3R4DA

Crystal structure of mouse coronavirus receptor-binding domain complexed with its murine receptor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
199
structure length
199
Chain Sequence
EVTIEAVPPQVAEDNNVLLLVHNLPLALGAFAWYKGNTTAIDKEIARFVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMKDMGVYTLDMTDENYRRTQATVRFHVHQPVTQPFLQVTNTTVKELDSVTLTCLSNDIGANIQWLFNSQSLQLTERMTLSQNNSILRIDPIKREDAGEYQCEISNPVSVRRSNSIKLDII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of mouse coronavirus receptor-binding domain complexed with its murine receptor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion/viral protein
molecule keywords CEA-related cell adhesion molecule 1, isoform 1/2S
total genus 36
structure length 199
sequence length 199
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3r4dA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3r4dA02
1HHHB 4PV8A 2BNRE 4O58H 1J8HE 1A8JH 4OD1L 1DE4A 4U3HA 1TJIL 1U8NB 5IW6A 4HK3J 1LEKB 3P3YA 1X5JA 1LEIA 1LEKA 1PQZB 1TCRA 4ZUWB 3BRGC 2YC1A 2HRLA 2NY3C 4UNTA 2LVEA 3R06B 4DN3L 1PG7L 2M1KA 1RZKC 4WUUD 1K4CB 4M93B 3K4DA 5ICXA 1UVQA 1A3RL 1RK1A 1X5LA 3O2VH 3GSNA 4P2RA 4PJEA 5F7KC 5ITBL 5J12C 3GSNB 4QYOB 3MSPA 4UIMB 1G7LA 1NC2B 1YEGH 2YZ8A 1AC6A 3S6CA 3TPKA 2ED9A 1TVBA 4YFLI 1S7RB 3MLYL 4S1RH 3V95A 5I18L 3MUY1 4IIQB 1I3RB 3W9EA 3RX7A 3B9KC 4ALAL 1ZT7A 4UU9A 2YK1L 4QTIL 2CIIB 4ORGB 2I9TB 4KV5F 3IDNB 4DOHE 3N0PB 2E7LC 3ARDB 2XTLA 3PABB 2R8SH 2A6DB 1HYRC 1N5YH 3DROA 3ARBB 3B9KA 4P2CG 2PW2B 4PJBF 1JPSL 5TE6L 3MFFB 4PJIA 1VKXB 1RZGA 3KR3L 1UM4L 2A73B 1BHGA 2OCFD 3Q48A 4MXWL 3G5XB 1O7SA 4AZ8A 4QRRD 1S7XB 3MRCA 5DJZB 3TNNB 4HIIA 1JPFB 3VWKD 4WU5B 4ZFFB 4U1NB 1OGAB 1AHWA 4OGYL 5T5NF 1OGAA 3PWJA 2BCKB 3B5HA 3SGJC 3VXRE 4YHPB 4QXWA 1FZOA 3CFBB 1DBAH 3S5LB 1UWEL 3G04B 4MA7L 3VXSB 4H88L 4N0YH 5CZVL 3G04A 1NGYB 2FGWL 3ELAT 4QXUH 3LN4A 1BX2A 4RWYL 1DN0A 2FH8A 3QR2A 4ACPA 4GAFB 4ZUUB 5MI0C 1CGSL 4LGRB 3T0XA 1IBGL 2MHAA 4IEFB 4JPWL 1X5GA 5DGQA 4OT1L 4ZOBA 4X6EB 1HZHH 3T65B 2QSTA 3G6JA 3VE0A 3QP3A 2Y25A 2IBZX 5DS8B 4V1DA 5DO2D 1QRND 1HNGA 3MGTA 5JA9A 4PR5A 4XCEA 4AT6B 4UDTA 2YD1A 2ZSWA 3NOIA 4X4YA 2ZUTA 3EYFB 3IDYC 1QFPA 2OLDA 4RAVA 4X9HA 3MLUL 4DKAA 4PRAA 4IOFD 2V9TA 4NO2A 2D31B 2P4AB 3CH8A 4NOBA 4OF0A 5E2JA 5C70A 4UTBL 1HXMB 4IHOA 4NCC1 3K8MA 4PJ7A 3WO4B 4IRZH 1MAJA 1YQ2A 1W72A 3DMMD 3KYKL 3F7QA 3B5GA 2ADIB 1JF1B 3QUZA 2N7AA 4JFQA 5FHAL 3FZUD 4FNLL 2B5IC 1YEGL 3MUGA 3TNMB 1UJ3C 2DL9A 4PJIF 4FFWD 3ECBB 1IGIH 2VLRD 1G7MB 2HT3D 3ECBA 2X6MA 5A1AA 1WZ1L 3MMEB 3OR7A 3V2AR 2IPUG 1ZWIB 2MCPL 4R97C 3JSSA 4F37K 5E2TL 1A4JA 4Y5XB 3SPVB 4L4TE 2KL6A 1MRDH 3V6ZA 1L0YA 3MRQB 1R6VA 2EEAA 3VXRA 1A1OA 3CFKA 3TZVD 5BJTA 4ZOCA 4NJ9L 1I3VA 4Y16B 3BT2H 5HHNB 4R3SA 5KBNC 1F3RB 1S3KL 4D0CB 4BH7B 2ZUXA 3H7LA 3TBWA 1BZ9B 2Q6WB 3GI8L 1N59A 1N6QL 1J12A 3HC0B 5EOCH 1EX0A 3HHRB 1DFBH 1RUKH 3HAEB 3DO7A 4I3SL 1QR4A 3I50L 4OGXL 4Y1AB 2DTSA 4L8CA 4NIKB 1MFCL 3ARUA 4HMCA 4OFIA 1F6FB 1WFOA 3GK8H 2HKHH 3L5WB 2GJJA 3GDBA 4MXQC 1KCKA 5FUZL 4Y5VA 1GGIL 4O2FB 3GUTA 5IF0A 4AIZA 3QDJD 4MJIE 3QHFH 3IKCA 5FECA 1ZA3A 3BEWB 1MWAA 5EPMA 4AMKL 5LKNA 1E4WL 2VITB 1BGXH 3WXWL 2XZQL 2VITA 1GIGL 3WFEH 3REWA 1PX3A 4BSVA 1AO7A 1MIEL 2FBJH 5DK2A 4QHNB 4NO5B 3EOBB 4N5UA 3QDJB 1MCOL 3CXHK 4OT1H 1IAII 1F3JB 4XNXL 1EEQA 3BGMB 4GAYA 2VKWA 4Q97A 3T2OA 2JF1A 1RVFH 3JV6A 5DHYB 3KG5A 2C7UB 4LPWA 1KCUL 3OKMA 3LDBB 1Q0YL 2KBGA 3DSFH 4WTZG 4YNYA 1P9MA 1EVUA 7FABH 4CU6A 4P5TA 4FQ1H 2Y5TB 2DTML 5IHUH 5EWIL 5CJOL 4MQ7B 4K8RH 4ODVH 4HH8A 4Y19E 5I16B 1YMMA 5J89A 3KPRB 4PJ5B 5SWZB 5KSBA 4U33A 5E00B 3HRZA 1TTUA 2JJTA 2KQMA 5CJQH 2IAMD 2H32H 3MZGB 5DJYA 1Q9KA 5IW1B 3T0DA 3QNYB 4OZGB 5F44A 5JW4R 4ONHB 2EE3A 4I2XA 1T04A 2E5EA 4XZUA 1OTTD 3IVKA 4AL8L 3V52L 1MCSA 5E4EB 1WF5A 4OF7A 1FJ1B 1EBAA 4C56D 5IMMB 1TJHH 4LCIH 5ICXB 3WL9B 4JANB 4X7TA 5LWYL 3OF6A 2E9IA 5DD3H 3EJYC 1KIUA 5L8JB 1JYWA 4JO1L 4NWTL 4AEIH 4X5WA 1Y18A 3CCHA 5E8EA 2HG5A 1DBML 4R2GD 2NY6B 2PYFB 2I27N 3RWDB 1UM6H 2YXFA 4F7EB 5D7LE 1Q9OA 5HYEA 3HPJA 3JV5A 3JXAA 5BO1L 4QRTA 3U2SA 5CCKH 1GZQB 1UENA 3MRHB 4Y4KB 1FNEA 3HPLB 4LVNB 3JBG7 4QRQA 4XT1C 2DI8A 3HPLA 3RVWC 4I9WE 4NCC2 2R9HD 1G6RB 1U9KA 1PZUB 4HT1H 2BVOB 1VACB 3CFCL 4RMWA 3KPLA 3TN0D 2ITCA 2NY0D 3RVXD 1BFOB 1FDLL 4HDIB 3CX5K 4TSAL 2BRRL 2NW3B 5FM5O 3ZSTA 5I1CH 3CDGA 4RFNB 3GMPB 3FB8B 5ACZA 3BH9A 4FQXD 4G6KH 4MB5A 4HQQH 2GJ6E 4HS6B 1H9VA 3CK0H 4XCCL 4PJ7F 2XA8H 3D0VB 2HLAB 2WBKA 5DUPL 1MCIA 1UZ6E 2PO6A 2RJMA 3FFCA 4QRSB 2PO6B 3FFCB 1NGPL 1F5WA 2BNQB 4KJPD 1BF8A 4X6CE 3KLSA 1WCBB 3OG6B 5BQ7A 5A3IC 3LIZL 4L5FH 3K80A 4JGUA 5TJWK 5TGBA 4OGZA 5HPMB 3CFJA 3O3AB 5TGBB 3E2HC 4QHKI 3I75A 3KPOA 3KXFD 3BKJL 4OLYL 3RTQB 5IFAH 1NFDE 1IM9D 1YMHA 5BVJB 5IFJB 3KPNB 3BKYL 3ZE0E 4DZ8A 1BLNB 5E99H 4IOIB 4UIKL 1NBYA 2EDQA 3CUPB 1CK0L 1QA9A 1ETZA 7FABL 2DBLH 4JVWA 4Y4FA 5FYLD 3HR5B 2DTMH 3CFIC 3RBGA 5HHPA 3KLAA 4JN2B 2D7MA 4NZDA 2M8XA 1DVFD 2XXCB 4OJFH 4YWGL 4P3DA 4XTRC 5BCAA 5C0CA 5L2KA 1IAIL 3BIKB 4OAWB 2VXSH 3QULA 1QQDA 4P9ML 2KZWA 3QHZH 1QVOB 3AM8C 2VR4A 2Y06L 4NDMA 5GIRB 4MSWA 7CGTA 3OX8A 4S1QL 1FO0B 4UQ3B 3GSVA 3PWPB 1ED3B 3CSBA 1R3IL 1PVHA 4X9IA 4EXPX 2WQ8A 1MCDA 3TA3A 5J3HC 3V52H 1A9BB 5D96C 2Z4QB 4FQXA 3T04D 4DCQA 4DVBB 4U1SB 4BKLA 1U8HB 3L5XL 3TM6A 5CWSB 3PWPD 1KN2H 2DLHA 4EJ1C 1KSRA 4CNIA 3L3IA 4L3CA 5I8KH 3L7FA 2DN7A 1H8NA 3RWGA 2IWGA 3FB7A 3RWGB 4D2NA 5FFLA 4OCLC 1KB9K 2ZCHH 5E6IA 1IKFL 1QYGH 5FGCE 2VL4A 2OBGA 4WO4A 15C8L 1XF4A 1LP9E 1T3FA 3AMKA 4YBLC 2OJZL 2Z31C 2X4RA 1HCFX 2AEQH 4KI5F 1NFKA 2ERJB 1JWMA 5FOBB 3MV7A 4HGMA 1B6DA 1DBJH 2B39A 2WIMA 1RZKL 3OV6A 4J3VA 1J87A 1OT2A 3LB6C 4NSKB 4S0TD 4KC3B 4R0LB 5ETUA 3O0RL 5E6IC 1ZLWH 4WY7L 3H3BC 3BGFC 1OGTA 3B4NA 2DM2A 2VXTL 3SDXF 2F54D 4NN5C 4QF1A 1G9NC 4M62L 2VR9A 1ZLUK 3LKOA 1WBXB 5TE7H 2JKXA 1JTPA 1YEDB 4JG1L 4LRNL 5LGJB 4EOWL 4PBXA 3OXRB 2FYYB 1R3HA 5FYJU 4HF5H 4G3YH 3B6SA 5GGRA 1D5MA 5IWLA 4WGWB 1AD9A 5AZ2H 5BXFB 1G7QB 4M00A 2D7NA 1CGYA 4FQHA 2UY6A 1A1NB 3CC5A 1JHTB 4W68A 2APBA 3TBYB 5JW4M 1A1NA 1A6VL 1DBKH 3VGAC 2EC9U 1H0DA 1HQ4A 1FL6B 1VESA 1LP9B 5CINH 3TBTB 3GUTB 5IT2L 1WAAE 4ZXBD 2R29L 4Q6YA 1MOEA 3GSNH 3HNVH 5ANME 1ZT4B 3QUYB 3L95A 5E95B 3B9KD 2B4CL 4P5TD 2C3XA 1BFVL 2P8PB 5J6GB 4MJIB 5A2LH 4I5BA 3NIDF 3EFDL 3UDWA 5ENWA 2Q76A 4P5MB 1HKLH 3BAEL 1EGJA 4EN3D 4HWBL 3CVIL 4PJDA 4XNMB 2DMCA 1JYXA 1LO4L 3GSWB 4JKPH 1QSEB 2G5RA 4LCCB 4U6YA 2YPVL 4LNVA 3CXDL 3ZKND 3IFOA 4JQIH 1ZVSA 3BD4A 1VPOH 4G7YL 3IFOB 3IDIA 2Z8RA 3RGVA 1AFVL 3U4BH 1DJSA 1KC5L 5ADPL 5DQ9A 4Y19D 5EZLA 2FATL 5I16A 5HHME 3RAJH 3FQWA 5C0RL 1U3YA 3IXTB 2DQDL 4WUKH 3RJQB 4C83B 4I48A 1P7QB 3RWCA 1OB1A 1QACA 1X7QA 3RWCB 5LQBH 2Y4SA 2IEPA 3PV6A 1HHJB 3MV8B 3BIAX 4WWKC 3C6LC 3T0EE 2FR4B 3IKKA 4KKLD 1G7PB 3LHPH 4AYFA 3ULUL 4YBQC 4HFUH 4CVWA 1YNKH 1MJUH 3LPWA 2Y72A 3N1QC 4WY7H 3F7VB 5IK3B 1E4KC 4NPYA 1ND0B 3RP1A 1ND0A 2JJUA 5HD8D 4X5WB 4C57C 3M1BA 4JY6A 4V1DE 2HTKC 2OMBA 4J8RB 4X6DE 5B21A 1KLUA 2GQHA 3KYMB 3OB8A 5KN5A 3OAZH 3NCBB 3PL6D 2DQGH 4KRLB 4HK0A 5M94B 1F4WL 1D6EA 4PS4L 3BWAB 1GZQA 1G7LB 3MUZ1 4CW1B 1I7ZB 5KAQG 1FNSH 3MV8E 3ZDYF 2CJUL 1N0LA 1RV6X 3C87A 3ZDZF 3FAWA 1DVFA 1F45A 2VLKA 2DQUH 4LOUC 3NAAL 3QXDA 1A6VH 2VZSA 1U3HD 2V9QA 1PY9A 4HKJB 4N0CC 4FQCH 2AV7A 2NZ9D 2PR4L 3FJTA 1J8HD 3DGGA 1W0VB 3QEQB 3WFCL 2DQJH 5DSCA 2D9CA 1NJ9A 1PYWA 5DSCB 5AYUH 1YPZB 5I9QB 4NFBA 1U8NA 5IW6B 2GJ6D 2H2PD 4XVTL 2ZUYA 3V0AC 5EN2B 4JJ5B 3BPLB 5IFHH 1A6PA 4L3EA 4GMSH 2YD4A 4MJ2A 1LGVA 4LK4A 1CDIA 3BP6B 5E9DB 3VFGL 4Z7VA 5DQJA 2CXKA 3VWKB 3ME0A 1TXKA 4KPHL 4QYOA 5T1MA 1IZKA 2UVEA 4JLRA 1F4HA 1EJOL 3ZKXB 3M17A 1BQSA 1JRHI 2DBJA 4OV5B 5T5FH 3JUYA 1MHEA 4I4WB 1J1PH 2BFVH 4GH7B 3TN0A 1I4FA 5B8CA 4OFYA 2QSQA 1I8LA 4XH2A 4O2EA 2DYPA 3ZMRA 3HR5A 3TWCH 4Z7OE 3LKQA 3I6KB 4YDJB 3TZVC 3MA7A 4AG4H 5I75C 4U6VH 1LO3L 1JPST 3MA7B 4EUPB 1BVKA 4KMTH 4PJBB 1SJVA 1VEMA 1HSAB 3S4SB 4DEPB 1D5IL 4UT6H 1CGTA 1MH5B 3IRPX 5DJCA 3WHE0 3GJFH 5EG6C 5FO8B 2IH1B 5D1XA 1YEKH 2IH1A 3IETB 2Y6SC 1J0YA 4X6EA 3ZKQD 3VFOB 1X4ZA 4Q6IC 4DN3H 3P9LA 3HI1B 1KN4L 3LHPL 1A9BA 2NX5A 4GBXC 4QWWC 4FXGB 2GCYB 4NZRH 4YHLH 3QXAA 3SE3A 5DEFA 3IFLL 3IF1A 4HH9B 1U8MB 5K59F 1FFRA 3S35H 5L9DL 5HYFA 3I85A 4MWFB 3SE4A 4C56A 2C3WA 5E5RB 2IH3B 1XR8B 4GRMB 5IJKC 3F7YB 3GSXA 5A40E 1E6OL 1NCUA 1UJ3B 3L5IA 1G7HB 1N64H 2DLTA 1CFBA 4FXKB 2F58H 1AH1A 1FHGA 3VXNA 3VFVA 2AXHA 2ZPKL 2IAMA 2J4WL 1F4YL 1SYVB 3SGEI 1F4WH 4YDKL 9CGTA 1G9NL 3WO4C 2BSSB 3KPSD 2V2XA 4YXHL 2ED8A 5ID0B 1S5IH 5E8NA 3WUWB 4OZHF 4PY7B 4RZCB 3VXOA 1IEHA 3BPCA 4PJXA 2J5LB 4Z78B 2AXFB 3E3QE 3UZEA 3VFPA 1KCSL 4W70A 4OFKA 3VFPB 2XIDA 5FGRA 3PWVB 2DQHH 4AM0A 3LS5H 2CXGA 3CAFA 1JNLL 5CKGA 5GHWH 3I6GA 3MX0A 4YQXL 1F3DH 1F42A 2ID5A 2CRZA 2MOVA 4RAVB 4A6YL 4ZTPH 3LZFH 5I73C 4PLJC 5IFHL 3K2UH 4RGNB 4TUOA 3O4LB 2F19H 1I7TB 2GSIB 1XGTB 3LS4L 4KVCL 4ZS7H 1DLFH 1YDPB 3AY4C 2H2PC 1HQ4B 4EBQH 3W0WB 1ZA6A 1Q1JL 5I6XC 2O5YL 3SQBA 4RIRA 5I8CA 2HN7B 4OZHA 3UJIH 5DYOB 4OF5A 4LLVB 1E4XL 43CAB 5F3BA 1I8LC 4YHYB 4UT7H 5KVGL 4HS3B 4OD1H 1S9VA 3CSYB 5F7NC 3NPSB 2VDKL 5JIKA 3VCLB 2D3VA 2B7DT 3VJ6B 1FE8H 5ACMA 4PJAF 4RQQB 4JZNB 4MX7A 5C0BE 5I1GL 1AGEB 1D5IH 4UT6L 4G8FB 4LKCB 1T1XA 3MLZL 4XX1E 2G60L 3DX7B 4FQ2L 4JRXA 4Y4FD 4KHTL 3O2VL 4JY5H 4EIGB 2NY6C 4LL9A 2MPAL 1OT1A 5T3XL 2ITDA 2NY1C 4IRJD 3AM8A 1I7RB 3GI9H 4NN7C 3TT3H 2EIBA 3NCJH 3QWRA 4FA8A 1RUQH 4I3RH 1KFAL 3KYKH 2XA3A 3MJ8A 5MEQA 5GS3A 4ODWB 4L1DA 5F7DA 1RJLA 3QDME 5JPMA 3RNQA 2V2WA 1S7QB 5JPMB 1U3HC 2O5ZH 3RNQB 1U3HB 1YEFL 1IGIL 4JFOB 1SY6L 1D5BA 3U83A 5DJYB 5JW4Q 3U6RB 2WAHA 4EDXB 2EIZA 2AVGA 1YC8A 4WFGD 5I1LB 5DXWA 4WFGE 1EK3A 5J12B 1JWUA 4XPTL 5BOZG 4X0KA 1GGYA 5C0EA 2VZOA 3PL6C 3RWIA 4ZG1A 5IK3A 1NGWB 2VLKD 4LOUD 5ANMB 1NGWA 1VFBB 1I7UB 2WBJB 4M1GL 1ZAGA 3A67L 3BI9X 3NGBC 2NTFA 4PBWD 3QFJA 5KOVC 2NTFB 2UYLA 3VXUD 4GS7C 5HY9A 1S7TB 3UBXA 4YXKH 3OKLB 1QLFA 4AEHL 4QKXB 3TESA 3JV6B 5DHYA 3HZMB 3PL6A 3MRRB 4XXCA 1BQUA 2WWMC 5JMRA 4AENB 1DDHA 1MJ8H 3FRPG 3PIQA 2VAAA 1XGUB 4LPCA 1RUML 1CBVL 3QCUH 5C0AA 4W4OA 4MAYA 4XWGH 4M4RA 1D9KB 3GBNL 3AREC 4BQBA 4Y16D 4RWYH 3EYUH 4I0PC 3WUZA 4ZS7L 3STLA 5CZKA 5SWZE 5TF1H 4DW2L 5E00A 3C5SB 3WE6A 3EOAA 1FGNL 4Y19B 4LCUA 1VGKA 1KIRA 3EJZC 5JXAL 5F7MC 4KGJA 2VLJA 3D69B 4I0CC 1BQLH 1VHPA 1F11A 3F12A 4JM2B 1NC4B 4EQ2A 2NY0B 3HS0B 4JM2A 4HZLA 2AP2A 3K2MC 2ITCB 4TVSa 1VKXA 1EIBA 1NMCB 4Y7MA 4JJ5A 2LABA 2R2CA 2JIXD 3L9RB 4RAUA 2EZ0D 4Y4HD 1XF3A 1ONQB 3G6AB 3FB8A 1A6UH 3QT2A 4Y4KC 3RY5A 3VWKA 1KIPA 2NR6C 4M7KH 2AK1H 4H5SA 2ZOLA 1RVFL 3D0VA 1ADQA 2EYRA 1TETL 4KI5E 4KY1H 3ARGB 5AG8A 2LV4A 5C0NC 5MERA 4KKCD 4KUCD 1X44A 1H5BC 4N0UB 5E24E 4PJFE 3WLWC 4JO4H 5GISH 1VADB 4G80B 2ZUQB 1YNLL 4K8RL 5CBAB 3CPLB 4PTTB 3FZUC 2X41A 4GW5B 4Z5RA 2Q7YB 4PG2A 4KK6C 5KVMC 4YHOH 4QNPF 5KSAA 4ZUSB 4QRQB 1QA9B 2D7QA 1RZFH 1K8IA 4Z8FL 3OZ9L 1IMHC 3UEZA 1KB5B 5FYLE 5J8OA 1KB5A 4LAJH 1WZ1H 3NN8A 5FKAA 3FT3A 1DUYA 3ES6B 4YK4B 1QRNE 1MRDL 3OJ2C 1INQA 1ZHLB 1NDGB 2FLRT 2ZG3A 3CDGB 2YPLA 4CADB 2Q7NA 1FN4B 3ULUC 4KDTA 4X8XA 4ZFZB 1W8NA 4F80A 3KDMA 3H42L 2GCYA 1JPFA 5DURB 3IGAB 4LSUL 4NKDA 4YR6B 4X80H 4ZO8A 1A14L 1ED3A 2AEIT 1OHQA 5DVMA 1ORQA 1S3KH 5I8EB 1ORQB 2K7PA 5I74B 4XP1L 3HCVA 4PJDF 3NABH 4UZGA 1WCBA 4ODTH 1DLHA 3HMXH 5DUML 3X12A 4F15C 4FTVD 2LAAA 1X5XA 5CWSA 5C3TA 3FCTB 3U4EA 4XCYB 2Q87A 3FCTA 3U4EB 4XXCC 3RPIB 2QTEA 3FMGH 3I50H 4OGXH 4PD4K 3VXNB 1LO2H 1N3NB 1YMHB 1CCZA 5CCKL 4JFDE 2NNAA 3MBEA 1PSKL 5DRZB 3D5OF 4R90L 4PV9A 3WHE1 3FFCE 3TNMA 1RUMH 3DVIA 4UQ2B 4KTEL 5IW3A 4UQ2A 4KKAC 4PJCB 4Y4FB 2QHLA 4BZYA 2XPGA 1I1AB 2QQKH 1Q94A 3CFCH 3OR7B 3P4MB 3U7YL 4K3JL 2VZUA 3GIVA 4IRJB 5DWUL 1C5BH 4BZ2H 2AXFA 4LASL 4CDHA 4QTHB 1T1YA 2VH5H 2FIKB 5C0IA 2E7LA 1FGNH 2NR6D 4QRPE 1MFDL 4RX4D 4AY0A 5HDBE 4X7SL 1OAQL 4R8WH 3HN3A 4OZHE 5IOPA 2ARJB 4KQ3L 3L3KB 1CI5A 2F53E 1X4XA 3CFDB 3RU8H 4YC2C 4I0PB 4PRNA 3BRFA 5IWLC 5CGYD 1MFBH 3QFDA 2VXQH 5DHVB 1D5MB 4NQCB 2V17H 4WEMB 1GOGA 2AW2A 1T1ZA 1DQDL 2BOBA 3L5HA 1MIML 4JFQB 2GITA 1FV1B 3L5WA 4NHCL 1DVFC 1NGXB 4AIZB 4U2ZA 3ZHKA 3PHQB 4J3TA 2YPLE 1EEYA 4X4XB 4F8TA 4YBHA 1CG9A 4I13B 4RMVA 1OD9A 3IDGA 4J2XA 4F9PA 4I77H 4LIQL 1ZT4A 3QUYA 3H9ZA 2H1PH 1RZFL 1EO5A 3CFKB 4Z8FH 4A2LA 4S1QH 3FONA 2X4OA 5JOPE 1FL3A 4JFXB 1KTKE 2FL5A 5LVEA 1RU9H 1UWGH 2BSTB 3WIFA 4WIQA 3VFWB 3D18B 5D1QA 1C1EL 3LEXA 4HFWB 3U46B 2FNBA 4KJYB 5IVXE 3IRZA 3WFBH 1LQSR 5FA4B 2UV3A 1XAUA 4F57L 2XQBH 4OCYH 2EDNA 4ODHL 4DFIA 2X05A 3HNSH 4U1KB 4PRPA 4YDIH 5CP7A 2E27H 1LP9A 3HRZB 2I07A 5TQ0L 4X5LA 4X7EC 3X11A 1I9IL 2QQNH 3MXWL 4OM0H 3N85L 4H20L 3DYPA 1A4KA 2ATPA 4JFYB 1RZKH 4OCSH 3GSRB 5FO7A 5FDWA 5J9PB 1MJJB 3NFNA 4R90H 5I1AA 1Y6MR 2BOCB 4PRIE 3DBXB 2XNAB 2AJZA 2XNAA 3IDMA 4KKBC 4NRYB 1L9MA 2VE6A 2HLFC 2R0ZL 5K9JH 1P7KB 5IB3A 3W2DH 4Z77A 3UBXB 2BVQB 4LLQB 3RPKA 4PJDB 4TSCH 3ULVE 3K1DA 5IESH 5I8OH 1OAUH 1EUTA 1JYVA 4H26A 3LN5A 5M95B 4XMLL 5BRZA 3NCMA 2JIXA 1HQRA 1R5VB 5C7XL 4JFHE 5E8DH 3DVNA 3CDYA 2R39A 3QNZB 1F4AA 4HXAH 4P9HL 5C09D 4NUJB 5CHNB 4RISH 1Q72H 4LNRA 3JTSA 1DANU 3OPZH 3K3QA 3GFUA 5CINL 3ESVF 1E28B 4F9PC 1Z0MA 3L3HA 1KIRB 2UZXB 3CJJA 4OZGA 4XP9H 5I1KH 1JTTA 2ZSVB 2NY2B 5F7LB 3T0EC 1A3LL 4NHCH 1CFNB 3WFHB 5K59E 5IHLB 2WSKA 1JNJA 3DRQB 1RULH 4Z7UE 1U8KA 3FT2B 1G7PA 5FCUL 3GM0A 1U92B 3FO2B 3CLEH 1MI5B 3BH9B 5IKCA 4G7VH 3MPCA 4WDIB 3TJEH 1P1ZB 2WUBH 3CVIH 1JNNH 1IEAA 4Z95H 5GS1A 2NY4D 3JWOH 4RFNC 3ALPA 2XWTB 4V2CB 2XYCA 1RHFA 5DJ6A 4LCYB 3WNKA 1S7VB 4W4NA 5DJ6B 2AJUH 3BP6A 3QIWD 2ZG2A 3CFJB 4O5LL 3VRJA 3UAJC 4XC1L 4PJ9D 4GMTH 4UIMA 2OTPA 1XH3B 3U2SB 3A6CH 1JGEA 5KSAB 1FLTX 3TBVA 1F6AA 4KJWD 4IOSD 5EORH 3VFMA 3N9GH 4L3ED 4L4VA 4FRWA 5IP4A 3LKQB 5IEKA 1X5HA 1QBMH 3NFSL 5HYQA 2ARJQ 2RGSA 2D7TH 2E27L 4Q6IB 1F4XH 1FGVH 2YOCA 3O41A 4NQCD 1FNGB 1VCAA 1FG2B 3VRIB 2H26A 4XAKD 4UI2A 1P6FA 1MH5A 3MV7E 4ZFZA 3PXHA 2R1WB 2RQ8A 1BWWA 3C5ZA 3O6KL 1RMFL 2FJFB 3BE1L 5E5UB 2BHYA 2HVKA 2X1PA 1ES0B 4GBXA 2AABH 2D4DA 3PDOA 5GJTH 4LSRH 4O4YL 5F1NA 1ITBB 2XFXA 5FGCB 5IEHB 1X6NA 5MEND 2UWEA 2YN5A 4CVZA 5JIIA 3IAQA 1V5JA 5K9JL 3RJDA 4HAFA 5EU3A 4G8GA 5SV3A 4G8GB 1B0RB 4DN4L 2F74B 3AVEA 4U6XB 1CLOL 3MRKA 1TZHA 2XKNB 4GRMA 1S7WB 2OL3L 3OGCA 5SX5H 4TQEL 2E6PA 1TQBC 5C7XH 1Q0XL 3BZ4A 3KPRD 4HXAL 4PJ5D 3I6KA 4YDJA 5HHMB 1V7MH 3DRTB 2VLRB 1CFTA 4AQ1B 3O4OC 1BMGA 5D72H 2IAMB 1T7YA 2ZNWA 5T1KD 1BVKB 1FIGL 4HIJB 2NY4C 2XRAH 5LJYH 3CMOL 4J6RL 2GUOB 5KS9F 2GUOA 4YDVA 1C8PA 2EDBA 5BV7C 4XNYL 4XVTH 4ZS6C 4HUNB 2X1WL 1CD0A 4GBXD 3ARDD 1OP3K 1OVZA 4OSUL 3SKMA 1HKLL 2GJZA 1XZ0B 1P4LB 1RULL 4Y2OA 3HUJA 3MC0A 3I6LE 5HHOD 3IDXL 1XFPA 1FFOA 4L8BA 4OZIE 2X2YA 4NQCA 4HG4K 1CDGA 1CDCA 1ZTXH 3TPUA 1KT2A 2X4SA 3A6BL 4JDTL 3O6MH 4MWFA 3JWOL 3EHBC 5MP6H 1DQTA 3U4BL 3D1MC 4J23A 1FV1A 3QFJE 3X14B 3FL7A 3T3PE 3AY4A 2FATH 3RNKB 4KXZH 3THMH 3UYPA 4OZ4B 2BC4A 1G84A 3D3VB 4WUKL 1NAML 5KS9A 4HAGA 4RNRB 3ZE1E 3G5YB 3ET9F 4GG6F 2Z93A 4K7PX 4DKFH 3LKSB 4F7CB 5JZ7D 2OR9L 1HILA 5C86A 2CR6A 1INEL 4EUPG 1JWSA 3P11L 1A21A 1ZHNB 4I5BB 2IADB 2Z35B 3IXAA 5KVFL 2IGFH 3CU1A 2I5YL 2IF7A 1FZKB 3F6LA 1FGVL 4XNUL 3WIFB 4JZNA 4MX7B 3O6FA 3EYQD 4ONGH 5FA3A 5ILTH 3D0LB 1HHIB 2QR0B 3WLWD 2F5AL 1EMTL 1CXKA 1PG7W 1U6AL 5F7UA 1AC0A 2JJSA 3TA3C 1R3JB 2XQYK 4HWZA 3N1FC 3DTXA 2FECL 4BQ9A 4CN6A 3X3FH 5D7SH 4WWKD 4LLDB 1E6OH 4PJBE 3PXJA 3L6FA 1T22B 3AS0A 3BH8A 2NXYB 5EU6D 5EOQH 5IMOA 3ZKXC 5FM8A 2R8SL 1N5YL 3BKMH 4XMKH 2ED7A 2NZ9C 5IMLB 2CDGA 2VDRL 5FO7B 3RKPA 3S9DB 4O02L 2VNCA 4LVHB 5I1AB 2NY0C 3RVXC 2CLZA 3BP4A 3ARED 4NM8L 4Y8AA 4MXWH 5CJ5A 3CSYA 4QY8B 4DEPC 2HTKD 1NL0H 4H0HB 3VWJD 2AS5M 2VE6B 4KRPD 1C16A 5HGDB 2P8LB 1LK2A 4JEGB 5F97E 3ARXA 2DIAA 5DRNA 4HPOL 4JPKL 3RWIB 3CH1B 2GFBB 1J1XL 1NLBH 1HDMA 1NH6A 1U8PB 4M1DH 3QDMB 1HDMB 3VWJC 1OQXA 4JRXB 3GJEA 1F6LL 4R9HA 1FVEB 3LZFL 1A47A 1FFNB 1R5WA 4JKLA 4X83A 5I71B 2A77H 4PRPE 1IC1A 3SGKA 3EJYD 2EXWD 4X7DC 3IDXH 2MQCA 3DX8B 4PG2C 1NBVH 1D6VH 3U9PL 2WWKT 5GQBA 5TH2A 3A6BH 4JDTH 2VLKB 1CDJA 3DXAB 5MP6L 3VFRA 5EBWB 3VDBA 1HN1A 3C2AH 5HDQH 1FNFA 1MY5A 1CFNA 3WFHA 3T4AB 3SGEH 1HHHA 1N2RA 4PV8B 5EIVA 1FVCB 3ZKNC 5DJ2A 1JGLH 1HOCA 3TVMC 2VISA 1QFWI 1NC4A 5ALCH 5BRZE 1YN6A 3TA3D 1DBBH 1Y0LA 1MLCB 1NANH 2IG2L 4J8RA 1WSST 3P11H 3WXVH 5LG1A 1AKJB 1KB5H 1KV3A 3P4OB 2MPAH 5T3XH 3E8UH 5DT1H 5JDSB 3T3ME 1BFTA 4JRYE 3V4PL 1P4BL 2BY1A 4G8GD 1U42A 1H3VA 3K4AA 5MEOB 2NPLX 3QUZC 1YYMH 4XB7A 4DK3A 2VAAB 3BZDA 4UAOB 4Q9RH 4TVPL 5F3HB 3IFPA 2OXGA 5F3HA 1CS6A 3FQRB 4M6MH 3ZL4L 1T4KA 3HPJB 5FYKE 3LCYA 5HHOB 4LLMB 4CN4A 2I9TA 1ACZA 3STLB 1LILA 1MFAL 1RIVL 3MO1B 1YEFH 1AD0A 3LV3A 4HHAB 1I85C 3EHBD 3EKCA 4F37F 1NEUA 4YXHH 3MJ6A 2R1XB 4I9WD 4P59H 3SDXA 5AD0A 1IM9A 4ZO7A 3TYFA 5EOQL 4GQ9H 3DROB 1G6RA 1U8OB 4NJ9H 2GIYA 5JMOC 2EE2A 1IC7H 1RIHL 5FKAB 3DETD 3HS0A 1W72H 3EO0A 1FRGH 1B2WH 4K9EC 2NXZB 1S7XA 5D7IE 3HZYA 2FIRT 2X09A 4EN3B 1ONQA 3FO9A 3KDMB 4LQ1A 3CXHJ 4JDVA 5DI8A 3IF1B 5D2LF 4KAQL 4JDVB 1GRWA 5DI8B 1NSNL 4K94H 4YXLH 3EYQC 4Y5XC 1ODAA 1NANI 2BCKA 2DLFL 1QPPA 2X9YA 1E4KA 2P47B 5GRYA 4Z76B 2BNQA 1J1XH 2NW2B 5F9WC 1G9ML 2NW2A 4NM4H 5FUZH 1YECH 4IMLA 4YHYC 1OSZA 3P30L 2GTZB 4MNQA 2JCCE 2AI0H 1VADA 4G80A 3BZ4B 3KPRE 3JZ7A 4PJ5E 2WNGA 5DVLA 4ZUUA 1J05A 2CLVB 2XZQH 1NBZA 1NQBA 3MLXL 4DW2H 1T5WA 5H35B 1J1OH 3HE6B 4LPVA 3V5DB 4P5KA 3HMXA 1HE7A 4NBZB 5KVGH 5HHPB 3JWDC 3KPQB 4TOYL 3WN5A 5KJRH 3PGDA 2XG4A 2KH2B 5DDHA 4N90E 4NOFA 1QQDB 1FE8L 1OARH 3D87B 3IFNL 4GXVH 4UDTB 4NQUA 2VKXA 2Q3ZA 4KUCF 1BEYL 5KS9E 3OHXB 4NJAH 1SVZA 5ESQA 4A6YA 5JXEC 2FEEL 1RFDL 4MVBC 4KY1L 3QNXB 3SE4C 3BESR 4WWKA 3MRLB 1DP0A 5CD3A 2P48B 4P57A 4Z7UB 5BS0E 4FN0A 1FORH 3O3EB 3BX7C 5JDJA 1RUQL 4FXKA 4I3RL 5JIHA 1OTSD 1KNOB 5D9SA 2E3VA 3FHQA 4N68A 4QHUA 3ARZA 3KWWB 43CAA 4CGTA 12E8H 1F90L 4ZPTB 2O5ZL 4RA0C 2SEBA 3LKSA 4F7CA 4ZPTA 1EPFA 4QT5A 1CL7I 5INCB 3LEYH 5HYJB 1KF9B 2XPGB 3AREB 4QOKE 4HCRL 2IBBA 3P0GB 1ZHNA 3HI5H 3SCMA 1S9WB 4J7RA 1ZWIA 4J12A 5DZNA 4QTIH 3VXPB 5DD3L 1X5AA 3BZFB 3ISWA 3RWHB 5TF0A 1KBGL 1U91B 3ZTNH 1IGTA 3HC3H 5BJTB 4I2XE 4KQ4L 2VZ3A 4D3CL 4U6HA 2EZ0C 1JPSH 2CO7B 3IJHB 4GW4B 1QSED 3WKML 5JOPD 1M71B 3MREA 3PUCA 4E41B 3Q1SH 4Q9QL 4M5YH 3KR3H 5D5ME 1QKZL 1EFXA 4YXKL 1BZ9A 1EFXB 2VSCA 4F7MB 3S96B 5JUEH 1ZLWK 4Y2DA 3WIHA 3UTTE 1LNUA 5CIPA 4WW2A 4KMQA 3HFMH 4LLUB 4YXLL 5EOCJ 4LLUA 3DVGB 3QUML 3UTZB 1N5AB 4D0BA 3STZB 3U0TA 4TSBL 2F8XC 1CGWA 1GHFH 1MCPL 1S7QA 4OD2B 3UTOA 5EZJA 4P0DA 1CE6B 1VA9A 5DQDH 2VZ1A 4LARL 1FZJA 4P2QE 5D2NE 4K3JH 4TVPE 5BMFL 3NCFB 4G6KL 1EH9A 1K8DB 5I1IH 3DGCR 3SDAA 5DUPH 1II4E 3HI6H 4NO3A 4X6CB 3UAJD 1NGPH 1MLBB 3CH1A 4X7SH 1I7UA 5J4MA 5F9OL 1U8PA 3SDDA 3HG1E 3LIZH 4L5FL 3OKNA 3HG1D 1CD8A 2H3NB 1ZV5A 4TN9A 5T1LB 3OKLA 1U8JA 3LRHA 4R4BA 3QH3A 2VB5A 2DQFB 2YWZA 3LN5B 4WCYL 2YKLH 1FL5B 3FN9A 5GRWA 4F9LC 4RFOH 1UGNA 4H1LB 5GRUL 3DX6B 2UWEE 1HI6A 3WUWG 4Z6AT 1JK8A 5KSBB 3F5WA 4U1KA 1BD2A 1WICA 2BSRA 4IMKC 4XP6H 5JHDB 1KTDB 2H6PB 4BYHA 3QHZL 2CDEB 1CXEA 3MRGB 5ADOL 1OB1B 5GGSY 4EDWH 3QIBD 1WVZA 3K4ZA 5FDWB 5J9PA 5FDYA 2NY1D 4IRJC 5ESVB 3C8HA 3S98A 2RB8A 1CZ8L 4Y4FC 2OP4L 5HVWA 1KXVC 3MOQA 1K9TA 4PBVC 1RK1B 3H42H 1N8ZA 3WL9A 4OBSA 5LGHL 1KN2L 4OIBA 3D39B 4FXLA 4KMLB 4LSTL 3S88L 3O8XB 3F7VA 4XP4L 2Y1VA 3VDAA 4Y1AD 4L9LA 1C1EH 5C0GA 5MEOA 3M1BB 1WC7A 2JB6A 2X4NA 3S3SA 1NC2A 3O4LD 1UZ6F 5GGVH 2C4XA 4PJXE 1K5NA 1KJMB 1LD9A 1NCBH 2HH0L 4M3KB 3LQAL 3GMRA 1LO2L 3PP3H 1M6OB 3PG2A 5IB4A 2A74A 4QRTB 5D6DA 1PSKH 4C4KT 3OKEA 2A74B 4ORGA 2F8VA 3CIQA 1B90A 1QSFA 3OXSB 3VG0H 5HVFB 3OXSA 1JGDB 3T2QA 1OAZH 3TT1H 4MXQD 3U7WH 3T1FA 3EFFA 4NHUB 3GKWL 5TE7L 5TDOB 3QI9C 2QLVB 3UTPE 5TDOA 5T33L 2W1NA 2VH5L 4U1GC 3G5XA 1U92A 1OAXL 2XN9E 2F5BL 2A2QT 3FT4A 4BH8A 4I1NB 4ETQB 5KSAD 2AK4E 5I1IL 3O9WB 1MIEH 3ALXA 3OG4B 4KK5C 1OP5H 3PWJB 1NCTA 2W9DL 4L3EB 4WEBH 2HVKB 4HIXH 4HEPG 4W6WB 4NC1C 3RIAF 1M7DB 1MCOH 4AQOA 5E7BA 1MCWW 1QLRB 3GJFA 3LQZB 2BNRB 3MRBA 1WV7T 3V9FA 3V6BR 4MJ5A 1B0RA 4POUB 4KROD 3PDGA 1EHLH 3GMNB 4QHKJ 5IFJA 4BUHA 3KPNA 8FABA 4Q9BA 4RGMC 3DMMC 5C6TL 1B9ZA 1BFVH 2LTQB 4O2EB 1HH6A 3KLAB 4JN2A 2FB4L 3GMOB 4L4VB 4ZD3H 1TITA 2FDBP 1CE1L 1XGPA 5C0CB 1KLGB 5L2KB 2Y7QA 3VE0B 3WBDA 4LP5A 2X70A 5D7IA 1AHWC 5LAXB 4DZBB 1RZIA 2WIIB 1ZHLA 1CWVA 3UJTH 3MGTB 4GW1A 3SKJL 4HUUA 4TNVF 5CJQL 1U95B 4GAGL 4NQVB 2R2BA 3H2WA 3VRIA 1CU4L 3DI2B 1WZMA 1XF2B 3PWPA 5HXMA 1FO0A 4X98A 3RA7L 1XGQA 5J56B 1P2CB 3HTLX 4NFCA 5EZIH 1UZ8A 4MDIB 4J3WA 4AL8H 1PZ5A 4JHWL 1PZ5B 1V3LA 5EH1A 3VRLE 1DLHB 2YUWA 1U8HA 3S34L 1SM3H 5H2BB 4DTGL 4XCYA 2BVPB 3KJ4C 5EU5A 3QCTH 4HW6A 1T20A 4LSTH 3S88H 1BJ8A 1MRFH 1U8IA 3A6CL 3QUZB 1EVTC 5LQBL 1AXTL 4WTXA 3WLBB 3TVMA 4PJAE 3GSXB 4HC1H 3FB7B 4ODHH 4R0LC 1WGOA 1K3ZA 4FABH 4RGND 5JOFB 4WUUB 3GB7B 4Z7WE 3ULUH 1XF4B 5HGHA 4YUEL 4F7PB 4OM0L 1QBML 5C0FA 3VFNB 2W91A 3QUZD 3MV7B 4YHNA 3VGDA 3KPPB 2PUQT 4R0LA 3VXPA 3QIBA 4KJQD 3ZYOA 4ZMAT 1OGTB 1EZVX 1NC4D 4WI8A 1IGTB 1R3LB 2Z31D 1R3LA 4QF1B 1PLGH 3OQ3B 5F7YC 4Z0BL 3SKMB 2QQQA 2GT9A 1FDLH 3AU1A 1AGFA 2H9GA 2CKBA 4I0PA 1BZ7B 4LSRL 4O4YH 4PRNB 5IESL 3S96A 2FYYA 4JAMB 4HJ0C 3ZKMD 3DMMA 1K3IA 1ZVHA 1IEBA 3QISA 5C08E 1VFUA 4Y4HC 2YSSB 4ONFL 3TCXA 2E8ZA 2PXYA 3NAAH 2BP3A 5C71A 3QRGH 5T3ZH 1MFEH 2IANE 5HHVL 3KGRA 2AGJL 3EUUA 4I0PD 3HG1A 5J13B 2UZIH 1ORSB 1NGXA 3HLAA 1CE6A 3W82A 2MKLC 4K9EL 4ZXBB 3MRMB 2PW1A 1F58L 4PUBL 5HD8C 3RVWD 4WW1B 3BP7A 2P5WD 3ZT5A 2J12B 1MI5D 2ADGB 2J8UB 4XP9L 1MI5E 2FX7L 5DYOA 2XRAL 5DJ0B 3QEUB 1ZT1A 5HPOA 5C6TH 3QO0B 2DWDA 3OAUH 3FONB 3VWJB 1EGJL 4HUMB 2Q76B 1N6UA 4OSUH 4GAJL 3MLTA 4ZOEA 1T83C 2PYED 1TVDA 4FFVD 3LRGA 4W81A 3QXUA 2R4SL 3TVMD 1L9NA 3BIBX 1CFQB 4U6YB 2OTWB 3RZCC 4YBQD 4MCZB 2C3VA 4WU7A 4Y4KD 3V7AE 3GJEB 5D93B 5A3ID 3RGVB 2X4PA 5DJXB 4FFZH 4FTVB 2OTUA 4ODXB 5CHNA 2H8PB 2EDYA 4DOHB 3UJJL 2KDGA 4U49A 4HZAA 3DPBA 3QIBC 2OM5A 1U8QA 2QQLL 3EJZD 5MEQB 1UXWA 1IC5L 5IGXH 3BWUC 3F6IA 4ONHA 4N8CH 4BELD 2H41A 2D7TL 2G2RB 4YGVA 1D5BB 4NQDE 2E6QA 2CLRB 1MREH 4K3EL 3TGXA 4XPGL 2PTTB 4NRYA 1A64A 4K3GA 3IFLH 4EEEA 2VISB 2VRAA 1TCRB 4ZUWA 3KVQA 5C0EB 5L9DH 5IJVA 1PGRB 1FNAA 1I3GH 2VLKE 5J11C 1T0MB 1T0MA 4WTZA 4EQ3A 1KCLA 2Q8AL 1FBIL 2YMXH 3QIUD 1BF2A 4RGNC 2F58L 2Z8SA 4F7EA 3T77A 5DMKA 4XMPL 4JCLA 3C60A 3EDJA 5GGSA 4RMUA 4YDKH 3RX8A 3W81A 3NGBB 2FD6H 4IDLA 5C0AB 3GO1H 1ZHBA 1MAMH 1UEMA 4L3EE 1YMME 3QXDB 3N1GC 3QRGL 1MWAH 4GKSA 1MF2L 1OTTC 5EO9B 4NKOA 1DBKL 5F1OB 5HHOA 4X6CF 3V79C 2ORBH 3C5ZC 1R0AL 3WE6B 3GIZH 4MA8H 1W0VA 2DF3A 3LV3B 2BZDA 4HHAA 4P4RA 5FF6B 3WJJC 1VGKB 2BDNL 4P4RB 4L4TB 2CGRL 2V9RA 2JLLA 4FG6D 2VIRB 3O6LH 4LEXH 4K9EH 2YBRB 4L4TA 2ZUWA 5I19H 3JWNC 1U2HA 3U9UA 3FT4B 3C8KB 4Y2DC 1A7QL 5FGSA 3EOTH 3O2DH 1J0ZA 4NGHL 2JE8A 2F19L 4G9FB 2DYPD 3QG6B 4NT6A 3ZDXF 3LS4H 4KVCH 3HZYB 4NN5B 4WEUD 4Z7VB 4XX1G 4EBQL 4ZS6D 4KKAD 4WI2A 4HV8A 5IBTH 4U1IA 5KSUA 2VJXA 5DMJB 4NWUL 1XR9B 3BN3B 1FG9C 2DKSA 4ODSH 2EYSB 1WEJH 4MAYC 3FRUB 3REVB 1WZKA 4AH2A 1VFAB 4PJ8B 5GRVK 1A2YB 2NY3B 2F74A 4G6ML 1VFAA 1IKNA 4U1GB 2G9HB 5ALBH 1IQWH 1BQHA 4L8DB 5CSZA 1NBYB 4P2OD 3QI9B 3THML 1WBZB 4N0UA 4Z7VF 4JQIL 3KPTA 1WBZA 5IB2A 3KPMB 1MCKA 2XI9A 1XMWA 3E6HB 1AFVH 2VLRA 1KG0A 5FYKD 2NX5E 4GW5A 4C59B 1RZ8A 1OAKL 1J05B 3G6DL 2Y7QB 2P1YA 4Q6IA 1AD0B 4LBEA 3RDTB 4OAWA 1P84K 3SDXB 5AD0B 5I1GH 3DI3B 3ROOB 1I9JH 4HSQA 2NY7L 5GS0H 1KLFA 3NN8B 1F2XK 2YA0A 4RGOL 3G9VA 4UQ3A 1INEH 4FFWC 1ROWA 3I2CL 1CFVL 1KPVA 3GRWA 4PJCE 2BHUA 4WENB 4LEOA 5M7QA 3MCKA 3TIDA 4OFVA 4Z7WA 1MREL 3PDOB 25C8L 4JO3H 5I74C 2YEZA 5IEHA 2VQ1B 3TT3L 4U1SA 5CEYA 1LDPL 2R9HC 4HKXA 2P5WB 3H9HB 2F5AH 3OHXA 2EDRA 1NCDH 3EYFA 2D0FA 1NAKH 3E8UL 4MMXC 4WRLA 4ZFOA 4ELMA 1UH2A 3SDAD 3PV7A 3C8DA 3BQUA 2IH3A 5D7SL 3S5LA 3AROA 4PJ9C 3DVFA 4ISVB 4NZUL 5FKPB 5GS2H 2VZVA 3PP4L 4MNQB 5IB1B 4JO2L 4KKCC 3FOMA 2DQGL 4RNRA 5GRJL 1J0JA 5F96H 1PG7X 5DRZA 4PS4H 4KK5D 1IFHH 4P59L 4U0QB 4JCMA 3MR9A 2CJUH 1AI1L 2GYSA 3BJLA 1XIWA 4XC3H 4U1JA 1SEQH 2WWKO 4FQXC 4PGCA 1Q94B 2AKRB 4WV1A 1AQKH 4Z7WF 3KPQA 3DURB 4G6JL 1M05B 4MJ4A 1UA6H 1W72L 2Z35A 3IXAB 1Z3GH 3GHBH 4CMMA 4AM0B 2X89D 4B7IA 2BDNH 4HPOH 3ARGC 4JPKH 3IAGC 1GVIA 3VI4F 5ISZE 5I19L 1R3HB 3BHBA 1JMXA 4M1DL 1CBVH 3L3KA 1Y6NR 2DLFH 3RIAK 4QCIB 2P45B 4N0UE 1DQQA 2W65B 4POZD 3MLVL 1SVCP 3ARYA 1V05A 1SJHB 1YDPA 1HXMA 4OZ4A 3VFGH 1FLRL 1ORSA 4OFDA 3I3DA 4LVNC 5KW9L 4KJWC 2CMRL 3NH7H 1NFIB 2FJGA 3TLRA 2M2DA 3MV11 3CVHL 1IJ9A 5ALBL 3ZHDA 1MHPL 1D5ZB 1IGYA 3MLWH 1MJ7H 3MACL 4O58L 5JW5A 4Y4HB 4CRPA 2DQCL 3HKFA 1HHKB 3PQYB 3ZE0F 3AREA 1UCTA 4KKBD 4AG4L 5T1DH 3W0WE 3W0WD 4RMTA 1KULA 1AKJD 4HC1A 1TQCC 2YA1A 4LAQL 4NNYB 1UKQA 3VXME 3TEUA 1K85A 4JFEE 4DUXA 5EUOE 4OM1L 4UINH 3DSNA 1I9JL 2AV1A 2B2XH 1EEZA 3WHXA 5F1IA 2A6JA 3H0TB 1EEZB 3WHXB 4MMZC 3UYRL 2D4FA 5A2FA 5ITBH 1S8DB 1QZ1A 5SWQA 3RBSA 3GGWA 4JFPB 1U8JB 5HVHC 2EDWA 5D1QB 1KN4H 4FHBD 4JO3L 5DQ9B 1I7RA 3C08H 4DGVH 1JV5A 4PB9L 5EB9A 3F62A 2FLBT 3VWKC 4J3SA 4IS6A 2B0SH 2ZUUA 3KPSB 3QUMB 5F89B 5I18H 2UZYB 1QNZL 3MJ8B 5FHAH 3GBMH 2AERT 4YE4H 1SBSL 3VGFA 2C3HA 2G75A 3QSKB 3T4YA 4HUXA 2OS7A 2I07B 5FIEA 2YK1H 4F3FB 1L0XA 2VDOL 3QWQB 2YD5A 4JDZB 3BO8B 2EIZB 1OM3L 5JO5B 2VYRE 1GOHA 1V3JA 4MCYB 2ZP0T 5TE6H 3FB5A 4KK8D 1HYSD 3N50A 1JWUB 4MNGB 3HC3L 1B2WL 4YBLB 5IIEA 1YN6B 3UCRA 3DHMA 1MLCA 3FN0L 4DKEH 4ZUVB 1KEMH 2Y23A 4WFHD 2E9JA 4U1MA 2W60B 4KAQH 2C4FU 2CDFB 1P9MC 3RKDD 4NP4H 3T77B 5FB8B 2WW8A 3VFSA 4EUPH 2DB8A 5I71C 5JUEL 3T3MF 1N7ML 1N0XH 3L3OA 4KTEH 5EC1A 4O9HL 3LPFA 4IIQA 2UUDK 3QUMH 3FQRA 5C09E 1AY1H 2R69H 3DV4A 5I1EL 1XCTB 4X9FA 1PY4A 4PLJD 3D3VD 5IB4B 1DLFL 1I9RH 3HUJE 1E28A 3D3VE 4OQTA 1TDQA 4R7DA 1RI8A 3Q6GH 3V7AG 5CUSH 5IW1A 3MRGA 3ORJA 4HULB 1VACA 3U82B 5C0DA 2V7HB 1ULVA 1TFHA 1WAAF 3ZTJH 3QO1B 5MEPA 4UT7L 2P5EB 5F9OH 4GG6B 4HWEH 2WV3A 3MRCB 5DJZA 5AWNL 1MUJA 2VXQL 2XN9D 4FZ8L 4PLKC 4ETQA 1KTRL 1S5HB 2HJLA 3A6OA 4OI9A 3FQNA 4GLRH 1XF5B 1KCUH 4PP1C 2EYRB 4Y1AE 3IDUA 4EN3C 4LSDA 2CRYA 3KJ6H 5I1HH 4WFFD 2H32B 1NPUA 2JB6B 3OKDA 4FQ2H 4XRCA 5K9QG 3O4LE 5DUBB 5BOPA 3QPXH 1NGYA 3M45A 1MAKA 3PGFL 4KHTH 2W92A 2X4QB 3UC0H 3W9DA 3P9WB 4CBPA 1J8KA 1EA9C 2OL3A 4LPXA 5JZ7C 5L8LB 5EBMA 4XPBH 2WMPA 3SDCB 1T5WB 5H35A 2RAMA 1GGCH 4LGSB 1F6AB 4Q7DA 1AXSB 5GXBB 3JWDH 1IM9B 4Q74A 3MNVA 4DQOL 1KFAH 2WBWB 1BFSA 5BZDA 4P23A 4NQSB 5AG9A 3EGSB 3B9KB 4JFFB 1JP5A 2R15A 4HCRH 2PW2A 3T65A 2WBJD 3SGDH 2VQUA 4LVHC 4LDOB 5DO2C 2GK2A 4GT7A 5HI5C 1CZ8H 1RU9L 5IQ9A 4PG9B 4PR5B 2A73A 4RA3A 4PLOB 4YZFF 4QRRE 1CGXA 1EFXD 1TJHL 2H26B 4LCIL 4X9BA 1C12B 5T1KB 4FXGA 4U05A 2OX5A 3QEGL 3TNNA 4QXGH 3GSVB 4Q0XL 3VFUB 4NNXB 1DL7L 4EI5A 3AUVA 4MD5A 1PW3A 1L0QA 2IANB 2J6EL 3DXAE 4YHPA 1I9EA 1XEDA 4GRWF 4GBXB 4GKOA 2VOTA 4GRWE 3VA6A 5GZOD 3BQUB 2Z4QA 1UB5B 4M1GH 4K94C 4HMEA 5CD3B 1UJ3A 1I9IH 3OKOB 1C7SA 3V4UL 1OW0A 4I3SH 3ROLB 2ESVD 3N85H 3SJVB 4G8EA 2EDOA 2VDML 2W0FB 3OF6D 2BXYA 4UOW1 1MJ8L 5HYIA 3D2UD 4OQTH 1CDUA 3B2VH 3C9NB 3H6JA 3L3JB 3C9NA 3F65A 5E4EC 4G6AD 2MCG1 4LARH 1I1AA 1JWMB 2Y5EA 3MJ9L 1KLGA 2WK2A 3D85A 5C0BA 2CSPA 2XWBA 1QFUL 4LSVL 1PBYA 4KGLA 5EO1A 2L0DA 3RWHA 3V5KB 1QR1A 4D8PB 5C2UB 1MPAL 1X6LA 5B4MC 4BFIA 3VW3H 1AGDA 5D6CB 2VLJD 5HYJE 4H25A 4GW4A 4YHMH 1QSEE 3RUGA 2EICA 2IPUK 2F53D 4TNVK 4QCIA 5HI4D 1ACYH 4PLNC 5GGQL 4KI1A 4O2CA 1LE5B 4RISL 2DIBA 4DCQB 1DR9A 2P24B 4OBRA 3K7UA 1LNUB 4XPAH 4FZ8H 1U3ZA 4XBPA 5TFSL 4DAGL 5FAAA 4NN6C 1IC4H 1EHLL 1TIUA 1NFIA 2FJGB 5CJ8A 3CC5B 5INDA 5EBLB 1G0YR 4K3HA 1FL6A 4JM2F 3QPXL 3SN6N 1RK0B 3PHQA 1WWAX 5DMYA 1UCBH 3MNWA 1M7XA 1TLKA 5ADOH 4MNQD 2VWEC 1S9WA 4EDWL 1EDQA 2YWYA 1AXIB 3SCMC 2E8YA 1AO7B 3BZFA 4GAGH 2KKQA 4ONOA 4Z18A 4OCMC 3QUXC 1FYTA 1UFUA 1QOKA 4WI7A 2EYTA 2EIDA 4OGAD 4RAHA 1D3CA 2VLME 1ZLUH 5ACLA 3LKOB 4JKMA 4KJPC 4E5XA 3NBNA 3QB7C 5D7JA 4JHWH 4GMTL 1P6AB 1IQDB 3QXVA 4NQTA 1YEEH 4ZYKA 3HE6D 5LGJA 3OKMB 1HNFA 4LDEB 4OLUL 4R4BB 4JO1H 3L5XH 1AP2A 4NWTH 4AEIL 2QR0A 2GAZB 4DGYL 43C9A 4TRPH 1AD9B 5GRXG 5I17A 3DUSA 1FIEA 1DL7H 5DFWH 4X80L 2C26A 1IM3B 2VC2L 3QG7L 3UX9B 2HFGH 1LMKA 1RJLB 3IDJA 5E8PB 5IMKA 4HC1L 1A7PH 1J8HA 4ENEC 5JA8B 2ZCHL 5EZJB 4U6TA 4F33B 3KPRA 4PJ5A 3L6FB 1CLZH 1F4XL 1U3HA 2XN9B 2D7PA 3V4UH 1FZJB 1BBDH 3FMGL 2QHRL 3VGEA 3AS3A 1A7NH 4IJ3C 2APTA 4P46C 1J88A 2EO9A 5A16A 2A9NH 4U1HB 4XBEL 3IVKB 4ZO9A 2G2RA 4BUGA 4OZGF 1AR2A 1LO5A 3MODH 3X13A 4YIQB 4LPTA 3O6FC 4NNPH 4H1LG 4PRBB 1OAXH 5BW7C 4P5MA 2ICEA 1P7KA 5D70H 3ARFA 3BPNC 5DA0B 3O8XA 4LSVH 5GPRA 1CD9B 2W9DH 4G43B 4S2SA 5DD6A 4G43A 4HF5L 5TPWL 2GK0B 1RUPH 3IS0X 1Q8MA 5D6DC 1H3PL 2HLFD 1VERA 4HBCL 2P8MA 2EIEA 3H3KA 2BVTA 2Y5TA 4JREB 5EC1B 1UWXH 5F7EL 5FYKU 4HPYL 1OTUC 3BOVA 1M6OA 4ERSH 4CDGC 4EVNB 3SO5A 3ZYJA 1U8QB 2DWEA 5DRWA 4BZ1L 3QDGA 3RIFK 5TFSH 2WZPD 4DAGH 1F11B 2HJKB 3F12B 3JV4B 5CEZD 4OJFL 4OZIF 1RY7B 4TUJA 1HH9A 4HZLB 4XZUB 2WUCL 5B3JF 2FR4A 4MD0A 4YGVB 3RUGF 3DUUA 3CZFB 2NYYC 1QLEH 5ECJE 3VI3E 4M7JH 3GMPA 1SYSB 3RTQD 1RUAL 3UXFA 1ZSDA 2RR3A 3GHEL 4WDIA 1WCQA 4OCWL 4R4FH 1P69B 2DL2A 4WVRA 3MBED 2AEWA 1BM3L 4M9PA 3W11C 3WDHA 5GS1B 4CJ1A 3RWFB 2PCPB 2BJML 4S11A 3QG6A 4NT6B 1UACH 4NKIH 3CXDH 4V1DD 4EXKA 5CD5D 3VRJB 5DQJB 1KJMA 4S0SD 4RSVA 1T2JA 1NAMH 3REVA 2Y9RT 1BAFL 4BFEA 1CYGA 1OF2B 2N1KA 4P46A 4XCFL 4OV5A 1JGEB 1BLNA 2G9HA 3EJJX 1XGRB 4F2MB 2BMKB 5MHSE 5MHSD 1X5KA 2Y36H 4G9FD 2X40A 4G9FE 2DJUA 1HXYA 1YMMD 2NY5L 1I1FB 4PJAB 4WJ5B 4F57H 1KJ3L 5HHXL 4PJAA 4YEFA 4HDIA 2I5YH 5LAXA 4DZBA 2W0KA 3RVUC 1BVLB 1C08B 3P2TA 4J1UB 5J13C 3O0RH 5CLTA 1P5UA 3ARDC 1L7IH 1RPQA 1T0NA 1K2DB 4OLZL 2A6DA 4HFUL 5CILL 1EMTH 5I15L 3U9UB 5KVDL 3HAEG 4NKDB 2A9NL 3RVTD 1QO3A 3VXTB 4DJMA 1UZ8B 2AJSH 2R1YA 5E03A 4PJFA 1YEIL 2Q8AH 2V5YA 5DHVH 1FFQA 4G3YL 3RIFF 1BJ1J 5D4QA 2CRIA 2AQ2A 1LDSA 3FRUA 3KNBA 1TQCB 1CXFA 5TQ2L 3RL2A 3MRKB 3O81A 1N4XL 8FABB 1QSVA 5HHVH 2FD6L 2AGJH 3BD3A 1CLYH 4WUUA 2ZJSH 2BRQA 5DC0A 1BD2E 1YPZF 3E6HA 3VFVB 2HRPH 4MHHG 3WMSA 5ABDE 3VFNA 6FABH 3B83A 2FX7H 3GIZL 5EUOB 5IB5B 3QIBB 3X17A 2FIKA 3NZHH 5EO1B 2OJEA 4PJGB 1NLBL 2ILLA 3MZTA 3ROOA 4JY4B 3HMWL 4RZCA 2O26U 2X10A 4PGCB 4PRIB 4LF3B 2AKRA 4M48L 4LLAA 4WV1B 1JPGB 1XGQB 4PJCF 4R7NA 2X42A 3EFDH 1WFUA 5DDHB 5CEXB 2J2ZA 3C6LA 5D93C 5IVOA 4GMSL 2CKBH 3FQXA 4HKZA 4J4PA 5F6HI 2ZSWB 3I6LD 3DETC 4LMQI 3OWEA 1B4JH 1KCVL 5BS0B 1E4XI 3QFDB 4NWUH 5DHVA 4XAWH 2AJVL 3QQ9C 2YPVH 1U8MA 1IEBB 1K6QL 1C7TA 3QUYD 4G9DA 3QCVH 2FSEA 3ZHLA 1BM3H 5E2WL 3KYAA 3LN9A 3C2AL 2IAND 4NQDB 5FV1L 1I7TA 4PGZA 1J1PL 4L9DA 3QFJD 3X14A 1NFDF 2FHCA 5BS0D 5CLWA 3UBXI 3D9AH 4P9HC 1KELL 5HGHB 1TJIH 3CD4A 4MLSA 5FOBA 1IAIM 1BAFH 1MVUA 1HSBA 4PGBB 4XBGA 1JF6A 5H37G 2AXJA 1ERNA 1S7SA 4GFTB 1MQKL 3N9GL 1A7RH 2CH8A 1DBBL 1VGEL 3ARTA 1CFVH 3WXVL 2VLMD 1YNKL 3R8BB 1B88A 1BP3B 1FP5A 1MJUL 3QIUB 3SEPA 1WBYA 3V6ZB 2HT4D 2XWJA 3BZEA 1IQDA 5KVEH 4ZYKB 2R0LL 5DJDB 1AGEA 1G7JB 4RMQA 4EI6A 3UDWC 5JR1H 3Q5TA 3DV6B 3I6GB 1E27A 3QWRD 1QFWH 1EO7A 1KENL 2ZNXA 3H0TA 5D7KD 1NAKL 4R3SB 1A6ZB 2ZCLH 2X4PB 2VL5B 4KTDH 5DD0L 5J7CC 3PQYD 2Q8BL 1URLA 1CICB 3FB6B 3JTTB 5HHMD 1ZEAH 2CRMA 5EOTA 5C0JA 4KH2A 3BH8B 4HXBL 3LEVH 1CIDA 4Y1AA 3DVGA 3MRJB 2P5WE 5I8CB 3QDGE 1VEPA 2BNUB 4XPFH 3VGAB 4OD2A 1L7TH 2E7HA 2V2WB 3QEUA 1A5FL 2NXZD 5EU4A 3QO0A 4MA8L 4HGKC 4K71C 2HYMA 3QJFB 5J6GA 1OW0C 3T2NL 4ZNEE 3VH8A 1T2QL 4YIQA 5KG9B 3U6RA 3VWJA 1MCJA 4EIZC 3CDCA 3GHBL 3REWB 5LBSH 3SDXE 3EOTL 3O2DL 3I3BA 3INUH 4X0KB 5CBEB 5DFVD 5D1ZD 4NGHH 4ELKB 1QSZA 5DURD 4G8FA 2FGZA 1CFQA 5E1HB 3SDDB 1UWEH 4MA7H 3O45A 2C3GA 1YECL 5HI3C 1KJ2B 1MNUH 2P8MB 1M7IA 1YY9D 2CKBL 4FTVA 2VERN 3FFDA 3LDBC 3WJLA 5GS0D 2A9ML 4JR9L 2DM7A 1ADQL 1KTLA 1F8TL 3JVGA 3QH3B 4G42B 4P2QB 1J1OL 5D2NB 1YN7B 1NCCH 5E1AB 4P2QA 5D2NA 1FFPA 2AJYH 3NTCH 2OSLA 4XCNA 3EO1A 1TQBB 4QO1A 2GHWB 1T2XA 1D9KA 4IDJH 5JHLH 3VXQB 3QDMD 1S78C 2G75B 1YMMB 3EYOB 3KYOB 4PJ9B 3V7MA 5B38B 1NGZA 1DE4B 3DGGB 4KMTL 2DQCH 3QEHB 1KELH 2XACC 1J7VR 3N1MC 3BKCL 3BO8A 1GC1C 4ZUTA 5I2IB 2FCBA 1AGBA 4UV4L 5JO5A 5BV7B 4YO0A 1YEJH 4H8WH 4D9RD 4B50A 3I2CH 4LAQH 1CF8L 5JQHC 4E41E 1OLLA 4MA3B 3WS3B 4UTBH 4YC2B 1UXSA 4YX2L 4IM8A 1JMZA 2F8OA 4M1CD 1FORL 4N9OB 2ARWA 4U1MB 3SKNA 1SQ2N 4P5TC 3DNKA 3R1GH 2P43B 3HZMA 1XF5A 5JTWA 1NUGA 3ARGA 2HVJA 4ONGL 1Y18B 2EKSB 4FNLH 1EBPA 1I7ZA 4JRXE 1I85A 1BPVA 3TBVB 1TNNA 1QSFD 1I4FB 4JG0L 2D03L 4X6FB 1LD9B 1JNHA 4KTDL 4ZNEA 5BV7L 3OB0H 4JPVL 3GMRB 4WJ5A 2R56L 2XZAH 3HI5L 4IOFC 2LQRA 3O11A 4PJIE 5E2TH 3SDCD 1ZEAL 5C1MB 3IDNA 3B43A 3SDCA 1SY6H 4PJBA 3RI5F 2R1XA 1AXSA 1QSFB 1K4DA 1S5IL 5D5MF 3PABA 1WQVT 3ARDA 3D69A 4PP2B 3STBA 1UM5L 3MRIA 3EGSA 4D3CH 3MRIB 4M6AA 3BEVB 5FHBL 3L1OH 3FTGA 3ILQD 3H9SA 3WKMH 3WNOA 3ARPA 3QO1A 4WHYG 4PTUA 5E7FA 5MEPB 5J3HD 3VXUA 2MWCA 2XZCL 1CVRA 2NY1B 1QEWB 1NLDL 1HWHB 3GI8H 4N8VG 1FYHB 1T2QH 2PYEB 1C12A 5F8RC 2YD7A 4R96B 2PYEA 1NL0L 4HV8B 3FO9B 4ZFFA 4UILH 4YQXH 4HUKB 2EYSA 2HJLB 3R8QA 5EU3B 4AEHH 4BA8A 3LKRB 1EHXA 3LKRA 5I8EA 3VXRD 5BVPH 1GHFL 1MCPH 3BQUD 1FZOB 3CFBA 5LCVL 4DGIH 2BY3A 3HAEH 5B8CB 3VXSA 3E2HB 1FLRH 2LU3A 2ICES 3GJFB 3LQZA 4L1HA 1Q1JH 1I8IB 2R69L 1DN0B 1BD2D 1G0XA 3MXVL 3LN4B 3EDKA 4NYLB 1ADQH 1F8TH 3WNNA 4LSQL 4OLEA 3Q6GL 3BSZH 2PO6D 3FFCD 5F1SA 3QHTC 4YK4C 4P2OB 5JXAH 1TPXC 3MACH 5L6YL 4CUCA 4PJCA 1BJMA 3B9EA 4PRIA 4PJXB 5CIPH 1M05A 3J8F7 4RCAA 3GIVB 4IRJA 5HDQL 1NCAL 1O0VA 3BIKA 1FAIL 1NEZA 1I1AD 5CGTA 4WI9A 4HJJH 2C9AA 5AWNH 4J4PC 2CO6B 1JGLL 3D39E 5HJ3B 5GGRY 1T1WA 1YEJL 4NNXA 4EI5B 2ICWJ 3O8XC 4LPUA 5EUKA 2Z31B 4A6YB 3S36X 4ZAKB 2Z31A 4TUOB 3KJ6L 1PG7H 4KRNA 4U31A 3F8UB 3CFDA 2D31A 5FGBC 2R0KL 1A3RH 2D9QB 2J5LC 1ZA6B 4GKNB 5FYKL 4DWHA 4QNPE 1WFTA 3PWUA 3QJHA 4R2GC 1KNOA 5D9SB 3BPNB 1T1ZB 3RPIA 1GJIA 4RIRB 1FO0H 1JIBA 1IKNC 3LRSB 1UYWL 3V4PH 2V7NB 3GBML 3AB0B 5ESAB 4NCDA 5I76A 1XIWB 4WNQA 2VDOH 5DJ8A 5D8JL 2D7OA 3BVNA 3TJHD 1BOYA 4OB5H 4ALAH 4AEEA 4UBDD 3ARVA 5EU6B 2APFA 4JGJA 4QXTB 2NY3D 1M1SA 5LWYH 4JJHA 1RIVH 4UAOC 4JKKA 3D25B 3U79A 4P23D 5EZOL 1T7ZA 4RMRA 4GQ9L 4BFBD 5AYQA 3D0LA 1AGDB 3P9MB 5DD1L 5IOPB 5L0QB 1AGCA 1T21B 1CGVA 2GT9B 3IJHA 3QXWA 3WFZA 2VL5A 4KRPB 4NP4L 2GSIA 3RGVD 4U3XA 3BRDA 1SJHA 2ATKA 4CVXB 3FB6A 4M7ZB 1T89A 4QGYA 4KJYA 4JN1L 4UILL 4WW2B 3QCUL 4OI8A 4XPHH 2VDMH 3MRJA 4PREB 2V2TA 3UTZA 4PJHE 1DBAL 4OUUB 3GKWH 4DGIL 4FQLL 4N0FA 1T0PB 3TBTA 1I9RL 1TVHB 3G5ZB 4XXDA 4OLXL 3MRMA 4HD9A 3U7YH 3TCLA 4MB3A 1MWAB 2VAJA 4HQQL 1K8DA 5CZXC 1CXLA 3VCLA 3CK0L 4XCCH 3MLXH 5CMAB 4LSQH 2IPTH 4QRUB 4HWBA 4F58H 4WEBL 4NO3B 3C5JB 4X6DA 1ZANL 4X4MA 4MJIA 1AQDB 3MCLH 3QDMA 1UG9A 1LE9A 1KJ2A 4L4VE 1DQLH 35C8L 1NCAH 1CN4A 4JPIA 4ZSOE 4PRPD 3ARQA 5DR5L 4BQ6A 5KSVB 1KYOJ 2DQFA 4MXVF 5JPNA 4S2SB 1QHPA 5DD6B 1JV5B 2FZ3A 4TUKL 5K9OB 1CK0H 3VD7A 1YN7A 3PIQB 2C3VB 1BZQK 4P5TB 1SJXA 3DUSB 4NJAL 5C07A 2FO4A 4LU5H 1A6TB 3PDDA 1MIMH 3WNMA 4ODWA 3UC0L 1RHHA 4XNQA 3QAZC 4FQPA 2FHFA 2H8PA 1RHHB 1YNLH 4XNQB 1MHCA 4NUJA 1QTYT 4JFFD 5EZLB 1TTGA 1I8KB 2XTJE 2NTSP 5D1QD 4OCXH 1WAAA 2DMBA 4EVNA 2GTWB 4CAGA 4IRZL 1Z9OA 3QEHA 3L3HB 4LQFH 4X99B 4JFZL 4JFYA 1MCNA 4PGDB 1BOGA 2EO1A 4LRIC 2EDLA 1NC2D 12E8L 1F90H 2BX5A 2AJZB 3HB3C 3WDIA 3R06A 2P5EA 2O5XH 4WO4D 2Y07L 4ORZC 1MI5A 4X7TB 2MCPH 5HY9B 4JANA 1DTUA 1JGVH 1IGCH 3QRFM 1ZGLB 3P4OA 5I8KL 1WLHA 2A6IA 3S37L 2OK0L 4N1EA 4L8SC 3SJVD 3PWLA 5JNYA 3CCHB 4E42B 4DGYH 1LVEA 4WFFE 4F7TB 3IU4H 4E42A 2V5TA 4KQ4H 2GEEA 2WP3O 3G5VB 3O3DA 4X6BB 5IQ7H 5E94A 3O3DB 2OJZH 1NMCC 2Z8WC 3ILPB 2IBZY 3QNZA 4PYHA 3D85D 4RDQF 5CEZH 1JNHB 4OCYL 3K8LA 1A7PL 1WT5C 1XCTA 3HNSL 3S7GA 2JJWA 1CLZL 5C8JB 4YHKL 3C5SA 3CGTA 4MVBD 1DFBL 1WIUA 3HFML 2JB5L 5C2BL 3QQNA 3O6FD 5IHBA 2VZTA 3QDGB 4X4ME 4RBPK 4NQSA 1MVFA 2GJ6A 2QQKL 4TSBH 1NKOA 2WINA 4NQXB 1P7HL 2AAVA 2QV2A 1GGIH 3DRQA 3TO2A 4JG1H 1WZLA 3CZFA 4ZSOA 4OZIB 4EOWH 1IGJB 5ACZB 2Y6SD 2DQTL 4XVSH 1MFDH 1PEZA 1G1CA 1WISA 1KIPB 5AZ2L 4R8WL 1G6VK 1GIGH 2HT2C 4YEEA 4QRSA 3FQUB 1QO3B 4EI5D 1OAUL 1Z9LA 3QUXA 4HWUA 3RU8L 1X5FA 4NBYB 3MCLL 5E9DA 2VTFA 4XWOC 5T3ZD 1A02N 3RY4A 1NCNA 5HGBA 1FPTH 1RZ7H 2GTZA 3RTQA 3CLFL 1I8IA 3GNMH 5FUCE 3I75B 3KPOB 2AEPL 3NA9L 4J3XA 2OL3B 5E8OA 4M6NH 3S36H 4MA1C 4RBPH 2V5MA 1UADC 4YPGB 1C5DB 3UZQA 4OIIH 4L8DA 1TZHB 3MV9E 1WITA 2B4CH 3WJJA 1VFMA 4Y5YC 3M07A 3HR6A 4JB9H 4DUVA 3P4MA 1MRCL 2YPKB 4QRRA 4LSSL 2IFGA 1DUZA 3S3JA 5DS8A 4HWBH 4Z0XA 5J1TC 3O41B 1H3TA 2YPLB 5FCUH 1SEBA 3UTTB 1GL4B 4D8PA 2ERJC 5JORA 4OLVH 3NIDE 1REIA 5F9JA 1A6AA 4XAKE 1R3KB 4TTGA 3LOWA 2VLLB 1I1RA 2BNQE 3VFUA 4H8WC 1KPRA 4H25B 1B0GB 5D5MB 4HEME 4XGZB 3U4AA 3QA3B 1F02I 3DXAD 2XY1A 5FOJA 3O3BA 4ZAKA 3SY0A 4LEOB 3BP5A 2R1YB 3HI1A 5L88H 4NO2B 4U0RB 2OP4H 4NKMA 3MROA 2AJUL 1B3JA 2XFXB 3QXAB 5KANI 2APXA 2CQVA 4PJ7B 2BVPA 4GKNA 5EU5B 2WQRA 5E5MA 3G9AB 4CNIB 1T20B 3AC0A 2I25N 4G8EB 4UOW0 3PWNA 4MS8D 1EZVY 4JZJA 5LXGL 3WIIH 5HGAA 2W9LA 1MCCA 2VDLL 2HFGL 2GITB 4PJFF 4POYA 1BIHA 3WLBA 3MOBL 2W07A 1DBMH 3B9DA 2JJTC 4K3EH 1UM6L 2D0HA 3FOMB 3D3VA 3NIFF 3QUKA 4M93C 1T6VN 4JZJC 4LHUD 4P3WA 5ETUB 1HSBB 4HCRA 4X6DF 4R26H 5B39A 3P0VL 2V6HA 3KYNB 1X5ZA 1I3GL 1AO7E 2JB5H 5C2BH 4MQSB 3NCCB 1NGQH 1HILB 1A1OB 1EV2E 3BUYB 2HFFB 3ZYIA 5FO9A 2DJSA 2NCMA 2VLJE 4ELME 5KVDH 4NNPL 1NCWH 2R0ZH 4KKLC 3RUGB 2YD8A 3AU1B 4UDUB 4XMPH 3FQXB 3NCEB 4D0CA 1T5XB 5T33H 2IQ9H 2ATKB 5I8OL 2Q6WA 5K9KA 1AE6L 2GAZA 3JVGC 5TPWH 5K9KB 3DMMB 4M43H 4YHZH 2AK4A 5C08A 5IV2B 2DQUL 1R3JA 1FYTD 3O4LA 1MCEA 3U36A 2PXYB 2DQEL 2OL3H 4HIHA 3U1SH 1W8OA 1YJDC 4TQEH 3TN0C 4Y16C 3EYSH 1T22A 1IAKA 4ODUA 3MGOA 2PW1B 4S1SH 2B1HH 8CGTA 5IG7B 4PJXF 4OF6A 2HKFL 4OLYH 1IAOA 5ID1A 5D72L 5EPMB 3VXMB 4Z7NE 5KS9B 3ULUE 4Z7NF 6FABL 4DFHA 3BP7B 1FIGH 3DIFA 3SDCC 5I1KL 5E99L 2WWMD 3CMOH 4J6RH 2QADC 4NO5A 4KRPC 3ZLQC 2FB4H 3QDJA 4KVNL 1NMBL 3L3GA 5D7LA 4M7JL 4PRBA 1E4JA 3HNTH 3GHEH 3AMLA 1WEJL 2Z91A 2VXSL 2BSTA 3SKJH 2O61A 3BDYL 4XNMA 5HHQB 3S8WA 3O6FB 1PKQE 1IQWL 3AS2A 2A6JB 5E6YA 2NLJB 2AJVH 4NKIL 5I17B 5AAMA 1R3IH 3V6FA 1FVEA 4O5LH 4HWZB 3NMEA 5F8QC 4X5XB 4HKBB 4NFDA 5DJXA 3PQYE 4GKZA 4PP1D 2PN5A 4JFFE 2EDEA 3SDDC 1V3MA 2ADFH 3T0EA 3IXTA 3I02B 4K7PL 4DTGH 2HMID 3MUJA 2DMKA 2X4TA 3RHWF 4TULL 5FV2A 1OOAA 2IAMC 1UXWB 1EHNA 3WIIL 3LH2H 1I1YB 2JTDA 5SWSE 5EBWA 4JHBA 5HHXH 3P4LA 3NFSH 3PV6B 4DKFL 3OAYK 1J18A 1F97A 4DUWA 2CLZB 2NY6D 1MQKH 3KS0J 3GSOB 1LO5B 2XV6B 4NQDD 5DEGA 2AEQL 1SYSA 5C6PB 5IKCB 5F6IC 4IRSD 2LU7A 5CILH 2IGFL 1GC1H 4ZTOH 4MCYA 4BQ8A 4IMKA 1C16B 4YO0B 1LEIB 1MCHA 2BVQA 4LLQA 4YDLC 3S35L 1U58A 3P0VH 2YR3A 1YEHH 3AFLA 4IBLT 3MV9B 1YY9C 4CKVX 1NGQL 3VD5A 5C07E 2FRGP 5DMGC 2JIXB 3OKKB 5HI3D 4JY6B 3ARWA 1U41A 5CS7A 2IQAA 4MYWB 1N64L 3SHSA 2PTVA 3TO4D 1FZMB 1IAMA 5DD0H 3MUHL 3SKNB 5FB8A 1FZMA 5DTFA 3VFSB 3HUJF 3FFDB 1F4YH 5FM4A 2IQ9L 5D71L 5DLMH 2HVJB 2JCCF 1D6EB 2GI7A 3MRHA 1XGRA 3EZ8A 4Y4KA 2P42B 1TJGL 2EKJA 1XIWD 4F2MA 4HXBH 4GSDL 4XC3L 2W0PA 3SE8H 5IVZA 1ZLVH 4ZFOL 5E08H 3AS1A 1QRNA 1HYSC 4O02H 3CFEB 3KYOA 4PJ9A 5B38A 2Z92B 4XHJC 4XB8A 2AV7B 2HFEA 3EYSL 4KKNA 3LS5L 4NQCE 1EAJA 2B1HL 1JNLH 1F58H 4PUBH 2YBRA 4D94A 1CQYA 4HS6A 5T3XD 3SQOL 4N8PA 1PQZA 2CPCA 4PJGF 2FX9H 4NZTL 4PJGE 3MFFA 3VXTA 1U2CA 3EO0B 4MA3A 3WS3A 2FEEI 1JZ8A 4KVNH 1UXSB 1T7XA 5I30L 2VMFA 5FK9B 4WHYH 4R96A 1B4JL 1KCVH 3BXNA 2JCCA 4WU5A 4XAWL 2ZOLB 3MTRA 2FWOB 1ZTXL 3O2WL 1YJDH 4M5ZL 2DM3A 4WI6A 1P53A 1S7WA 1NBQA 1MHPH 2EKSA 3OGCB 2QSCH 5HDBF 4Z7VE 4XH2B 2X4UA 3TBSB 3OR6A 3VFMB 2ADJB 3HZKA 1VPOL 3MRNA 5CKAA 4HS8L 5DK3A 5T1DL 1IILE 1A9EA 2A1WL 4HJGA 2NX5D 5ADPH 2YD3A 1RZ8B 4EUPA 4U1LB 2QBWA 5GZND 1CQKA 1VFOA 2W9EL 1FNGA 2PETA 1T0NB 1BQHG 4P2OA 3UTTA 5CSBA 3S5LG 1DN2A 4YDVB 5D1XB 1XF2A 5AZEL 1FSKC 1IC5H 4OF3A 4PJIB 1P2CA 3EYVA 5L0QC 4ZQKB 5KVFH 2GJZB 3EYVB 1NDGA 2OQJB 4JM4H 3MCKB 2VSDA 5ERWB 3MLRL 1TZIB 4TPRH 3UP1A 4LLYA 5BS0A 2IC2A 4PB9H 1LO0H 4PGJA 4LLYB 4HKXB 1QFWL 1T7WA 3IB4A 1AR1C 4KZDL 2O93L 4HH9A 3V6OE 2IANA 2EECA 4G9DB 3L3IB 3RGVC 1JZ3A 4POZC 3IJYB 2RIKA 4PRHA 5FGBA 3RZCB 4Q9RL 3F7YA 4JG0H 2VUYA 3ULVF 3IDYB 4ELMF 1IGFH 1WWWX 4M6ML 4K71B 4J4PD 3U48A 1W72B 3QUKB 4P23C 2NZIA 2RCSL 1ZS8B 4ZPVB 1Z2KA 2NNAB 3MBEB 2CLVA 1FNLA 5HSFA 3G6JF 3KWWA 2OJEB 3LSOB 4PJGA 4U1JB 3KYNA 3TJHC 4QT5B 1AO7D 2EC8A 3MR9B 5E8NB 3SE8L 1G7MA 3GMMA 3EBAA 1S7UA 5E08L 4MQXD 3FN0H 4DKEL 3BPCB 1MQ8A 1FRGL 2XWBB 4CMMB 3SPVA 1T1YB 5HDOA 3QIWB 4X8JA 1NLDH 3WFCH 3VI4E 3S37X 4LEXL 5ISZD 2Z0BA 1WT5A 3DLQR 3C6SB 5JW3H 3D39D 1Z0NA 1JZ2A 4GO6B 1OAYH 4OCRH 1QFHA 4NZJA 5D7KE 1A7QH 4KUZL 5I1JL 4PRHD 2EDDA 4FMFA 4F15B 1M71A 3MREB 3X3GH 1AY1L 4G6FB 1DQQB 2W65A 4PRAB 1GPOH 3EYUL 5I1EH 1CT8B 4U4BA 2P24A 4LFHG 3JUZA 3P30H 1J0IA 1J9CT 1IAKB 2AI0L 3O9WC 4ODUB 5EFIB 3MGOB 4NQED 4JFEA 1KJ2H 3QWOB 3O2WH 4M5ZH 1VENA 4XHJD 4WI4A 4Y89A 4PIRF 1S9XB 1R5IA 4JGMA 1R5IB 3U0WL 1SY6A 3SDYL 3MRFB 4Y4HA 4JPWH 2Q20A 2QADB 3NZ8B 5HYJA 2FECI 3TWCL 2I26N 4HS8H 1DSFL 2YZ1A 3MNZB 2FX8L 1UWXK 4MD4B 4U6VL 4JRYA 5GZNC 4PGEB 3WFDH 5ENWB 4KDWA 1Y6KR 3L5JA 4GXVL 4RQQA 4HJJL 5FYJE 5EUOF 5FYJD 1J5OL 4X6CA 4KFZC 1U91A 5EDXA 4EI6B 4M9OA 5F1IB 2EYTB 2PTUA 2LVCA 5SWSB 1E27B 2AV1B 4RX4A 3VD4A 3AXLB 1NEZG 1KPUA 1MHHA 1MHHB 1CR9L 4E41A 1ZVSB 3MLUH 2XY2A 1NFDA 2ENYA 3W11D 1CTNA 3D18A 2UVFA 1KIQB 4KI5C 4ODXA 4KK9C 25C8H 1KTLB 4XPBL 4TPRL 4G42A 2YRLA 5JOEA 2FZ3B 4YHLL 5K9OA 4PJEF 2IFFL 1YQVL 4M1CC 3VD9A 1P84J 4URTB 1T80A 4I48B 3T3PF 3OKYA 5F89A 1UYWH 2ZOKB 2OZ4A 1FQ9C 2YRPA 2CDGB 3DX6A 1OWRM 1LEGB 3KLHD 1C5CH 1UT9A 3TH2T 1LEGA 3ZE2E 4JVPA 3T4AA 4NZUH 2X1XR 3QJFA 3WO3B 4F3FA 4HUWB 1EEUA 2EE9A 4QY8A 3TFKD 5DVOA 5DJ2B