3R4RA

Crystal structure of a fimbrial assembly protein (bdi_3522) from parabacteroides distasonis atcc 8503 at 2.38 a resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
284
structure length
274
Chain Sequence
b'DELSFDMSLVLLTGDTYATTEELTIQNCHVAVFDKDGKRIYFKNFYSKDLGEMKTIGNLSGYELQLEGVRTFGKEDKKVSVLVVANANNANNSPFDNLTTYDGVDNSYTAKTIAKGPVTASLLVKIGKSETTLKYNQDNAPVTVSLIQLSAKIEYTGVYKKENGELLEGFSLTKVAGLNASSKITIFNTSAVENGAFSDLAYPTTKPVTFYTYEISDAFKEVILSVQSGVEPKEYPFPANKFIKGNYYRIKGLKSSTEIEWVLENVEDKEVTLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical fimbrial assembly protein
publication title Crystal structure of a hypothetical fimbrial assembly protein (BDI_3522) from Parabacteroides distasonis ATCC 8503 at 2.38 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Cell adhesion
total genus 66
structure length 274
sequence length 284
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06321 P_gingi_FimA Major fimbrial subunit protein (FimA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2580 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3r4rA01
2.60.40.2590 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3r4rA02
4JRFA 3UP6A 5DHMC 3R4RA 4RDBA 4GPVA 4JG5A
chains in the Genus database with same CATH superfamily
4OFIA 2VB5A 3H9SB 3WFBL 1KPVA 2V8LA 5CM1A 1R24B 3GI9L 1MEXH 1CT8B 6PAZA 3WBDA 1F58H 2DRUA 3IJYB 1XIWB 4L29A 2IF7A 2OSLB 4U0RC 1FNAA 4B41A 4GKOA 3PCYA 1G6RA 3NSFA 1YY8A 1W91A 2H1LM 4Y19A 2VSDA 3ZR5A 4OIIH 3GM0A 4Q52A 3LD8B 3ZX1A 2CQVA 2X6UA 3BZ4A 3IGFA 3QO1A 5MP6H 4TN9A 2K8MA 3JWNE 3N43F 4HIQA 1BZEA 3AWFA 4Q9RL 1RZKH 2X1PA 3F05A 3WNKA 4DKTA 4Z7WF 3TBWB 3BMVA 1BVKA 3HE7B 4HT1H 5SWSA 2M83A 4M43H 1ZA6A 1IE4A 4HU2A 1IJ9A 2YUXA 1HH6A 1CBVH 4X6FB 1INQB 5A43C 4YDIH 5HYJD 1YNLL 2R27A 2E59A 3BAEL 4UT6A 4CVUA 1N5YL 1RVFL 2ED9A 1SY6A 4TLUA 3VDCA 4TRPL 1CL7L 3ZDZE 5EWIH 5CJQH 1Q0XH 4E42B 2FT8A 5C0FB 2XYBA 3KPSD 4A63A 3BW9A 2WYIA 3H9SE 2X88A 1ROCA 3F3HA 4DVRL 4ONHB 1MUJA 2K7QA 4GI6A 3DX1A 3CBRA 1XO8A 1HQ4A 3FUMA 4A2DA 4L37A 5I1AB 3SD5A 1Y6KR 3MMEA 1MG2C 4CJ1A 1AR1D 3VXMB 5D7LD 4ANXA 1B3IA 3CSGA 4PJCF 2VQ1A 2E9BA 1SRDA 2ERJB 5SWQB 4TUKH 4PVLA 3EJZC 4UZUA 1TNMA 3OF6D 5DHVH 2DQIH 5FOJA 1HAWA 3FFCA 2H2SC 2J5LB 3PAUA 4FS0A 5E6RB 5T33L 4OVUA 1ZGLB 4OUUA 1HSAA 3QORC 3D06A 3ZU8A 5F7MC 4YDKH 1Q8MA 3IEAA 5DVMA 4P9HH 4XI5D 5GGRY 4A7VA 4PTTA 5E70A 4MQTB 1K2DA 2VIRB 2BVQB 5A6LA 4EN3B 2CO4A 1IQDA 3BZFB 4BKSC 3KM1A 3N42F 5GSRA 4WU7A 3VI3B 5AAWA 1I8KA 3QNZB 1RUPL 2VZSA 4ZUWA 1MJ8H 1DVQA 2AABL 2F53B 3CUPB 4IBQA 3QXAA 1OW0A 2VJ8A 4GW5A 4XNMB 5DJ2B 4DP7X 4YIQA 2JI1A 2WWOA 3P73B 3E3QC 3BIAX 3VXME 3WTTA 4CC4C 3VFPA 3QUMB 4UMGA 5DK0B 5DGRA 2YOAA 3S5LG 1GRWA 1UA3A 1FO0B 1KGIA 2PWEA 3V4UH 5I1EH 1OM3H 1X5AA 4HISA 3L7EA 3UABA 3HNTH 3U0TB 3U6XS 2YPKA 2AEQL 2ED7A 3ZE0B 2E4TA 5E8NB 4ZAKD 1ZVSB 5B22A 5T3ZL 2ZOKA 4E5XB 1GGYA 4OI9A 4EI5B 4ZG1A 3GJFB 2FX8L 1K8IB 5DI8B 1HDMA 1I4FA 3BAWA 3QJFA 4KO7A 1LEKA 4KI5C 1P6AB 2E7CA 4MCZA 3V10A 4L9LA 4NQDA 4BXSV 4FQCH 5EZJB 1IO4C 3QUZD 4I9WD 4XPGH 3WLBB 4JCMA 5C6WH 1MDTA 5DQDH 3VI3E 2R51A 1MJ7H 8PAZA 2OMNA 3GDCA 1J8HB 4LAQH 2YQBA 2IH9A 5FM5M 2Z8WC 3NFSL 1BZ9B 1L0YA 2YQ2A 3FONB 1MLBB 1MAML 3ZT6A 4U33A 1G4MA 4X4ME 3ESNA 4JFPA 3GXPA 3LY6A 4R4BB 3U1SL 5FYKD 4LHUD 3UROR 3IDYC 3MLWH 2PXYA 5GGTA 3S3DB 3WIIL 4WEBH 4WDIB 4PJEF 4JGNA 3QDMB 3C09B 3S3CB 4QRTB 4HFWA 3SKMB 2GJ6B 2A5UA 3CZKA 1ZSHA 2WNKA 4MNQD 3HI6L 4R7DA 3QQ3A 3CTTA 1C5BH 1JPGA 2YMOA 4JFXB 1M1XB 2JCWA 1U8KA 1R3HA 2O26U 3ML9A 3GMQB 3FT2B 5BRPA 1YMMA 5IB5A 1CB4A 4JFDA 4FQQB 2FECL 2LGNA 1TQVA 4RNRA 5EIVA 1J8HE 3LKOB 5JORA 1I9RH 1OLLA 4J6IA 2R8SL 3KBFA 3TA3D 2VUKA 1WICA 4NKIH 1Z6JT 2NX5D 2JH2A 3WMSA 2WXRA 4KQ0A 2O30A 3U2JA 3IXTB 1H3PL 2F7RA 2CIKA 2VDPB 3U7WL 4D94A 5ISZA 1EEYB 1NUDA 1F11A 2A9MH 2V2WA 3HB3C 5CZKA 2VXUL 1GAFH 4JHAH 1T5KA 4AGMA 5JW5A 1JHLH 5TE6L 1LMKA 4CILA 1ID5I 1E65A 3EO1B 4E9VA 3QDME 3FYEB 4B7LA 2N59A 3KL0A 2GJ6E 4IYKA 1TF4A 1LGVA 3H9YA 3WFEL 3QEQB 3NTCL 2BHUA 5KVEL 2WINA 1TFHA 2VGLM 5EO1B 3QC5X 4DFHA 2P26A 3OJMB 3RY6A 3GMMA 4HP5A 1RKRA 2GTWB 3DPDA 5A2FA 5AD0B 1Z7JA 1YY9C 5BCAA 2A2QT 4XB7A 3VWJB 1XF3B 1Z2KA 3ARGB 3TWCL 1DJSA 4XCNB 1NBQA 2YC1B 5GZOC 3VI4E 1IVTA 1TU2B 1IGYB 2DKUA 3FU5A 1U2CA 4JDTL 1UT1A 3MA7B 5CR8A 4LRIC 2W07A 2OP4H 3O8XC 5H37H 3P9WB 4DKEH 3B2DC 2BHYA 1J0HA 4RWYH 4XPBL 1RK0A 3SY0B 1E4XH 1EAQA 4GSUA 4KKCC 4AV0A 4ODHH 4LBEA 1DUYA 3QA3A 5IROA 1C08A 3ETBF 4UANA 4P5TA 4HCIA 1A1NA 5EOCL 3IBOA 4JKPL 3DX0A 4G72B 4OD1L 3MOAL 4A68A 3WTXA 4WWOA 3RVXD 2OYMA 5E95B 5IM7A 3PAVA 3KAAA 3DK0A 2HJLB 5JZ7C 1BF8A 3KGUA 5HYSB 5DQ9A 1N5AB 3E38A 4N8UA 5DFVC 2GEQA 4Z7QB 3L9RB 2L04A 4GPVA 4NQEE 5EU7E 5B3SB 4YGVB 2VM4A 4L0ZA 4BZ2H 3QZOA 4R7NB 5FYLD 5AAPA 2EDQA 3QFDA 3HUJE 2K8QA 3L3JA 4TNGA 4PJ9D 3UC2A 1UC6A 2BMKA 2H8PB 3WNJA 3FFOA 2DIAA 4R4FH 1MCBA 3MLYL 4P23D 4PBWD 4W93A 1MAKA 1T2XA 3WL9B 4JFFA 2VLKB 3UJJH 1IGJB 2ZCHH 4MMXB 5F97E 2X38A 3KPNB 4HK0A 1WRFA 4MXWH 3JTTB 2UY7A 2XZAH 3Q2CA 2VLRB 3QDGD 4XO9A 5DURB 5IQ9A 4JFHE 3B2UD 3VA2C 4R2GB 4NZUL 4K8RL 4AEFA 4BSJA 2BRRH 4ZS6C 4UT6L 3DURA 5SX5K 4NNXA 3ZYOA 5KYXA 4JPSA 1KB5B 2R23A 1SY6L 1G7JB 3QPQD 3Q43A 5ITFB 1NMCB 3FOMB 2F5BH 2MWCA 4B95C 4LFHG 3SDCA 1KB3A 5IUCA 1RIUL 4XZ4A 5I6XC 1FYTD 3BN3B 2OX5B 2XN9B 3VU1A 2JTDA 3JV5A 3RAJL 1R5VA 4N20A 5F71A 5KN5B 3UDWA 1AHWA 1M42A 1RSFA 3FAXA 3KR3L 2EYSB 3X14A 1YYMH 3O4LA 4GXUN 4HQQL 2MOGA 2A6KB 5CUSH 1LO3L 1QPXA 4P3CL 1NCDL 1WC7A 3VFUA 5KW9H 2FYYB 4Z8FH 4X6CF 3LS5H 4NO2B 1FN4A 4F1ZA 4MAUH 1BFOA 1G7PB 5JDJA 2BOCA 4CUCA 1T1ZA 5HI3D 1KJVB 3SKUD 4V1DB 3H3KA 2VLKE 1A4KB 2PW2B 4ZUVA 1RURH 3ARDD 3PF2A 1NBZB 4MQXC 5E8DH 2VLRE 3FTGA 4CDHA 2DN7A 3QIBC 1KY7A 4J3SA 5IWLC 1HJBC 4X8JA 1HKLL 3VFMA 1IC1A 2AJSH 3HC2A 2ATAA 2OV0A 2ODIA 1S7SA 3U6RB 1T5XB 5D2NB 2Y7OA 1S4IA 3QS2A 5I6MA 5AB9A 2JKRM 3ARBC 1NOAA 1T2JA 1WCQA 5F44A 4HULB 5E2TL 5HGBB 3C8KA 3FBQA 2ZG3A 4HGKC 2OMWA 3CFBA 5EUOA 3LEYL 2VABA 3CVCA 5ABDE 3D3VB 1NMBL 1LDPL 1I1FA 4U4BA 2QGEA 3U82B 1DE4B 1HNGA 2B2XH 4U1NB 2A7BA 5EU6B 1X5XA 2DTML 1BZ7A 4G1MB 2LV4A 3IB4A 4OZHA 3GUTA 1WO2A 5LVEA 4MCNA 4CSTA 2R69H 2DQUH 3LZRA 2KQMA 1JHTA 2XPGA 3CZSA 1F3DJ 3MOBL 4ODUA 1HYSD 2HFEB 2QQLL 1YO4A 2F7IA 2YEVB 3TV3H 4H13C 5MEND 2PNDA 4KK9D 2I5YL 4LQFH 3FT4B 2P5ED 3NPSB 2ZP9A 2VT0A 3ULSA 2G2PA 2PMZA 4JM2D 1Q1JL 4NDMB 1L3NA 5D2NE 2MIZA 4AH2A 1A0QL 3FQNB 4R84A 1JXGA 1L9NA 1F1AA 5IHZA 4PBXA 2WC7A 5DYFA 2IANB 5ID0B 3MCLL 1IC7H 3MV7D 1KCUL 2YRZA 3D3VE 2YARA 2W8CA 1ZLEA 3MREB 1M7DB 4L8BA 5EU6E 5I8KH 3NN8B 5DVOA 5TPWH 4DEPC 3LRSB 3NCJL 3LDBC 4HJSA 5FKAA 1W0YT 2FZ3B 1H9VA 5D1ZA 1IZJA 1WYJA 1DN2A 4MA8H 5GGRA 2CHNA 1IAIM 3K81A 4WI2A 2ZICA 4JQXA 5T3XH 3HR6A 3TL5A 5GGTL 2DKSA 4AL8L 3O0RL 2DQEL 3FQTB 4LF3A 5E4AA 1AANA 1VZGA 4OM0L 1QEWA 2FD6L 2VLMD 3LRMA 2NUPB 4IBZA 5BRZD 1NAMB 2IH3A 4GUCA 5FWQA 4DT2A 5IHBA 2YAPA 3HZYA 3ELAT 3R0NA 1FL6A 4LNRA 2CO3A 2K9UA 5JR1L 5E4EC 1G43A 3OAUL 2XA3A 4NWUL 5FLUA 4P5KA 1P4IH 1XFPA 4PJ6A 3EH5B 3FDWA 2Z8SA 5DRZB 1GA2A 1I1AB 2X42A 3K2UL 3OG4B 5FM8A 4ZBJA 4GRMA 3SQRA 1RZKC 1CFSB 2BDNH 1SVZA 3Q44A 3W5MA 4ELMB 1CLCA 3V9EA 3L3KB 4P3DA 2Q8BL 2YAHA 3MI6A 2VNCA 1AO7E 3EJUA 3MZGB 1WAEA 4PJBA 1KACB 4AEIH 4PGJA 3T6QC 3BVNA 5TD4A 1TTRA 4RSYA 2DPKA 1X4YA 4GEIA 2X9ZA 4ABQA 4X5PA 3R19A 1J8SA 5FM5O 2Y9RT 3LZOA 4URTB 3IFOA 3UTTD 4JFEA 5DCCA 4E0RA 5CP3H 4ZFGL 1GC1C 2M2DA 1AKJB 1SQMA 4QXTB 3VXPB 2BS9A 1KC5H 3GXNA 1MCHA 1NGZA 3HLAA 1DUZA 2DQMA 3VD5A 1RL1A 3HI5L 4PJIF 3O0LA 3QZWB 2UZXB 3KLHC 1KTJA 4PY8I 1SEQL 5FUZL 4WJ5A 3TC9A 5I1LB 1IEAB 1CLVA 3GMLB 3WXWL 4KPHH 3FH7A 2XTSA 1MFCL 2RTTA 2AMUA 4J8RB 3CX5K 3C5ZC 2L7UA 5E5LA 1YRKA 1KTDA 3IS1X 3R4DA 4WENB 4ELME 2F8VA 5EN2A 4OI7A 1RZJH 1LD9A 4JO8A 4XCCL 1E40A 3X12A 1ICTA 1UH2A 3V95A 1XR8B 2APFA 4M48H 2CJ3A 4P9HC 4Y2DA 3SO3B 2WJ7A 4JJ5A 2XTJC 3EOAB 4QO1A 2HX8A 4R0LB 4OZGF 5E2VL 3SBWA 1V5JA 2VWEC 1J05B 4JUTA 1SYSB 3GRWA 4NLHA 3ZW3A 3Q13A 1BA9A 2CPUA 1W0VA 3BQVA 3S4SG 3A6CH 4APQB 1WH0A 5HHOA 1IL1B 3VD2A 1TG8A 2YXWA 3PGCB 3SZ6A 1U95A 1A25A 3PWPB 5KANG 2J8HA 3GI8H 2WLKA 4JO3L 5EG6C 3V6OA 2WSDA 3HCVA 1C12A 1A3QA 4H8HA 4MMYB 2OYLA 1OE1A 1A22B 2ADGA 4YLQT 3QNXB 3RHWF 4KK5D 1CXIA 2XWTA 3D4GA 5EORL 4I2XA 3ASNB 3Q1EA 3AWGA 3E9UA 3T1FA 5ADPH 1EEZA 4LRNL 4B60A 4FMVA 1HL9A 5C71A 5I1CL 4N8VA 3NEEA 3VAEA 2OA9A 3C2AL 3KXFB 2I69A 2ZYSA 1MHEB 4FXKB 4NO3B 4ZW8A 3QJHB 3SE4A 4N8PA 4K71B 1VADB 3CX5J 5DTFB 4WI9A 2NNRA 4UMSA 2PCPA 4O02B 5KBMA 1N6VA 4CAGA 2Y1AA 3GBDA 4LLAA 1BOYA 1JWMA 3BUBA 2NZ1A 5I74C 3VW3H 2WLJA 2D4FA 1HEZB 1NBCA 1QI5A 4O4YH 1JVLA 1PX3A 2J55A 3C60A 1MCQA 2P5WD 5LBVA 1XGYH 1ZSDB 1O9VA 4YSEA 3MRJB 3K2KA 5DD0H 1TTAA 4FQIL 3DKHA 3B7YA 3GBNL 5IR1B 1F3RB 3X11B 1CF8H 5HHNA 4DZBA 2ICES 3PJSA 4F57H 1OGAA 4OJFH 2OCFD 4GAFB 1L9QA 2WIIB 2X7LB 5C08A 3M8OL 4AUUA 1GSKA 3UYRH 1HN1A 1JPTL 1F2XK 4KXBA 4M3HA 5KSAB 1J0KA 3POCA 2VR9A 1JTTA 2X4TB 1R3LA 2A99A 3IAQA 1F6FB 1SN5A 5DXWA 3D2UA 1CMOA 4F7CA 3OAYH 4L8SC 4WHTB 5I1JH 3TTYA 4PTUA 3MJ8A 1JL8A 4Y5XB 1C7TA 4GXVH 4HFUH 1ITBB 3U83A 4Y5VB 1GPOH 3GBEA 4FZEH 4JPVH 5ESQA 1S7QB 4YHYB 3KXFE 3EJZD 4TVSa 2XKUA 1A6UH 3U36B 3EO9H 3K6DA 2Z31D 2H2SD 4QF1B 4PJAF 4OZIA 1KN2L 1WA0X 5D1XC 3RY4A 3MJ6A 4HJJL 4S1QL 3VXQA 2F8OA 3N1FC 1OOAA 3F58H 3NEXA 1MFDH 1JHKL 1PLGL 3TJHC 3SD2A 4WNJA 1CDUA 3MNVA 4WWID 4Q9QH 3BKYH 1V7NL 1OSEA 3B9KB 1MI5B 1I1RA 3FHQA 3L13A 3V8CA 1U8HA 4JN2A 1HK6A 3VH8G 1Z9SA 2YD1A 2BVUA 2IDQA 1ZV5A 4KFMA 1B9KA 2XA8H 3LX9A 4BK4A 1G5GA 1JFQL 3Q6FA 3SCMB 4PB9L 4YDLB 3NA4A 5F0LB 2PO6A 1GYVA 3V0DA 4ZMZA 4ZW6A 3LXAA 4MFHA 4FFVD 1KYOJ 2XN0A 4DF9A 1EANA 3B37A 4TOYH 1PFCA 1IB5A 3CVIH 3FZUC 4TVUA 4GS7B 5CSGA 1XGPA 3KVPA 3HAEA 5F1IB 4Z76A 1EEQA 1O9WA 2X4PB 1J48A 2KI6A 1IBZA 5C2BH 3IDJA 4ZD3L 2ORBL 3CZGA 1CR9H 1MNUL 1F18A 2ZE0A 3FUFA 1MCKA 3QULA 4FYRA 5JO5A 1GGCL 3P4OB 1HNYA 3MA9L 4LKCA 3NQIA 3UJTL 2RB8A 4H8VA 3AJ7A 3TNMA 1U58B 3H7LA 5K9OB 4FLOA 2YJQA 2C3WA 2HT4C 1D7CA 4KI5D 1LMIA 2UV3A 4X9HA 3UAJA 4BSVB 5E9DB 1CYWA 2GUOA 4UILL 1D9KB 2A6JB 3IU4L 1DLHA 1RLBA 4LSVH 4GFXA 1CXHA 1SJXA 3QDHA 2WXFA 4QRAA 3O2WL 5E7FA 4P0DA 1E30A 2ZONA 4AGPA 4W81A 4HKXA 4AIXA 1BVLA 2BSRA 3SO5A 4PY7A 4BQ6A 2QDWA 4YBHA 4IK6A 4PJHF 3M1BB 4MJ5A 4MRCA 3BX7C 5HVHC 2BSTB 4LKXB 2DWEA 2WKOA 2VZTA 4K23L 5EC2B 2IEPA 4PG9A 3V5KB 4WFGE 1Y18A 4J3VA 1W8OA 1DJHA 1DQJA 5HYIA 1YLBB 2F54A 5DUMH 4KV5E 2QKIC 3DUUA 5GS1A 3EXLA 4LSPH 1SYVA 1PF3A 1UQSB 3NCEB 3HRZA 2X2HA 1G7LB 4NBYB 5DMIL 1DDTA 1P1ZB 1UM4H 3SQOL 2EIBA 1N67A 4Z3IA 5DJ6B 4N2LA 2R4RH 4F8LA 2WXNA 3ATBA 4PJ5E 4PJGE 1MHCB 3NIGF 2X4UA 4P57A 3RNQB 4L1BA 1A5FL 3OKKA 3R06A 4HUWA 3HE6C 4RIRA 1E5AA 1JV2B 1AG0A 4RFOL 4WSGA 4N68A 3DX6B 5DO8A 1DBAH 6TAAA 4OJEH 2IDCA 3MRMB 3T0EC 1KTBA 4IM8A 2NMSA 2DM4A 4GG8A 1AZVA 2CUHA 3FB5B 3NABH 4N1CA 1MF2L 1DJGA 2VAAB 5MERA 1TLKA 2FQGA 3MRGB 4BK5A 5E1IA 4HHWA 1DSFH 3JV4B 1GYUA 4AKOA 5K59E 2VITA 4UINH 1MRCH 1J88A 3WG7B 4NKDB 1F41A 3K6SA 2BZCA 3BUPA 4GG6F 2W5PA 5JIQA 5DVPA 5MEPB 2R0LH 1BM3L 1E5BA 2CIIB 5FHBH 3PWNB 1XAUA 3L2NA 2Y3AA 4U4IA 1AKPA 2NSMA 2E7HA 3ELQA 2Y7SA 2Y4SA 3GIZL 1Z9OA 4Y5YC 4QHKI 3VA6A 1I82A 3G5VB 2NR6D 2YUWA 43CAB 1UGKA 1FV1B 2ZAGA 1ULVA 1YNTB 4JQVA 3S37L 3TFBA 3TF4A 4HUMB 3BDXA 5CGYD 3FKUS 2FBOJ 4Y9GA 2HMIC 4KC3B 3AAZA 4JKKA 4WI0B 5JPNB 5DYOA 1XT5A 2VSMB 3A5VA 3IRZA 4X8XA 3UTPD 1SHMA 4HZLA 3T4YA 5IJVA 1NAKL 1P4BL 3GNMH 1ETZA 3O8XD 3ECUA 3SDAD 1F4WH 1OAZH 4OJYA 1RHHA 4R5VA 4GRLB 2EYTB 1AGFB 2R7EA 3L1OL 4KKCD 1ET8A 1QO3A 3MRIA 5ACZB 4FQPA 1W15A 1GZQB 4KMQA 1J8KA 5EBLB 3P0YL 3BUQA 4ADJA 3O9WC 3RGBA 3LZQA 2ZXQA 2D9CA 2VKXA 2ICWJ 2B9BA 4X98B 5I73B 5D2LF 3GRWL 1LVEA 1PDKB 5DJZA 5J1AA 5JZ7D 2Q3XA 3OKDB 4P8QA 3T08A 2FATH 4JHZA 4RAHA 5EIQA 3HW7A 3RX8A 1W2KT 5DFVD 2XRAL 1ZK9A 1CD8A 4L3CB 4LB8A 3UGEA 4Z3GA 4G6KH 1MCPL 1Z3GL 3LV3B 2CRIA 4QOKA 3FB8A 4LU5H 2G5BB 2XT1B 4MHHI 4WTXA 4AYEC 3I3BA 4NQTA 1Q38A 2W9LA 1L0QA 4L1TA 4GW4B 5F7YC 3RHWK 2BP8A 5DVKA 3ZYZA 1DJIA 1H3TA 1YEIH 3HG1E 3UEQA 1E6OH 3G08A 1AGEA 4Y4HA 1FORL 2BSED 1TZHA 2BOLA 3NZHL 3FPXA 3WELA 2A38A 1AYRA 3QUGA 1XD1A 5EBWB 2V7HA 3GJEA 2E6QA 5KVGH 2Y7QB 4QHNA 4LVNB 5KS9A 1YDPB 3CDZA 2EUXA 4P2OC 5L6YL 1FIGH 3DX4A 2WMPB 4PRID 1BSIA 4FI6A 1IBBA 2HPTA 4OJCA 5G55A 3CXHK 4GBXB 3BZEA 5HY9A 4BHUA 1QLRB 3I02B 1BAFH 2Z65C 5C3LD 3II3A 5F93C 3LN5A 1U3NA 4FTVD 1QFWL 4HC1H 3WUWG 2EILB 2WLIA 4JRXB 1QZ1A 5BVPH 2H0JA 4M7LL 1FBIH 4JFQA 4FNRA 3RWDB 3TIEB 4FXTA 3WE6B 4EPSA 2MTAA 2OMVB 3M46A 1PD0A 4FKEA 4JEGB 4ATWA 5EZOL 2YBRA 5H94A 4J2QA 2WYZA 1QRNB 5I6PA 1E8ZA 4LAJH 1FFNB 3RDTC 3WIAA 4Z7VA 4XNDA 4LEXL 2ZG1A 2J7LA 5T3ZE 3IVKB 2WZPA 2B0SL 5D96C 1H0DB 4X8GA 5JLZA 4FG0A 5F1NA 1NFDF 1JG9A 2BLFA 5ADOH 1U3HB 5T8IA 4JZJB 4C59B 3HPJB 1ACXA 5IB3A 1D5XB 3VXSD 5IUSA 1BVNP 4OZFA 5BPPA 1OVZA 4OD2A 4JFZH 3WKYA 2KZ1B 3ESPA 4IKNA 2HZHA 4CJ0A 1C7SA 2D7NA 2X70A 1E6JL 4WHCA 1AY1L 3SBQA 2QVIA 3PABA 4Q74A 3UEZA 4I18C 1UKQA 1EZUA 5DZVA 5TDNB 3CXHJ 4JRXE 2J3SA 4ZFZA 1NC2A 3GZPA 2IOOA 1AMYA 2H45A 1DANU 3RWGB 1F3JA 1PNCA 3WJLA 5L8KB 4Z7WA 4DGUA 1W9XA 1HXMB 3V6FA 1OAXH 4BD4A 3ZE2B 1D5ZA 5LAPA 2WTRB 1UZ8B 2NR6A 3H0TA 5AL8A 1IBYA 2BVOA 3SPVB 5IIEA 2FEEI 2XG4A 4OCSL 4MD5B 1YUHA 4NN7C 3VE0B 3JZYA 5KYUA 2WCGA 4JY5H 3CDGA 1J0ZA 3BAIA 5EA0H 1KELH 5C07B 5C0CD 1B2YA 3NDZE 1M05A 4I77H 2ICEA 3EFDH 2FJGA 3NIDF 4W9GC 1Y0LA 1NLDL 4BWWA 4AMKL 5J56B 4DNLA 4NZTL 3QRGL 1N18A 2WZAA 3NOIA 3SIKA 1UA7A 4JY4A 3VFNA 5IQ7H 1W80A 3QHFH 1S7WB 4XC1H 4G11A 3NH7L 1UCBL 2CU9A 3K4ZA 3IAGC 4JKLA 2B39A 5FYJL 3OPUA 3VB9A 2DEWX 4POZC 5F6HJ 2F1AA 1MCOL 4HG4J 4PJCA 1IT9H 4JKMA 4WI8A 5C0BD 5HHQB 1BBJA 4GUPA 4ZK8A 4XPFL 4PQXA 2OR7A 4CADA 3TBYB 1E4HA 1T66C 4AWJC 3L3OB 4NC1C 1TSRA 4ZW3A 1FC2D 1I9IH 5CNHA 2MEJB 3ZE2E 1L6ZA 2H1PH 2R2HA 3B2XA 4GYBA 5I18H 5JHLA 3QYNA 2XFXB 1JPFA 3QJQB 1F1GA 4HUXB 5IHLB 3IWVA 3NIFB 3TZVB 3OJ2C 3VSTA 2EIKB 4AKPA 1KPVB 3FTUA 5AVSB 1JYNA 4XOBA 3D4YA 3ILDA 4FL4C 3PWVA 2FH6A 4L29B 3WN5A 3N1PC 1OP9A 2G0LA 2IWFA 1G6RB 1YY8B 3GJFH 3OKNA 4Y19B 1HINL 2OXGA 4QXGH 2CJUL 2R2EA 3D9AH 4HAKA 3BZ4B 3QO1B 1UEMA 4OM1H 3KGTA 4GAGH 4WK2B 3JVGC 1H6UA 3MYJA 3FQYA 2ZOTA 3NCWA 4OJAA 2BY0A 5FA4A 2QPUA 4TSCH 2VZUA 3BUDA 1BVKB 1TETL 5KVFH 4EDWL 5SWSB 2IAMC 1ZA6B 1RZGA 4PBDA 3BD4A 4FZ8L 1HH6B 1P5UA 1TVBA 3V2AR 1TJHL 3ARPA 5T1MA 1JZ6A 2RCSH 4ZTOL 1VIWA 1WFIA 5J5EA 3PU7A 5DD3H 5D1QC 1R33A 3CFNA 4G8AC 1E8YA 2IPTH 4AGOA 2FIKA 1E4KA 1CFTA 3BW9B 2OULB 4GFTB 1KCRH 5H37G 4P05A 1MUJB 2DKMA 4X7SL 1XZWA 5AW9B 1HQ4B 4AIOA 1NDTA 4F9LC 1OP4A 4WO0A 4G9FE 4F1SA 1RQ5A 2ZUVA 4I8DA 4L37B 5IJKC 4G6FB 2L3BA 4Y19E 3MMEB 3KWUA 1W6LA 2P3YA 4DZ8A 4PGDA 1WISA 2CO7A 3QPKA 5C0EA 2BPBA 3AUWB 5D5MB 2NDGA 5DJYA 5DZNA 3HIZA 5B38A 3E7JA 2VQ1B 1INEH 4WKZA 3LVTA 1BVOA 1DQDH 1JDCA 3QJRB 4EIGB 4YK4B 1S78C 3KLAA 3FFCB 2G60H 2Z7ZA 3CLWA 3C5ZD 4OUUB 1HSAB 2EJ1A 5CHNA 3CSFA 4JRFA 3V6BR 1R75A 5E6IA 1H15A 1NCHA 2Y06H 2NZ9C 4FI8A 4X5RA 4PTTB 3UP1A 4ZFFA 2YRBA 3UX9B 3FCTA 4AOFA 1PMYA 4ACTA 5E5RB 1LK3H 1JZIA 1T7XA 1KV3A 4WU7B 5GSRB 1I8KB 4ZUWB 3ECBA 3KBHE 5DA0B 1KFAL 3OLGA 3QXAB 2AVGA 4GW5B 2E27L 4YIQB 3KPRE 1QLEH 1BYOA 1WWBX 2UZYA 2AXGA 2DIBA 4ZJ9A 2EC9U 3ZDZF 4ZTPH 3VFPB 5LDSA 2YK1L 3BE1L 5CILH 3NPZB 4XNXL 4WU5A 2ARWA 2XWJA 5AWNH 5TTRA 3GKWH 1N68A 2WBJD 1B90A 3B5GA 5J57B 4LGSB 1LO5A 2BIPA 4FQ1L 3L7EB 4IEFA 1BJ8A 2UYLA 2YPKB 4CKVX 4FP8L 1QBML 25C8H 4QD2E 1U42A 2VM3A 1HYRC 2W9EH 3TOPA 1T7WA 2ZOKB 2KZWA 4IRSD 1VEOA 1YZZA 1HDMB 1I4FB 1OSPH 3QJFB 5KUMA 2OL3A 1LEKB 3QIWC 4MCZB 5JDSA 1JZ5A 4L9LB 4NQDB 3BH4A 5DO2D 4UOQA 3TN0C 3ABKB 3B7UX 1KB9K 5HDWA 3S3PA 1FVCA 3NJLA 1CLZL 2COVD 2J43A 1BD2A 5IGXH 1DVFC 2H3NA 1T6BX 3D25A 2CHDA 4CBZA 1X4XA 3AZUA 3NT0A 4QUOA 4C57C 2VJ0A 3OZLA 4HSQA 4JFPB 4D3CL 5IEHA 2NYYC 3BT0A 5JQHC 5IREA 4YBQC 2PXYB 2H3XC 4FNSA 3GSUA 1LO2H 4ZXBD 3UTSD 2GG1A 5KVMC 1DFBL 4RFNC 1I9JH 4DGIL 4JREB 5TJWK 4HFWB 1BM7A 4ZPVA 3DJTA 3GMOA 3QBTB 1CE6A 4F8OA 3UAFA 4EZJA 1KGCD 3DVIA 2X3AA 4NQVA 2X41A 4R7DB 1OTUD 1JPGB 1L7IL 5CZVH 3CLEL 3RU8L 1M1SA 1R3HB 2XY1A 3NCFB 3VXOA 3WS6A 4C56D 5D1XD 3A24A 4NQDE 1A66A 4GLRI 3TVMC 1YMMB 3D09A 5IB5B 5CD5C 2X9WA 3LS4H 5E56A 5EZIH 1G6VK 3RWJA 3TJHD 4LCCC 4JFDB 1KB5H 4RAUA 1SXCA 2AJZA 4RNRB 1AS6A 5JORB 4XRCA 4YVNA 1PZ3A 2FB4L 4XBEH 4GT0A 4K7FA 1Q9WA 4XPAL 4CDGC 4JO2L 3M86A 2PCXA 4E9WA 2ZXAA 3SDDC 1D7BA 1AJ7L 3IFNL 5T5FH 5GHWL 3V0GA 4LLDA 2OYKA 4HOMA 4N9GA 1S7TA 4OLVH 3DHMA 2CIKB 2HFFA 4AQAA 2OQJA 5ISZB 1F11B 2V2WB 5EDSA 3U0PA 2EXWD 5KSUA 3S8GB 5JW5B 3HI1A 3BDYH 2EACA 3FZUD 4KY1H 4NUGL 2KH2B 3BPOC 4Z0BL 5A1AA 2X2UA 4UTBH 3U79A 3VWKA 2I60L 5E6ZA 4M93B 1BGXH 3D50A 5E2JA 2BIMA 4IHOA 3MYZA 2DYSB 3TJPA 1A6WH 1ZXQA 2WINB 2GT9A 2OS7A 35C8H 1NLBL 3IJ7A 3GMMB 2W60A 2VUYA 4HS3A 1A2YA 4PS4H 2IVFC 3VMPA 4DAGL 1F1DA 2P46B 4BE5A 1YMME 5DMJB 4M29A 3N06B 2ESVA 1YEWA 4GAAA 1MFBH 1TTGA 1JXDA 3OC8A 2NY1B 4B0MB 4OLEA 5CJ8A 1PZBA 1MREH 3GHEL 3I2CH 1TQUA 2W07B 5C7XH 5BMFL 1UVQA 1U92A 2AHIA 2V6HA 2QQKH 2X5PA 2D8KA 1RK0B 4I0PA 4MXVF 4Q4IA 5I8EA 1BQSA 4YVUA 3GLAA 4X6CA 4IRZA 4FABL 3KYNA 4DP2X 2YPLE 5FUCC 3CVHA 3BISA 4LBEB 1DUYB 3QA3B 1C08B 1D5BA 3SB3A 4P5TB 4UQCA 1A1NB 2X6VA 3GZQA 3K91A 4BQ8A 3V4LA 1M2OA 2HA1A 5JHLL 2X6BA 4YS4A 3F7YA 2YMXH 2ZNWA 3Q8EA 4YHPA 5IM7B 4A7GF 1EDQA 4WK4B 3BRGC 4J12A 1ZT7A 4ZFOB 3O11A 4OFKA 4YSDA 5TF1H 4GINA 4LSQL 1NDGA 5DQ9B 4FLSA 3KPOA 5F7EL 4PVNA 4NZDA 1E9QA 3TTSA 4F8PA 1REIA 1OWWA 1ERNA 2WV3A 3QFDB 1G0YR 4U49A 3L3JB 3VMOA 3AS1A 3VRJA 1UURA 2BMKB 3KCPA 4GNKB 4EBQL 2P80A 3MRDA 4ZS7H 2CUIA 5BZWA 4LARH 3HE6D 2CWRA 4JFFB 4IOIA 5I75C 4X4YA 4A7SA 2B5IB 4PS3A 1MOEA 1H5BA 4HK0B 4JKNA 2UY7B 5IQ9B 2DQFA 4JQIH 1S7UA 4NUQA 5JA9A 4MB1A 1II4E 2B4CL 4PGBB 4LCWA 3MRBA 2C26A 5FYJU 1NDMA 2DD8L 4PRPD 1KBGH 2WB7A 4HVBA 4NNXB 3FN0H 3MODH 5KYXB 2R23B 1Z3RA 1T0NB 3IDXL 5ALBL 1HWWA 2PCYA 4BIKA 2AAAA 2D9QB 4MAYA 3SDCB 3PAYA 2YZ8A 1XIWC 3BP6A 3GQFA 5F9JA 4ACPA 4ENEC 3W2DL 2W94A 2A0LD 1R5VB 4G7YL 5L2KD 3BESR 1AHWB 3LD8C 1J12A 2MJWA 3FH5A 1PEZA 2XPZA 3H1ZA 3O4LB 3X14B 4DPAX 1P6FA 5LWYL 3IMUA 1DBBH 3VFUB 1WC7B 3BP4B 4U6VH 1H3WM 4E41E 1KCLA 3CFCL 3RGVC 3UO1L 4H88L 2YD3A 1W72A 1FN4B 4FX5A 4AQOA 1ZT1A 1BFOB 5JIDA 2BOCB 1T1ZB 3U9PH 1QFWM 4WUKL 4OSUL 2HMID 3FB6A 3ATEA 3FF7A 4JFFE 1QFPA 4ZUVB 4BA0A 1SDDA 2R1WA 4M9PA 3L2MA 5L7XH 2NTFA 4KVNL 2QPFA 2EIZA 1UUNA 3FTGB 4DTGH 3MLSH 1S9YA 4J6RL 3OAZK 3ZE1F 5DHYA 1CDGA 3O2DA 4X8JB 1QAWA 3VFMB 3WEXA 4KRLB 2WPGA 5GZNA 1SXZA 3CIQA 4RFEA 1S7SB 1BFVL 3D39D 5C0RH 3NG5A 2NY6B 4NN5B 3O9WD 3FT9A 3D85A 4A7TA 2IV9A 1HQRA 3Q8BA 3C8KB 3D07A 3QIUC 4MJ4A 1L0XA 2OMWB 3BQUA 3CFBB 4HDIA 2VABB 3QHTC 5EPMA 5EIIG 5EUOB 5GGSY 3QAQA 5GXBB 1WHPA 3O41A 1ZLUK 2G3MA 4GQQA 1EZVX 4CMMB 4LP8A 3JWOH 4YXKH 3EDKA 1BZ7B 2AK4A 3QUXA 3IPFA 4OZHB 2OK0H 1HWHB 4PRHA 3GUTB 1TSHA 4MDJA 4DN3L 1TJIL 4AT6A 2IFFH 4G71B 1ZWIA 2GK0A 2XPGB 2KLTA 4ODUB 2JCCF 2ICWA 3CVDA 4HWEH 1JRHL 1JXKA 1LILA 2J5LC 4GIOA 4E2OA 2QQNH 5CEZH 4HUKB 3S0PA 1NGYA 4Q0XH 1OHQA 1YECH 1MHPL 2DQJL 1LP9E 3ULSB 4DPRA 1MFAL 1Z9LA 3QJVB 4EN3C 4O2FA 1SJHA 4PJIA 2G5RA 2OL3L 2FIRT 4P2OD 3VQLA 4AH2B 3AM8C 4XMXA 1NCUA 1FDLH 4GAYA 3IBEA 4JVPA 3APNA 5IHZB 3PL6A 3IN2A 3K1DA 5EUOE 2J12B 3H3BC 1P7HL 2HKHH 3IKCB 4L8BB 5ANHA 4R8WH 3CFDA 4KZDH 3OHXA 4KRNA 5GGVY 1B2WH 4C8XA 4HUVA 2OXHA 5TE7L 4WUUA 1DP0A 2K3TA 4OZHE 5FKAB 1Q72H 4MTMA 5LBSA 2XPYA 1YPZE 5D1ZB 3STZA 3UTOA 5GGRB 2DLHA 1IV8A 3HC0A 4N86A 1O6TA 2H9GA 4KH9A 1B4RA 4LF3B 3TT1L 1MZYA 4OZGA 5T3XD 1QEWB 1KYAA 1VGKA 2IH3B 5JW4Q 1XF4A 3DHJA 4P4KA 1NL0L 5C09D 3HZYB 2VDQL 3CPUA 4K7PL 1FL6B 5CLWA 3ETTA 4LNRB 4XO5A 1EFXD 4EI5C 4FFZH 5L9DH 3QUYA 4I3SL 3US1A 2GC4C 4LL9A 3B4NA 4CC1A 5D70H 5AOLA 4P5KB 2NXYB 5CLXA 2JQZA 3ZO0A 3ULVH 2NXZD 4XNZB 5IBUB 1U41A 4FG6C 1HILA 4GRMB 2J8UE 1RPUA 4NRYB 4YAQA 2XDHA 1UB6A 4MJ6A 4LCYA 1DQLL 5F9DC 3VSQA 1K5NA 5HJ3A 2QFRA 1DN0A 4ZODA 4P3DB 4RISH 2P43B 2ZAHA 2EO9A 4P5SA 1AS8A 4PJBB 3FN3A 4MMZB 43C9A 3FAWA 4KUCF 4B9JA 4YSPA 3HJ0A 4NQCD 3FF8A 4NSKA 2C9QA 1YC7A 1P5VA 1N0LA 4KQ4L 3IFOB 5LCVH 1KWGA 4JFEB 4E0RB 2YSTA 5BOJA 4D2NA 3GXMA 1EAJA 4NERA 1A3RL 4XNBA 2XTLA 1NGZB 2ZPKL 5D4QA 3HLAB 1S5IH 2FUQA 3GHPA 1ZVNA 1F4XH 4WI4A 1URIA 4YUEH 5ECJE 5E2WL 4NKMA 4FQXC 3RKPA 2WWNA 4XNQA 5TFSH 1BW8A 1SDYA 1P7KA 1WE5A 3K80A 3E8UH 1QYGH 3LMJH 4WJ5B 2C9RA 4H26B 5C9KA 4N90D 3ZOAA 1BPLB 1LLAA 4AGQA 3TBCA 2SODB 2V7NA 1XGQA 1KTDB 2CMRL 4KROD 3LYRA 3OSKA 4N0RA 5EN2B 4HEPA 5L4IA 1NCTA 2XETA 3JBG7 4POZD 1LD9B 1R9FA 3EH3B 3X12B 3VFOA 4LP5A 4HKZA 4OF6A 4Y2DB 5B1CA 3ZKXB 4JJ5B 1DO5A 3RPKA 4QO1B 1T66D 2Z0BA 4IRZL 1GTFA 1MHHA 3CVHL 5I1DA 3KS0J 2WK2A 1YUKB 4PJAA 1E5CA 1MFEH 3N3EA 2O6EA 1W0VB 5F6IB 5DRXA 5HHOB 3BLBA 2MCMA 3CFIC 1WUZA 1J18A 4ODXA 3TO4A 3W0WE 1U95B 1CF1A 2P7TA 4OLUL 4KJQC 3HCVB 1T0PB 1C12B 4K9EH 3RWEA 3FT1A 4FQ2H 3P3SA 2ADGB 3WD5H 1A7RL 2DAVA 1DVXA 3I9AA 3H2WA 2G4GA 2JIXA 1FGVL 3KGRA 4FYQA 4LE8A 4B9KC 2XWTB 3HC3H 4I2XB 1CU4H 2TSBA 4RMWA 3AACA 3T1FB 1EEZB 4N3TA 4NO5A 3SPJA 3VX1A 2NZIA 3T5WA 5E08H 4N8VB 4LPYA 2F74A 2P52A 5TF0A 5BVJA 3AREA 3OKYA 3VYOA 1PGRB 2IAMD 4PLNC 1IC4H 3I84A 2PCPB 1X6NA 1NCNA 3GSVA 1JWMB 5MEOA 1MNNA 5DZLA 3WFBH 1HI6A 5BOPA 4UZGA 3T2PA 5C6TL 3C60B 5D1QD 1E2ZA 2XY2A 5DEGA 3F00A 1WZ1L 3D18A 4Y4KD 4EQ3A 5CR1A 3UTZA 2H26A 1OAQH 5I8OL 1VDGA 5HHOE 2A74A 3I6LD 5KYWA 2CR6A 5HHNB 4DZBB 3PJSB 1JNHA 5EEUA 3MBEA 2P44B 3V6OE 4IMKA 1X5LA 1JZ7A 2K78A 5C08B 4EOWH 4ES8A 1V7MH 3PRZA 1YQ2A 3IKKA 3CMOL 4R97B 1IM3A 4YSTA 1R3LB 1H3XA 1HNFA 2F7PA 2RHEA 3D2UB 4I2XE 4F7CB 4KITB 3VGDA 3VNYA 1X7QA 4PTUB 1XBDA 3MJ8B 2FGZA 3FPYA 1QZNA 5ESQB 3X1GA 1HZKA 5E00A 5AALA 1CQKA 5DFAA 1A9EA 3C8DA 3BAEH 4PJHA 1W72L 1QUNA 1RK1A 3CH1A 4G83A 1N5YH 5E9AA 4MMXC 3DVGA 4OZIB 3LXBA 4M7ZB 3VXQB 4TUOA 3SN6N 3RRQA 2VXTH 1YEFL 2NZ9D 2VLJA 2X28A 3MNVB 1IM9D 4NJ9H 4TNFA 4IKLA 1HZHL 4HIIA 1U8HB 4JN2B 5FKPA 3W38A 4IBVA 2APSA 1Z9SB 2CG9X 1NMCC 5I30L 1EJ6A 1ASOA 3UPAA 1BQLL 2Y1ZA 1OGAE 3PNRB 2PUQT 4D8OA 3Q6FB 5C08E 2PO6B 4PIRF 2OCJA 1AG6A 4NM4L 5TE4H 3QFJE 4BFIA 3N40P 1XGPB 3HAEB 3P30H 3ETSA 1OD7A 5GGUA 3T3ME 3V9CA 4Z76B 2A4CA 4QRRA 4NQUA 2EO1A 2W9DH 2YD2A 5TDOA 2FX9L 4M6NH 4E9YA 3WHE0 3IDJB 1QW9A 3RTQA 4LBAA 1ZV9A 2C4FT 2VN4A 3KH3A 3QULB 3S5LA 1BIIA 5JO5B 3JTBA 1AGCA 2X10A 4AJWA 1ZRUA 4LKCB 1F02I 2YZ1A 4OZIE 3DRTA 4RBPK 1ZTMA 4S0TD 4Z95L 2DL2A 1I3VA 5EMYA 3TNMB 1F13A 1O7DC 3DO7A 2LOEA 1TVDA 2M1KA 3QHZL 1GJUA 4Y7OC 4FA8A 2HFGH 1OZUA 3QIWD 3WEMA 3BD5A 4Z5RA 5B8CC 1E67A 5EU4A 2MKWA 2C3HA 1KULA 2QT6A 2GUOB 3MTXA 2CGZA 3F12A 1DLHB 2OMYA 3LH2H 2CM5A 3QI9A 4M6OH 1A7PH 1JZEA 4IJ3B 2J1WA 1DVFD 3S5YA 4IBUA 1AHMA 4HKXB 4YHML 3ILPA 4MLIA 1BVLB 2BSRB 2YXVA 1H8NA 4PY7B 1SGKA 2Q6WA 3SODB 1T83C 1XF5A 4FN0A 2NYYD 4MJ5B 4FFYH 2OTWA 3BDBA 1AZRA 3PHAA 4KJPC 4YBQD 2DWEB 3TXAA 3G6JF 4PG9B 2CPCA 3EYVA 3T3PF 1Y18B 3E2HB 4XP4L 3RX7A 1DQJB 5IBTH 1FJ1A 2F54B 4RDQG 5LNDA 1AQDA 3K6NA 5JW4N 1A3LH 1D5IH 3DUUB 5GS1B 1SYVB 2BNQD 2VQUA 1M71A 2DI9A 3HRZB 4NS0A 1TPXB 2AEPH 2R29A 2A9NL 5EOQH 3NPSC 3KPTA 1F4YL 5D2LA 4KTDL 3H2QA 5GGSA 4M1CD 1KJ3L 1JBJA 4X4XA 1ND0A 2X4UB 4P57B 5IW6A 1KUMA 5CD5D 3NFSH 2Y2YA 1WIPA 3R06B 4HUWB 3NYKA 3WTUA 4RIRB 1MAMH 1Y7VA 1EHNA 4G8IA 1RUML 2NY0D 4XNYH 4TSBH 1XBRA 2JLLA 3PWLA 4N25A 2NSXA 2CJSA 1MRFL 4K94H 1DBKH 4HCRL 3UFIA 1XXFC 3GXUB 3ZZSA 4GG8B 4PV1C 3PNWA 4OGAD 3NCYS 2B3RA 2FHCA 1EUUA 5MERB 5DR5L 4XNUH 3WN6A 3TJEL 4LCIL 3LRLA 1Z66A 1QATA 3F01A 3HI6H 2VITB 3K6SB 3B5TA 2KDYA 4KVCH 2O5XL 3V0HA 5IMLA 2F54E 1A9BA 3C6LA 2QLVB 3SOBH 4F92B 1LWHA 1WZAA 1S9VB 2R0ZL 5GRJH 4QJ4B 4YE4L 4H8WL 2YGOA 4MB5A 2LAGB 5KG9A 3FCUB 2R8SH 1ZGLP 3DOSA 4R7XA 3CAFA 1VERA 1I1AC 1MSPA 3BC9A 3AAZB 1TKWA 4H1LH 5IT2L 5DYOB 2QVKA 3NCYP 3U7WH 4R90L 1EMTL 1UWFA 1R34A 3LXCA 5K1JA 1X6LA 3RJQB 5CCKH 3BVDB 4HZLB 3L3HA 1KN4L 2VXUH 4JDZA 3T4YB 5HVWA 5IJVB 1ETZB 4LSUL 4AY0A 3NVQA 3AVEA 4WHYH 1NGXA 1RHHB 4L3ED 5TE6H 1CURA 4LVOB 2R7EB 4CSSA 3HNSL 5ESAA 1QO3B 2CK0L 2G2NA 2BK8A 4PJGF 3MRIB 1NFDA 1TR7A 3SGKC 4PVMA 4K2UH 1MRDL 3DSFL 5HHMD 5KVEH 2GYSA 4IBLT 4YC2C 3QDJD 2CKBH 1T3FA 5LGKA 1CGVA 4NNYA 1UD4A 5JHDE 2QVMA 2KLRA 3T2NL 5DJZB 1BMGA 5J1AB 1D2PA 3P40A 2XWBA 4HF5H 1ZV2A 1Q90A 1GXEA 3CBJB 4AYSA 1S3KL 2J4WL 4U1MA 4QOKB 2UWEF 3FB8B 1J9TA 4N3UA 3ATFA 3ULUL 2AQPA 4TNWF 2BP8B 3OQ3B 1AXIB 1AI1L 3QH3A 4HYTB 2V9TA 3G08B 1YYCA 1AGEB 4Y4HB 3SGDI 1TZHB 5AAMA 1KZQA 1PEWA 3CDFA 4XC3L 3BAYA 4JKPH 4UAOB 4JHVA 3QR0A 5FW6A 2V7HB 2C8NA 3SO3C 3GJEB 1SOQA 5HJDA 1QWUA 2QV4A 4R0LC 4QHNB 3FO0L 5KS9B 1IAOA 3CDZB 3MLRH 3A67H 5DC4B 3VD9A 1RZFL 3P69A 3LIZA 2NLJA 4H0GA 3SKNA 4ZFQA 3DV6A 5I1HL 3H9SD 3BZEB 5HY9B 5CJXA 3LN5B 2WLIB 1AXSA 3TBSA 2GJJA 1XIWD 2BNQA 3QW9A 4JPWL 2HLFD 4JFQB 5K33A 1QHPA 4JKWA 4N1HB 2A83A 2UXGA 3MLYH 5H94B 2YBRB 1TDQA 2Y36L 1IGCL 5CEYA 2DQTH 3P0VH 3QUKA 4XN8A 4Z7VB 5DRNA 2EH8L 5DJ0A 4I1RA 1UA6L 4PR5A 1N0XH 2AXJA 5JLZB 3RVUD 5F1NB 4FXKC 4XP6H 3HE7D 3PQYE 3IPBA 4K71C 2BZDA 2CBPA 2DQCH 4ALAL 1CGSH 1PAZA 5BUGA 5ITBL 5LXGH 2YAEA 1T7ZA 4FLQA 4AEHL 2P8PB 5IB3B 4O51A 4UT6H 3UERA 2VQ4A 4K3JH 5HD8D 4WY7H 4OZFB 4MBOA 4Y4FC 5KS9E 4OD2B 1Q4NX 1DQIA 1X9RA 5FCUH 2X70B 1EXGA 4LDEB 3PHOA 3ULVC 4M5YL 3MV9A 4HSCX 2AITA 3DMMA 1N6UA 4XX1E 1KTRL 3KR3H 4ZFZB 1TUPA 1I53A 1NC2B 2LW3A 3GSOA 3N43B 1CTNA 3MZTA 3ZUCA 5AOIA 4OCYL 4Z7WB 5E6UB 4RMBA 3TF7C 1NM9A 3V6FB 2FL5A 5KBNC 5I0DA 1D5ZB 3QEGL 3VXMD 5CGBA 3S35L 3H0TB 3FU6A 3R7QA 4L4TE 2BVOB 4Y5XC 2Y23A 3VGAB 4Y5VC 2XG4B 3U9UA 4YHYC 1YUHB 2Q3AA 4CNIA 1D6EA 4NP4L 5I6LA 4AYBA 5KYUB 3W9EA 3CDGB 3N1QC 1M05B 2TAAA 3EJYC 4NN6C 4ZOEA 2ICEB 1PSKL 1VPOL 3S34L 2FJGB 2WOYA 2OZ4A 2LT9A 1Y0LB 5TDPA 4ZOAA 1OTSC 3RI5F 4CGUB 3M1CA 5F7HA 3B9KC 3VFNB 1NCCH 4JY4B 2VXSL 4PCSA 3RVVC 4EN3D 5I19L 1HIML 3LEYH 5KTEH 1CVSC 1WG3A 4WFHE 3UG5A 3VACA 2IQ9H 4DUVA 4Z1PA 3HBPA 4KGLA 3ZTJG 2G3XA 3NACL 3HBQA 3SCMC 4PJCB 4J3UA 2F53D 3QORA 1BBJB 3K6FA 4GUPB 3ARRA 4CADB 4Z7WE 3HFML 3TP4A 2Y5EA 4PLKC 2R2HB 2QSCL 3MOBH 4O9HH 2PYEE 3I85A 1G9ML 1JPFB 3GSQA 3T65A 2Z4QA 5ACLA 2OTUA 3MLUH 4OLWH 1NICA 1CD0A 2C1OA 2ITDA 3AQZA 3QZBA 2MCPL 3GIVA 2XLLA 3L5WA 3PWVB 1EA9C 1G0XA 3ARYA 3K5RA 3RIFF 3WN5B 1T04A 1JERA 2CHWA 3OKNB 4KFZC 1SHXA 1ZY9A 2OXGB 4LT7A 2DWDA 5KAQG 1NIBA 5FDYA 1A0QH 2R2EB 2UXFA 3WJJA 4EI5D 3UPCA 4NZRL 5DUBA 5DUJA 3VFSA 3LPWA 1DJWA 4QRFA 3MYJB 2R29L 2UXTA 5H4YA 3F7PC 5DS2A 3GB7A 4JPKL 1EAOA 1I1CA 2J44A 4EIUA 5FA4B 2JELH 1D9KC 4WGWB 5C92A 4FG6D 1EHLH 5AEAA 4DCQA 1J8HD 2BIHA 4F7KA 2A9AA 3H85A 2CDEA 2WCPA 4PJCE 1RZGB 3UZQA 4ABVA 3NCJH 5D7JA 1FZOA 1P5UB 1TVBB 2B1HL 2ARJQ 5D7KD 5DEZA 5T1MB 5MEQA 1F6AA 2YQ3A 2XU9A 1DVTA 4N2HA 2Q20A 1HAUA 3MHZA 4AL8H 1DO6A 5GGTH 3SYCA 2EVGA 3RNKB 4N8CL 2FIKB 4W9KC 3W11C 1CFTB 4MVBC 3MXWL 5HHVL 5HDLA 4RA0C 2QL1A 4N8VG 1BP3B 3R7RA 3QDMD 2XN1A 1E4XI 2GJ6D 4NWUH 4I1NB 4S11A 5HDBF 3WFZA 2EDDA 1JNNL 1MCJA 1IILE 2F8XC 4EDXA 4DZ8B 3BKMH 4PGDB 2CO7B 5C0EB 2W59A 1QNIA 5DJYB 5B38B 5TH2A 2DLEA 5CFAA 3QQDA 3UIYA 1GGBL 2B14A 4WKZB 3NP3A 3QG7H 3CNKA 2X89A 5I1GH 2L0DA 3JVFC 4IIZA 5GGVL 3LEXA 3KLAB 4FNUA 5CHNB 4X2UA 5AW7B 3LZLA 1OGSA 5CCJA 2BWIA 5E6IB 1H15B 4G6AD 4N2EA 2BVPA 3FTWA 1OCOB 1CI5A 2BINA 4M5ZL 1QWHA 1HXKA 4DO5A 2HJKA 2VDKH 4ZFFB 4ZFGH 3FCTB 1KNOA 2CRZA 4WW2F 2FNWA 2ED6A 3K7UA 4N87A 3QUHA 1I75A 1M56B 3HI5H 1IIIA 3ECBB 1V8HA 4G8EA 2JXMA 4TL4A 3C5XA 4A7QA 3DX7A 1E7UA 5GS0L 3QEQD 2PWGA 3NSJA 1ZS8A 3BXNA 4GO6B 3S4SA 4ANVA 4EUPH 2UZYB 4FKKA 3WXWH 2AXGB 4KJQD 5JIHA 4YE0A 5J3HD 1MFCH 3Q8FA 4XN7A 4NQED 3G5YA 4FFTA 4PM1A 3UBGA 3VWJD 3ARGD 4FNQA 1XMWA 4WU5B 2XWJB 4ZMAT 1EVUA 5DZAA 5JPNC 2XC8A 5CAYB 4XCCH 5JXEA 2YS4A 4IEFB 2UYLB 2RQ8A 2NQ3A 5SX4H 3R1GL 3QEUA 4TNWK 2EH7H 4PJEE 5BO1L 4PWFA 3EHBC 4GRLC 5D6DC 4KK8C 4TLTA 4X7EC 5I5JA 3BKCL 2XXCB 2DIJA 3DVFA 3PPSA 3V4VA 2OL3B 2WYHA 2WOBA 3HAEG 4L5FH 1SOXA 4GP4B 4M4PA 4P2RA 3UMNA 5JDSB 3T6WA 1KTCA 3E6FA 4JFHD 3FTVA 4X4MA 2YQGA 1J0JA 1Q9LA 4MS6A 5GZOA 3IRCA 3L9BA 3NAAL 1FVCB 2WVVA 4LPUA 2ZCKH 3EF4A 3ABZA 5I73C 3LIZL 4LDCA 2UX7A 1SNRA 5TQ0L 1BD2B 4DPBX 2H3NB 2DJ4A 4X5QA 4BJLA 5EORH 3D25B 3GHBL 5HGGS 3N0AA 4BH7A 1U6AH 4ODSL 2XQBH 3TCTA 4OFQA 1X4ZA 5IEHB 2JB5L 4ONGL 4XNAA 5DT1L 1ZIAA 1KJ2A 4WCYH 3GSUB 2L7EA 4KNUA 3LQMA 3WIHA 2WUBL 3NCCB 4ODTH 3MV11 4NFDA 1XGTA 4ZPVB 2GITA 1KEMH 2VDQB 3GMOB 1CE6B 2HCZX 3QCVH 1CFVH 1YEJH 4NQVB 3EXJA 4XVOA 1LWJA 4GKZA 3QCUL 2VLKD 2OFQA 3IJ9A 3V7AE 4LASL 4A7GA 3VXOB 1GYWA 4B3VA 4DGVL 5K9QI 1QHQA 3CN0A 4FQIH 5DURD 2VLRD 3K71A 2DTSA 1WQVT 3FO1A 4PI2A 3GYRA 5IEKB 1FCCA 4R2GD 1QKZL 3IFLL 4LIQL 1JPSH 4MJIA 2DLIA 4HGWA 4RAUB 2AJZB 5T1DL 5DJXA 1KXHA 3V5HA 4XRCB 4TPRL 1OAYH 1I3RA 5CU9A 5K9JL 4K7FB 1Q9WB 1IC0A 3N85H 4MA7L 2A77L 3CK0L 1BD2E 2Y7LA 4JW3A 3VH8A 1LJMA 3BRDA 2GEEA 3OMAB 4LLDB 4N9GB 1S7TB 3EYUL 3P3YA 4P48A 2XN9D 4K94C 2HFFB 4AQAB 2OQJB 3U0PB 4F2EA 1KEGL 4JO4L 5KSUB 1MW3A 1JZ2A 4N2FA 3HI1B 2VN5A 4U1KA 4X50A 3VWKB 1IARB 2MKLC 5LQBL 4FCAA 3S88H 2AJXH 1AP2A 4HUNB 3GXDA 4HJJH 4S1QH 4IHOB 2IGFL 4G5ZH 3VI4A 4U3HA 1B6UA 1U3HC 1UD3A 2YEZA 1JHKH 1PLGH 3EO0A 4V1DD 2GT9B 4UAHA 2Y3NA 1XL4A 4F2ME 1UWEL 2W60B 1A2YB 2XX1A 2WXLA 3OQRA 2DQGL 4IKIA 3ZZLA 2TRYA 2NDFA 4X83A 3L1EA 2OZ4L 2XZCH 4LSRL 3ESUF 5E9NA 2YGQA 4GRWH 2XUWA 3B43A 3WGVB 1JFQH 4PB9H 4PVBA 3BAXA 4QXUH 1HKFA 4EXPX 2D2CC 2FJUB 1Z32X 4LL1A 3FSAA 4B5ZA 3K3QA 2YUZA 3B7TA 1UVQB 2BM3A 2ICCA 1U92B 3S98A 3QP3A 4I0PB 4O2CA 5I8EB 4X6CB 2D2OA 4NT6A 1BXAA 2WO2B 3KYNB 4FCHA 2WY3B 4YL4A 3D3VD 3CVHB 1MNUH 4U6HA 3QIBA 4L1DA 2YD6A 4TQEL 4CU6A 1D5BB 3QG6A 1E9PA 5EU6D 1HT6A 1XGZA 5IWLA 4XWOD 3MA9H 1IU1A 2DBLL 2OAAA 3UJTH 4C83A 3D8MA 1JMZA 2XWCA 1J0IA 3F7YB 3OV6A 4X5XA 4YHPB 1E4WH 3ARBA 4AQ1C 2XWXA 1ZOXA 1ZT7B 3O11B 1L7TH 2D4DA 4HKBA 4NJAH 1NDGB 2WQRA 3KPOB 3OC5A 4P46C 1R5WA 5A2JH 5IFAH 3FQ1A 5FO9A 1WAAF 3TLRA 3VFVA 5M95B 1E9QB 1LL1A 4NKOA 4ODVL 1MDAA 4UILH 4KJWC 3W57A 2ESVE 3IMBA 1RP8A 2MH4A 4U1LA 3DETC 2AJUH 4CC0A 2Q7NA 3S36H 5CZRA 3VRJB 3LQAL 4YEFA 2Q2EB 3KCPB 4KAQH 3MRDB 1ZTXL 2ODHA 2DW5A 2A9DA 5BZWB 3ZTNH 1ZA3A 1YQVL 4IOIB 4X4YB 3O81A 2IAND 4Z7AA 4RH4A 4UZSA 4D0CA 4FGMA 4GUQA 2F1EA 1H5BB 4D9LL 2NCMA 3EBGA 2DQFB 3NA9L 4JM4L 1S7UB 3FU8A 3KNBA 1IEHA 4LCWB 3MRBB 4UT9A 3QB7C 1NDMB 5FYLH 5AZEH 4FLHA 5ICZA 1EO8H 4RMUA 5AZUA 1OPGL 2AQRA 2VN6A 3TZVC 1JWUA 5JXAL 2WCSA 3VM5A 2F15A 5DJ8A 3T9WA 4XMPL 1NBYA 1KCKA 1BXVA 3LNFA 4HAFA 4MAYB 2HRLA 3BP6B 1FVDA 3MV8A 3V4PA 5F9JB 2VDLL 4P3WA 4U3XA 4XXWC 1KJMA 4G7QB 3FUKA 3VD0A 1CFBA 1NCAL 4HXAL 3ZYIA 3OAYK 3MLPA 4JFVA 1PU0A 2VISA 1DJXA 1W72B 1ZHKA 2DIEA 1ZT1B 2J6EH 3BPNB 1I1AD 2VDNH 4GOSA 4K5LA 3FB6B 2WJ5A 4NNPH 2LLLA 4IOSD 4XX1G 3ZLQC 1BWWA 1SDDB 2R1WB 1IBGL 4TLKA 1FAIL 1IQWL 1MF2H 2NTFB 1OARL 4K8RC 3VYPA 2EIZB 4KQ3H 4XMTA 1WWAX 3UBXI 1EX0A 1EVTC 4Y16C 3RLSA 1S9YB 3JXAA 3SE9H 1U8PA 3OSVA 3WY3A 1J87A 4GQ9L 4LCWE 5DHYB 5FXCH 3DUSA 1NIDA 4KZ0A 4AEEA 3WEXB 4YOKA 1VFMA 1FE8H 4R4NC 1JGLH 1P69B 2P45B 3FUDA 4RFEB 1UG9A 4UOJA 3DX2A 4XP9L 1H8LA 4UV4L 3GIZH 4KKNA 4PW9A 3IGLA 3D85B 1HQRB 3SE8H 1AKJD 1R0AH 1JXFA 4W1TA 4G6JH 2ZXBA 3BQUB 4HDIB 5CWSA 5EPMB 3DSNA 3S37H 1YEGL 4QY8A 2D7QA 3O41B 3GSRA 2AK1H 3X13A 2FJFA 3V8OA 2N7SA 2AK4B 2YO3A 2K70A 3QUXB 1D3CA 3HA0A 4PRHB 3RWHA 4XH2A 4MDJB 4AT6B 1NPJA 1ZWIB 4OGXL 2GK0B 4RMRA 3U46A 4YK4C 3MBXL 3S6CA 2ICWB 3KW7A 2VL4A 2FHFA 3APFA 3KLSA 2G30A 3EF7A 1RD6A 4PEEA 1NGYB 1KENL 1ONQA 2FWLB 2PR9A 1F2QA 5GSVA 3GLEA 5EO9A 3V0FA 5JW3L 1C8QA 1PTZA 2BP3A 2IH1A 2HPOA 1N26A 4O2FB 1QSFA 1SJHB 4YBLB 3QQ9C 3GRWH 4PJIB 4XAKD 4JCWA 3V4VL 4DETA 5AAWC 5C1MB 3PXJA 2DDQH 2IPUG 1FHGA 3MGAA 3QWRD 4GAYB 3PL6B 4GLRH 5DHVA 1LEGA 1FRGL 3Q48A 1FZKA 1OW0C 2XJKA 4NCC2 4APQD 3TV8A 2EINB 3PWPD 3CFDB 3OHXB 4HUVB 1BVZA 4AYID 4D7PA 2OXHB 3SJVA 4S2SA 4WUUB 3WUWA 1MN4A 3KPSE 2WNWA 1DLFL 2BZ7A 4PRHE 5CCGE 1PIFA 2R1XA 1M3IA 3ZE0F 2FYVA 2N1TE 3STZB 1FORH 5IMKA 3HC0B 4DP8X 2H9GB 5DUPL 2NY5L 4K15A 3N5AA 4PCYA 1KJ2L 3NZHH 2BWQA 4OZGB 2ID5A 4F9PA 3MOQA 1VGKB 4X99A 2JKNA 3WIHL 3KXFD 1DBMH 1XF4B 3POHA 4P4KB 5FGRA 3LPPA 5L6YH 3QUYB 3E6HA 1RJZA 4XP5L 2MTPA 1H19A 4WTZG 3WY4A 1U36A 1J1XH 2BNRA 1AO7A 4PJIE 4AQ8A 4C47A 3AG2B 5DS1A 5BS0A 2EVHA 1HILB 4AE1A 1QRKA 2PPEA 4YAQB 5IW1A 2NYKA 5D55A 1UB6B 4MJ6B 4M7LH 3BO8A 4LCYB 3HRPA 1E9OA 1K5NB 5HJ3B 1T0MA 1DN0B 1QFUL 2VDRL 3P11L 4OW6A 4L23A 4R7VA 5DFWH 1OF0A 3ZHFA 4WO4A 4WUUE 1LP9F 4HIHA 43C9B 3ARQA 5KSAD 4GUOA 5JIIA 1IGFL 4AL8C 2HWZH 2B0SH 3EKCA 3BGMA 3IWUA 4NSKB 4XOCA 2HH0L 3VXRA 4M6ML 1P5VB 1A7OH 3T4AA 4JR9L 4DN4L 2CO1A 3QC6X 1OT1A 1PAMA 1UM5L 1UKTA 4OZGE 4W4OC 4JDEA 2R56H 2ZWKA 5DHDA 5JOFA 4ZNCD 4PUBL 1PX4A 3HC4L 32C2A 4ZX4A 4XCFH 5JW4M 1NM4A 4L5FE 4NKMB 2E46A 4ZMTA 3EJYD 4XNQB 1JZFA 3VMNA 1KBKA 1P7KB 2XVBA 2FRGP 2H41A 1X9LA 1KWKA 1I7RA 4FHBD 5AZ2L 2I25N 1YPZF 4QKTA 4BXVA 1CD1A 3KZ8A 3B9KD 1PD6A 1O6SA 1MI5D 2WW8A 2VDPL 2V7NB 4G3YL 1NTDA 2WLHA 1XGQB 3KWWA 3U0WL 3CSYA 1KPUA 3KCWA 4D9QE 5E2UH 1ASQA 2X1QA 3SCMD 4B6ZA 4JGMA 4OCXH 3VFOB 4CN1A 4Z6AT 2EE9A 1TYJA 4RVBA 4HKZB 4FXGA 2X4OA 4I9WE 5FK9A 4OCWH 1AR1C 1MHHB 5D8JH 1JXJA 1JNLL 1RXLA 1DQMH 5I1DB 4XHJC 4PJAB 5FM4A 4JFSA 3RA7L 4XMKL 1GHFL 4M93C 3VGGA 4ESKA 5IJDC 1OAUL 3ALWA 5DRXB 7CGTA 1L9RA 1NLDH 4WFGD 4ODXB 3TO4B 1ANUA 2P7TB 3ZDXF 4NPJA 4JGUA 3RWEB 4BRVA 3QVAA 4NZTH 4QNPF 5CBEA 3AADB 3NRFA 2Q2LA 4IJTA 5FYKE 5A2CA 5I1IH 2OMXA 3INUL 2CLRA 3NH7H 2JIXB 2VR7A 4NHCL 2C7UA 3QPXL 2ZUYA 1A7NL 1GGIL 1W8NA 2KBGA 2LFGA 5I17A 1Y6NR 3BWSA 3IJSA 4NO5B 3RWFA 2NY1C 1MCOH 1RUQH 2I27N 4A55A 1J11A 5EBMA 3PXLA 1WJ3A 4IOFD 3DOHA 2YRPA 3LNEA 4WW1A 5E9DD 2F74B 2FGWH 4QWWD 2FBJH 1D9KD 1IZKA 1NFAA 3CHPA 2O5YL 5BVJB 3AREB 1QFOA 4ANUA 1ZDQA 2EDWA 4FOMA 1WV7T 3OTTA 3GSVB 3RFZC 4D7BA 1N7MH 1ILUA 5MEOB 1D7DA 1BXXA 1BQRA 4P5TC 1HI6B 5E99L 4AG4H 4Z0XA 4PJAE 2WB1A 4H1LG 2JNZA 5DEGB 1KGWA 3D18B 4OGZA 5IQMA 3UTZB 1N8OE 1X3DA 2NX5E 2H26B 3C6SA 3FU7A 4UT9L 3W11D 4Z3HA 1EJFA 2A74B 1RZ7L 1HINH 3CFMA 5KYWB 5ILTH 2GIYA 2IXQA 3MBEB 5H37A 3NJGA 1F8TL 4KXAA 4OFDA 4ZAKC 2XV2A 5KBKA 1IM3B 4GRWE 4NGHH 2BFVH 3PGFL 1E50A 5GISH 3V4PL 5L0QC 4HPHA 3WFCL 2D03L 4OGYL 1MWOA 5FHAH 1X7QB 5L88H 1OSZA 4AIEA 3QUZC 3FUEA 5E00B 3KJ4C 2X0UA 1TT6A 1A9EB 3VQ2C 2DQDH 1MQKL 4ZTOH 1JK8B 4LEBA 4PJHB 2JLPA 3S96A 1QUNB 1RK1B 3CH1B 1KIUA 2GSGA 2B5IC 5I76A 3DVGB 5F7FA 3W1ZA 3M7OA 5ERWA 3G6JA 4ZMPA 1MEXL 1Q9OA 3ZKMD 4TUOB 5J4MA 3KPQA 2VLJB 1VRSA 1F6LL 4BZ2A 5LO7A 2GFBA 4HIIB 5IMMA 1KTKE 4OIIL 5FKPB 4N2CA 4LLQA 4XVTH 3N55A 3RZCA 1K8DA 2V3FA 2V9UA 5MP6L 3VQ1C 4N0FA 5BZZA 1MIEL 4N2NA 1KEGH 2JJUA 3JWDL 1O7SA 3KVDD 1ZHNA 1RZKL 5KAQF 2WO3B 5J7CC 1BPVA 3X17A 4HT1L 3UDWC 1AHWC 4BFIB 3T0EA 4XB3A 4NBXB 5GGUB 3BUYA 3FNKA 1CBVL 4QRRB 3LNHA 3QEHA 4YDIL 5FAAA 5TDOB 2UZIH 1J9CT 2C9XA 1C5DA 3OB8A 4JPIA 3RTQB 4HXBH 3HS9A 4HX1A 3S5LB 1M6UA 1ZHLA 2Y2WA 1BIIB 4UNVA 4PJHE 3DTDA 4PRNA 5EWIL 5CJQL 3TA3C 4ZO6A 3RDJA 1AGCB 2V37A 4R6UA 3DRTB 2GC7C 3MRRA 5AENA 3MRCA 1A1MA 4QPEA 4W6WB 3GMPA 4Y5YA 1QNZH 4GRLD 5DD5L 3AT0A 4HWUA 2WXMA 2BX5A 4QIRA 3L3GA 1E42A 2ZCLH 4POUB 3NK4A 4JCLA 1X5JA 1KFAH 4Z5RB 5EU4B 4GXFA 3BH9A 5FR3A 3Q01A 4NEHB 3Q8CA 2NY6C 3F12B 4XHQA 2GBAA 3QI9B 2OMYB 4UIMA 1O5DT 1GOFA 1GY1A 3NIGE 4ZDHA 4TUKL 3QJOA 3BE1H 3ENEA 2W0PA 2DQIL 3ILPB 1ZLWK 1ETB1 2Q7YA 5T5NF 2Q6WB 1HHKA 3GSWA 4FQ1H 1XF5B 3G9VA 4EIBA 4ECNA 4YDKL 4N2MA 2OTWB 5E5UB 4FP8H 3CZEA 1FCGA 4F33A 1N12A 1KGXA 3EYVB 4MXQC 2ZOUA 1RJYA 1FYTE 1MKFA 1PY0A 1FJ1B 1SQ2N 3BYYA 3GSNL 1Y07A 1AQDB 2XN2A 4PJGA 4PJ5A 4U6XA 5T3ZD 2WBWB 3PE9A 3KL3A 1M71B 1JDAA 2WXOA 8CGTA 1UENA 1TNNA 4PJ8A 4GG6E 1MJ8L 2WTOA 3T3MF 4B9GA 4KDTA 1S9WA 2NCEA 5D2LB 1MPAL 4PJXE 5GGSB 3NDYE 1CK0H 2A9CA 4X4XB 1ND0B 3ZDYF 5IW6B 3NZ8A 3PJNA 1JPEA 2R69A 3IMRA 3W37A 4L3FA 2VXVL 3F65A 4G8IB 2JSFA 2O4EA 1JUFA 1KT2A 5DLMH 4GBXD 4D3CH 5H4ZA 2WWMD 3D4CA 2UWEA 3V4UL 3O3BA 3PWLB 1E90A 4ES9A 1MVFA 5I5RA 4JRXD 2ZKXA 3HNTL 4IBYA 1IMHC 3PNWB 1DZBA 1E8WA 5ANMA 1NFKA 1I31A 2JV6A 4WSKA 3A4FA 4W70A 5D1ZC 2NOYA 4JQXC 5IMLB 1L7IH 1A9BB 3C6LB 3HZ3A 4FQCL 4UYPA 5KSBF 4XPGL 4P23C 2FEJA 3II2A 3SSGA 3N91A 1MJ7L 1H3GA 1U3HD 3ARVA 4LAQL 1L6XA 4OZFH 5KVDH 4BCZA 5D2LE 3FU3A 4NP9A 3DOSB 4WWKA 4NOFA 2QTVA 2X09A 4JO2H 2EABA 5E8PA 5HPOA 3IS0X 4XNZC 1OHZA 1WIUA 3U4BH 1G5AA 2HFTA 3RDTA 2QMJA 5MENE 5E6SB 2AP2A 4XWGH 3MLWL 4U6TA 4DO4A 3FTYA 4M3JA 4TSAH 3L3HB 4WEBL 2GVYA 4JDZB 4M7JL 1NGXB 4JS7A 3APDA 1A14H 1CDCA 4UM8A 4MMZC 2OKMA 5ESAB 4A2EA 2I60H 1NFDB 1UJTA 3ISRA 3WAKA 1AD9A 1C5BL 1ZMYA 2HUEA 1NCOA 1VKXB 4BBWA 5SX5H 3GS0A 1UKSA 1T3FB 2VN3A 1BLNA 3GZOA 3MV7E 4I18A 4NNYB 5HI3C 4JAMA 4BM7A 3EGDA 3V6ZA 1V27A 1I9RL 3P3TA 5C07D 3HG1A 2XWBB 3Q9QA 4GO9A 3QRBA 4NKIL 2B16A 4IRJD 4ONFL 3ABMB 2UVEA 5DMGD 1RIHL 4AV4A 4U1MB 5FO7A 4KJWD 1IGTA 1CYXA 1TLMA 4OV5A 4K5OA 4MZRA 1GR7A 3DETD 5DVNA 1CGUA 1GAFL 3H9HA 3QH3B 5J11B 5BRZE 1JHLL 2ZX9A 2CHXA 1JFHA 3LQZA 1S7RA 2LTQB 1KBBA 2VTFA 4OTXH 1VLXA 1P84K 4W9JC 4W9LC 2X4RA 1R47A 1MFMA 1P4LA 4YX2H 3GM8A 2XXMB 3UIZA 3ZSSA 2DLFH 1GL4B 4Y2DC 3ZKXC 5G4NA 2JKLA 1FC1A 1IAOB 1E3FA 3SBWC 4RSVA 4W9IC 4KHTH 2NLJB 1TQCC 3NIDB 3SKNB 3A0OA 1HESA 4WV1A 5IB1A 3SYQA 1S5HA 3TZVD 3UBFA 1W8EA 5F7EH 2AMGA 5F6IC 3D5OF 5IB4A 2HRGA 3V6OC 3TBSB 3LAFA 3LHAA 3P0GB 1MIMH 2BNQB 1WTLA 2BIOA 2OP4L 1T89C 4YSOA 5KWYC 4LSSH 1DZ0A 5J13B 4Y19D 4L9DA 4RWYL 1CQYA 4EBQH 1BX2A 2A83B 1P53A 2AJVH 4PAZA 3SZKC 4JM2C 1RZ8A 5CEYB 4ODHL 5I15L 3S3SA 3QUKB 2AQNA 5DRNB 1THCA 4GIPD 5DJ0B 1PG7H 4PR5B 2XIDA 5IHHA 2V5RA 4XX5A 3SE4C 4EUPG 1DQQA 3D0LA 5SWSD 3I9GL 4U0RB 2B4CH 4KKQA 4X7DC 3ULVF 3SGJA 3MACH 2DD8H 1P84J 4O51B 5JPMB 4M5SA 4K8RD 1UASA 3V79C 5F21B 4OFYA 4DSYA 1UOVA 1FSKC 3G7TA 2WQUA 2NT1A 4JFOA 4TQIA 5I5IA 1N2RA 2AAVA 3NEOA 4JGJA 3PHOB 4P59H 1PLBA 2CUMA 4JVWA 3F85A 4P2YA 3MV9B 3MLVH 4I87A 4D9RE 3BVTA 4R4ND 4H2CA 3W2DH 3O2VL 4BZ2L 3L9YA 2FO8A 3DMMB 1E28A 2L4OA 4AMXA 5GRWA 1XD0A 3GSOB 3L5IA 5F70A 3LOWA 4Y2OA 3TPUA 5GIRA 2PP7A 3FSZA 3ZMNA 5LWYH 4E9LA 4HMEA 4R4FL 1PZ2A 2C9PA 1QW8A 2VW6A 3CFCH 4G6FD 4R97C 5E1QA 3EJCA 4ZMXA 2FL5B 5EIIA 1FNEA 2QVTA 3UJJL 3VSVA 4WUKH 4C4UA 3P54A 2YHGA 3PY9A 3QZPA 4MXWL 2C9VA 4UM9A 5BQ7A 1GKEA 2QQQA 2XZAL 2C3VA 4KX7A 5LN4A 3U9UB 4CNIB 4KVNH 1D6EB 5DJCA 3KPMA 2BRRL 2GIMA 3SPGA 4TQ8A 2PP9A 4XE0A 5CJOH 5DWUL 3W9EB 1FFQA 2WANA 2QJDA 3FFCD 4MNGE 4IKKA 2Q3ZA 2F5BL 4LIQE 5TDPB 4M7ZC 3MXVH 1XTLA 1CLOH 4DP4X 2A6DA 3U7YH 1L9SA 2DY2A 3MV9E 2QBWA 4DGYL 5LG1A 1XB8A 3QQ9D 1XCWA 5AKTA 2PR4H 5CUSL 4HJ1A 1UFGA 5BNXD 4M6AA 1JCVA 2PO6C 1N19A 3LS5L 3QORB 4MAUL 3V5DA 3V0WL 5LBGA 4Y1AA 1OF2A 2B7DT 1TJIH 4LHUG 2NW2A 3UC0L 3DJZA 1RURL 3GSQB 3T65B 1JRHH 2Z4QB 1MY5A 3CV5A 2OTUB 4WJKB 4J3OD 2C1OB 2ITDB 4G8GA 2YGVA 2BCMA 3CVBA 4G59C 4G70B 4HS8H 5F72S 3QYCA 1CXLA 3EH4B 3GIVB 1H6TA 1TJGH 3L5WB 5J0BA 2ZKHH 4WW2A 4EI0A 1T04B 1WA2X 1XH0A 3NBNA 1WCBA 4OU3A 3GO1L 2ZYIA 1IAIL 3L4TA 2DWDB 1LE5A 4KMTH 5DSCA 1HL4A 2HVJA 1IFRA 2O6PA 1XSIA 4MA3A 5DUBB 3ZRSA 3VFSB 2WLZA 3ZMRA 1O6VA 1KTLA 1S9XA 4NQDD 3AS0A 3GB7B 3UAJC 3GMRA 5CJBA 2Z92A 5EF0A 2HLAA 3ZDZB 4DCQB 2CCWA 2CDEB 3SKOA 3UZQB 3IJ8A 5HSFA 1JYWA 2R69L 5D7JB 4BDVA 1FZOB 1NIAA 1SLXA 5GJSH 5MEQB 2IIJA 1FPTH 4IJ3C 3LZNA 2VR4A 1UZ6F 3TV3L 4MJ2A 4PGEA 3LKQA 4OBSA 4G9FA 1H3VA 3TONA 4OIFA 2VXQH 2EDXA 1X5ZA 1XF1A 1K4DA 4LQFL 2BOBA 1IAKA 4KK5C 3FHAA 4M8VA 5A2AA 3TBVA 3TN0A 4E9TA 2PXYD 4NZJA 1I8MA 2OZNA 3UJIH 2VDLB 2ZWSA 4K7PH 1AACA 4XBMA 5DEFA 3B83A 1TXKA 3I75A 5GS1C 2W0FA 1RI8A 3HRZC 3VTMA 1TPXC 3MNDA 3E3QE 2J1ZA 2C9AA 4EDXB 4GSRA 4P06A 1WD9A 1FNHA 1ZLDA 1ZTXE 4JDVA 3SKJH 4UQ3A 1HE7A 3QQDB 4N85A 4JRYA 4NHUA 2J73A 1YMMD 3FTXA 1T1YA 5DWPA 3INOA 5I8KL 4EQ2A 1NGQL 2EKSA 5TPWL 4JFDD 2OCCB 5AVXB 3J2PA 4YFLI 2VAJA 3NK3A 3LEXB 4WFED 2PTVA 2WP3T 1GC1H 2HUHA 1PKQA 1N70A 4MA8L 2VERN 4KOCA 2BVPB 1J1OH 1YEKL 1GGUA 4KQ4H 1T03H 2HJKB 2QGCA 2Y72A 5ISZD 4Q6KA 1KNOB 4KXZI 2X4SA 4LPWA 3KPRA 5FX3A 3SGDH 4YDZA 3TVMA 4BK5C 2O61A 4LGRB 4M8UA 1MCNA 2YD9A 4XHJD 3UXFA 3TURA 4G82A 3DHPA 1P4IL 4G8EB 2JXMB 4PSPA 3DX7B 2KYIA 3SDDA 4UQ9A 4IHBA 3SYAA 4UI2A 1ZS8B 3BXNB 2I7OA 3QGVA 4PWIA 1ZPUA 2VERA 2Z31C 2BDNL 3D30A 3L4YA 5HGDA 4F15B 4GMSH 5KYYA 3KL5A 3RWJB 3HB3B 5GJTL 1UJ3A 4K5MA 4A2HA 5CINH 3G5YB 4JQVC 2K6WA 2H1XA 4OZ4A 1BFTA 4FXLA 4AW4A 1OP3K 5F88A 4ODWA 2LE9A 4JN1H 4TNVK 2NY1D 5JIKA 4IU2A 3VRLF 1IRAY 2Y22A 1G7HA 1MWAA 2DYPA 3ILQC 3QEUB 1OIOA 2DH2A 3ZBMA 4IRZH 3D33A 4FJ6A 4LVOC 5K9KA 3CVHH 3EDJA 1KC5L 1RULL 4FFVC 3V4VB 3B2VL 4P2RB 1N59A 5F7AA 2DH3A 1ET5A 5IROD 3E6FB 4P5TD 4F27A 1Q9LB 4IBTA 4OLUH 4XXCC 5I71B 1T22A 1U91A 4NPKA 2WVVB 1A7RH 1XHHA 2ENYA 2PTTA 2PCFA 4KPHL 2G9HA 3AS3A 1JD9A 3V0JA 2EDMA 4BH7B 1PZAA 1O0VA 3UADA 3PP3K 4U31A 2Z6FA 3H3PL 4M03A 4P2CG 3B8SA 1RZJL 1GGTA 4ZMLA 1KJ2B 2XKNA 3EBHA 4QT5A 4M48L 3EH1A 4MLSA 4BCXA 1T7YA 2IFGA 1GS6X 3QRLA 4MJJA 1AGBA 3HVDA 4AIZA 3T6VA 3ZL1A 2BVTA 1XGTB 2GITB 1JGVH 2FK9A 4KI1A 4HJTA 4WSJA 3QQ4A 4Y4HC 2WIMA 4QYOA 4I3RH 4BZYA 3HHMA 4GKZB 5F3HA 4JFFD 5C6TH 4RQQA 4UAOC 3BZDA 4L4VA 4NCC1 3HS0A 4P2RE 5B7EA 1A6PA 2HN7A 1U8NA 3UCQA 5I8OH 3GI8L 3K71B 3FO1B 3LKSA 4MJIB 4HGWB 5DJXB 3UTPE 4RGNB 3V5HB 1WAAA 2VDRB 4YR6A 5JMRA 1I3RB 2CA3A 2YAQA 1ASPA 3CMOH 1FG2A 4BFKA 4OB5H 5BZXA 1Z9PA 3VH8B 3SDCD 4YFDB 1HCFX 5CN1A 1K5WA 4LDOB 4MJHA 2RAMA 3OZ9H 2BS8A 3LN9A 4ICWA 2IJ0C 3KDPB 4PH8A 4QHUA 1X5KA 1D2OA 1KGYE 3BEVA 4EZLA 3O4LD 4MXVE 4U1KB 4J27A 1W72H 2Q8AL 2J56A 4OCRH 4MYPA 3VW3L 3RL1A 1A65A 3L3IA 4HBCL 1AP2B 4O4YL 4F7EA 3OZKA 4U1SA 2K3HA 3KEHA 1ZJBA 1A4AA 3RY5A 2KKQA 3VI4B 2YEZB 3EO0B 1YEFH 5DD0L 5LGHH 4HC1A 4KHXH 3CGTA 3OXSA 4MX7A 2OYPA 3ZTCC 4UYQA 5E4OA 2XVGA 3NSCA 4MJIE 3UYRL 1EZLA 2YPLA 5AUMA 4RGNE 2NY2B 1IGMH 3RGVA 2F7OA 2ISDA 4NM4H 1UD8A 3GC3A 3R8QA 5I1JL 2NY6D 1N6QL 4HFUL 1GPOL 4FZEL 4JPVL 4O2CB 4NT6B 3GDBA 3WJLC 2XI9A 1A6UL 4U6HB 4AM0Q 1PCXA 1OSYA 3EO9L 4PYGA 4X9BA 5B1JC 3QG6B 1E9PB 1MW2A 2NR6C 1HE8A 2H2PC 2QGDA 4NQEB 3DYMA 3F2LA 2BY3A 3GPSA 3F58L 5CGYC 4C83B 4X5XB 1MFDL 1FNSL 1GVIA 1GZHC