3R4DA

Crystal structure of mouse coronavirus receptor-binding domain complexed with its murine receptor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
199
structure length
199
Chain Sequence
EVTIEAVPPQVAEDNNVLLLVHNLPLALGAFAWYKGNTTAIDKEIARFVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMKDMGVYTLDMTDENYRRTQATVRFHVHQPVTQPFLQVTNTTVKELDSVTLTCLSNDIGANIQWLFNSQSLQLTERMTLSQNNSILRIDPIKREDAGEYQCEISNPVSVRRSNSIKLDII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CEA-related cell adhesion molecule 1, isoform 1/2S
publication title Crystal structure of mouse coronavirus receptor-binding domain complexed with its murine receptor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion/viral protein
total genus 36
structure length 199
sequence length 199
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3r4dA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3r4dA02
4QRSB 1AGCB 3QPQD 5KVDL 2HJKA 4RWYL 3D2UD 1DFBH 1JMXA 3B5GA 1F02I 3D0VA 3QG6A 2NTSP 3NCJH 1RJLA 2P5WD 4D8PA 4GQPH 5I16A 5EUOA 3NIDF 2Q87A 5ANME 4N0CD 4XMPH 1IVLA 4LPXA 5D1XC 1M7DA 3FB7B 4WWKB 1F90L 2GT9A 2FEEL 3J7HA 1E4KA 2XQBH 3GDBA 1S78C 3VXSD 3VJ6B 4WI4A 4CVZA 4NCC2 5C09D 1HYRC 5FYKH 1J1OH 1YJDC 1I1AD 4PRAB 3U36A 2DKMA 2X89D 1E27B 2B7DT 4LSUL 1KIPB 4B41A 1BZQK 2GTZA 1RZ7H 3H9SD 3RGHA 1YECH 1WC7B 1JWMA 2BSTB 1FGVH 2DF3A 1CTNA 3V6FA 3IDJA 5GRUH 4K3HA 3R06B 1I8KB 3GUTA 3HC4H 1DQLL 1MREH 3WNKA 1PZUB 3RPIA 1G7JB 1T2QL 5EWIH 4K7PX 4QRRA 4PG9A 3H7LA 1MY5A 2D0HA 2XTJC 3PDGA 5HHQA 4I0PA 4JQVA 3GRWH 3WKMH 2K9UA 4QHNB 3WIHL 3T04D 1CXIA 1NGPL 4JVUA 3QWQB 5EOQH 3MRMB 4QXGH 5KS9E 1X6LA 5IKCB 1E6JL 2NXYC 2PXYB 1D6VH 1LDPH 5H37H 4R2GB 2E7BA 5E2UL 3C2AH 3D69A 2FR4A 5JLZA 3VGGA 4EI6B 2I25N 3TCXA 3X3FH 2EIEA 1SYVA 3C6LA 4QHUA 4KZDH 2MJWA 2ZJSH 4LNRB 4OT1H 5DEFB 2MPAL 4GKNA 3L9RA 3CSBA 4WO4D 1CCZA 2YA1A 2DQUH 4LSPL 2ZG1A 2FRGP 2Y07L 3GMPB 1RJZA 3LHPL 4OFYA 4ZQKA 3IXTB 4PJIE 1R5WA 1CIDA 3MLSL 1F8TL 1SEQH 3SOBL 2QBWA 4PLJC 4G5ZH 4GSDL 3QCVH 3D39A 3VGAC 4APQA 5DMIH 3BOVA 1LMKA 2P45B 3X14A 2QHRL 1P69B 1RPQA 1YNLL 5FFLA 3U6RB 2R23B 2GHWB 4KHXL 4LCWE 4AEEA 1S9VA 1DLFH 2VKWA 3JTTB 4KUCF 4G6AC 5J1AB 1EERB 2HAZA 3NA9L 1FG2B 3V9FA 5E6ID 5GSRB 1BPVA 2FH8A 3FQRA 3H9YA 2C4FT 3E6FA 4P5KB 3CIQA 5FXCH 3SCMB 5AWNH 4JFEB 1DDHB 4M93C 2JELH 3TJEH 3ZZ1A 1WAAE 4DAGL 3OG6B 4R97B 1SJHB 1N7MH 2JLLA 4Y4KB 3HMWL 3DO7B 3K8KA 3PDOA 4NDMB 5DZOA 4JFYA 1AO7A 3LS4H 1RIVL 5IFAH 3IAQA 3VWKA 2VXUL 1QZ1A 2JJWA 3SDXF 3QIUD 3MRRA 4YHZL 5C0BD 1U36A 1X4ZA 3I6KA 5T5NF 1EVTC 3H42L 4OF0A 3K7UA 2DBJA 1F3JA 3HPLB 5JHDB 2XFXA 1RIUL 4G7YL 1ULVA 4LHUD 2NX5B 3P9MA 3PGDA 2R0ZL 3QO1B 3DRTA 4NKDB 3FB6B 4IOIA 4EN3A 1UJ3A 4FFWD 2P24B 1J1PL 5E2JA 2YPLD 4LRIC 4BFIA 4PP1C 3UCRA 5I6XB 1N2RB 1ND0B 3ARGA 5BVPL 4LLYB 2FHBA 3PP3H 2VDNL 3GJEB 5FYLD 2RBLA 4HUWA 1KEML 3BHBB 4HFWA 4PYGA 1RUQH 5DHYB 1QRND 2HRPH 1LE5A 1FSKC 5TH2A 4WFEE 1EHLH 2DQCH 4NQXA 4Z76A 2YD3A 1T20A 4NO3A 1LK2B 1G7IB 2VZUA 4JY5H 4XP9L 3SQBA 4PJGB 1QOKA 1FFQA 2WLYA 3QWRD 1S3KH 4RMSA 1JF1A 4Z7VE 5IVXB 2NY0C 5C0CE 3VWJB 1YDPA 3C08H 3H7BA 4F8QA 1TVBA 4FXKB 1MJ8H 1QLRA 4X6EB 5CEZE 3PWJB 1IGJA 4O51B 1H15A 5K9JL 3HB3D 2ZUVA 2B1AL 2BK8A 3MRLB 4ZXBB 1SMAA 4X99A 4BSWA 3BH8B 2VLJA 3VGBA 1OSPH 3RKDD 5C7XL 3MCKB 4MNHA 4Z7QE 1YMMB 4ZSOB 1EZVX 4QWWC 1IARB 4H20L 5D5MB 3RVVC 3OBAA 4F7PA 1EFQA 3KLAB 2BNQE 1UCTA 3SDDB 4W68A 1XF5B 2GTWB 5SWSE 3VD3A 1RJYA 3K8MA 4YDVB 3C8KB 2BRRL 3NCFB 4MNQB 1FO0A 3DOSA 1HWHB 5JPNB 3TV3L 4KQ4L 3SDAB 1QNZH 5F6IC 1Y6KR 3RHWK 4XP6H 5ALBH 2IQAB 4GKSA 3SBWA 3VXUA 4I4WA 4U1SA 1DVFD 3OKKB 4TNWK 1PSKH 1EO7A 3O0RH 1I7RB 1UWXK 4KK6C 2BJMH 1MCPL 4Z77B 2BSED 4EDWH 3AU1A 3U1SH 1U8IA 2J4WH 2H6PA 4KKAC 1MRDH 2QSQA 3G6JA 1QR4A 1EDQA 3GBNH 1OSZA 3QH3A 2W0KA 3AM8A 2NW3A 5L6YH 1KSRA 3KPQA 2GJZA 1FNEA 3X11A 4I2XE 3SDYL 1UVQA 1CD1A 3KNBA 1U8NB 1IGMH 3GSUA 1KTLA 3ARBA 2VH5L 4N1HB 4IBLT 5GGSA 2W38A 1TCRB 5EZOL 3RIFF 2XN9E 2W0FB 5EBLB 1DCLA 2VAJA 4ZUTB 2J88L 1YNTA 4HJJH 2CIIB 1QSZA 3BP7A 3BD5A 1EEYA 3JSSA 2BNRA 3UC0L 1BAFL 4V2BA 3HE7D 3QCTL 1FL6B 5DRWB 1WZMA 2IPTH 5CJQL 4YR6A 3QDGB 3BDBA 1KEGL 2ZPKH 2ERJC 2NR6D 1PDKA 1XGPA 3WXVH 1ZTXH 2FJGB 1T4KB 2FZ3A 3QZWA 2D7MA 3WFBL 5MENA 5ICYA 4JGMA 2AJVH 4ZUWB 3L3IB 4O4YL 4Q6YA 1EFXB 1RK0A 3S88L 4HUUB 3C6SB 3PXHA 4N0YH 2B4CH 3ALPA 1AGBB 4GRWB 2QQNL 1XGUB 4OV5B 3TZVA 3P73A 3CAFA 2V5SA 3JBG7 3O4OC 4XCEB 4UTAL 3LQMA 1OP5H 1ZLUH 3TCLA 4PFEA 3GIZL 3SJVB 4P57B 4H88H 2I24N 4OF3A 2X4PB 4PJBA 4UV7L 2W0LA 2E7LC 2BC4A 2LU7A 3PHQA 4N90E 2FJFA 1S7QA 3STZB 2Y7QB 2F15A 4YDJB 1AGEB 3L3KB 5I18L 4GFTB 1YN7B 4Y4KD 1OAKL 4FS0A 5C0DA 3ROOB 2VZSA 4PB9L 4RAVA 2OR9L 7FABL 1GC1L 1KXTB 3VG0H 2RIKA 4MNGA 3KYAA 2NY4B 2JF1A 2CDGA 3CDGB 1S7WA 2BY3A 4FQJL 3GSNL 1Z9MA 3LEXA 4G8GD 4L8SA 4QRPE 4RIRB 4XP4L 3ZHDA 1TETH 4K7PH 1GHFL 3O8XD 2DQGH 1GIGL 3CCHB 4FQ2H 4UT7L 3PWVA 5CJOL 3D3VA 1DN0B 3MV8B 4TOYH 4UI2A 5JXAL 1NGQL 4K3DL 4PJEF 1HI6B 1C5DA 2E7HA 1LO5B 3SDXB 3MNVB 4H8WC 1FYTB 1NLBH 4LGPB 4JLRA 4KFZC 2V2TB 1QFHA 2F9BT 2YN5A 4XNMA 3QQ3B 3CH1A 1VFBA 3DSFH 2EEDA 1LO4H 2BZDA 3CC5A 5I1KH 2D03H 4N9GB 3MO1B 5T5FL 2DM7A 3ULSB 4NWTL 3IDXL 4X4YA 5EC1A 3I6LD 3ZDZE 3Q48A 2W07A 4OI7A 2X42A 1GGYA 2GJ6A 4WFHD 1JL8A 2FL5B 4ZFZA 3W0WB 2EDQA 1Q8MA 3NACH 1U0QA 1SY6H 1TQBC 1A1MA 2P5EB 2ICWI 3FO2A 4BZYA 3HCVB 5SX5K 4XB8A 3QIWB 1BQSA 5HD8C 4NWUH 4XBEL 2NY7L 1CLOH 1N8ZB 3C9NA 2HG5A 3ESUF 5F8RC 4FMKA 1D7FA 2EYRA 1UZ8B 5B22A 3RAJL 4R96A 1KJ2A 3OL2A 3QIBB 2XOTA 4OJFH 3EZ8A 1KC5H 1SMOA 1A6UL 3VFTA 1OM3L 5F9AC 2FO4A 3UMTA 1S8DB 1JP5A 1PJ9A 4X98B 3QBTB 1OP9A 5GZNC 2YK1L 1Q72H 4LASL 2YUVA 4S1DC 3QPXH 3MRPA 4QRRE 3P9LB 2Y36L 2GAZB 3NGBC 2LFGA 5IW1B 4NRYA 4FHBD 2HA1A 3UTTA 4ELMB 1YEIL 1DBJL 4L8DA 5FYJD 1AD9A 1Q9LB 3SDCA 1URLA 2AABH 4FTVD 4NO2B 3FQWA 1J86A 5I17B 3FQNB 3K3QA 2XA8L 2ZCKH 4G43A 3TO2B 4JFXA 1JTOA 2H32A 4OZFG 3RWCB 5AZ2L 4HWEH 4M43L 1BBJB 1HN1A 1VFAA 3VI4E 3LQAC 4AZ8A 4X5XA 2VABA 3RY4A 1DSFH 3IXAB 4ISVB 4LSSL 3UBXI 4KU1A 5D6DC 2PTVA 5A16B 4I1NB 4V2CB 4P9HH 5DK0A 2F74A 4PJ8A 3RWIA 4GRLB 5CMAA 3UBXG 4ONFL 1VADA 3PGCB 3O6ML 4UIMA 2ESVD 3AREA 5CP7B 4AH2A 4ONHA 4L9LC 5L88L 4UZGA 4MJ5A 5DD6A 4DUWA 3T8XB 2DICA 4XC1L 5DLML 3O6FD 5F9WB 3V4VH 3OB8A 4JPVH 1JYXA 3IDMA 3QDHA 5C0EB 2ARJQ 3GHEL 3ZYOA 2AGJH 4HC1L 1BREA 3MLYH 3MJ9H 4KV5E 1JHLL 3LCYA 5DRZB 5BXFB 1IAKA 1UA6L 4XMKL 3D39E 5HVGB 2BNUB 3D87B 1IFHL 4D3CL 1WQVT 1NC2B 1KGCD 5EZJB 3CFDB 5E1AA 4AK1A 5CLWA 2NMSA 5I1EL 1UB6A 4C83B 1S9YA 5JTWA 4K2UL 1S7TB 3QDGD 3ROLB 4WDIB 2XNAB 3L3OB 5IK3A 3C2SA 4CU6A 5I74C 3S3JA 2VIRA 3H0TA 5DFVC 1RUMH 2HTLC 1ED3A 4I18C 5CIPA 4P23B 4LIQL 4NNYA 1JPTL 2PW1A 1AO7E 2QEJA 2WQRA 1RZJH 3PF2A 4PJCF 4G8FB 4ALAH 5C86A 1RVFL 1F6LL 2B39A 3B9KA 3MNWA 1I9EA 3QFDA 1ADQL 3MJ7A 2NQCA 4ZUUB 1JYNA 3BQUA 5FGCB 5IGXH 1C5CH 4DN4H 3SJVD 2XZAL 1QBBA 5FA4B 5IMMA 4M1CC 1ETZB 3VXRD 1FBIL 5HGGS 5GRJH 3K2UH 3CVHL 3WV0A 4QTIL 5DJDA 3FO1B 5HPMA 1MFCL 1OWRM 4LMQE 3HE6B 3V5HA 1UH3A 4YHNA 4HIEB 4LVOB 2FYYB 5IOPA 2EZ0C 3B4NA 1RHHB 5I1JH 2CK2A 3QEGH 4Y1AE 4JHWL 1EUTA 4OUOA 3TESA 4KUCD 2BP3A 3EYSH 4K8RH 1FGNL 4JM2C 1S9WB 1F3DJ 3T0DA 1KCSL 3LDBC 5T33H 3U48A 2E3VA 3QXUA 2H8PB 4EI5D 1Y18A 4HBCH 3D2UA 2YMXL 3QUYB 4NBXB 3LV3A 1EGJA 3RWDB 5KANI 2O61A 5GISH 3P77A 2P5WA 3OTTA 3ZE2F 3CK0H 1YEJL 4P2OD 4QRQB 4XVSL 2OL3B 1J05A 4N5EC 1ACYL 2HWZH 2Y5TB 3QI9C 4HGMA 2LQRA 5KANG 3BZFB 5E8OA 5I8EA 5KSAC 4NN5B 1U91B 2BCKA 1FYTD 5JA8B 2EC8A 1AQKH 4WEBL 5SV3A 5EU3B 4FQQA 5KVEH 5IHZA 4U3HA 2APXA 3VXSA 4KI5C 5C09A 5DDHA 3MUGB 3L3GB 1I1AA 2YD1A 3QRFM 4MMXC 3MJ6A 2J8UE 2X89A 2A6JB 1Z9OA 3IJHA 4KXZH 2CKNA 1VACA 3QJHA 1IC5L 1QVOA 4C59B 2JB5L 1RAMA 1S7VB 3H9SA 1JBJA 3W0WD 2CIKA 3N1FC 5JIPA 4NNXA 2VERN 4JVWA 2WBJD 2WIMA 5D7SL 3UPRB 1DANT 3BP4B 5GS3A 1NUGA 1P53A 1KACB 2JJTA 5EIQA 4LCIH 4MAYD 3TIEA 1YYLH 2R1WA 2WIIA 1ZA3B 5DHVB 2EIZB 4NIKB 3ECBA 3QNZA 5I66A 4ZOAA 4PRDB 1AQDA 1HINH 3OHXB 1UEYA 2IF7A 4KDTC 5IFHL 1CL7H 3D18B 1ACZA 4P2RE 3QEQD 4KI5E 3VXUE 2Z91A 1WT5A 2AERT 2VDLL 4ODBD 5JUEH 3TH2T 1FZOA 1YQ2A 4G6FB 5KSUB 4E5XB 2AK1L 2XY2A 4KTDL 1TTFA 3M17B 1U3HB 3QEHA 3WNOA 3G6JE 5IQ7L 1FAIH 2P1YA 1BJMA 1UXWB 2AVGA 2VRAA 5DR5L 4JRYD 4DOHB 2Q8BH 4RBPK 4QXUL 3RWEA 1W2KT 2XKNA 5I76A 1MI5D 4M62H 4WO4A 2JE8A 4N8VG 1VB9A 4KMQA 1MRCH 1BX2B 4Y4HC 3MXWH 1PAMA 2J8HA 5ITFA 1TPXB 1A0QH 1ZGLB 5JIHA 5EDXA 1KIQB 4PGZA 4NPYB 4DK3A 1AR1C 3QJFB 4XNZB 1BFSA 3MV7B 2HFEA 4MXVF 5CBEB 2VLRA 3UZVB 1XGTA 2C1PB 4HS3A 1QBML 1JMZA 5D7JB 5A2LH 3RTQC 2BNRE 4LEXL 3VXMB 4ENEC 1PGRB 2VUYA 5DYOB 1CIUA 2BRQA 3RY5A 4PRHD 4MA3B 4YC2B 4I8DA 1OHQA 1PKQB 1T1ZA 4HF5H 5EOTA 2J6EH 3TBVA 3RVUC 3O2VL 2VMFA 5E6IA 2X6MA 4JVPA 4WFFE 5L8LB 2VSDA 3ARFC 1XZ0A 3SKJL 5MENE 5GGVH 1B0WA 1DBBL 2OI9B 2CDEB 2XWTB 3DV6A 3QULB 1QLEL 5KVDH 2Z92B 2EKSA 1VFUA 3R1GH 4ZO6A 3MJGX 1PFCA 4L8SC 2PYFA 3ILPB 1FL5B 1M05B 2FX7H 3WXWL 4QO1A 1YMHA 1J88A 3E1F1 4WGWB 3QIUA 4KJQC 1TJGL 3WO4C 5C0BA 1F90H 4L4VE 3TWCH 3VFGL 3HS0A 4PJBE 4C57C 1JPGB 2Z0BA 1LEKA 1MAJA 3MODL 2LAAA 3WL9A 3CFEB 2EO9A 2GUOA 4I3RL 5FA3A 1X6NA 4ERSH 3KWWA 4LHUA 8FABA 3ME0A 2Q86B 5F89B 1BBDH 2ICEA 2IPUG 4NRZB 5JOFB 4JR9L 2B8OT 3CZFA 4LF3A 1ODAA 1QR1A 5KJRH 4PGEB 2YPLA 5GGUA 4MNGE 5TF0A 1CGSH 2E6JA 1H5BB 2QQKL 4U1JA 4LLWA 1NANH 1REIA 4QYOA 4P99A 3GMMA 1CDIA 2F54E 4E42A 3Q0HA 5FDWA 2OK0L 1QRNA 2KZ1B 4AENA 5F7UA 3HE6D 1IM9B 3BMWA 4KVCL 5F6HJ 4X4XB 3CFKB 5CZXD 2HTKD 4G3YL 4XI5D 3W5NA 2VC2L 5CUSH 3DTXB 3PWLA 4FP8L 4XPAL 5DD3L 4ZDHB 4JGJA 4XPHH 1M71A 4K71B 3HUJA 3QUMA 3C5SA 4HKZB 4M8VA 1R3KB 3DHMA 1R5IB 1AI1L 5T1KB 3QQ9C 1BQUA 3QHFL 1VCAA 3S7GA 4KRLB 4L3ED 4PGBB 4KTEH 2N56A 2R9HC 3WFHB 3PABB 3FOMB 3GSVB 5E2UH 3STBA 1TVHA 4M6NH 3LSOB 4RDQG 3RNQA 4ZUVB 4OGXH 3UYOD 1ZGLM 4RQQB 4FXLA 4AM0A 5A3ID 3SKNB 5EU5A 1Q38A 4I77L 4KKLD 3WNLA 3EO9L 2R1XB 3T0AA 2FD6H 4LMQI 3RDTC 2HKHH 1QG3A 2MPAH 1U8OB 3BN9C 4HULB 2IANE 2YA2A 1IEBB 4NFCA 3TA3C 2H41A 4LSPH 1WBXA 3L7FB 5IBLD 5C0NC 1T0MB 4MHHI 1D5XB 2BOBB 3RVXD 4ZTOL 1L7IL 4OZIA 1CGYA 1JRHH 2AJ3B 3CFIC 4MHHG 1F8TH 4I9WE 4U1KA 3SOBH 1FFOB 3GMNB 4MA1B 4Q7DA 1ZGLP 4MAUH 2EDEA 1X7QA 3D85B 3DRQB 4GSDH 4IDLA 3MLWL 4F7CB 1CFTB 3EDFA 1MHEB 2QHRH 1YNLH 4P5TD 3GSOB 4UQ2A 5GQBA 1ZHKA 1NJ9B 1NFIB 4IS6B 2WUCL 5MI0C 3K8LA 1DVFA 3S3SA 1G7MB 3O6KL 1UENA 3AREC 4PRPD 2Q7YA 3SE4C 1BQHG 4JANA 5J11B 2Z4QA 4QT5B 1H3TA 3VA6A 1CXKA 1NCBH 3BGFB 5HYEA 1LWRA 2C9AA 4JREC 1WBZB 2ATKB 4ONGL 3G04A 1ZVSB 1J0KA 1U58B 1MWAL 5C70A 4PB0L 2DDQL 2VXUH 5DQJA 2Q76B 3GBML 4Q9RL 1T7YA 3MRMA 4LLVB 5T3ZL 4YHZH 4KPHL 3MOQA 2C5DC 5L7XH 3UROR 12E8H 3H42H 3BZ4B 1MHCB 1NFDA 4HV8A 3U82B 4TQEL 2IMMA 3DPBA 1CDBA 1PYWB 4OCRL 1VPOH 3V5KA 3MGOA 4G7YH 4UT6L 3SO3C 4PJXF 3CFCH 1AY1H 1MCCA 4YLQT 2R0ZH 4RFNB 2R0LL 3ARXA 3ULUC 3BW9A 4DWHA 3RVWD 4Q2ZB 5CGTA 1J1PH 5I8OL 2LABA 3HE7A 4NUGL 3NIFF 4GW5A 4N0UB 4ZNCD 1XF2B 2R2EA 2VDNH 4OLXL 4RAUB 4M61B 3TJHD 2DAVA 5BJTB 1KEMH 4JGUA 5IEHA 4UOJA 1KB5A 1HSAB 4GBXB 4N1EA 3MV7D 1CGVA 1U92A 4LKCA 3F5WB 4TPRL 5LJYH 4D0DA 4MXWH 3KPMB 5D7JD 1FH5L 3U6RA 2JJSA 2FB4H 5TQ2L 5CJ5A 4XP9H 5KG9A 5DJCA 3WNNA 3MRKB 2W92A 1GCFA 5J1AA 4LSRL 5E99L 1S9XB 3KPPB 5JA9A 3TC9A 2VDPH 3MRJB 3DSNA 4OQTL 4P5KA 3MR9A 4NRXB 4RZCA 1ZHBA 3SCMA 1JF6A 3ULUE 1DDHA 1JNNH 4NC1C 1CLYL 4J1UB 5DWUL 2X1XR 1UH4A 4HUVB 1KELL 2L4OA 2DQHL 3OSKA 2YSSB 4Y4KA 4NBZB 1PY4A 1OGAB 1ORQB 2I9TB 1LO0L 4X6FA 2OJZL 3ARZA 5FO7A 5C08E 5BOZG 5CJXA 4NHUB 1M4KA 1L7TL 2DQIH 1KV3A 1ZMYA 5IR1A 1JYVA 5C7XH 1UM4L 4OD3L 1BOGB 4PBWD 3WFEL 4EQ2A 3GSQA 1VHPA 3DUUA 3G9AB 4HWBH 3N85H 4G8GA 5DMKB 5HYJD 5E6YA 4XXCA 3O8XA 2Z31C 3BD4A 2WNGA 3OJ2C 3QO1A 1JNHB 4H8WL 2FBJL 5EZLB 2X4OB 3KR3L 1D3CA 4NKDA 3U9UB 3I9GH 2P24A 4POZC 4O9HH 5C0FB 4YDIH 1A4JA 4O5LL 5DVNA 5B4MD 3ILQD 2E5EA 3HZVB 5F7WC 4KQ4H 3SKMB 1N2RA 3CMGA 2F5AH 4GXVL 4NC1E 4OF6A 4KAQL 2X4SB 4LLYA 2IAMD 4XWOD 5ESQB 1KPVA 3GJEA 1P5UA 3I2CH 5D1ZD 2F19L 3K4DA 1BIIA 4JFFD 3HG1E 5T1LB 3BHBA 2HRLA 1CZ8L 2HH0L 5I0DA 2PTUA 3EFFB 4HX1B 5GHWH 4IDJL 2P5WE 3PQYD 1FG9C 2AJUH 5C2BH 2W65B 4YK4C 3NBNA 2DYPD 4KK8D 5DMGC 2HFFB 4CGTA 4G6KH 2X9XA 5L2KE 1KIRB 2WBKA 1BVZA 1ZHNA 3KXFB 5DRXA 2X4QB 2MCPL 1VEMA 4X6DF 1KTDB 3LD8B 5D7IF 3DUSA 4MQXC 3X17A 3W82A 2DQJL 1FRGH 1TZGL 4C4KO 3KG5A 1FZMB 3S6CA 5JW3L 3JUZA 2AK4B 1R6VA 4U3CA 5C09E 2I60L 3DXAB 4ZOCA 1KNOB 3DROA 2RFXB 1IKFL 1BHGA 1LDSA 5LWYH 3WUWG 5DEZA 4UBDC 1FC1A 1G6RB 4NN7C 3DYPA 5K93A 3PWJA 1C08B 2J88H 1BWWA 4O51A 5ACMA 3BXNB 3MRLA 5FAAA 2FGWL 4I48B 1BAFH 5DJXA 3TBYB 3QCTH 4A6YL 1O7VA 1NBYA 3ZE0F 5FYKU 1U8KA 3PP4L 4DQOH 1OTSD 1UXSB 4NQDD 5B8CC 4HK0A 5EULV 5JXED 3V0WL 5MERB 1Z9SA 3BFOA 1ZLWK 3QQ4B 4O4YH 1IKNA 3C8KA 3VD4A 3GI8L 4JY4B 4NM4L 4PP2A 4LLUA 3MROA 4FTVA 3LQAL 4Z7NE 4N8PA 4KK9D 3HMXH 2I07A 2QQNH 3U83A 3O4LE 2DWEB 2HP4A 3UX9B 2PN5A 3F6IA 4OFPA 5HPOA 2ADJB 3GIZH 4OUUA 5IQ9B 4R3SA 3VG9B 1I7RA 4UV7H 3UTSB 4BZ2H 3QNXB 5E8EB 1A1OB 1MEXH 4M7JL 1F11A 1A6ZA 5M7QA 4GKOA 3IF1A 4Y2DD 2XWBB 3RA7L 2AP2A 1LP9E 5D72L 1P4BL 5GIRA 2AV7A 3KPOB 3NFSH 3DIFA 5DK2B 1OD9A 2Q8AL 5E08H 4XPBL 4PB9H 2ESVA 2OR9H 1ZSDB 1T3FB 3QDJE 4F7EA 2ATPB 1NAML 1SY6A 4MD5A 3CU7A 3O6FA 4MX7B 3KYNA 5FYKE 5SX4I 2DLGA 4Y16C 4FQJH 3ZKXB 2UZYB 3TNNB 3V7AE 4DZBB 3BGMA 5GS2H 2WM0A 3ARUA 3TVMB 1HE7A 3NTCL 1VGKB 1GIGH 1CVRA 4KJYB 2MSPA 3T0EB 2J5LC 2ZCHL 1A2YA 1NGQH 2BVTA 1CU4H 1K4CA 1FL6A 1T0PB 5DRWA 3MBED 1CT8B 2ZNWA 3QDGA 5F8QC 4C56B 4PREA 4FZ8L 2DLHA 2FJGA 2QQLH 4P3CL 1CXFA 3GKZA 3WN5C 4Q0XH 4X5WA 4ZUWA 1ZLSH 1WFTA 1ZWIA 2ZWLT 2EE3A 3BUTA 5T5FH 4YHPA 1IEHA 3C6SA 1X5YA 4DVBA 2BXYA 3EYQD 5ANMB 4WV1C 5C0BE 1XGUA 4X8JB 1DBKL 5GS1C 3SQOL 2O93L 4H1LG 4XCEA 4YWGL 2H45A 1MRFH 3SJVA 4P57A 1QYGH 3VXRA 4PJ9B 3GMQB 1WBYB 1HCVA 1I9IH 4XBEH 3FQXB 4YDJA 2NY7H 1NL0L 2DIAA 2W9DL 3A6CL 3VGFA 1OGAD 4YIQA 2LVEA 3RAJH 5ACZA 1HKLH 2C1OB 5IB4A 2EXWC 5CGYD 2AEQL 4ZS6D 4XT1C 3SGJA 2VKXA 4GG8A 4F15B 1G7LA 4O58H 2YK1H 3OMZA 3DVIA 4MCZA 1KN4L 1E4XI 3NPZB 3RKDC 4EI5A 5TE6L 3MA7A 5IM7B 3MJ9A 5E9DB 1QSVA 1F5WA 3OR7A 2XKUA 5CWSB 1YEIH 2ARWA 1DBJH 2C3VA 2DJUA 1DN0A 3RVTD 3VRIB 4KROB 4P2OA 3IFOB 3HUJE 4P4KD 4Z7WE 4QHKI 5D1QB 3TN0C 3TPKA 3BX7C 2A1WL 3MQIA 3SDXA 3TO4C 1T66D 3FO0L 2DQEL 1FYTA 3DX7A 4XRCB 1R3LB 5KS9B 5GJSL 1YPZF 2X1WL 4LGSB 2O5XL 3RJDA 5HI4D 4YAQB 3P4OB 3LRSA 1I8LC 2BDNL 1CFNA 3RIFK 3ULSA 2CR3A 3D25A 1S7UA 3O9WD 2P48B 4CJ1A 3BEWA 4Y5VA 3W0WA 5FO9A 1HHHB 2WMPA 4OZIE 2Z9TA 3WJLA 2WBJA 3NH7L 4RA3A 4KZEL 2BVEA 3HRZB 4P49A 3HCVA 4MAYA 3TIDA 3L7EB 3PWUB 3HA0A 2XPGB 1KCLA 3GHEH 3EKCA 4PJIB 1AE6L 4KGLA 1E4WH 5FM5M 1B88A 1GGCH 1JHLH 4MB4A 1UA6H 2NZIA 2VXTL 3MC0A 5I30L 1UZ8A 1F97A 1N5AA 2WAHA 3N06B 3U7WL 3QEQA 3HNSH 2J3SA 1KXVC 3N1GC 2IBZX 5LGKA 4LCWB 3IGAA 1RUKL 3TBWA 1S9KC 4EVNA 3O11B 3OKMA 4Y8DC 4NQVB 4X4ME 5ITBL 4UV4L 3P9LA 3C09C 3MRHB 1CFQB 4NNPH 1WWBX 3PL6D 1OT1A 2DJ4A 4LIQH 4LLAA 3QDMD 4AEIH 4JRYA 1Q9LA 1CDHA 4RMQA 3N1MC 3FZUC 4KJWD 1MI5A 1MCFA 4NO2A 1MH5A 2DBLH 5JO5B 3GNML 5I17A 5D6CB 3FAWA 4E41D 2CRYA 2PCPB 3IS1X 1D5IH 2CJUH 4BJLA 3U2SB 1NFDE 1BBJA 5DRNA 3NPSC 2A73B 1R5VA 5CSZB 4L4TD 3C60D 1WCQA 1IQWL 3AS2A 3IXAA 3CVHH 5DJAB 1EXUB 1NKRA 4W6XB 1KLUA 2Q6WA 4PJ7B 4YBLC 1W72B 1BECA 1NGWA 4JZOA 3WD5L 2AEIT 4OTXL 4OLUH 4CMMB 4WJ5B 4RGND 4S1RL 4K7FA 1FORL 5ICZA 1OLLA 5JHLL 2DQTL 4PRHA 1JVKA 3HKFA 2I9LB 1QLFB 3D9AH 4EZMA 2C4FU 1ZT7B 3FJTA 3T8XA 1WIOA 2ICWB 1FGNH 4M93B 1TENA 3ELAT 4H25B 3UJJH 3VFMA 4IEFB 4LU5L 4JO3L 4XHJD 5ADPH 3KYMB 3C8DA 3RNKB 3TVMD 5IVZB 2YMXH 4K3EH 3FT2A 2QADD 3MGTA 4GAFB 1YEGL 1MJ7L 3T0ED 3CFDA 4RRPA 3S96B 2NW2A 4JFHD 3QCUH 2WP3T 4LPUA 1ACYH 3IJYB 2CO7B 3PXJA 4C83A 4R4ND 1L9NA 3U4EA 1WUNT 3BDXA 4ZFGH 2KH2B 5EN2A 5AEAA 5I9QB 4WEBH 5HJ3A 3OWEA 3IYLW 4Z7VB 4XC3H 5C0CB 4JRXD 3OZ9L 2VDRH 3QUZD 4YHKL 4BZ1L 3PV6B 4NT6A 1FIEA 5CZVL 4HCRH 4MVBD 2D7TL 4L1DA 4G8FA 4L3CA 4G6JH 4YFEA 3T1WA 2AS5M 4UNUA 5F96H 1U8LA 5FUZL 2VXSH 4DGIL 1EPFA 1RIHL 3DX9A 5BV7L 2JB5H 3V7AG 3S37L 1TZHB 1KBGH 4OV6F 4FNLH 2B4CC 4WI3A 2DQFA 5D7SH 4LSVL 1FSKB 4G8GE 4NQED 3VI4F 2OSLB 4PJ9D 5FHAL 1IGTB 3UBXB 3GM0A 1J5OL 5IBTL 3HE6A 2CLZB 2BNQB 5JR1L 2OMNA 2FYYA 1XIWB 1P6AB 1O0VA 2AXFA 1RHHA 4ODHL 4ELKA 3BYYA 1P9MA 4BH7B 1JYWA 5IFHH 1MF2L 2R1YA 2MHAB 1VFMA 2NY0B 1MCOL 1Q1JL 1LO3H 1Q94B 4L3EA 5H2BA 2XACC 4GRWH 5MHSE 5ACLA 3GB7A 2QR0B 4DGVL 1BVKA 2JJUA 3JVGC 5D1XD 5H37G 4U1MB 4JZJA 3ZDXE 1IGIH 3I6LE 1OOAA 4TNVF 4M4RA 2OL3A 4QXUH 3LIZH 3U7YH 3RX5A 2BOCA 3MRBA 3PNWB 4PR5B 1S78D 2D4DA 2J7LA 1IKNC 4Y5XC 3KDMA 1EJOL 5KZCB 4NZTL 4I2XB 5E2TL 2XXCB 3PG2A 1UKQA 2IBBA 1SVZA 3O3BA 3WLBA 3HC3L 4S0SD 4LQ1A 1FZJA 3W9DB 4QRTB 2XZZA 1D6EB 5F6IB 3O2DL 2XN9B 1V7MH 1EUUA 4LCCC 4LEXH 4PJEA 1AXIB 3TT3L 4GT7A 1QA9B 4P5TA 1G7QB 2M1KA 3KPSB 4RCAA 4YDLC 4DVRL 3T3PF 1X5AA 4XGZB 5B38B 4LHQB 2P8PB 5F70A 2YHGA 4XBGB 3GMOB 2XTJD 3UPRA 1CG9B 1DLHB 2N7BA 4PRPA 2OTPA 1U93A 3B5TA 1ZA3A 2YEZA 5C71A 6FABL 1DBBH 4PRID 5DHVA 4D9LL 3HLAA 2OP4L 1UKSA 5FYJE 2N4IA 3NIDE 5KVGL 4JDZB 5I1LA 5E4EC 1CGXA 4Q74A 4FTVE 3LMJL 1FJ1B 1CE1H 3WIHA 2NXYD 3T77B 3VGHA 4WU5B 4YHYB 4U1NA 5I8KL 2H9GA 1DBML 1EH9A 1BFOA 4N9OB 5E8PB 4JRWA 4X0KA 4HZLB 3VFGH 1E4XL 3O45B 2IEPA 1G7PB 5EO9B 3MODH 3VFWB 1X5JA 1VDGA 4HLZH 3LQZA 5IJVB 4EXKA 3OAYK 3BKYL 3G5YA 5C2UB 1C12B 5E56A 1JGLL 3IETB 5FEBA 4ONOA 4G42B 1QQDA 3M45A 4JO2H 4R9HA 2ESVE 3B2UC 1CQKA 4CN6A 4JCLA 1J87A 1EK3A 4M7ZC 4PRBB 1OD7A 1YN6A 3BPCA 2Y23A 1OY3B 1NCAL 4PLJD 3MUY1 3MACH 2FDBP 25C8L 3OKEB 3QUXC 4NPYA 1FPTL 4LDEB 4NQUA 5J8OA 3BE1L 3QJFA 4U49A 4QRPB 3LKOA 4PS4H 4MQ7B 3BMVA 3MV7A 1F6AB 5CBEA 4HIXL 4LVNC 2C1PA 1T1WB 2J8UF 4G6AD 5D7JA 4G3YH 4JM2F 1CXLA 2VC2H 4JN2A 4XPAH 5DYOA 4BQ8A 5DD3H 1KPUB 4P9HC 4MA3A 2GSIA 3DV4A 2CKBL 5HVHB 3LN5B 2DLIA 3EYOB 5DEGB 3KPRD 2GSGB 1T83C 5B21A 3ARDC 1JUFB 2O5ZL 4D9RD 4X83A 3ES6B 5IBUG 3V7MA 2XWTA 4QHLB 5GGTL 3WLWC 5CD5C 5F3HA 2Z92A 5CD3A 4EOWL 3THMH 4U7SA 4I77H 1RJLB 4WEUD 1FL5A 5I16B 4IJ3C 4XP5L 4UINH 1M7DB 4AEHL 1DUZA 2A6IA 2M26A 4KI5F 5TE4H 2GT9B 3QT2A 2EDTA 3U30C 4R8WH 2ADIB 4KRPC 2B5IB 1CICC 1ZHLA 1ZANL 3CFEA 5SWZD 4JZNB 3HAEA 4CVZB 5HYJA 3E2HC 3ZYIA 4N8VB 3C5ZC 4UQ3A 1WVZA 2NY3B 4R0LC 1P7KA 3MPCA 4PP1D 5JOFA 2GTZB 1NCDL 2FJHA 3RPKA 5CEZD 3MLWH 5IHLB 2JIXD 4PGEA 2APFA 1RZJC 1JWMB 2IAMA 4JPIB 4OZ4A 3GK8H 5D1ZA 1JZ3A 5FM4A 3A67H 2J1KA 4Y5YA 3IDJB 4YXKL 4JFFA 4Q9QH 3O6KH 5KSVA 4OCWL 3GUTB 1INEL 3EOAB 1WITA 1Z3GL 5LXGH 4QRRB 5I73C 2BNQD 4QTHB 5HHQB 5T3XL 4I0PB 3BSZL 3PQYA 3U4BL 5ID1A 1OP3K 4RMVA 5IMKA 5SWSD 2RCSL 4ONGH 2DYPA 4PJCA 5LGHL 5EFIA 4ZDHA 4ZOEA 2E7CA 5ILTH 2I5YL 2DDQH 3D6GA 4LP4A 4R7DA 1R5IA 3B83A 3CVIH 4PGBA 3WFHA 3N9GH 4GAGH 2X09A 3MSPA 1J11A 4HK3J 1DQJB 3D69B 3LSOA 5EBGA 4K8RC 1MLCB 5IWLA 4RQQA 4Y0GA 2R4RH 3SKNA 5I19H 4IOFC 3NCJL 1SYVB 3C6LB 2FCBA 2Z8WC 4UT6H 3VMPA 3L9RB 4B53A 3UTOA 1IEBA 1Q9KB 4QWWD 3U46A 3RVVD 5DO2C 1A9BB 5DJ6A 5I8OH 1RJZB 43CAA 1T0MA 4NUGH 2BOBA 5KZCD 3REWA 5A2FA 4ZQKB 4OLXH 1M7IB 3GJFK 1R5WB 4FFVC 4CMHB 4NQDA 2VOTA 5BRZD 4U1GC 2IFFH 4MJIE 3MUHL 3BGAA 4JFDD 5JXEA 3AMKA 4MXQD 3SE3C 4RX4D 3D85A 3D39B 1WIUA 4APQB 3QEQE 4M48H 1RZ7L 3X14B 3RUGF 2R4SH 1MNUL 3PV7A 1S9VB 5CLTA 1J12A 4YHOH 1NJ9A 5F7FA 4KK6D 1NFIA 5E99H 4ODTH 5GRUL 3SKUD 4KKAD 3TYGL 1MREL 4OQTH 3E6FB 5CKAA 5JDSA 4QT5A 5I0ZA 1F58H 3GRWL 1CLYH 1KUMA 2AKRB 3WKML 4JRYE 1KELH 4Y2DA 4HMCA 2ATKA 2DQHH 3PDOB 4L9LB 1XCQA 1ZVSA 3KHQA 1ROWA 5BS0E 1AO7B 1GRWA 3VWKB 5BOPA 1LO0H 1EIBA 5EUKA 2OJZH 4QXGL 3C87A 4R6UA 5T3ZD 3DNKA 1D6VL 3OJDA 2CR6A 3I6KB 1L9MA 4PD4J 4OD3H 1F3JB 2XFXB 4MB3A 3HN3A 5I1AA 2HT2D 4WI5A 3DGCR 3O3DA 4N90D 2DTMH 5IV2A 1EX0A 3P9MB 9CGTA 1OAYL 2AEPH 4G6MH 2BVQA 3DRTB 4IOIB 4PRHE 1UGNA 4PV9A 4EN3B 3ALWA 1UJ3B 2APTA 3JV4A 4BFIB 4O5LH 4Y1AB 2NY6C 4LLQA 2NY5H 2Y06L 4KAQH 3MBEA 3MFFA 3CXHJ 2CLRA 2ICWJ 5ESAA 4RAUA 1RY7B 4HUWB 2E27H 1SEQL 4HFWB 5BJTA 1C1EH 3BT2L 4S1SH 4WY7H 1CZ8H 4XVTH 3VRJA 2CK0L 4G5ZL 4ZTPH 3F5WA 1KCRH 4NQXB 1EEUA 2LV4A 2IG2H 5HYQA 1NFKA 3IDUA 2MKWA 4KKCD 1NCUA 4OCLC 4F9LC 1J0ZA 1MHPH 1JN6B 4CW1A 4MDIA 4IHOA 2HTKC 3MRKA 4CNIA 1S9XA 5F7DA 1XFPA 1PY9A 4D0CA 5HVWA 2FHFA 2DQJH 1TZGH 3PWPD 3VFVA 1W0VA 5JW3H 1JF1B 4TN9A 5AWNL 2I60H 3TJEL 2HT4C 3ET9F 3MCG1 4J1UA 1KFAL 3VFPA 2VDQH 5MEPA 1YDPB 3DMMC 3H7BB 1M6OA 1LILA 4W4OA 4OLZH 1HHJB 1OGAA 4X6CF 1QLRB 4GKZA 2J8UB 4POYA 1X4YA 1IGJB 4JM2B 1H15B 1C7TA 4MJ2A 4JFQA 4KKLC 3LDBB 1HHIB 2FGWH 4QKXB 4BSWB 1YEFH 3S37X 2DMBA 3QXTA 1BOGA 2C3XA 3GJFA 1MHHA 4J4PD 4F7PB 5DMKA 3GSNA 2CDFA 3PP4H 5C0JA 3IDGA 4XAWL 1JNLL 4NP4H 5KSBF 1WFNA 3QI9B 1RJYB 4O02H 2X4OA 1ZEAL 4P4KA 1NLDL 1FO0B 3FMGH 3QR2A 5C0FA 2X4TA 1TTGA 4P2RB 5KVFL 1A8JH 2V9TA 1KULA 2DWDA 4L3EE 5ESQA 1U6AH 4GKSB 2IWGA 3VXUB 4I4WB 4U1SB 4P5TC 4R90H 2QV2A 4NZUH 4PTUB 1RUQL 3F7VA 2HRPL 4OLWL 3AU1B 3V79C 4M7JH 1U8IB 3AUVA 1EHLL 2W65A 2DQCL 3G6JB 1QFPA 3P9WB 5F7NC 2YN3A 3MFGB 1BEYL 3RA7H 2ED9A 4JY5L 5D72H 1P4BH 2HFFA 5D2NC 3QH3B 3O9WA 1WISA 5GGRA 1H8SA 2X4QA 3KPQB 2GJZB 1FNEB 3V0AC 3X11B 5HD8D 2VJXA 1JHKH 1NAMH 1S3KL 1UVQB 1CD1B 5FGRA 1OTUC 2OJEA 4FZEH 3QFJE 1ZT1A 4QGYA 1KNOA 1QFOA 5EB9A 3RI5F 4HG4J 5GGSB 3ULUF 3C08L 1INDL 4JO4H 4EBQH 5JPMA 3NTCH 1MJ8L 4PJEE 1D5MA 3LKPB 5GZND 1YNTB 4WW2C 3BP7B 3SE8H 1VSCA 3KGRA 4BKLB 1EEYB 2BNRB 4S1DD 3TP4A 3G6DL 1INQA 2WWKO 4YR6B 3FN3A 3OKOA 4FZ8H 5ECJE 5D2NE 5LBSL 1UXSA 3UJIL 3QZWB 5MENB 3QXDA 3PL6A 4BK5A 5ETUA 3K0WA 1RK0B 4JY4A 4EQ3A 1XR8B 3LAFA 4LVHC 5IP4A 1QNZL 3TZVB 3P73B 1TJHH 1X5LA 5ALBL 1DBKH 4E41A 3SQOH 1JF5A 5DMJB 1KJMA 3I02A 1G1YA 1RZKC 4XCCH 2DL2A 3TCLB 2ADGA 1PSKL 1PX4A 2ED8A 4L4VB 2ADJA 4OZHE 1S7RB 4L4TA 3O0RL 4PJBB 1GGBL 2BJML 2BC4B 3LH2H 1LD9B 4EDWL 3PHQB 3QNXA 2FJFB 3RTQB 1S7QB 2C3WA 4IOSD 1MRDL 1NL0H 2XWBA 4K23H 5FV2A 1G0DA 3IU4L 3GBNL 2C3GA 3A6CH 5C0DB 3EYFB 2F5BH 2A6KA 5DK2A 5L6YL 4RAVB 1ZSDA 2AEQH 1HXMA 4MLSA 2VL4A 2Z35A 2EYTB 5E5MA 4MNGB 4MX7A 3U0WH 2CDGB 3VU2A 2VLKE 1IGML 5SWQA 3FCTB 1KN4H 5AZEL 1GXEA 4L8SB 2E8ZA 4HC1A 5L2JB 3MRFA 1TQCC 3TVMA 3PHSA 2HVJA 5F7HA 3QDAA 3PWVB 2IC2A 5E94A 5DJYA 4ORZC 4C4KT 4HJJL 1JE6A 1U8JA 5TQ0L 5JOEA 3T0EA 2A77L 2MQCA 1C5DB 1FV1A 5HI5D 5F88A 1KN2L 2DQEH 3VW3H 2IPTL 4JLRB 1CT8A 2HTLD 5B4MC 2DJSA 3WXVL 5GJSH 3D0LB 3CH1B 2O5XH 4WI7A 2AJVL 1Z0NA 1RD6A 4JFOB 4JRXA 5DXWA 3K4ZA 3CC5B 1FLRL 4PJXA 4U1LA 3QUZA 4ZFOL 1KLFA 4LBEA 4KXZI 4N0YL 2B4CL 1PEZA 5M94B 3VE0A 3OKYA 4M1CD 4RFOL 4ZFZB 1ADQA 2IH1A 5BVJB 1MCNA 5DD1L 3BO8A 1A1MB 4H88L 1DBAH 3FO2B 5HYJE 2EZ0D 4NQEA 4HD9A 4NQTA 4PJ9A 3GMQA 2DKUA 3MLUL 5CKGA 3WDHA 3UAJC 1MVUA 1E6OL 2HG5B 1RZ8A 3KHOA 5GRVL 4BH8A 2EYRB 5I30H 4R96B 1LE9A 1KJ2B 4JM2D 1LP9F 2C1OA 3U7WH 4PJ5D 1CL7I 1JZ8A 3VFTB 1FNSH 4U1HA 2FO4B 3VG0L 3LN4A 3V4UL 4JFFE 3CXHK 5C3TA 1RUKH 1KCKA 3TH4T 3MRPB 5KAQG 2CXGA 5C6WH 5IM7A 1TETL 2EO1A 3PQYE 2DQGL 5D1XA 1FE8L 4N5ED 3OXSA 1A7PL 1I3GH 3QI9D 3UTTB 4PJCE 4CU7A 4L8DB 1UWGL 3IDNA 3KJ4C 4QY8B 5KSAD 3TA3B 2JKXA 2YD4A 4TOYL 1GJIA 4XPTH 4J7RA 3EOBB 4P2RD 4XRCA 4KI5D 1R3LA 2H32B 3RWFA 2EDXA 1VFAB 4K94L 1T5XB 4X5XB 2VABB 3DSFL 3P40A 5ISZD 2A74A 1U9KA 5J12B 1IBGH 3P4OA 3E3QC 5I1KL 4FXGB 4H1LB 5IF0B 5DK0B 4PJ8B 3RWIB 3L95A 3WD5H 2LTQC 1VADB 2ZG3A 5MI0B 5GZOC 4S1RH 5JHLH 5CHNA 4UIMB 2DQTH 2R29H 3AREB 4ONHB 1HHHA 5IJKC 4IM8A 1QSED 2HLAA 1JTPA 3HRZA 4DTGL 3IDMB 4NQDE 3L7EA 2XPGA 1QSFE 4NWUL 1HEZB 1T04A 5J3HC 1CLOL 4PRIA 3DBXB 1YEHL 1L0XA 1IAKB 3BAEH 5LVEA 4FABL 3P0VL 3R8BB 1CBVH 3U79A 2DLFH 5E1AB 1ZV5A 1UB6B 4RAHA 4X6DA 5D7IA 3ZKND 1S9YB 3E3QE 5EC2B 2NY1C 1PBYA 3O11A 5H35A 5JNYA 4HW6A 3HI1A 3FT3A 4WFFD 2AJYH 1X44A 1V3JA 2VIRB 3H0TB 3AY4C 4JDTH 1ED3B 5CIPB 4NQCD 3OZ9H 4IRJC 2CD0A 4X7SH 5T1MB 4Y4HD 2AABL 1LK3L 4DGIH 5FUZH 1G6RH 3B9KB 1RIHH 4Z7WF 5BV7H 5B3JE 3MJ7B 2EDYA 3FQUA 3S37H 4JG0L 3BQUB 4HWEL 5C08B 1YNKH 4L4VD 3QA3A 1IZKA 2Y1VA 1NANI 2F8OA 3CDYA 5FHAH 1U8QA 4HG4K 5DJDB 5HPMB 2VL5A 3U0PA 4WWKC 3V5HB 4YHNB 1H0DA 5INDA 5IOPB 5JR1H 1KCVL 4UDUA 4JY6A 5LAXB 3LB6C 4CMMA 3WEXB 2E9JA 3ARFD 1MF2H 3L5XH 1QLFA 1RUAL 1ZT7A 3ZT6A 3KPRA 3Q5YA 4YPGA 4H25A 2F58L 2P47B 3SKOA 2BSSA 4D9QD 3HG1B 2BERA 2F54D 1Y18B 4DGVH 3D2UB 3LV3B 3OPZH 5ICXB 1TITA 3WE6B 2O61B 3DURA 2FX8H 2P5WB 4G8EA 4WTWA 2R2HA 1J05B 5IIEA 2VTFA 5E8OB 5I8EB 2BCKB 2YWYA 4X5LA 3OAUL 2EE6A 3AFLA 5AD0A 2M2DA 3EDKA 4NZTH 1A5FH 1H3VA 2Z31B 2Y72A 4FQQB 2W91A 5IHZB 5SWZA 3VXSB 5FECA 3UDWC 1JRHI 5C09B 1K85A 4BFGA 5DDHB 1RUML 4MXVE 3BKMH 2H2SD 1HNFA 4LRIA 4OZFA 3IJHB 4P48A 2PXYC 1VACB 4R2GC 1WZLA 1TNMA 2YRZA 3FHAA 4KI1A 1QVOB 3WCYA 3EJYC 2JIXA 4WVRA 4NO0D 3T0VA 4WW1A 3H9SB 2IAND 2CIKB 3MLRL 5IGXL 4DVRH 4NNXB 5DJZB 5J9PB 4XPFH 3JV0A 4XBPA 3I50L 1AXSA 5HYSG 1MCWW 1BF8A 2UVFA 2OXHA 3TIEB 1IGTA 2Q7NA 5F21B 2R1WB 2WIIB 1NPUA 2ORBL 6FABH 3DETC 4LVEA 2BNQA 2G75A 4R7NB 1ZA6A 4D9LH 2OP4H 3ECBB 3QNZB 5I66B 4NZDA 5SWSA 2HFGL 1WSST 5I1JL 3QEGL 3QQ9D 3LMJH 4LDOB 1OW0C 4XVUD 3BEVA 2A9MH 4HBQA 2Z91B 4TTGA 1IGFH 3EYSL 5F3BA 3O6LH 2UUDK 1Q94A 4FQXD 1D5BB 4OSUL 3O4LB 5T33L 1ZLVK 1FZOB 5K33A 5F1KC 2QTEA 3W9EB 5C3LD 1IT9H 4PGCA 4HBCL 2G2RA 3RDTD 3G5XA 1MCWM 3BN9D 3OR6B 1OB1A 5BZWA 3RZWA 3CK0L 1JGLH 3TA3D 3WNPA 4MA8H 5J13B 3RWEB 2XKNB 1W8OA 5I76B 3IKCA 1LP9B 3P4NA 4XH2A 5D93C 2B0SH 2YXMA 4YHML 3ULVL 4U7KA 3QDJB 3QRGH 4NBYB 5KVEL 3CNKA 1NCAH 3Q6GH 1J10A 5EU6D 5BRZA 2EIDA 4JFDA 4O2EA 3BE1H 3C60C 2CLVB 3NZ8A 2HFEB 5C0AD 3W9DA 5FKPA 1B2WH 1HQRA 1XGTB 4HIXH 4RX4A 2X44D 4LGRB 4UUJB 3FTGA 2DD8L 4NCC1 2YD9A 1T1ZB 3TBVB 2P8PA 1J1XL 1XR9B 3MMEB 5T1DL 4AMKL 5LCVH 2KZWA 5E6IB 4LCIL 3FRPG 1YYLL 1RK1B 5DF0A 1YPZA 4ODXA 3T65A 2UVEA 3DV6B 1RZIB 1U8MB 2KQMA 3ZL4L 3QDME 2GJJA 5I6XC 1HINL 1HHGA 5ESVA 2PYFB 2OZ4A 5CEXB 1CL7L 3T77A 3E8UL 1A4KB 1BD2D 1MWAA 2QADC 3TEUA 4AQ1B 3QIUB 5E2VH 3FFDA 5C0BB 1T22A 2GY5A 4NSKA 5JUEL 3GFUA 4L4TE 4Z18A 2UWEF 3OF6D 4JG1H 2SEBB 5DZNA 3WL9B 1F4WL 1FL3A 1ZANH 4R4NC 5JHDE 2GUOB 5KOMC 3WS3A 1FAIL 3VFUA 3ULUD 3KWWB 2J5LB 5ADOH 8FABB 2VITA 3TYFA 1FNHA 3F6LA 2EECA 2FH6A 3ZSSA 3CDCA 3R0NA 4RGNE 4G42A 2ZKHH 3ZDXF 1V7NL 4M7LT 4HK3N 4MMZC 3CZFB 1QR1B 3VWJC 3H8NA 1MRCL 5GGUB 5GRYA 4HIIA 4MVBC 1AKJD 3AROA 5C08D 3K46A 4LLWB 1Y6NR 1J9CT 4QYOB 3GMMB 4M6ML 4E42B 2IPUK 4OCWH 2A0LC 5A43C 1MCJA 35C8L 1INEH 1OQXA 4ZXBC 4AENB 4MQ7A 4PPTA 4WV1B 5T3XH 4U0RC 1VGEH 2YD7A 5ABDE 1J0JA 4JFHE 5GS1B 4NOFA 3CH8A 2RCSH 4LDLB 1ZOXA 3PWLB 1YA5A 4AJ0A 3LOWA 4LCUA 1B3JA 1KPUA 1MIMH 3HUJB 3QUMB 1JTTA 3C5SB 4HF5L 4Z7WB 2J6EL 2E7LA 3SDDC 3PWPA 4JKMA 5FUCC 5GGVL 1TVHB 3RNQB 4OQTA 4DZ8A 1R3JB 1X5HA 4QHLA 3HG1D 4JRXE 5IVXE 4DGYL 4PJXE 4QHMA 3VH8G 4LIQE 3SDAC 4AM0B 3R1GL 5EU5B 1I3RB 2FX7L 3OAZK 1F2QA 1T6VN 2JTDA 4Z95L 3EO0A 2ITDA 3PDDA 1W72H 3NIFE 4BFEA 5L2KD 3TWCL 3BRDA 2X9YA 1WBXB 1QPPA 4RISH 4NQEE 2ADIA 4B5EA 5JORA 2Z31D 4OZIB 1IL1A 2PO6D 1V8HA 4JZNA 3P0YL 4ERSL 1EO8H 1MFDH 3BESR 3JV6A 4N8VA 4U1KB 1BBDL 3EHBC 4POZD 1T80A 1J18A 3TO4B 2V9RA 1MCKA 2DIJA 1X7QB 3UJTH 3WFCH 1OAXL 2DRUA 5KJRL 2VDKL 4MA7L 3WDJA 3ZT5A 4NN6B 4UQ2B 1MNUH 4K07A 1CGSL 4XPGL 4NGHH 1ZHKB 4JPIA 3RFZC 3MLXL 4LP5A 1DVFB 2FX9H 3KJ6H 2IJ0C 4AG4H 4Z78A 3H6JA 4N8CH 1HK6A 2Q7YB 1HKFA 1CK0L 5F1NA 2WLZA 3ARTA 3EOAA 4JANB 4JQXA 3TYGH 5C0GA 5DMGD 2VWEC 2Z4QB 4QTHA 5HI3C 5T3XD 1KT2B 1N4XL 5HYIA 1JGEB 2BVPA 3T2PA 5CUSL 3GM8A 4D0BB 1MAMH 2ARJA 2K3TA 3G04B 4MQXD 5EA0L 3CPLA 4XPHL 4TVSa 3P11H 2VQ1A 4XB7A 5DQJB 5IBUB 1HH6B 4MD0B 1J8HD 5I15H 1QUNA 2EXYC 4U0QB 4KTEL 5I1HH 1NBZA 3BWAA 3O4LD 2WWMC 4M6NL 5FK9A 1DQJA 4OGXL 4FFYH 4UBDD 1NFDB 3ZO0A 5K59F 4HV8B 4I13B 1NSNL 4K55A 1MLCA 3V6BR 3UTQA 3T1FA 3SPVB 4NFDA 4LPVA 3V5KB 3MGOB 4GMSL 4NO5A 4PLKD 3VA2C 2FD6L 3BJ91 2HKHL 3OB0K 3Q6FA 1OAYH 5A2KH 2X7LA 3TBTA 3CX5K 3BW9B 3QAZB 3BIBX 1Q9KA 5DMYA 1A9BA 1KJ3H 3HE7B 2VWEE 2P8MB 4GW5B 2XTJE 3G5ZB 4GXUM 4PJHF 3FN0L 2XY1A 1C8PA 3QDJD 2IBZY 2R2EB 1PLGL 2Y06H 4L3AA 1JRHL 4A6YA 2UZIH 1M7IA 2HT3C 1TJIH 4MLIA 3ZDYF 4PRIE 4G8IA 5FYKD 5IEHB 3BT2H 1KB5B 3FFCD 1EEZA 3CJJA 2CK0H 1K6QH 2QLVB 4MAUL 5CJBA 1U92B 4LKCB 5HHMD 3S98A 1AC0A 4D0DB 3BIKB 4X9BA 2NY4C 2PYED 1EGJL 4MB5A 4BUHA 1RZKL 5J6GB 2ZUWA 3VD9A 1B6DA 4X6DE 5D7IE 5KG9B 1NUDA 5BZDB 5DJCB 4AT6B 4GRWE 4GG6F 1NMAL 3BKCH 4W6WB 4BQCA 1HHKA 2X4NB 5D6DA 1YC7A 3QNYA 4P59L 3MREA 2BVOB 3MR9B 4RZCB 1ZHBB 1AJ7H 2X10A 4ODVH 3T0BA 4OAWA 1FHGA 1NCBL 4OD2A 5KN5B 5F7KC 1TLKA 4JPKH 2AKRA 1KFAH 1F4XH 4M5ZH 3F7QA 5DS8A 4L9LA 4NJ9H 2GW5A 3WJJC 1A9EA 4QHKJ 3OQ3B 1A7QL 4X6FB 1A6WH 1Z9LA 4Y89A 2YPKA 3GMRA 5I75B 1ORSA 3MLTA 5FO7B 1HOCB 2C26A 4Y16D 2Y25A 5L7XL 12E8L 5IR1B 3ZE0E 3GSQB 2P44B 2OTWB 3DUUB 1A02N 4G8GB 1VPOL 4YFDB 4XAWH 1JNLH 3CFCL 1AY1L 3O8XB 4WU7B 1MCSA 2GITB 4YXHH 5I71B 3F12A 2WSKA 1NMCC 3P2TA 1ZEAH 5FKAA 1MFNA 1UB5A 1NLDH 2VR4A 4S11A 3QIWC 1A4JB 1BP3B 1HILA 4WHYH 4Y1AA 3KPRE 5KVFH 1K2DA 1I85A 3RKPA 1KPVB 1X5KA 2CPCA 4D9RE 1XGRB 1HSBA 1BIIB 4I18A 2BY0A 1JWUA 4FQLL 3V4PL 3QIBC 3IDYC 3EW3B 2YRLA 4OLWH 1I1YA 4MXWL 5JMOC 5CP3H 4JB9H 5EOCJ 4Z9KB 2VDOH 4YDKH 5HDBF 1BEYH 1RFDH 2FB4L 2JB6A 4OLEA 1BQHA 2P8LB 1ZHNB 1JN6A 5DRXB 1CDGA 3X13A 1NC4B 3VFRB 3DUSB 1RMFL 2VDPL 4O2CA 3LN9A 5SWZE 3RL1B 2CH8A 3OJVC 3RGVD 1P2CA 1JNNL 4J12A 4X7CC 3DROB 3LKQA 5EPMA 1INDH 2EXWD 4AYFA 3E6HA 1HHJA 3RU8L 2J8UA 4FQHA 1DQDH 3L5WB 4JM2A 5F1SA 3MRQA 4PJ5A 3DI2B 3L5HA 1HHIA 5DQ9A 2DQIL 5DJXB 3L1OH 3G6DH 2F8XC 3GHBL 4UIKH 5IT2H 1ES0B 4GRLC 2GQHA 4HWBL 1NBYB 3N85L 4PY7A 1U8KB 1T21A 1U8HB 4F58L 5LBSH 5JDJA 3UJIH 4HK0B 3TN0D 3VGDA 3QI9A 4AIOA 1CDUA 3TO4D 5KSAA 4NZJA 5F9WC 3I9GL 3MJ8B 4PP2B 4LLUB 4O9HL 1I9JL 4YDIL 1GVIA 3MROB 4FTVB 3LEYH 4MXQC 4KWUA 4P2RA 1EO5A 2F5AL 1YY8A 4P4RA 2I07B 4PJFF 2A9NH 4XNYL 2OTUA 3I2CL 3OKDB 3H3KA 4PTUA 1MQ8A 4XXDA 3L3HB 4OUUB 4R3SB 4GQ9L 1GGBH 2IFGA 5GHWL 5ISZA 4ZMAT 4U31A 1C7SA 1IC4L 1J0YA 2AJUL 1F11B 5C2BL 1A6ZB 4CADA 3IF1B 3P4MA 4CKVX 5IG7A 3IU4H 4O00A 5GIRB 3IFNH 4JAMB 4G6KL 2AV7B 2VZ3A 1B4JL 5KAQF 3DIFB 2YR3A 2ESVB 1FRGL 2FSEA 4F7EB 1NAKH 3KVQA 4P23C 1QSEA 4MD5B 3O6FB 3KYNB 3S36L 1OLZA 3LRGA 5BRZE 5FYLL 3KPNA 5CZKA 4JFDE 5AZEH 4RMTA 4KDTA 4UMGA 3VXOB 5LWYL 3BGMB 5HHXH 1YEEL 4TRPL 2HT2C 3FAXA 3LKPA 2HN7B 5TQ0H 5FB8A 1A2YB 2A77H 4BKLA 1GH7A 1A7OL 3H9HB 1FLTX 1OGTA 4NKIH 1GYAA 1N6QH 1K4CB 1I7TB 3QUKA 4Z7UF 4LVOC 1AP2A 1KN2H 2Q3AA 1YPZE 2QJDA 4PREB 4DQOL 4MDJA 2CRIA 5CBAB 2XG4A 1GGUA 1HZHH 3FZUD 4KY1H 4Z5RA 3RWJA 3UZQA 1U2CA 4X5WB 2A2QT 4NQCA 3JZ7A 1FLRH 1NUFA 1ZWIB 4M9PA 4YHPB 2ITCA 4F2MB 2BX5A 4Y4HA 4DVBB 1XR8A 4WUKL 5D2LE 3NN8A 4HJ0C 3HMXL 5T3ZE 4MD4A 4ZS7H 3BUYA 4RFOH 4ZD3L 3RQ3A 3BP5A 3QUYC 3QUXB 4S10A 5DD1H 3RRQA 4KKCC 4L4VA 3T2NL 1DUYB 1S7RA 3PJSB 4LVNB 3VXRB 5IHUH 4BZ2L 1LD9A 1MEXL 5FCUH 3RTQA 5JMRA 3MLUH 4XVJL 4NN5C 1A14H 4NCDA 1E6OH 2E9WA 4OKVA 4YIQB 3EYFA 3NFSL 5ACZB 3PIQA 2W59A 3RUGA 5E08L 5IB4B 3QHTC 4OZGF 1QFWM 2HYMA 3ARFA 4GG8B 1JPFB 1DP0A 3WUWA 2EYTA 1UWEH 2AV1A 3V4UH 5F9DC 1G7LB 4ZYKA 2G60H 1JPST 4MCZB 3FCTA 5DJ8A 1QFUL 4EI5B 5L2JA 2F54A 3MA7B 5CAYB 4CUCA 1AC6A 32C2A 1FE8H 4P2YA 5GJTH 4B50A 1A7PH 4J4PC 3BYTA 3OR7B 5D71H 3V2AR 4HFUL 3QEUA 2C3VB 1UWGH 1YZZA 3MLVL 2DN7A 1W8NA 4J23A 4P2OB 1EHNA 3RBGA 3CFJA 1VERA 3EYVB 1CU4L 2X41A 3L6FA 1SJEA 4KRPB 2V7HA 3B8YA 1CICB 4JFPA 5K9OB 1CDYA 4RGOH 3DX7B 2VXVL 3PWPE 1L6ZA 3E2HB 4YXLL 4PJDE 3C5ZB 2VR5A 5TF1L 4HH9B 3QP3A 3D0LA 2UV3A 2QQLL 4K94H 3ARWA 5MHSD 2NY5C 4QCIA 4JFOA 4Q0XL 3LRSB 1ZLSL 4NKMA 1CFNB 3DGGA 1OAZH 4JQXC 3B43A 3D25B 1S7UB 1WTGT 5F6HI 3GSWB 4EDXB 2ZZUT 1V5JA 3BEWB 4Y5VB 1U3HC 1JZ6A 3RBSA 5FO9B 2IANA 1NC4D 5BVJA 3CMOL 1MRFL 3BISA 2WBJB 5DSCB 1QYGL 2VUOA 4DTGH 4MAYB 4OZHF 4PRNA 3TIDB 1I9IL 3QXWA 5CILH 2VISA 3DARA 4WW2F 1SVCP 1SM3H 2IQ9H 3ORJA 3Q3GA 4F80A 1YEHH 4N1CA 4MJIB 4FABH 1KJVA 4HKBA 3P0VH 1N5AB 1HKLL 1TPXC 1P5VA 4FQIL 1B0RA 5AAMA 3QEQB 1U2HA 1QO3A 4PJAF 3IGAB 1X5ZA 4O58L 1H3UA 4FQXA 5LGJA 4UT9H 3TBWB 4EVNB 3OKMB 3O41A 2E6PA 3O3UN 5E95B 1B0GA 4BSVB 2AJZA 2YRPA 3RDTA 2VXQL 4RFEA 1WICA 15C8L 3TT1L 4PY8J 3T4YB 4QY8A 3TA3A 4X6CA 4JRYB 4X80L 3T09A 4IMLA 4HLZG 5HGAA 2A6DB 3EOBA 4P5MA 4OCXL 1LK3H 1MI5B 3S4SA 1MH5B 4L8BA 1VENA 1BLNB 3OXRA 2R0KH 4JG0H 3SY0A 5DRNB 1R5VB 1CN4A 1T5XA 4QOKE 4GO6B 4XWGL 4QRUA 5EU6A 1FFPB 1AGDB 1HH9B 4FXGA 2D9CA 1KLUB 4PGDA 4W4NA 5GGSY 5KSBA 2Q6WB 4H1LA 5IF0A 5C0AA 1NGWB 3F58H 4RNRB 1KCVH 5I1GL 3LEVL 1HNGA 4JZOB 3O2DA 4K7FB 5ICZB 2W9EH 4F37F 4PRHB 3NAAH 1A21A 3SE4A 1RUAH 1BQLL 1FO0H 2QKIB 1KPRA 3F8UB 2R56L 5IB5B 4X7FC 2F58H 3VFMB 3ARGD 3JTSA 3T2QA 1PD6A 1HEZA 2AXGA 1E4WL 1GGCL 3DBXA 4C54A 4LAJH 3VFNA 3FT2B 1H5BC 3MGTB 3ZYZA 2YC1A 1CLCA 1FVEA 4LKXB 5A1AA 1T5WA 1RZFH 1X5GA 5FF6A 4LQFL 3WMSA 1VEPA 1BD2A 3HNSL 2NW2B 1XAUA 3AS0A 4LLMA 3VXTB 5EC2A 3U4EB 3OAUH 2N7AA 1ZK9A 4JFZH 4GAYA 5EN2B 3OF6A 2XI9A 4HKXB 1XCTB 5HJ3B 5J6HA 5HI5C 1I85C 4AIXA 4DFIA 4NNPL 4K71C 4FN0A 1U3YA 2ILLA 3B2UD 3P4LA 1I7UB 1OARL 4AEIL 2ZUQB 2EE2A 4NT6B 5TDOA 5T1MA 2ZNXA 4L3CB 4XX1G 5DA0B 4ZPVB 1U8LB 2DBLL 4FFZH 3DX9B 2L7UA 3T3PE 2EH8L 3QUXD 1D5IL 2CJUL 1AKJA 2FATL 3GO1L 4WTZG 5C08A 3MLRH 5E8NA 2AJXH 1AFVL 2DQFB 3I50H 1CFVL 5MEQA 2H3NA 4L1HA 4TTDC 4KMTH 2ORBH 5INCA 2VLLA 2H1PH 4CVXA 1S5IL 2AXFB 3HPJA 4OLUL 4N0RA 5DGQA 2HFGH 5LAXA 4ELKB 4JJ5A 4F7TB 3UXFA 3ARDD 3WEXA 4HQQL 2DI9A 2R1YB 3D9AL 2X1PA 2CKBA 2VE6B 4OCNC 5CS7A 5HHPB 4MA1C 3WLWD 3S34L 5CD5D 3G5VA 4L3EB 5H2BB 4OSUH 3UJJL 3NFNA 1OWWA 1CF8L 3DUHA 2DLEA 5JQ6H 3GB7B 5ADPL 3HG1A 1BVKB 5GGTA 1IEAA 4K3EL 3IVKA 5ICXA 3WE6A 4JZJB 4YEEA 2MQ0A 2LE9A 1OTTD 4D2NA 4G9DB 2IMNA 1G1CA 2MMXA 3QCUL 5AUMA 4KRPD 2BOCB 3MRBB 5J11C 1CICD 3S35H 1NDMB 5L2KA 4P2QE 1PW3A 4ZFGL 3KDMB 4FMFA 4YHMH 3ULVH 2X4RA 2B1HL 5F9JB 3C5ZD 2Z31A 2RAMA 1NH6A 3QFJB 4XC3L 2NTFA 3O3BB 5TE7L 3X3GL 3WLBB 2VDRL 2UYLA 3GI9H 3RL2A 4HCRL 1FZJB 1E28A 4G6JL 4L4JA 4PJ5E 1O7SA 5F96L 2VXSL 4PJEB 4OGAC 4P5TB 4EUPH 3F7YB 1G9NH 1KBGL 4FNLL 2DD8H 5B3JF 4U6XA 5DJZA 5J9PA 1J1XH 5E1HB 5T1DH 4Q6IA 4AMKH 3WS6C 2YA0A 4PRPB 3UYRL 1U93B 5IW6A 1GL4B 2YEZB 1YEKH 1N3NA 1EA9C 1WWCA 3GMLA 3PE9A 4ZG1A 3U7AA 4JHZA 5D2NB 4R7NA 3HLAB 3ZL4H 3EDJA 1UWXH 4MJID 4F57H 4WFGE 2OR7A 5I1LB 4WWID 2FHCA 1WZ1H 2QSCH 4HGKC 4GS7C 4PBXA 3E8UH 4U1NB 4E9LA 1BM3L 2F53D 2H9GB 1J8HA 4LNVA 5D96B 3IS0X 1BFOB 4DEPC 4K8RD 1LO3L 4GBXC 2BMKA 4IRSC 3NZHH 3ZE1E 4X0KB 1D5BA 3O4LA 3Q1SH 1A1NA 4IOFD 2EDHA 4XZUB 3W9EA 5ISZE 2P7TA 2W9LA 2CXKA 1N64H 3ZKNC 1F4WH 3LQZB 5TGBB 4IIQC 3NIGF 1IAIM 3G5YB 2PNDA 5HHOD 2GFBA 3OR6A 1K4DB 3J8F7 1IGIL 3O3EA 5DO2D 3STLB 3QXAA 4LLDA 3VFOA 1QQDB 3LIZL 1V7NH 3U7YL 1LP9A 5BS0D 4W70A 3NA4A 4FFVD 1QSEE 5AYUH 1KJ2H 3VDAA 1CVSC 4WCYH 5B8CA 1YN6B 3BPCB 3QDJA 5C6PB 3S36X 4XCFL 3HHRB 1U95A 4M6MH 4O2FA 2K1MA 35C8H 2P4AB 1MY7A 3LKNA 3LKOB 4P3WA 5DK3A 2LAGB 2EE9A 2CLVA 3LPGA 1YC8A 3UO1L 5IEKB 1V7ML 3K81A 4UUJA 4V1DD 5HYSB 2PYEA 1IC7H 2ZSVA 4JN2B 4HPYH 4HMDA 2C4XA 2GSIB 3DV4B 4LARH 2LU3A 1XR9A 1HXYB 3HC0A 3CLEL 3MMEA 8CGTA 3PP3K 3B3IB 1F3RB 4EKXA 3R0MA 1RK1A 1IGCH 2QHLA 1T89A 5E0QA 2H32H 2RHEA 1RZIA 2GKIA 1OAQH 2JCCE 2VLME 5F3HB 1U8MA 7CGTA 4NQCE 4DGYH 3PWNB 3JUYA 4ODUB 3GRWA 3V5DB 5CD3B 4KTYA 4FQCH 3WNMA 1CE1L 2YWZA 4TSBH 5CEXA 4WI2A 4Z95H 1A4KA 3CD4A 5CSGA 2R69H 2VN4A 1DUZB 2A6IB 1FAKT 1QEWA 1T0NA 4S1QL 3IAGC 4Y16A 1DL7H 5HDLA 3PGFH 1TQCB 2SEBA 2YZ1A 4GRMB 1ZHLB 3HAEB 5EIIA 3P0YH 3L5IA 5HYJB 3RY6C 5FO8A 4JM4H 1NEZG 4UQ3B 4HXAH 1P7KB 2ENYA 2Y9RT 2NY6D 4G9FD 4JO2L 5EU7C 3RUGE 3ZTJH 1CR9L 1OAXH 2FJHB 2H2SC 4TUOB 2OM5A 2VDKH 2FIKA 4MA7H 5HHVH 4H5SB 3CX2A 4Z0BL 4XPGH 4OFIA 2IAMB 4OZ4B 43C9B 3MLXH 3MACL 5D1ZB 5BV7C 1RULH 3WN5A 4Y5YB 4D9QE 4JFFB 5KSVB 5AAWA 3EZJB 2XQYG 1CK0H 5D9SA 4PS4L 1HCFX 3INUL 4WV1A 2RB8A 3PQYB 3TPUA 5ID1B 3PHOB 3UYPA 1N4XH 5E2WH 5IMKB 1UADC 5GS1A 2DYPB 4PJCB 2ENSA 5EFIB 5EA0H 4OIIH 5CIPH 3FONA 1N59A 4PLNC 4Z7WA 1MIEH 4R7DB 5BMFH 3KXFE 4PTTB 2CQVA 4N68A 3SDCD 2HT4D 4DFHA 1T03H 1K5NA 4XVUC 1ZS8A 1JZ5A 3QWRA 4HIHB 3DMMD 2MOVA 2KPNA 3RGVA 5BQ7B 1R3JA 1NGXB 1NSNH 5I1IL 4FQXC 5F44A 2P46B 5E70A 3IB4A 5SX5H 3THML 1I3RA 4BSJA 3IU3A 5HGBB 4JPWH 2GI7A 4UAOB 4GMSH 4I3SH 2YKLL 3QB7C 4ZO7A 1YY9D 3OKLA 4UINL 3SE9H 3VG9C 3WIIH 5L9DH 3U46B 5TE4L 3FB5A 5DJ6B 4FRWA 43CAB 2WINA 4KJPD 4R8WL 1G0YR 1YEDA 3FN0H 2D3VA 3REWB 3EBAA 1PLGH 1EVUA 1P7QB 4E0RA 5BW7C 5TPWL 3KJ4B 3QFJD 2J12B 4GW1A 4NQDB 5DUPH 1QRKA 3RIAF 1QSFB 4M1GH 4M6AA 4TSAH 1I1CA 1Q9OB 3TN0A 3TO4A 4FQ1H 4POUB 1CD8A 4X6BA 1FNAA 4TVPL 3B9DA 1EGJH 4M7KH 1RZKH 5C07D 1UT9A 3FL7A 3T3MF 4KKNA 3GK8L 2JK5A 1NMAH 3A67L 5DQDH 4Q9QL 1I8LA 3MRIA 3O2WH 1UCBH 4P59H 4OLYL 5LXGL 4X4MA 5HGHB 5JDSB 1R3IL 5CINL 4KMLB 4HZAA 4BQ6A 2LTQB 4XNUH 1KT2A 2Q1EA 4X6CE 4OI8A 1JGEA 4Y2DB 4D0BA 1XCQB 3AMLA 3MOAL 5ILTL 1HH6A 1A7QH 4M8QA 1OTUD 2W0PA 4LPYA 4MD0A 5EUKB 5KW9L 2EICA 3FB8A 1G0XA 3CVIL 3OJDB 4PJGF 3N9GL 3VD5A 4GAGL 1OP5K 1ZLUK 1CGTA 5EU6E 4CU8A 1UG9A 4JHBA 2R4RL 1TZIB 1M1SA 3SPVA 3WHXA 5I1AB 4GW4A 1UZ6F 5KSBE 5I19L 3O3DB 5C0AE 3FO9B 1H8NA 5IVXF 5IV2B 3BP6A 1ERNA 1GOHA 2BVQB 2VDMH 3I3EA 3V6OC 4PV9B 1ONQB 3MV9D 3JV4B 2P8MA 1P84K 5ELIA 4LLQB 3G5ZA 3AGVA 1N6UA 3MBEB 3MFFB 2CLRB 5ESAB 3OKNA 3GKWH 1KENH 2UY6A 3EYUL 2GY7B 4FQLH 4C56E 1FC2D 2VLKD 3V4PH 2IFFL 5D5MF 5L0QB 3VRJB 1F4YL 3O3AA 4F15C 2AJSH 4LOUC 2NXZC 4P3DA 1BD2E 3BIKA 3JWDL 3V0VA 4AL8H 4M48L 5JQHC 5HYQB 3K74B 1LNUA 1N0XL 2R4SL 4FQPA 5J6GA 4Y4FC 4PG2C 3KLDA 1D9KD 5F93C 5BZDA 4YHOL 4CW1B 2OL3L 4MDIB 4IHOB 4AT6A 4LAQH 4CNIB 1T7ZA 3MV11 4ODTL 5F7DB 4D0CB 3C5JA 1RMFH 3FOLB 3JV5A 2X4NA 4Z8FH 1C16B 3VFVB 1AR2A 1W0VB 4GOSA 1QHOA 4KROC 2BVOA 4JKKA 5F7MC 3V6OE 1P4IH 1F58L 2EIBA 2JJVA 2MWCA 5D1QC 4XCYA 5KN5A 2FEDC 3VFPB 1NBVH 4I0KA 5MEPB 4I5BA 5EU4B 1G9EA 4ZUSA 1M6OB 1BZ9A 4DUXA 4WHTA 1AHWA 3RU8H 4GKZB 2V17H 1OF2A 3WSQH 2GCYB 1YYML 4KRMB 4JFQB 2OYPA 1NMBH 3SGEI 2KQNA 1GOFA 1HOCA 2P43B 3GHBH 3GJFB 4J8RA 4HDIA 1MHHB 2OTWA 2FWOA 3S3PA 5TDPA 1H3PL 3P30H 4NYLA 3GSNB 2CDFB 5C0JB 3IDGB 1A7NL 4F58H 2DTML 3Q5OA 4ZAKC 4WU7A 4DCQA 1I4FA 2GITA 2PO6C 5E9DE 4YJZL 2AEPL 2HKFH 3E0GA 4G6ML 5KVMC 4UDTA 1P7HL 2MNUA 2V2WB 4MSWB 4YO0A 4P4KB 1A64A 2VO5A 1I9JH 3MX0A 1X5FA 2X4TB 4HS8L 2DWDB 2NY5L 3BPNC 4I0CC 4XNYH 2G9HA 1D5ZA 1XGRA 4CBPA 3TF7C 2UWEA 2E27L 1C1EL 1FFNB 4S1SL 4WY7L 3F7VB 1CXEA 1G7HA 4GQ9H 4XVTL 1IMHC 4Q6IC 4ZTPL 1IC4H 1KCRL 2AQ1A 1WWAX 5ERWA 4ODSL 4HWZB 4ZFOA 2IG2L 4OCYH 3SGKC 1SJVA 1B4JH 3O9WB 1MHPL 5JIKA 2P8LA 5GGRB 4JHAH 5DFTA 1JGVL 5ENWB 1NC4A 3VFRA 4GRWF 3UAJD 3W11C 3RL1A 4JN1L 1S5HA 2OJEB 1ZT1B 3S36H 5FYLH 1FN4A 4KK5D 2QL1A 3JWOH 2VDQL 1TVDA 3BJLA 3CSGA 1ZAGA 4OLZL 3B6SB 1IM3B 5JPMB 1YEEH 2DM3A 3F65A 5J1TC 4TRPH 1P4LA 3A0OA 2PR4H 3QYCA 2AEWA 1D5MB 3L5WA 2OBGA 3QWOA 4MZ2A 5I1DA 1RUPL 2VLRD 5DUBA 1YEFL 4PLKC 1A7OH 3RZCD 1Z5LA 3DX6B 1INQB 3TNMA 3JVGA 5J89A 1CGWA 3QUMH 3JWNC 1ES0A 3U4AA 1P7QD 1YQVH 3OKOB 5DD0H 3DWTA 1U8HA 1CE6A 1AIFA 4HIJA 4NP4L 5T3XE 2V2XA 1QSFD 2XT1B 4O02L 4NM8H 3QXDB 3PL6B 4GMTL 4HAFA 5B3NA 5ETUB 3QDMB 5D93B 5DD5L 4Y5XA 3FMGL 3MJ8A 1J8HE 4A2LA 3VXQA 3UZEA 4WUKH 4RBPH 4YNYA 1U6AL 3I6GB 1MFAL 3HFML 4ZD3H 4E41B 5CGMA 4MWFA 1KJMB 4R90L 4NZUL 3I02B 3OKDA 1GOGA 2ADGB 3T2NH 4Y19D 3L3HA 4ETQA 4L4TB 3C60B 4XNQA 1MJJA 3FRUA 3S5LA 1JZ4A 4LCCA 3DX8A 1X3DA 5D7LD 5GZOD 3GSRA 4M02A 1JNJA 4XVJH 1DQTA 1BVLA 1T89C 4GXUN 1SBBA 2HJFA 4CL7A 4PJ7E 1A6VL 3CUPB 3MRGA 4JAMA 4HGWA 4YBQD 2MTPA 3CSYA 5I9QC 4RGNB 3W39B 2A6KB 4NUJB 3AB0B 4RMRA 4DKEL 1HXMB 1QPXA 4M3JA 1I8MA 1F2XK 2Z35B 3CLFL 1JHKL 5J3HD 5E5MB 4FZEL 5GXBB 1EHAA 5SWQB 1UM6L 3AS1A 4KH2A 3FFCE 5FUOH 4DJMA 3VXOA 1QFUH 2EC9T 4BELD 3KYOB 1Y0LB 3MRFB 5TFSH 4JO4L 4KHTL 4HPOL 5HHME 4EBQL 2HVKA 2HVJB 1WF5A 2EYSB 2QADB 4P2CG 4LSTH 5E94B 2PYEE 5B39G 5DJYB 4HFUH 5FGBC 1U8JB 2HN7A 3MLVH 2NY1D 3SE8L 3X12A 2NNAA 1FV1B 3H9HA 1CDCA 2APVA 5F88B 1I7TA 3AXLA 3L3DA 4S2SA 2VXVH 1XIWC 4YXLH 4U6VL 2CUIA 2HJLA 4IRJD 5TF1H 3S4SG 3GGWA 5IROC 2X1QA 5CBAA 4JRXB 2YUZA 5GS0L 4XMLH 4PJXB 4U1LB 3QUZB 4P46C 2EDOA 4LBEB 4F2MA 4ELMF 1UYWH 3VE0B 1F45A 1TJHL 1QKZH 3QUXA 2IH1B 3CMOH 4XCCL 4PJHA 1IAOA 3BO8B 1XT5A 4WWKD 1X9QA 5KBNC 1DUYA 4YUEL 3PJSA 1CDJA 4NQEB 3VCLA 4U0RB 3LH2L 2APWA 3CVHB 3I75A 3LB6D 1OCWH 1S7XB 1MVUB 4K23L 3RGVC 2R39A 4MS8D 2W60A 1RZ8B 4BH8B 1KB5H 1JV5A 5DJ2A 1LE9B 2F5BL 1T83A 4WUUE 4FQIH 3ARDA 1KG0B 1K9TA 1KF9B 4U1HB 3BVNB 1JPFA 2D7OA 3LN4B 3DVNA 5E7BA 1M7XA 4GG6A 3U0WL 3UTZB 4P9ML 4L9DA 1AXTH 1MFEL 1NDGA 2H2PC 3EGSA 3N1QC 4L8CB 2NZ9C 3QG7L 2VXQH 5GS2D 15C8H 5D1XB 5MP6L 4YHLH 3OXSB 3TT1H 5H94A 4C58B 2A83A 3IDNB 4QNPF 5E00A 2IBGA 4X80H 3EYVA 1PG7W 4OCXH 3U0TA 1CICA 5K9OA 3VW3L 1T2JA 2BSRA 3B2VH 4PUBH 5FHBL 2YD6A 4HUMB 1Q0YL 3RWFB 5DURB 3BH9A 1SBSL 3C5ZA 5AYQA 4LRNL 3IKKA 4R0LA 4HH9A 2PXYD 4K9EL 4YE4H 4YHYC 2Q3ZA 3K1KC 2A74B 4R2GD 4XWGH 1JFQH 5A40E 3EJYD 4TULH 3NFPA 2NCMA 3L95B 3T4AA 5I1GH 3ZKSD 3LEVH 5AG9A 1P1ZB 3ARPA 4R4FH 4KGJA 3GSWA 4EDXA 1JWSB 3AS3A 4KRNA 5CHNB 4ZOBA 5IB1A 3CFBA 1K8IB 5D2LF 4YZFF 3KPSE 4CVUA 1BQLH 1DBAL 3DETD 2HLAB 2KL6A 2OMBA 2XTJB 4OM0L 5DSCA 1MPAL 3A6BH 3HR5B 1AGFA 2R56H 4DN3H 1F3DH 1K8DA 3WIFA 1MCDA 1T04B 5I1CH 4PRIB 2C3HA 3GSXA 3GBLA 1DE4A 1G6VK 4K7PY 4MJIA 2BY1A 1OPGH 5IESH 1PZ5A 2NXYB 5C92A 4LQFH 1DN2A 1NGZA 4U2ZA 1FNSL 2E6QA 4M5YL 2F53A 4X6DB 5D7IB 1XF3B 4PLOB 5HHNA 5J56B 5H35B 5JNYB 2D31A 3HI1B 3FT3B 3T08A 4BSVA 1JGDA 4BQBA 2X4UA 5HHOA 1ZT4A 5AG8A 1I3GL 1XF4B 5HVHC 4UTBL 3SCMD 3T4YA 4JFED 2ZOKA 1OARH 1FQ9C 4XPTL 4KKBC 2DMCA 3LKSA 1J7VR 2A6DA 1XH3A 2ZG2A 5BS0A 2D9QB 1BLNA 2D2OA 1KTRL 2EH8H 5TDNA 3FQUB 2FATH 3GO1H 5C1MB 1RURH 4YFLF 3QA3B 5EBWA 4PJDF 1AFVH 2NYYC 1CFVH 4HJGA 3SE3A 3VGAB 1FFPA 1IBGL 1U8QB 3OX8B 1WCBB 4OIBA 2VL5B 1AGDA 3NVQA 5GSVB 3U0PB 5JHDD 1HH9A 1H0DB 5INDB 1E4KC 4RNRA