA 1D7FA 3F1QA 3C2RA 1VCFA 3N04A 3HTWA 4LS1A 2C3ZA 3S5NA 2DSWA 3UG5A 2HE5A 1HF6A 1E73M 2WHMA 2OMAA 3CZ8A 6XIAA 2D1ZA 1QPNA 2V5JA 1W54A 4KCTA 3LCLA 4QXIA 3PPGA 4A3QA 3ORWA 3F4VA 1QOPA 4UFJA 1J9YA 1CXFA 1A3XA 4GACA 4LAMA 1XH1A 3E12A 1V3JA 2G0WA 1XLHA 5HBFA 4MDOA 2OXNA 1S3HA 5XIAA 1OZQA 1PX4A 2YA2A 3F2DA 5A6BD 2GUBA 3M6DA 4UNLA 3W1LA 3W25A 1M9HA 4ALDA 2J7HA 1OFDA 2WZTA 2NW0A 1LBLA 5JU6A 2QUTA 5HOSA 4GVIA 3BARA 3A5VA 4LBUA 3DFTA 2A7NA 1AODA 1F8IA 4RPPA 3FVMA 1WDWA 1SM9A 3PWGA 3M07A 2BY3A 5FIPA 4HQVA 4C60A 5AN7A 3VGGA 1ZP3A 3W7HA 1BXNA 3W76A 2ZXAA 2OQYA 1SMAA 4F2BA 3TQVA 3WH6A 3KVKA 1WZKA 2Z24A 3FYPA 2VRKA 2NWRA 1QI5A 1PX8A 1S5WA 3AXHA 1YRRA 1P6WA 3WQFA 2CBUA 3UWYA 3NPXA 1V3MA 4N7QA 1R46A 2BOFX 3H2AA 4C91A 5LZLA 3QW3A 2CZEA 4EE9A 5EKYA 1GVIA 2YYUA 3GTHA 3R8GA 4JTSA 1IHIA 3OB8A 2CLFA 4PL1A 5EBUA 2V8ZA 3HGOA 3TP4A 3W7LA 2HJPA 4LAKA 3POCA 2UBPC 3P0XA 3A24A 2VJXA 3I7SA 3MKCA 4UTKA 5I5RA 4I7VA 5LNRA 1RP9A 1K8XA 4IMEA 4XV0A 3H4GA 2CFFA 3HGSA 2V6AA 1R3QA 4A3YA 1XCXA 3ELFA 2A3CA 3APTA 1G4PA 4WY0F 2R82A 4JICA 2GGIA 3BGJA 4OIFA 2IKIA 4H41A 4DM1A 4WHBA 1GKPA 3EWCA 1WX0A 2QCGA 3M0KA 4HNTA 2J75A 4MNMA 3SCUA 3A23A 1W9DM 3QV9A 2YBTA 2QIIA 4I90A 3QY8A 3AOFA 3H26A 4FI4A 4QITA 3WK2A 4PMRA 2VFGA 2WHJA 4ZXLA 2YL8A 5D9PA 4HYWA 2OYKA 4N4PA 3EOUA 4DBUA 2QHAA 3WQDA 1PYMA 4KWWA 1G5AA 3STGA 1XRVA 1W1B1 1U5VA 1TWDA 3FGCB 3AS0A 4WJEA 2BY2A 1W3LA 4JKKA 1NDYA 1J12A 4BKNA 2AKMA 2ZA3A 1E9IA 2P8CA 1AMYA 3M0VA 3R4IA 4LX4A 4KWVA 1EGVA 2VDHA 1SJCA 3BURA 2FTWA 1V03A 2J88A 1DIEA 2YXGA 2A3BA 1ZLPA 5GJMA 3TTSA 3OOQA 3B0UX 2G3FA 1K7FA 1KKRA 1XISA 3CEPA 4LBRA 3RN6A 4GUJA 1AUSL 2HWGA 4HNOA 3TJ4A 1U5HA 1MW3A 4OGZA 3R94A 2BWGA 4I6VA 1IWBA 3JZUA 5A6MA 1QNOA 2PDUA 1SQ7A 4FPSA 1PZ2A 5FOOA 4PYSA 1XBVA 4P8XA 5FI8A 3NZRA 4A8IA 1B3WA 1Q6GA 5A95A 2PF8A 1MEIA 1L2UA 2L5HA 5AZ0A 3T44A 3WDPP 1HO4A 4XSMA 3SQLA 2TPSA 4RDWA 5B80A 2VR4A 3AIVA 3CV7A 4RZ6A 1J6PA 1VPQA 5EMUA 1GOOA 2FPYA 1EEPA 2Q3RA 3SN0A 2H3DA 3CYVA 2NVAA 4S3DA 4QEHA 3DAQA 1JVNA 2Y88A 3WLHA 5AVHA 4ZEPA 2O56A 5I3HA 2PFHA 1BPLB 4GYFA 2WWCA 3B0YA 3F7JA 3NPWA 5CGTA 2CETA 1QPOA 3HPFA 3QGAC 4P7NA 4DZIA 4D9PA 1S5VA 3EMCA 5M03A 1YYAA 5DMYA 3REQB 3EBVA 5KZ6A 1SW0A 3EX2A 1YNQA 4NL1A 4KEVA 4JX5A 4EPKA 1T99A 4I7WA 2FB3A 2F2KA 1EJVC 2XSBA 1XLEA 1E72M 4I9AA 5IFTA 3MS8A 5J8LA 4XAPA 4P2VA 1E40A 3OEXA 4G9PA 4YTRA 1TE6A 1P5BA 4HMNA 5KTLA 2X0YA 2YJQA 2REQB 3DFQA 3ZLGA 2OFJA 3SQSA 4QISA 4E3VA 1ZBVA 1GEQA 3DENA 2QDEA 1W1TA 3TTEA 5D8WA 3B03A 5CPSA 4MKVA 1XYLA 3O06A 4IZGA 2AL1A 4J3XA 5EMMA 5A6LA 2JIWA 4B5TA 1IWPA 4G5DA 1I60A 2R1MA 4RDVA 3A3WA 4GVHA 1QNSA 1ZS2A 1KFKA 2CEQA 1YDNA 2CBIA 1PHQA 1UR8A 5T8GA 1POKA 1E1EA 1FP9A 5LNWA 3BMWA 4YVXA 3GDLA 2TMDA 3KHDA 3P7YA 4PMJA 3ZM8A 1HX0A 2RGLA 3GO2A 3PUOA 2HK1A 2VURA 4NVTA 3HOJA 2ACUA 2YW3A 3WDQA 1MO0A 4CN4A 4Z2GA 2DIKA 1HKIA 3IV3A 3ITGA 3G3DA 4PC8A 9XIMA 1T5AA 4HA3A 2XM1A 4GYPC 5MF5A 2DFAA 1FHLA 4LOCA 3K46A 3WD0A 2YBVA 1EOKA 4N9EA 4Z17A 3CH9A 1VP5A 3M5YA 4PEKA 3EA1A 1BGAA 4O12A 3W87A 1E4MM 1W3HA 3LHTA 3CZEA 3OGRA 1XIHA 1V77A 2XZ9A 4JTDA 3OZMA 2QMKA 3GXIA 3T4WA 1XDLA 5M5DA 4WZHA 1XR2A 2WSPA 2VQTA 3WJWA 3ME3A 3VGHA 1V7YA 2X7VA 1E0XA 3UVIA 2PI6A 1DORA 1WA3A 3KLLA 4KW2A 8TIMA 5LNVA 1LM1A 4G1NA 3EOSA 5T9CE 3ARVA 1J93A 4BQ4A 3W2KA 4PFMA 1J0JA 4AG0A 1AJZA 2RAGA 2ZRXA 5C2GA 3NL6A 4CQAA 4O8RA 3LNMA 5E9AA 3WL1A 1MVYA 1OT1A 3N6JA 2A1YA 4UOJA 3W71A 1MDRA 1JFHA 4NNBA 5FL1A 4YS1A 2NXGA 3POHA 5HJLA 3INPA 2Y4SA 1KXVA 1W9UA 1U22A 1LG1A 1RVGA 1JPHA 2HRWA 3VKAA 4R33A 2XN0A 3QR3A 4HK7A 1DXFA 1UWSA 2Y8VA 4X22A 2W62A 2PDCA 3E1F1 3UPBA 2CKSA 4JTRA 4UFIA 4FOUA 4LV9A 1IXNA 1FFRA 1H2JA 4BWLA 3EOLA 1IV8A 1BG9A 2PDPA 3LHUA 3N9RA 1OYAA 3R7MA 1D3HA 2DVTA 1OY0A 2VI0A 3B8DA 3ITCA 3WQEA 2BVDA 3AHZA 4GUGA 2ZKMX 1GWJA 1WAUA 1Y65A 2CNCA 3DX5A 2PB1A 3L5AA 3LLDA 5MKGA 4O57A 4IMFA 5MKGB 4ICCX 3TJXA 1UD2A 1GW1A 3EA2A 1Z42A 3E2RA 6PTDA 4WXYA 4XIMA 3G8EA 3RCYA 4YWSA 4GUHA 1ECQA 3HBLA 3RITA 4C1KA 4V27A 1FWRA 2CBVA 4MZYA 2P53A 2OO6A 4N4QA 1UWUA 2CHRA 2IXVA 3AMKA 1KM3A 4JKMA 2ZADA 1AG1O 4V1YA 3M1ZA 2XGIA 2HBXA 2ZWZA 3AUJA 4MG4A 1HW6A 2PWUA 2DEPA 2ZCGA 3CYJA 3C0JA 1R3WA 4ZCWA 2DZVA 5LSMA 3H23A 1W3KA 4QM1A 4WR3A 4HHLA 4FLOA 2DVUA 3A22A 4OQVA 2ZBTA 3CIXA 3T2QA 4IHCA 1IGWA 3CL6A 1RY8A 4IF2A 1HXJA 1ZUAX 4KFPA 3UCQA 4XSLA 3SUWA 1V0MA 2PDLA 3UXLA 4D6JA 1VENA 5HXMA 3KFTA 2E1WA 3PTKA 1F4HA 3DI0A 3QLDA 3G18A 3U3HA 4PCFA 4D6CA 4PUMA 3WQGA 1UOZA 1LLOA 1UYQA 4XZMX 4Q33A 1QPKA 1SGJA 3PSVA 2E28A 3T55A 3P60A 3DFOA 1W1ZA 4IPLA 3ABZA 1DL3A 4LVBA 3UZJA 3LENA 1CGWA 1DWGM 1FXPA 3E0VA 1EEXA 4BI6A 3PFRA 4JTJA 3BMXA 2VX4A 1LT8A 1ISXA 2VZTA 2P1FA 4IFOA 3G0XA 3LV6A 5GJPA 1DIKA 4HPGA 4MYXA 5TF0A 2XPKA 1M03A 4GUIA 4DWSD 3LTSA 1DJGA 2KX9A 5D2YA 2DZUA 2W91A 3A21A 1FTXA 3I65A 2ZX5A 5GPRA 4XZHA 4H6QA 3RK8A 2X0HA 2AGTA 3TQKA 2EBNA 9RUBA 4DZHA 4MM1A 2C79A 3CZKA 3OVGA 3H53A 3PY2A 2QT3A 4C6DA 1CGVA 3VZZA 1LDCA 4DWSB 5JBDA 1K8YA 2E40A 3IWPA 3IIOA 4WGXA 3BSHA 3SZ8A 2Y63A 5IRPA 4KGJA 4U4MA 4UCFA 4OOUA 3NEVA 2FJKA 3CHEA 1GK8A 3WNMA 4GVGA 4NP7A 4AZGA 1DJHA 1ECEA 2ESCA 3HZ3A 4DJDD 1OIMA 2Y24A 3U0HA 3ITTA 1VBJA 3R6IA 3EWYA 1JUEA 3G8RA 1M1BA 3ZVIA 2EPOA 4ZQMA 3SRFA 1MEWA 4PFHA 2DUAA 1JZ5A 4O1AA 2Y85A 2E6AA 5KEZA 1GYLA 3GLCA 2PRMA 4DM2A 1ZGDA 3LG3A 1LCOA 1CBGA 3THQA 1C93A 2FVMA 5HUPA 3V1PA 3VMOA 4PBGA 1GTEA 2XINA 3H54A 1O12A 4XVEA 3BQ6A 2FFIA 4C6JA 3C2OA 1TSIA 3M5ZA 1MSSA 1YBQB 3MSRA 2FQIA 2DW6A 1EA0A 3LLFA 4NNAA 4QEEA 2PF0A 3WQ5A 1L8PA 5H8UA 1BQCA 3LMYA 5T91A 2WMHA 2WMGA 3HG5A 1JDDA 2J9YA 5I06A 3SADA 3DEQA 3SCRA 4A05A 5K4XA 1PXGA 3OBEA 1QPRA 1X7FA 3GQYA 4NZJA 4W4QA 1Y7VA 3F2CA 4ZENA 2NXIA 2RKXA 4UR9A 3CMGA 3GKAA 4UFHA 4L1XA 4FHAA 1T40A 3STPA 4K39A 2B31A 5C9XA 2OYMA 3Q94A 4WIWA 3NNTA 4RLIA 1W3JA 2NLYA 4EVZA 1QXLA 3D6NA 1PWLA 1B57A 2PDKA 1XX1A 3T09A 3DFPA 4JNYA 1PHWA 4C5ZA 2DP3A 2PBOA 2ISWA 2Z4GA 1FWAC 2WC3A 1OBAA 3VU2A 3P82A 1UA7A 5LGXA 1H1YA 1JAEA 3U5YA 3I3EA 4MB3A 4G7EB 3S1UA 2BP1A 3WLJA 2DJXA 3GDTA 3PZVA 5F1VA 4QHRA 5G2WA 2FDSA 3C0SA 1YEYA 3O16A 3B0XA 4GD0A 4QE4A 3EDFA 4QQ3A 4DBSA 4L56A 1S5NA 4ZOEA 3BLDA 2FVLA 2F7FA 1WZAA 1HJQA 3UR8A 3WDRA 2XVGA 2D0FA 3SN4A 2Z27A 3CQIA 4YU1A 1Y5WA 2ZX7A 3L68A 4CNUA 4I5UA 4ASTA 3I3BA 5GQBA 1JRBA 4K6AA 1XV8A 2WMIB 3LSCA 3N14A 2EG7A 2WSKA 2KZHA 4R85A 4UTWA 4OVXA 2XH2A 2RGMA 3NEHA 1BLIA 4IPJA 5FAGA 4HVXA 4P7LA 5D02A 4GISA 3WEZA 4AWTA 3STEA 2ODOA 4QX4A 3V3WA 3SFWA 1DJZA 1HIZA 4XQ6A 1W8GA 2EXOA 5HWNA 1QUMA 1J10A 4MJ2A 4HHHA 3BOFA 1WPCA 5E6YA 1E6QM 2R14A 1HJWA 4P7RA 3GY1A 1O68A 3B0VC 2PDGA 2OG9A 1KBKA 5H8MA 3B0PA 4B5VA 2OQLA 2CLPA 3AMLA 3N4EA 2FZ8A 1V6VA 3G0UA 1V6XA 4UCGA 4C1NA 1MQPA 2PP1A 1TG7A 1O4UA 1JCMP 4DQWA 1M5WA 1Z9AA 3T42A 3UD6A 2P5NA 1I2RA 4F0SA 2DSUA 4QE5A 1B4EA 4QNEA 3R8HA 4AEEA 1R7AA 3E0IA 3NQDA 3GR4A 3RU8X 3MUIA 8CGTA 4AY7A 1KWGA 4GBUA 2OODA 3VGEA 1TPUA 3WD2A 1NARA 3UVAA 1GVSA 1UH2A 3S1VA 1E6SM 3H2NA 3LBCA 2I1OA 4K2SA 5IFPA 2D3NA 3NAVA 1WKDA 1XICA 4DJDC 3PF3A 3AWOA 4AISA 4KGLA 1K7EA 1JXKA 5T9BG 3TU9A 5DCEA 2A6LA 1VHNA 4ML4A 1EGZA 5CSSA 2DY3A 4UQDA 2DZSA 3TNOA 1BKHA 2CBJA 1QT1A 1QO5A 3SAZA 3VIGA 1H7RA 1J5TA 1EO7A 3R0DA