3R4RA

Crystal structure of a fimbrial assembly protein (bdi_3522) from parabacteroides distasonis atcc 8503 at 2.38 a resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
284
structure length
274
Chain Sequence
DELSFDMSLVLLTGDTYATTEELTIQNCHVAVFDKDGKRIYFKNFYSKDLGEMKTIGNLSGYELQLEGVRTFGKEDKKVSVLVVANANNANNSPFDNLTTYDGVDNSYTAKTIAKGPVTASLLVKIGKSETTLKYNQDNAPVTVSLIQLSAKIEYTGVYKKENGELLEGFSLTKVAGLNASSKITIFNTSAVENGAFSDLAYPTTKPVTFYTYEISDAFKEVILSVQSGVEPKEYPFPANKFIKGNYYRIKGLKSSTEIEWVLENVEDKEVTLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical fimbrial assembly protein
publication title Crystal structure of a hypothetical fimbrial assembly protein (BDI_3522) from Parabacteroides distasonis ATCC 8503 at 2.38 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Cell adhesion
total genus 66
structure length 274
sequence length 284
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06321 P_gingi_FimA Major fimbrial subunit protein (FimA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2580 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3r4rA01
2.60.40.2590 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3r4rA02
5DHMC 4JRFA 4GPVA 4JG5A 4RDBA 3R4RA 3UP6A
chains in the Genus database with same CATH superfamily
4YL9A 3KLQA 1NFAA 3DPBB 3SO5A 3O6KH 1DQLH 4P2RE 4PJGA 4JFOA 3WFCH 2VM4A 4G6AD 4P9MH 5AALA 1CD1A 3DMMB 3PWVA 3QUYD 4JO2H 4Y2DC 1UVQB 2NW2B 4XBGA 4OZ4B 2HKAA 3NJFA 3VWJA 3NCCB 4J39A 4V1DB 1E8YA 1YHPA 1J8HB 3UTQA 2ZX7A 1T5WB 5HY9A 1QHPA 1BV8A 1V05A 4HHGA 1A7OH 4HKZA 3N43F 4TTDC 5IFHL 1L9OA 3MNDA 4NRYB 2WXFA 3KPNA 3ABZA 4OAWB 4HYTB 5C0BA 1E5CA 3ILQD 5I24A 1U30A 3MX0A 4NOFA 2G5RA 4FZEH 4H1LA 4DPRA 1E3ZA 3CBRA 1DBMH 1VFBA 1D5ZB 3V5HB 1OPGH 3R1GL 3BSHA 4KO5A 1BX2A 4GO8A 5SWQB 3LZNA 5DFVC 4JKMA 4F9LA 1QA9B 1ZHKA 4R5TA 5EU3A 1NL0H 4N0FA 3MUJA 4NOBA 5E1AB 1EJOL 5HYSG 2CM6A 1AQ8A 5JW5B 3WE6A 4YFEA 4LLMA 4HOXA 1KDIA 4X50A 3ZTNH 3O4LA 5DQJB 2V8LA 4JK0D 1EEZB 4X6FA 3IWVA 4NJAH 4G72B 5TD4A 2J1KA 1SN0A 5A1AA 4AIZA 1YYCA 5C0CE 5HHOB 4E68A 4CU7A 1Q90A 4GFXA 2Y7MA 4IJ3B 2FWOA 4KK8D 4LCYA 2F8VA 2D7TL 5E6SB 4JDTH 5MERA 3HC4H 3T65A 3IGLA 2DWEA 3V6ZB 2CGYA 4ZG1A 2ETWA 1BF8A 4FNQA 2ICWB 3L48A 1XBDA 3UADA 4B9PA 2FLMA 3WHXB 3B1TA 3BP6B 3IMSA 4H88L 4CA4A 4YX2L 2X9XA 3VD2A 1QBAA 3HMWH 3P30H 1YPZE 1ZK5A 3P3UA 1K4CA 3A6CL 4N0UB 5AW4B 5C08A 4RDQF 4A2GA 5MENE 4GKOA 1SXZA 4GO9A 3L95B 1WCBB 1PX4A 2E9GA 4UTAH 5CBEA 2NSXA 1IKFL 4Y5YC 3GM8A 3CC1A 2QSVA 1Y0LB 3O11B 2X6UA 5E99L 3S96B 1JZ8A 5F1NB 3OPZH 1OCWH 4OCSH 4ATTA 3HAEA 3OXRA 5FHBL 3WGVB 1XQ4A 2D9CA 5A7BA 4P2QB 1FNEA 4HOWA 5D7KE 1MFBL 1UXSA 1GGIL 1XGYH 4M1DL 2YQBA 5ICYA 5BS0B 2YRPA 4X8GA 5E00B 1HILA 2AQTA 4I5BA 4NKOB 4FA7B 4NHCH 3L2LA 1ZHLB 3VJ6B 4N8CH 1NBVH 3P2TA 4MGXA 1C5BH 1MH5B 3SKJL 1D5BA 1FBIL 3QUZB 3DKHA 3O8XA 4GRWE 3HS0B 4PRBB 1EAOA 3DV6B 3ASOB 2HX7A 1SN2A 3G6JE 3WE1A 3KE0A 1NGYA 4HLZH 2W1NA 5E6ID 4OTXH 5JPNB 3TBYA 3ZDWA 5I1LA 5IR1A 4DPCX 1S7XB 2PO6C 5A2IH 1RU9L 2PYFA 3E9TA 2WUCL 3RB5A 3W9EA 5F88B 4LHUG 3NRFA 1FYTD 3VYPA 5AW0B 4G80B 1K6QH 5IROA 3KLLA 2OR9H 3ARGB 2DI7A 1T80A 1BP3B 4QOKE 5HPMB 4XE5B 3MBED 5HI4C 3C8KB 2BVQA 1DL7H 4Z7VE 3D25A 1KXQE 4PLOB 3H9SE 1RUMH 4GQ9H 5E7BA 4BFBD 2UWEA 4GG6F 3QFJB 5DGRA 3L5IA 3K2KA 5DFWH 3FTSA 4XMVA 3UO1L 3NFNB 2ZKHL 3AACA 1A1NB 1R17A 4KJQD 5G4MA 1N8ZB 5T3XH 4JCLA 4DGYL 3TA3D 3B9KC 4ZMWA 3KW7A 4MVBD 3I3EA 2JKNA 3VU1A 1O6TA 4KJWD 5I30L 3IE9A 4ZMXA 1ORSB 3LXCA 5DQ9B 5ICUA 2HZHA 3TOPA 4MBOA 4M5ZH 1TZIB 1UXLA 5L4FA 2YUZA 2Z4QA 3OL2A 4P2OB 5TDNB 4YSEA 1QSZA 1C7TA 4Z7NF 1U4EA 1KCVH 2MOVA 2BSTB 5E6ZA 1QBML 1T1YB 3UCQA 3IKCA 5HVHC 1G9HA 2OS7A 4G8FB 4M9PA 3T0EE 1N7MH 4OZGE 2XBTA 1G7JB 4RISL 1PYWA 5EF0A 3U2JA 2Q8BH 2HLEB 3HG5A 1V3LA 1HH6B 4X5XA 2DQHH 2YPKB 4MDIA 5I73C 4UIMB 1I53A 1GZQB 5ID1A 3QIWD 4JKLA 4MD0B 4YSUA 3VRIB 1UCTA 3BZFA 2MWCA 3WNLA 4WI4A 1YYLL 4HWBH 2K4AA 5KVFH 4NQEE 4IRSC 4QCIA 1CQKA 5EA0H 5FCSH 2QGEA 4JHAH 5LG1A 5AW8B 2COQA 1R3LB 3F7VB 4F3FA 1GGUA 1YY8B 3ME0B 4D8PB 1P1ZA 2JKIS 5CILL 3UBXA 4GINA 4JFDB 1S9KC 4N2GA 2NMSA 4L3EA 4CNIB 3Q13A 4L8DA 2YPVL 4QI3A 2OMZA 1C08A 4DKTA 4Z7IA 4Z95L 4ZNCD 1OGAD 4ZO6A 3VWKA 4DFIA 2R7EB 2UZIL 4D9QE 3EYOB 3RGVA 4C4UA 4LEOA 4EPSA 5K9OB 5DC0A 4HG4K 1H3UA 2R29H 3BDBA 4NKIL 1NCTA 4MYPA 5IUCA 3QO0A 2CQVA 2E7CA 4MLIA 4ODUB 4NWTH 3ES6A 4PJIA 3KPPA 5DK3A 4N5UA 2GG1A 2A4ZA 1OO2A 2PLTA 2VW4A 1BAWA 2IAMC 2O5YL 3DJ9A 3HI5L 2A77L 2VJXA 2IG2L 4NCC2 2KLRA 5ESVB 2P44B 1G4RA 4BFIA 2DQ6A 4KJYA 3G6AA 4PGDA 4FFZA 4LDLB 3RPIB 3IPBA 1K85A 1GGBH 3QAZC 1I4FA 4X0KA 3V6OE 2AABH 5IBUG 1HHKB 1BBJB 4X6CB 3HZ3A 5DJCB 4YDVB 2GK0B 4HKBB 1UCBL 1RULL 4Z0XA 2DKUA 4X6BA 4MFHA 2K6WA 3CGTA 4OZ4A 5C0DA 2A4CA 2N4IA 1DN0B 1FIGH 1NC2D 3N5AA 1G9NC 4P8QA 4NP4L 4UT6A 3WJMA 4DN3H 1RK1B 1DBBL 1J8HA 5IHHA 4Y19A 1G0YR 1UM4H 3OF6A 1JTPA 1P9MA 2WCPA 1J9TA 3KGSA 4LDOB 4Y2DB 3SJVD 3STLA 1B90A 3AUVA 4B0MB 3MJ7B 3DJRA 5JORA 3IJEA 5T8IA 2EP6A 4KHXL 1BG9A 1IC7L 1SOKA 4GT7A 1R3KA 2B1HL 1D5ZA 4X5WB 3BUIA 2VE6A 2JQZA 4JMNA 5SWQA 1MZZA 2GSGB 4DESA 1HINH 4E9QA 5LGJA 4J5VA 2BP8A 3MRFB 3GHBL 3FQXA 4J8QA 5JW3L 1OAYL 5TPWL 4JY5H 3V0DA 1CL7H 3D85A 5ILTL 4K5LA 3PGCA 2H6PA 2CUIA 4HXAL 3QJUB 1XIWA 1OAZH 2X70A 3ELQA 4QRRB 4ZMOA 4PJFF 4HZLA 3DVNA 5AYQA 3BVUA 3M88A 4F7CB 1BFOB 2MOGA 5DZPA 5BXFB 4ZUUA 1YMME 3CPUA 4F92B 4PREA 2YK1L 1BZOA 4FQXC 2AXGB 5BRZD 2ICWA 4ONOA 3UC0L 1REIA 2J73A 5GRWA 3ZVVA 4QNPF 5HYJE 2UY7B 3LPWA 1BGXL 1S7QA 1KTBA 2MPAL 3GB7B 4FQIH 5TK4A 1MF2H 1UD4A 3OJVC 1FO0H 2GJPA 1XGUB 4YGVA 2FDBP 5FB8A 4M56A 1QR4A 1JDAA 1RVFL 3TX4A 3BZDA 2H3NA 1MJ8H 4XN8A 3L95A 4JFFD 4R0LC 4HCIA 4OJFH 1U8IB 4PLJC 4RGNE 1OQXA 4JRYA 2H9GA 2Y1YA 3QJSB 3BW9B 4TNVK 4BELD 4NUGL 4JO3L 1UZ6E 3DO3A 4P46A 2BNQD 3PAVA 3OJDA 4AQEB 4RDBA 4GUQA 3ZE2E 2PXYD 3G6DL 5CCJA 3RYMA 4ZPVB 4MCYB 1JZ4A 2HLFD 4RNRB 1CT8A 2FT7A 3C6LB 1ZLVH 1OOWA 1AJ7L 1OD7A 5DMGD 3P11H 3RZCC 1R3JA 5F6HJ 3PF2A 4ZNEA 1MXGA 2X4PB 3BD4A 4PJEE 3FBQA 2CO6A 3MLYL 3M8OL 2GEEA 1RJZB 4C55A 4K3JH 1JJUA 1YUHA 4N0YL 4OF5A 43C9B 1JV5B 4AMKH 2SEBB 1Q9WA 2CBQA 4XB8A 1N59B 5JDSA 4UYPA 1H6UA 1N67A 4ALAL 2DWDA 1CU4L 4LMQE 4LPYA 4APQD 4BWTA 5I0YA 3VXOB 5KN5A 4WHYH 2V2WB 3ARGA 4PUBL 2XIIA 1SF3A 4X9FA 2PO6B 2WLJA 4LU5H 5EZJB 4HULB 1MFMA 4I85A 3KGTA 4P5RA 4FLOA 1OHZA 3SDCC 3MA7A 2X4QB 1CPUA 4MB1A 5FUZH 3VA2C 2CNYA 3R7RA 3C8DA 2J56A 4RBPH 5IQ7L 1AXTH 1SLVA 3DX0A 3A6BL 1QNZL 5FKAB 5FYLE 1BQHG 2FWLB 2ENQA 2ILLA 3HVNA 4XXWA 1UEYA 3AG1B 3HZYA 3Q1EA 2BWQA 3KVPA 3QBTB 4Z77B 4HG4J 3KR3L 1F4AA 2FAUA 3FU0A 3VAEA 2AXWA 2VXSL 3SE9H 5BVPH 2QTVA 3B9KB 1CXKA 1Q0YH 3RL1B 4K7PY 4C8XA 1T1YA 5C0FB 3QSKB 2QVTA 3GSWB 4HWEL 1IARB 5J6HA 3AY4A 4PRPA 2QHLA 1KJVA 1MHHB 1HH6A 1AMYA 1HHJA 1XZ0A 3VM7A 3EZ8A 1KULA 4KVPA 3FU7B 2YKKA 4OZFB 4TVSa 4LRNL 4BZ2L 5EBLB 4HXBH 4M7JH 1I8IB 5HVHB 4CKQA 1P7KA 3AWGA 3MBWA 3NQKA 1EAPB 1E5AA 2ICES 3TEWA 4LSTH 3UTTA 1I82A 2ESVB 4PG2C 6CGTA 5C92A 3U9UB 5I73B 2BNRB 2XWDA 3VFPA 4JFWA 4X7TB 3QXUA 5EO1B 2X9WA 1X5KA 5IEHB 3DROA 5BCAA 1NEZA 1NMAL 1NH6A 4JPVH 1W16A 4JFDA 2FEEL 1BZDA 1JXDA 3MO1B 4IRSB 5D7HA 3UJTL 5C0GB 4IU3A 3QYCA 3EHBC 1S9YA 4UTCA 1OT1A 3DSFL 5F9JB 1OAXH 4L3CB 5AVVB 4GPVA 3TEXA 5DUMH 2EDNA 3F5WB 1PCSA 1OSYA 5K1JA 3KLKA 1LO3H 3H56A 2IFFL 2YPLB 5JW4M 3HMXH 1JGUH 2WQXA 1B3JA 2J8OA 4YPGA 1VJSA 4JY6A 1CLZH 3L9EA 2UZXA 5EB9A 1E4JA 5A2CA 1A66A 2G4GA 4XMTA 5C09E 1Y7VA 2IPUK 2LV4A 3ZKMD 4GXVL 4A2DA 2H8PB 2MPVA 3V55A 1PZ3A 1EGJH 1MFDL 3RAJL 3ML9A 2CDFA 2AW2A 4BZ1L 5EOTB 5F9OL 3V6FB 3VFUB 1Q72H 4X8JA 5KSBA 2WLLB 1OHQA 3WTTA 3FB8A 1RJYA 2WQ8A 5FO2A 3MCKA 2YOCA 1RHHA 3AW5A 2P3YA 3PP3H 2IAMB 3FZUC 3VXQA 4Z7UB 2KDYA 2D31A 2YA2A 2YPVA 1M42A 1KTCA 5F89A 3COOA 2C9VA 3FC8A 3HLAB 3QAZB 5H37A 1EXGA 4HQQH 1C12B 1QPKA 3O6LH 4YHMH 3UZEC 4OBRA 1HYSD 5HI3C 4LBEA 3WG7B 2X3CA 3ULUF 1EHAA 1ZVYA 3LN4B 2CK2A 3WTWA 1KXTB 1GGCH 1AOHA 3PP4L 4HCFA 4KRPC 3HG4A 4GXFA 7PAZA 4K8RL 1KTJA 4G6ML 5EUOE 3QEGH 3RIFF 3U82B 2OV0A 5CZXD 3UACA 5I1GL 3R7QA 5IVNA 4MZIA 2XZAL 1A6TB 4XMXA 4K23L 2ZCLL 2VM3A 5C07B 5DMIH 4JFXB 3L1OH 3B2MA 2Y0SA 4ACPA 3ILPA 3N0PB 3BESR 2YN3A 3ESVF 4FI8A 5K9KA 1MRFH 5ISZD 2ZP9A 2CJUH 2IDQA 2GSGA 5F7BA 4B97A 3BH9A 1LP9B 2G2NA 4GUOA 3LY6A 2HT2D 3RWJB 4FZ8L 3QEQE 2CALA 4PV9A 1ZA3A 1CFSB 4I3SL 3L1FA 3GXPA 5D1QA 5EORH 1DQQB 4JPQA 1MJUL 3SKNB 2BVYA 2V33A 4PVBA 4R3SB 1S9VA 2NSQA 3BMWA 5EN3A 1EH9A 3WHE0 3V0JA 1JK9B 1B0IA 3CBKB 4WUKL 5L88L 1FN4B 2IGLA 4X6CF 4PG9A 3IU3A 1F41A 4J1UB 4P3DB 3UZVA 3DGCR 2K6YA 1SEBA 2UX7A 4LCVA 5CINL 1JUFA 4AGPA 4B9KC 2Z3FA 1WGOA 3WY3A 2Y5TB 5IEKA 3EOBA 1D9KA 2Z8WC 4NNYA 3WNMA 2DI8A 2P5WD 4AX3A 4Y4KD 5C3IA 1NDTA 3IRCA 2WLHA 1Y18B 2X4NA 4N24A 4QRBA 5C8JA 3CZNA 2MNUA 3GKWL 3MVSA 5MEQB 3WY2A 1QFUH 2XWTA 2ZYRA 2EYSB 3L7FB 5J6GB 2FO8A 4FQXB 5E8OB 1CI3M 1HKLH 2NY0D 3MODL 4PJBB 5FWRA 4AXWB 4QRPB 5C09B 4YZFF 1S78C 1A3ZA 2KDGA 3GFUA 4BQ9A 3BZ4B 1TTRA 3VQ2C 2CGRH 3FO2B 3AAZA 1QFHA 4Q6IC 1ZJBA 4P4RB 2NXZC 3SDDD 1JWMB 4QHKJ 1A7QL 3Q2VA 4H25A 5EHFA 3C5SA 3EH3B 4H26B 4R0LB 1QR1A 2FJGB 5LBSL 5FUOH 3JTSA 5F3HA 3GRWH 1E42A 3VYOA 1JZFA 1AGDA 3K8LA 2SODB 1MKFA 4H2CA 4X4ME 4H1LG 5DD3H 4XVTH 4AW4A 4GUPB 5HDRA 1N18A 5KWYC 3K7UA 4FA6A 1G9MH 4WWPA 1J0HA 4H5SB 4LF3A 4IRJB 3WNKA 3EJTA 1M7UA 2AC0A 3A4AA 3FCSA 1ZE3H 3KL3A 3MV9E 3NFSH 3RZCB 3FMGH 5EOCL 4DSYA 3K74B 2XQBL 3AABA 3MYJB 3V0AC 3PPSA 5DJZB 5DJXB 5DYFA 1GGTA 3V7AG 2ODIA 3VXRE 2PCXA 1X5LA 1D6EB 1FORL 4NZ8A 3GJFH 1QO3A 5LGHL 2P43B 4FKKA 4JZOA 5HPOA 2AV1A 1IGCL 2DQUH 3I6GA 5I16B 3B5GA 3N9GL 1IGJB 4Q9QL 4W81A 5DS8B 3IJ9A 1CLOH 2VR5A 4EKJA 5AW6B 2E6PA 3U7WH 2AAVA 5JR1H 4BEIA 2Q6WA 3QUHA 3N50A 2IADB 2F8OA 4H8QA 3MPCA 3SD5A 4N2IA 4FE9A 3BQUA 3IE4A 5EUKA 3SDCB 3FB6A 3UYRH 3VXME 3ZZSA 4N9OB 5E0QA 2VYRE 4DZ8A 2V2TA 2IAND 3QEQB 1QSFB 2DMBA 4PWHA 1DDHA 2Y25A 2XQYA 4GNKB 5AAWC 4AENB 1Q9LA 3HAEG 4YHLH 3H55A 1FZOB 2HKFH 4WK0B 1GZHC 3GS7A 2F2HA 4HJIA 5GXBB 1WTGT 5I1HH 1YEDA 3GGWB 3P4MB 4LL9A 3IDIB 4JM4H 5D2LB 2CRIA 5KAQF 3L4CA 4YLCA 2ZE0A 5DJ2A 1P2CB 3DJZA 4NP9A 2Y7OA 4BQBA 2IQ9H 3GK8H 3BVNB 4XWOC 1L5GA 5HVGB 3RX5A 5D7LA 5G2NA 3AM8A 1QEXA 3DX6B 3FTWA 4OZFA 2F19L 2OXHA 3UGEA 3KWXA 2ARJA 5GZOC 4OFVA 3ATEA 2YXVA 1SM3L 4ZFOL 4OSUH 4AV4A 1QI3A 1HHHB 3VW3H 5DHMC 1MFNA 4NYLB 5F7EH 1T20A 5I15H 4MCMA 4RSVA 4X7TA 5JLZA 5JQ6L 2DWTA 2YUVA 5E95B 4N2KA 5J89A 2WLZA 1F4WH 2H0PA 3K4ZA 2GITA 1N5YL 2VR4A 4TSBL 2HFGL 1FGVL 2Q7YA 4WU7B 2LE9A 4LIQH 4FMFA 3HFFA 3ARFD 2ALWA 1J9RA 1JWSB 1HAUA 3IKKA 2JXMB 3I2CL 3WLWC 4QEGA 3W11D 1ML0A 1NGZA 2XY1A 1FL3B 1VHPA 3HBGA 2FEDC 4JRXE 1MNUH 3BC9A 2J5LC 4M6ML 4Q89A 4GKZB 2OZNA 3EHBB 2YUXA 2WXOA 1XSIA 4Z9KB 1NCOA 3D2TA 3RB7A 3VI3A 4GBXB 4U6XB 2E4TA 5I75B 3IU4H 4HCGA 2IGTA 4BZ2A 2WXKA 1I8LC 5KS9E 3VFUA 4AQOA 1R6VA 5AOZA 4X7SH 2AKRB 3H4HA 2BS9A 3QI9C 4JN1H 2QMKA 1W8EA 5C0AA 3TM6A 4B95C 4MS6A 1SBSH 4BGLA 2WGNB 4E5XA 1F0LA 2YAEA 1PNDA 4Z7UA 2H45A 4PGBB 4LEBA 5FF6A 3BAIA 3E6FB 1KZYA 3Q1SL 1MI5B 3N3EA 3W2DH 3LD8C 1ADQL 3TO4B 3EFFA 3HLAA 5IVXE 4EUPB 3RZWA 1YEGL 4BH7A 1E0OB 1S9XB 1SHMA 2QKIA 3V10A 1TCRB 5I8KL 3IYLW 3TA3A 4PMFA 4JLRB 2FECL 3PG2A 3LN4A 4N6QA 4XPFH 3P0YH 2PPAA 4ZX5A 5K9JH 2C3GA 1KACB 4OW6A 1N6QH 4YVNA 3FSOA 2PNDA 3LKRB 2M83A 2F0CA 4BZ1A 4LSVL 1A7NL 2P7TB 1SEQH 3UBXG 3VACA 1BFVL 1VFAA 3TWCL 4P23A 4E41D 1CLYH 4AITA 1LMKA 2QV2A 3ATDA 1PD0A 1YEFL 2FLBT 1T03H 1MN4A 3KXFE 2R23B 35C8H 5CD3B 1L7IH 2XVKA 4QMEA 3IFNH 5BMFH 4UTBL 4XCEB 1JZ3A 4J3OF 1KEML 4PJGE 1NUFA 3QIWA 4LLDB 5FYKE 1SJXA 3WTYA 4FLRA 4NLAA 3OMNB 1NDGB 3GI8H 1AOZA 5E24E 3KBEA 5KYUA 2A74A 2OJEB 5CIPA 3TFKC 3WEMA 1AG6A 3D06A 1U8OA 3ETTA 2GUOB 2N7AA 4U6HB 3ZDYE 3FUKA 1N4XH 4WFGE 4TSAL 1NOLA 4RGMB 1P5VB 2YMXH 4QAMB 1XSJA 2H1PH 3OKKA 4M8QA 4L2LA 4Z7UF 1DUYA 5DDHA 4MNGA 3FHQA 4F37K 4UT7H 2PUQT 4PPTA 4UAOC 5ICXB 2DYSB 3BRDA 1J0JA 2YMTA 3KNBB 2ICEA 5C0BE 1IL1B 3PDGA 4XZUA 4XO8A 4PJ5E 2KZ1B 4MDRA 4KDTC 2NNFA 3U36B 1BYPA 1VGEL 1E4KA 4E9TA 5BOJA 1YJDL 4YN3A 2A99A 2F61A 2FSEA 1KBWA 1CICC 5E7FA 3FL7A 2CBPA 1L0XA 3QVAA 4QRPA 5GGRY 4POYA 2FWSA 4TLSA 4JCWA 3MRCB 4KFZC 2WLIB 3LB6D 4G11A 4KMLB 1E5ZA 3TASA 4MJIA 4AKOA 3O4LE 2JF1A 4KY1H 1RZJH 3PXLA 2LFEA 2EDJA 1OW0A 3AY2A 4JL2A 1BZEA 2Z65C 4OM1H 4LHQB 2CMRL 2DOCA 4OLYL 4TUKL 3KWUA 3C60D 5E8PA 2FJGA 4FHJA 4YBQD 3QO1B 2C3XA 3JWOL 2BHZA 3GEFA 4IEFB 3GUFA 3RWFA 5JHLH 2VLRD 4PJCB 3LPGA 4S0HA 1IC4L 1MEXH 1Z1WA 4XX5A 1MFCH 4L37B 4Q6IB 1SVZA 3S5LB 3MNWB 3QUGA 1LP9F 2NXZB 2VDKL 4PI2A 4ZUTA 5KVGH 3RX8A 1IV8A 2X4OB 4NDMB 4MSWB 3U4AA 1B6DA 1KB5L 2G4EA 4IRJA 3A67H 2R8SL 5E2WH 5A3ID 1FNLA 4ABQA 2RGSA 4QRSA 5C08E 4NNPH 1OSZB 3U6XA 1G84A 4Y2OB 5MP6L 3DIFB 3LKQB 1D7FA 4OT1L 3GMPA 1HL4A 3OZ9L 4HUXB 1C8QA 4MJ6A 3TVMD 4NN5C 1JN6A 4NM4H 5IG7B 2AEQH 4O58L 4PRHA 2NT0A 3WSQL 1XCXA 4IBYA 2XKNB 4AQ8A 1MNNA 3OKOB 1F4XH 1SXAA 4OCNC 3UZQA 3SJVA 3PDOB 3BI9X 2P24B 3BT2H 3MGTB 1FZKA 4TQEL 3NZHL 2EYTB 3E6HA 3WL9B 2YQGA 5LBSA 3Q8CA 3VFSB 5FO9A 4O2FB 4GG8B 3WJJC 4JDZB 4MMYA 3KXFB 2JE8A 1F1GA 2EH8L 3G3LA 4PJBF 4HS3B 1H5BC 5CD5C 1JPTL 5I71C 3THML 2EDYA 4P4KD 3QQ9D 1ZTXL 5FLUA 1H6TA 3GMLA 3IFLH 1MHEA 1Y1UA 1E4XH 1MWAB 3VFRA 4E9VA 2IH1A 2R9HD 5L9DH 2HFEA 4B5EA 2G75A 1L9TA 1Z9OA 1KCUH 5I18H 3OR6B 2ZP8A 3JWNG 4DGIH 1BREA 3BP4B 2NUPB 2YZ1A 3JV0A 1J8KA 4X9GA 4PYGA 1EEUA 1FFTB 2L0DA 1HH9A 2ED6A 1J8SA 2OX5A 3FT3B 4LCWD 1DJWA 1PZCA 3WOVA 4KC3B 3IPEA 5CMAB 3UIYA 5BQ7B 3UMTA 2R0LL 2JNZA 4OZIB 1G7IA 3ZZ1A 1NJ9B 1U2CA 1LE9A 2X1PA 1QPPA 3WIFB 2Z92A 2P8MA 2UWEE 3ZN6A 1BOGA 4PJ5B 3OVUB 3U4BH 2D3VA 3IN2A 3M17A 3PWJB 4M29A 4X2UA 1I31A 1MLCA 2AK4A 4HAGA 1UB5A 2UXVA 3MRNB 4AMWA 1I9EA 3TO2B 1RIHL 5KVMC 1N64H 3TT3L 1PY9A 3ZIMA 3QH3B 3X3FH 3WI9A 5KW9L 2BNQA 3LX9A 5IGXH 4NS0A 2YEZB 4FN0A 4WNJA 3NK3A 4WU7A 5J56B 4PJXB 2XVGA 1B4TA 2JXMA 1IGML 2WBJC 1NBZA 3PUCA 3C5JB 3DYMA 1X44A 4GH7B 2PW2A 1CL7I 5B38B 5I74C 4AEIH 2BERA 4CRPA 2VXTL 3I9PA 4JZNA 1XR9A 5MEPA 1GYCA 2LU5A 4GBXA 4Y4HC 3L3JB 2CPUA 4M43H 1MW3A 3TNMB 1QBLL 1INEL 4ZFOA 2J5LB 1AIZA 2D2CC 4FFYH 1JK8B 1ND0B 4J6RL 1Z9NA 3K71B 3H7BA 2OMTB 1WPCA 2OZ4L 5D2LF 3RTQD 3L9RA 3GMMB 3T09A 4XXCC 3BFOA 3B2VL 4KZDH 1E28A 1ZCRA 4L3EE 4QRUB 4NPYB 5EIVA 4APQA 2X3AA 1C1EL 2WTPA 5B1CA 5MI0C 3CXFA 4JREB 4Z76A 4L5FH 4R97C 5FO8A 3DO7B 3BSZH 1IGYB 2OMWB 1OALA 3L4ZA 2AZUA 3QI9B 5F3FA 5JIKA 5HJ3B 4ZMAT 4ZQTA 3TNNB 3VFNA 2FO4A 2BY1A 3HVDA 1JHLL 4LAJH 4POZD 3TO4A 5IJCC 4JFZL 4JPKH 1CF8L 3HW7A 2F8XC 1J5DA 4S1QL 5FHBH 4PJIE 1N10A 3GSRB 5IOPB 8PAZA 1TCRA 3AU1B 2WQWA 1ZIAA 3LD8B 2ZXQA 5AD0B 4ZFGH 1WAPA 3BGMB 2UXTA 3ZGIA 2DLFL 5BW7C 4K55A 2OJZL 5AZ2H 3S37H 3S3JA 1NEZG 2P7TA 2BVOB 4KKBD 1W2KT 1NFIB 2OMUB 2XKUA 5AW2B 4GSXA 4HWZA 2BMKB 3CFEB 2IWGA 3EGXB 3FTZA 1IKNC 5CD3A 1PIGA 5KYYA 3KYOA 1EHNA 2XWJA 4XNYL 4POUB 1WP6A 4YFLF 3W5MA 4PWKA 3N55A 3NYKA 1YY9C 4JMXA 2FNWA 43CAB 1U3HC 1PF3A 3CIQA 2MQCA 1XBRA 5GJTL 3PFUA 2QADC 3LEYH 1ADQA 1UB6A 1JSYA 3HNVL 3MTRA 3VXPB 4UQCA 3PQYB 5AZUA 2E9JA 5I0ZA 3HC0B 3O6FA 2FX9L 2EEXA 3PWLB 1BPVA 5ANMB 3II2A 5E56A 3J7HA 4Y19E 3WFEH 3FUEA 4LLAA 2FB4H 4IKLA 4RA3A 2F6AA 4KV5F 1YEWA 1HL8A 3QUKA 2VJ8A 4WTZA 1S9WB 3BWSA 4QWWD 4RGOL 1C5DA 1M7DB 1OF2A 1MHCA 2IALB 3KPMA 1PFCA 3BKYL 4TUJA 2EE2A 1GA2A 3EH5B 1PS3A 1AP2A 4L8BA 1RMFL 2HJFB 4AG4H 2AXHA 1AACA 3F7KA 1GKOA 4UAOB 5JIHA 5B3JE 1F13A 3A5VA 3ETBJ 5D9SB 5DJ6A 5KANG 3NZSA 2X09A 3WKML 5HXMA 4UTBA 2QQKH 3GBLA 1D6VH 1UD6A 1A7PL 5GS1C 3MUHL 1KCLA 1S7WB 2N7BA 2ICCA 2XRAL 5I76B 2WLIA 4MHHG 5E2TH 4OJDH 3NZ8B 3A21A 4WRLA 5DMKB 4I0PD 3FUFA 4FG6D 4DO4A 1TYJA 4WV1A 1GYAA 3TONA 1UT2A 3QO1A 3WO4C 4GSDH 3UTSB 4N2MA 3PJSA 4ODWA 4CVWA 1WBZA 1SXCA 2CRZA 3HIZA 4YXKL 2XWXA 2JIXB 4IBQA 1F8TL 1X9LA 1E9QA 3LNHA 3TZVD 1O9VA 4CJ0A 1VB9A 3RFZB 3HE6C 1ZXKA 1HHIA 1WG3A 4HUXA 4KNSA 5IT2H 5JPMC 1NOFA 3QWOB 1V10A 3NSYA 4UB0H 3WDIA 3CLFH 2GY5A 4HISA 1DLFL 5B22A 1JZ5A 4Z7OE 1XH1A 1WGVA 3DETC 2I9TB 2MSPA 6FABL 5IV2B 4F7PB 1O5DT 4NN5B 5ICZA 4KZEH 2BFVH 2IWKA 1U92B 1TIUA 3MNZB 1HC1A 1ZLVK 5AG9A 3RY5A 4EI5C 5BZXA 4JDZA 2ZOKA 3C5ZD 1KJ2H 5CEZH 4N1HB 4LSQH 5K59F 4EI6A 4ZNEE 5MHSE 3BUDA 1F90L 1UJ3A 3NCWA 4BQ6A 2V5YA 1PFOA 4D3CH 2ZAHA 4XP6H 5JIDA 4XBEH 3ULVD 3EJRA 3BPCA 1KB5A 4JB9L 4QYOB 4H0IA 4FNLH 4TNFA 4XZ4A 1H5BB 4MMXC 3K6SA 1P4BH 3OR6A 4J4PD 5EU4A 5I71B 3VDBA 3RWHB 4NM8H 4PJCF 2NR6A 2Q3XA 4LASH 3FT3A 3MBXL 3WNNA 4DJMA 3MGOA 1UOKA 4D2NA 5JTWA 3BZEB 4K0OA 4NRXA 3VH8A 1VCBC 5IB3B 2W9DL 5LN4A 5DC4B 5BS0A 3WIFA 3ZQWA 25C8L 3GMQA 3UAJC 3ZX1A 5IVZB 2P5WA 5KAQG 1Y6KR 1PLGH 4GAGL 2DM7A 1BXXA 2OMYB 4Y16A 3AB0C 3NG5A 1CWVA 3KPRD 3MRNA 2GQHA 2CHNA 4NO3A 1MCIA 3HNSH 1F6AA 5D1XD 2AQNA 3BIAX 1VKXA 1FYHB 1SDDB 3GMNA 4A7SA 4V11A 1P4UA 1TZHB 2PPDA 2ZOTA 3TEYA 3O81A 4EIZC 3SDDA 3L3DB 3UJJL 4FQPA 4ZFZA 2VLJE 5EBMB 1XWVA 5HHME 1Q9KB 3ZW3A 2E7HA 4KHTH 1HX0A 1XGPA 2MKLC 1AHWA 4S1RL 4G3YL 4PJ8C 1ECYA 4PRPE 3HB3D 1WFTA 4XAWH 3ARDA 1ILSA 3FU3A 1I8UA 5HYIA 2P45B 2ZWSA 4XVJL 1UYWH 3EJYC 4K07A 1J88A 1PL3A 2QVIA 4HKJA 2A6KA 4QHLA 2WBJB 4P9HC 1UKQA 3HRPA 2XN2A 3LQAC 4HC1H 3SCMD 4HUVB 1IVTA 3E1F1 2F54B 2EVFA 1PEZA 2VDNB 3NJJA 5F6IC 2DTML 5SWSB 3I85A 5F1KC 3CU1A 5KSAA 2KPWA 3DRTB 1IGFH 1ZEAH 2YUWA 3FB7A 4OZIF 5DYOB 1I7RB 4Y4HB 4WWOA 2XQYG 3LZFH 3F58H 5IOKA 1AMXA 5JA9A 1RUKH 2WYTA 5BPPA 4UOW1 4YDKH 3W0WA 4RQQB 1T7WA 3DHJA 1KN4H 4XP9L 2IAAC 2NYKA 3DDGA 4XN1A 1CFBA 4XMWA 2VITA 1AG0A 5EZJA 2VW6A 4OBSA 3HCVA 3POHA 1ZHBB 3MNVB 4MAUH 4TV3A 5FYJL 5HJ3A 3J8F7 5DHXB 3U79A 2WLYA 3UH8A 4OZFG 3TPUA 3QUYC 5CAYB 5MI0B 1H19A 4WVRA 5BV7C 2AQQA 4XWGH 4L1LA 2X2JA 3WXWL 3GSQA 4CVXA 1FNGA 1XGQB 3MLRH 2R69L 4XMUA 3VG0H 2XY2A 1FZJB 2EDOA 2I26N 3GLEA 4N5EC 1NAKH 1E27A 1FNSL 3VSQA 2YQ2A 2G3ZA 7PCYA 1KYAA 5G5DA 4LLQB 3SQRA 3EJQA 4PJXF 5AKSA 5FM4A 5KSBE 3FPYA 3L4VA 2XN9B 4WEBL 3BLPX 4K3DL 2X2YA 1T4KB 1WJ3A 4O9HL 3ILQC 2OZ4A 3MV7D 4LB8A 4Y4FD 2GTZB 4IRZH 4ZOBA 5GGTH 1N0XH 2DLIA 2RR3A 1IQWH 4KUCD 1LEKA 3PP3K 3ARWA 1KBPA 2NYYD 4GRLC 4DO6A 4M3KB 2AQ3A 3FT4B 3UG3A 4KNUA 1Z32X 1CI5A 2WLMA 4J3OG 1M7IB 2O5XL 1JRHH 3ZZQA 4P57A 1N26A 32C2B 4ANWA 4NQDB 5JHBA 1U3HB 5DR5L 2VAAB 4JY4A 4LLWA 4KK8C 3AS1A 2E46A 2PWGA 2QADB 2Z6FA 4KQ4H 1VADB 2XA8H 2EIEA 5E9AA 5J9PA 1AD9A 1QOKA 4WKZA 3VM5A 3ARFA 1QRNA 4UDTA 1MSPA 1OK8A 4AYSA 2PW1B 3WV0A 1TF4A 1LNUA 4XCCL 4G1EA 1I8KB 3EGSB 5DK2A 3GBNL 2OXGA 2ZX5A 3LKSB 3D9AH 1BD2A 1PW3A 4S11A 4YHYB 5EDSA 3TJHD 2WZ0A 3S0PA 3MKGA 4HIXH 4KDVA 2FJHB 1E8XA 2B77A 2VABB 3M1OA 2XZCH 1S7WA 2NT1A 2C9PA 4H20L 4PWEA 3FH5A 2ZICA 4FFTA 5D1QE 1GYWA 5T5NF 1YECH 3LEXB 2Q86A 4DK5A 5HHVL 2CDGA 3N41B 2YGNA 3IMWA 2VCOA 1CGSH 1KFAL 3C2AL 2W0KA 2ZYHA 5GS1B 3RWCA 4HJEA 4TUOB 4WWID 4HAKA 1QUNB 4M7LH 3SODB 4Y9GA 1T83C 2J21A 3H2PA 4JHVA 1I1AA 5CUSH 3AUWB 1A8JH 5BUAA 2ZCZA 4OLWH 4ZTOL 1ZVHA 4PS4L 3HJEA 4ZMNA 1BF5A 1TZAA 5TDPB 2GBTA 5ESAB 3WO4B 3O3AA 3MLXH 4Y88A 4AGMA 3UPRA 1JHKL 4M1GL 1Q94A 3RRQA 4AKQA 5E5MB 5E6IC 1MJ7L 4ICXA 2J1XA 3T0XA 5JW4Q 4X83A 3V6BR 3RFZA 1UT1A 2OW7A 3ULSA 2VLME 2GHZA 3QB7C 1LO4L 2R1WA 4M7KH 3RG1C 5DHVB 3ARBD 3T3MB 2VSMB 3EFDH 3S35L 5B3SB 1PG7X 1X7TA 3BAJA 1KTDB 2ZOOA 5EZIL 3UDWC 3CSPA 3O45B 4NRZA 3V4UH 2UX6A 3HE6B 4KZ0A 1JYNA 1G7QB 4O2EB 2JB5H 3SQOH 1DYZA 3MBEC 5JPMB 4J8RB 3HJ0A 1U95A 4FNRA 1A6VL 1Z3GL 3MOAH 4GIAA 1FHNA 3L45A 4PD4K 4BKSC 2VXQL 2HVBA 4PRNA 3VD7A 4ISVA 4I48A 2BRQA 5EU5A 4Y9CA 1S7SB 3AXLB 2QKIC 1YEKL 3LXBA 4JDVB 4KJQC 1G7HB 4HH9A 4NENB 4XVUD 4WI7A 5T1KD 7FABH 1I7TB 1OD9A 2ORBH 4MVBC 5DHEA 2P8LA 4Z3TA 1MG2C 4DCQA 4EI5B 2PKDA 4KJWC 4KITB 3U0PB 4D0DB 5EIIB 2CLRB 2NQ3A 3ZSTA 5EEYA 3T77A 3KLHD 5HHXH 4JN2B 2YO3A 4MMZA 4A1RA 3EJCA 1VDGA 1F97A 1YNKL 4N8VB 1KIQB 5AVRB 3RY4A 4JUTA 3SGKC 3WTXA 3J27A 1DVXA 3IBEA 1XH3B 4OFQA 3OHXC 5BQDA 1BJ1J 5D93B 2B39A 1JNHB 4E2OA 1Z5LA 4GAJL 4U33A 1MCOL 4CILA 1PAZA 2QL1A 3MRHA 5B1JA 3Q3GB 3SQBA 3A4FA 3B4NA 1JZHA 3NCJL 2OMYA 1GXEA 3H8NA 4EN3D 1GCFA 1RK0A 4AL8C 4XXDA 2V5MA 3AS2A 4DUWA 4KH2A 4U1HA 1MDAA 1QZ1A 3N44F 1FVDB 5L2JA 5BJTA 2EUZA 3T0DA 3W1ZA 4PGJA 2V7NB 3SPGA 4PGCB 3O6KL 1DQLL 5T5FH 4MNQD 3QQNA 1XEUA 1S6NA 4HWUA 3GBMH 4P9ML 3B2XA 3C60A 2WN2A 4JO2L 4XNZC 4BFGA 1P7QD 3TWYA 5GS0H 4OIAA 5HTSA 2VLRA 4ZAKC 3OAUH 4Z5RB 5C2BH 2YLKA 5D7LE 1YEEL 4DUXA 2CHZA 5D6DC 3WEOA 2DQMA 2CAKA 1GC1L 3S4SB 1XMEB 1M05A 2DN7A 3LV3B 1CLCA 3PV6B 4PJ8B 4LZKA 2LOEA 2RD0A 4OCYL 1AQDB 3ZL4H 2BP0A 4FZEL 5GS2H 2FQFA 3TYFA 5C7XL 1VFUA 2EECA 3NH7H 4R4BA 5KEZA 4U1LB 4TNWF 1FJ1A 1LEGB 4GYBA 2GK2A 5F6IB 3EADA 4L9LB 2YLHA 1HSAB 3QJHA 2NY2D 3ZTNL 4RA0C 2NZIA 3VE0A 1YAIA 3IM1A 4ZUVA 2H1LM 4HCRH 4NJAL 4JGJA 3Q2NA 3VI3E 3F8UB 1UATA 3D07A 3H9YA 2QLVB 4HALA 3HC4L 1DVFA 2PCFB 2YGVA 1E7VA 1WBXB 1HJBC 3REVB 3HZVB 3OKDB 4UQ2B 3CFKB 4CGUB 4WI0B 3NCFB 3RWEB 4J3VA 3QHZH 3O0RH 3JWNH 4KAQL 2Q87A 1NGPL 3QJZA 3MRKB 5BV7B 1MUJB 2J8UA 5J4MA 1FYTE 3SOBH 3BAKA 1CIUA 3HMWL 3P30L 3UAFA 2WBXA 4P2RD 3AQZA 1KCSH 5IHLB 4YSSA 1VZIA 4GIPD 2QT6A 3QCVH 2GT9B 1F3JA 1U2YA 2C3HA 2IH3B 1I1FA 2DIEA 2W07B 2ATKB 3SDYH 1FA4A 3U2SA 1RUPL 4OCSL 3CFCL 3TBWB 4BCYA 3EH1A 3DTUB 1Z66A 3IVKB 4NKMA 2VNCA 4ZJ9A 4N2OA 4B96A 2YAMA 1MFVA 3NJGA 1XGYL 3GHEH 1OP5H 5JOFB 3CVHB 2XACC 3F6LA 4QJ3B 1CGXA 3T4AA 2X4TB 1RZFH 4LVNC 4GRLB 32C2A 2CR0A 4ONFH 4NHCL 4NWUH 4WW1B 2X10A 3K2MC 2R69A 5CR8A 1C5BL 4IS6B 4MWFB 3BDXA 3ZRSA 5GZNA 3QEUA 3G5YA 2CJSA 5LQBH 4J3UA 4CSSA 2DYPA 3DHMA 4CC4A 4OF0A 1JV2B 2YA1A 3NIFB 4OTXL 3B2DC 4G71B 5HD8D 2MFNA 4LBAA 3LXUX 3CXDL 1NMBL 3VXUB 4QUOA 1ZGLA 1ZSDA 5IB1B 5IB2A 3CFJB 4LSRH 1TJHH 1ES0B 3V0WL 1GS7A 1D5RA 1R0AH 1EXHA 4EUPG 3TCTA 1K6QL 5IFAH 1OB1B 4P5MB 5DJAA 3IJYB 2OR9L 5FC9A 4EQ2A 5C0CD 1A6AB 5F7WC 3IJHB 1AANA 4B50A 1TNNA 1X9RA 4PBWD 3MAWA 3A4EA 4PGEA 3L9YA 4PD4J 4XVOA 3APDA 3DUSB 1FH5L 2OI9C 3LEXA 3M1BA 4JO5A 5K33A 5CBAB 1MAJA 3CQPA 2PXYC 3F6JA 3QNYB 1MCCA 2AERT 5I19L 4OD3L 3GUTA 1OE2A 3OKEA 1LTXA 4JKNA 4UQ3A 2HLFC 3LIZH 4MNGE 3PUUA 5T3XL 3D39D 3WN6A 5C7ZA 3MJWA 3WS3B 4DQAA 1I1YA 3SZKC 5F71A 5GQBA 4WUUB 5MEND 3KG5A 1ZKAA 1OGAE 1QLFB 2N01B 4XO9A 5DT1L 1HQ4A 1BM3H 4PJHB 5IESH 2X87A 4ZO8A 1OOAA 5C0JB 1T66D 3FN3A 2ZUWA 2IMMA 1XSOA 4GP4B 5AL8A 2APFA 1KCVL 1BJMA 5DHYB 3GSUB 2HLAB 4U1GC 1BOYA 3L3GB 2WXRA 2LQRA 4AQAA 2Q8BL 1M2OA 4Q6KA 1IBYA 1YN7A 3KPSB 1R9FA 1SY6H 2DQHL 3REWB 3DX7A 5E6IB 3ULUH 2PMZA 4BH8A 5C6PB 4F2ME 4HWBL 4F8LA 3B37A 5KVFL 1T5XA 2EDMA 3OAYK 3LH8A 5CZRA 1JVOA 5EA0L 2CE6A 5EWIH 3KDPB 4XBPB 1F4YH 1NWPA 3MJ9H 3L7EA 1KXVC 3SYQA 1AKJD 5CU5A 4BFFA 2IDSA 3AXLA 1KF9B 2YWYA 3MBEB 2VDQH 3PGFH 1JGDB 4XC1L 2FQDA 5E23A 4YJZL 2ZNXA 5I6XB 1AO7B 3QG7H 4LDCA 3JUYA 3DX9A 4RZCA 3HR5A 3X11B 1KIPB 2EIKB 3N41F 2QR0A 5FCUH 2WQSA 4YQXL 4D0DA 3AG2B 3HE7D 5D7EA 1UFUA 5TE6H 5IWLA 3AWFA 2R29L 2EYRA 4XRCA 1KCBA 4WWKA 5E2VL 4NWTL 2LVCA 3H9SD 3SJVE 2EDKA 5AKVA 3MLSH 4ZO9A 1FNHA 2GCYA 2W65B 4TLUA 1TO5A 4PRDA 3PV7A 4DVRH 1XXFC 3BWUC 3MRQA 1NLBH 4TN9A 2WXHA 2XFXB 3S5LG 5LAPA 2DJMA 2VXQA 1JNNH 1D5XA 3OHXB 3T3MF 2IOIA 3ZLQC 1L7TH 1G94A 4U6VL 2WK2A 5A2JH 1GGBL 1WYJA 2FJFB 2VWEC 3UG4A 3SPVA 1LQBC 3VX0A 2AABL 2V9QA 2ADJA 3LRMA 3MXWL 4AUJA 4NFDA 2J1YA 3F05A 3VB8A 5I9QC 1JTTA 2R1YB 4N2HA 5AZEH 4XCFH 1WA0X 2EO7A 3T8VA 3TL5A 3Q9QA 1EDYA 1AZNA 3D12B 3INOA 2XVBA 1A6WL 4KBPA 3EJZD 1S7UB 1FIGL 2XNAA 4X8CA 5IUSA 2XG5B 2V3EA 4JS7A 4L4TB 2XFGB 3TBSB 4NQED 4A67A 2FHCA 3GI9L 3IDJA 3L3OA 1DDTA 1UM4L 2C7UA 2VZUA 3FOMB 4XNZB 4YHIB 3ZKMC 1OGAB 4WFHE 1NLDH 5JHDB 1WUNT 3GIZH 3A3YB 3QPXH 2ENJA 2BVUA 5BOPA 3L5WA 4JFSA 4ZAKB 3TZVA 4AMXA 1HQRB 1K2DA 1PAMA 1T3FB 4TVPD 1QW8A 5J1TC 5L2KB 3PXHA 1VPOL 2BC4B 1ZLUH 1JPGB 1KIUA 3EDFA 1EERB 4WWNA 1IZJA 2E56A 4WEUD 1QW9A 2BNQE 3BP5A 5EFIB 2BVTA 3GINA 4D9LH 1I1CA 1HINL 1LEGA 2VMJA 3H53A 4OLUH 3NABH 1ZTMA 5T3ZH 4NZFA 2W81C 3FRUB 4JY5L 4PJ9D 4HFUH 1CL7L 1U8NA 1U8MB 5DRNA 4F2MB 1PLCA 1WIOA 5MEOB 3HZMA 1UWFA 4XO5A 5E8NA 2NQCA 2Z1KA 1KBBA 1K3ZA 4X5RA 3NA9H 1TQUA 3EDJA 3ZZLA 1HYSC 2B4CC 4M4RB 2DDQH 3G5XB 3NT0A 3WTUA 1P0SE 4NQTA 3V95A 3HN3A 4ADIA 1RZIB 2CBMA 3IDMB 4G8EB 4KZCA 4U1NA 5I8CB 4KI5D 4QPEA 2ZONA 1A9EA 2F74B 4UBDD 1WHOA 3FSAA 1EEQA 4E9LA 5I17B 1NC2B 3MRPA 1MF2L 3EO0B 1KYOK 1FO0L 1OSPL 3CN4A 4D7BA 5CFHA 1BWMA 1FFOA 5F3BB 1FUNA 3QJXA 1CE6A 1MJ8L 3MXVH 4J6IA 4KI1A 2Q9OA 1W0WA 2HFFB 2IH3A 2J4WL 1I9IH 1M71B 1OTUC 3TEZA 5SWZB 2AEPH 5B38G 5IJVA 4ADJA 2DJ4A 3PNWA 2HT2C 1FDLH 1IEAA 2DJSA 5ERWB 1WQVT 3FTYA 5CHNA 4M5TA 4CL7A 2W38A 4PVMA 5JIQA 1XF5A 4UOW0 1KJMA 4UINH 4ZTPH 2K45A 3MLUL 4I2XB 5D1XA 2HVKA 3P11L 2O1AA 3OB0K 2BDNH 1XGZA 1TYEB 3WEAA 4E42A 1MVFA 4KMTH 2WN3A 2FT6A 2M8XA 3SN6N 1NMCB 5KJ7E 5B4MD 1ZA6A 4W4OA 2JKRM 2VMDA 2GKIA 4A2MA 3CG8A 4LVNB 5AYUH 1BVOA 4E36A 1XB6A 4OF7A 3IDXH 2AHIA 3MJ6A 4JVPA 5DJ8A 4B3EA 4Y4KC 3VVVA 2J43A 2FYYA 4F37F 4HAFA 1PY0A 3HOGA 4UTAA 2PF6A 2PTTB 4XPBH 5BRZB 4M7LT 2NY0C 1O7VA 3DJSA 1BG1A 1SJVA 3JVGC 3ZE1E 2NY3D 3C9NA 3QIUD 4H4NA 4EIUA 2HN7A 5HGGS 3SE4C 1D5IH 3OV6A 2B7DT 4KXCA 5LBVA 2G0LA 1DE4B 3ARYA 3QR2A 2WTOA 4X0NA 4QLRA 5FUZL 2MQ0A 1PD1A 4JFFB 2YEVB 4XP1H 1FZMA 1XD1A 4WJKB 1RPKA 3IMUA 5EBWA 3ET9F 1CK0H 5HYJD 4XCNA 4IGBD 4X4YA 3R06B 1TETH 4WO4D 2N1TE 4P5TA 3I02B 2PXYB 4QLWA 1DO5A 2GW5A 1QLFA 2D7PA 3QNZA 3ZTJG 4QXTB 1WT5C 3F7RA 4MRCA 2FR4A 9CGTA 4HIQA 2UY6B 3G04B 1NUDA 3KYAA 1RZGB 5D7IE 1J9QA 4RX4D 3SE9L 5BVPL 2IWEA 3VD3A 1QRKA 1F1DA 4PJAB 4LHUD 4ZXBD 4X42A 4EEEA 4PW9A 5E9DA 4YDJA 5KSVA 2XTLA 2WO2B 1MG3C 1IJNA 3KPSA 5GGRA 3QDJA 4X9IA 2P52A 5E8EB 4YR6A 3K0WA 1FIEA 4ZQKA 3WAKA 2Z9TA 3O9WA 1B4LA 1EJ6A 2XV6B 3NIFF 2B9BA 4MA3B 2QELA 4M7JL 4U1GB 1N19A 1HCYA 3P54A 2ZSWA 1K8DB 1J9SA 3G08A 3QWQB 3TN0D 3U1SL 1URLA 2JSFA 2VL4A 2YD0A 4Y4FA 2CIKA 4LSTL 4BV1A 2VR6A 3I9AA 4HSAC 4OV5B 2V3FA 4PSPA 3ETBF 4WTWA 1EIBA 4NIYE 2CXGA 1IEHA 3DGDA 4G7YL 2J44A 1GYVA 5FGCB 3UL4A 4JPVL 3WY1A 4KKAD 5ID0B 5EU6B 2IDTA 3QDGA 1E3FA 1FVEA 4ZW7A 4A6YB 3IDNA 1R75A 5GHWH 3ZPDA 1OAXL 4RIRA 2AQRA 2FIKB 1X5AA 5DUML 3ZL1A 1ONQB 5F0PB 1J48A 3HMXL 4L23A 1JGUL 4BFRA 2Y2WA 4QAWA 1E4HA 1CLZL 3EYSL 1I9RL 3EG9B 3CVIH 1B4RA 2ITDA 3MRGA 2H32A 5CU9A 3VXTA 2W65A 3OJ2C 4Y1AA 3NRPA 4PJHF 1QACA 2O30A 1EGJL 4HUWA 4BK5A 2YBGA 1A9BA 4HWBA 5EO9A 2D9QB 1I7ZB 1Q72L 5IKCB 1ORQA 4Z23A 3RVVD 2FH6A 3DOIA 2VLLA 5ISZE 1I9JH 4XX1G 1BQKA 2ZYSA 1S5IH 5FW7A 3T0WA 3DGGB 5D6CB 5F8RC 4Y0GA 2BHYA 3HEIB 3X13A 2BWIA 4RFOH 3K1KC 4AE1A 4N0CD 3VGFA 1ADWA 1BMWA 2GC4C 5GGQH 3E8UH 1T5KA 1B2YA 2R29A 4HQQL 1H15A 3O6LL 4YHML 1U0QA 4FXKA 3T4YA 4ADGA 5I9QB 2O6PA 1KPUB 2W88A 1G9NH 4N2EA 2XXMB 5GPRA 1S7UA 3K6NA 4UOQA 5DZNA 3QW9A 5LHDA 1GGCL 4LOEA 3STZA 3Q8FA 5JXEC 3KCWA 3SE3C 3UEZA 4LKXA 2NYZA 1H9DA 1JRHI 2P5WE 2VLKD 3L5HA 3QEGL 4JO4H 5D4HA 1EZSA 2BCKB 5D1ZC 2MCMA 2ADIA 2VC2H 3WFHA 3QULA 1SRDA 3DVFA 1KYOJ 5LJYH 1TT6A 3MJ8A 4XCYB 5DMIL 4ZW6A 5AB1A 2A0LD 3GZQA 3L1OL 2L04A 2WVVB 4AZ8B 1MREH 3G5ZB 4PRIB 3T2OA 1ZTXE 4LGSB 4EQ3A 1LD9A 3ARBA 1FCGA 3RDTD 1BXAA 4DN4H 3QRGH 1B9KA 1MRFL 2IGFH 2CJUL 1UUNA 3HNTL 1UUSA 2YD1A 3QXAB 1FC1A 2AXJA 2YD8A 2IPUG 4L4VA 2VUOA 3X12B 4TOYL 3OTTA 1ZS2A 3K8KA 5F96H 3N04A 2ZKYA 3QDAA 1SHXA 3RY6A 3S6CA 5MEOA 5B7MA 4NKDB 3O41B 4NNXB 5AL0A 1QEWA 1BBDH 3QZNA 2ZNWA 3KWWA 3OGCB 1LK2B 4F7MA 5T1KA 3N40F 1SJMA 2YD7A 5I1JH 4G8EA 4TULH 2Z7UA 3R18A 4B9CA 2D0HA 4AH2A 5IK3A 1HEJC 1XR8B 1KBGH 4DK6A 5CEXB 2OTWB 5DRZA 4BFJA 3L5JA 5DJDB 1SZNA 4HW6A 1BZQK 1QLRA 5FGBC 1QFUL 5HYQA 2HTKD 3W0WE 1HKLL 1U91A 2MHAB 1Z6JT 3Q43A 5DI8B 3T2NH 4NX0A 2F53D 2PABA 1WA1X 3DX1A 1BLNA 3U0WH 1ZJAA 4CADA 2C34A 2CGRL 3EUUA 2QEJA 5E94A 3KW8A 3QCTL 4DERA 3Q2WA 3D3VD 1VESA 3BVXA 3UG5A 3SDAD 4JZJA 1IT9H 1KCRL 1U8HB 4TVPL 5ERWA 5FUOL 1K72A 1XGRB 2G3XA 3GRWL 1KIRA 5DURD 2AFNA 2V7HB 2Z31D 3ZKXC 1AY1H 2BOCA 3OZLA 5DD3L 4XVTL 3RTQC 1NCWH 2GFBB 3BUPA 3QQ4B 2IANE 3MRIB 4YNYA 3EOAA 4Y9BA 1G9ML 2X6CA 1E9OA 3RNKA 3QEHA 1XVSA 3BIKA 3OGOE 3NFSL 4GOSA 3FMGL 1FO0A 5BO1H 1YO4A 1A1OA 3RVUD 4PTTB 3E7JA 4Z7WB 1UM6H 1E2ZA 3MRBB 3B6SA 5E4OA 2XTSA 5B39A 4FD0A 5TH2B 4JRLA 1AGEA 4IBZA 3LB6C 1HCFX 2DQUL 2ZF8A 4A04A 3EDDA 3UJIL 1SFHA 5ECJE 4FEIA 5FOBA 1NIEA 1CLOL 2NY0B 3MRMA 4KXZH 5L6YL 1SOSA 1ZLWH 1EFXD 3U7WL 4YBQC 4AYFA 4XNQB 3NJXA 1CYGA 4HIPA 4FYQA 4X6EB 5AW7B 4A68A 1QRNE 1SJHA 2JLLA 2WXGA 3VI4A 1JL8A 5E70A 1K3IA 3IMVA 4UNVA 3W9DA 3P3SA 1OM3L 5FKPA 3RNQA 2YAHA 2AMUA 4FQQB 1BD2E 3G04A 2YGPA 3BUQA 3DARA 2E76C 5A3IC 1OARH 1G7PA 3CMGA 3TEUA 3WNIA 4YHLL 3KLAA 5I1HL 3T6XA 3ZQ9A 3VDAA 4E9SA 4JM4L 2RMNA 3TVMC 1EZVX 1V3JA 1GVIA 4BUHA 1HXMB 3RKPA 5CFAA 1U3YA 2QKSA 2FX8H 3ISYA 1V27A 1NM9A 3GK8L 5E8EA 4O51B 1PZSA 2Y72A 3T71A 5DS2A 1EEYB 4OSUL 2FD6H 1FL6B 1OTSD 4FQ2H 3RVXC 1C9SA 5F7EL 4HP5A 1OP3H 4ZI8A 1YYMH 5DD0H 3WJLC 5I15L 5FFLA 1ZT7B 3EH2A 3L3HA 2X0UA 4MNHB 5KVEH 5CWSA 2IDUA 4P4KC 1S3KH 4U3HA 1N9PA 1M6OB 4HKXA 2IQAA 1BVLB 1S7TA 4N90D 5A16A 1A2YA 1ZS8A 2H2SD 2R9HC 3MLPA 1AIFB 3KPOB 1G1CA 5EPMB 4YBLB 4L0YA 3AROA 1NIFA 4KTEH 3ARED 4GSRA 4RMBA 4AM0A 1AR1D 2LTQC 5E03A 2YD5A 1AXIB 4G8GB 2EKJA 2VTFA 3HPJA 1MNUL 4PLKC 1UZ8A 4Z0BH 4OU3A 3FTXA 4R7DB 2XPGA 2WC7A 5I26A 2V3DA 2XI9A 3VD5A 3NACH 4F7TB 1PD6A 4MXQC 2CKNA 3KPLA 3VFTA 4E41E 2OW6A 4ELKA 5DVKA 4AQ1C 3U7AA 5TFSH 3WS6A 4RMRA 2E7LA 5CGYD 1MCSA 4R6UA 1NPUA 2PYED 1WFNA 4PJAF 3RU8H 2OA9A 5BOZG 4BSWB 4R96A 3S3SA 3T9WA 1R24A 4X7SL 1HNYA 4YVUA 3HG1A 1YNLH 4FC3E 3MUUA 5DRXB 5K9QI 3QDMD 4JN1L 4MA8L 1SBSL 1JF1A 1HOEA 4NQCA 4MCZB 1L3NA 1L9PA 1P6WA 1R5WB 4FAAB 5JXAL 4I8DA 1WAAA 3ORJA 1N6VA 3W2DL 4JJOA 1IJ9A 4TKWA 3E3QC 3HMXA 5ACMA 2B14A 3RIKA 3I9GH 2AQPA 5DK0B 1A6UH 1KPUA 5D2NC 4ODXB 3P73A 1IAOB 3HN5A 5FPIA 1LE5A 3EBIA 4BBWA 1QSVA 3D33A 3HI1A 4YWGL 5K9JL 4LFHG 1EGJA 5D5MA 1BYOA 1MLBB 2YWZA 1SEQL 2VMEA 4H2AA 3S7GA 4DKFH 1QFOA 1NIDA 1G0XA 3SKUD 3FO1B 4A7TA 35C8L 1CF1A 2ZF9A 3II3A 4WJ5A 1L7IL 3JZYA 4HUKB 1K8IB 2XVLA 4KX9A 4YEEA 5EIIG 3AS0A 3IFNL 5F7LB 4D0BA 5BMFL 5D1ZB 3MFFB 2Z35A 5BZDA 1VEPA 1YEHL 3DVGB 4OUOA 4N8VG 5FWQA 3IJSA 3ROLB 4HDIA 1F1AA 2DL2A 1KT2A 4JRXD 1ZANH 4XHJD 3GI8L 2VN4A 3PL6C 5EC1A 3EYUH 2VLRE 3SY6A 2Y7QB 4POZC 4Y1SA 3U83A 2ZOLA 1N4XL 4IDJL 4NLHA 4WNQA 2YMXL 4F58L 2B9AA 2H1PL 1SNRA 2VZOA 3MLVH 2NW3A 1E8WA 3DURA 3W81A 2NNRA 4G70B 1WAAF 2OMNA 2VDLL 4EZMA 2O5ZL 5DWUH 4F9PC 1MJJA 2BSSA 5TGBB 4C57C 4G8IA 3NPZB 4C54A 3D18A 4NB7A 2OTWA 1WS8A 2OBGA 4KKBC 3QG6B 4XMLL 1F5WA 1QABA 1TITA 1GTFA 4NUJB 1BMZA 5CEZD 3QXDA 4W6WB 1I8AA 1ASQA 2VZSA 4N25A 2QZ5A 3KYNA 1QHOA 4AV0A 2W0FB 4QTHA 3GDCA 4E41B 1H3VA 2IFGA 3FO9A 1XF4B 1RZJL 2EADA 4OD2B 5HGBB 4OM1L 3BLBA 5DJ0A 4FTVA 3FFDA 4QO1A 3S4SG 1WDAA 6TAAA 5JHLL 2WKGA 3DK0A 1EMTH 4UU9A 1MEXL 2AJZB 4HFWA 3WIIH 4UNIA 3RUGE 4Q56A 1X5IA 5KVGL 4NXSA 5EOQH 3PDDA 4LAQH 3MRIA 1AGCA 2XPYA 4IW4C 5D70H 3V8CA 1JAEA 3WIHH 4HGMA 1NQBA 2Y07H 3A67L 3ZKXB 5I1DA 2CZNA 4P04A 5E2WL 5T33H 4QWWC 4DUVA 5AFAA 4NNPL 2YAQA 1XCQB 3BP7A 4XOEA 3VGEA 4NM4L 5LAXB 1VERA 4I3RH 1A4JA 3A4DA 2AEQL 1RPQA 4I9XA 3LPPA 2ZCHL 3VWJD 1KJ3H 4YK4C 1F4XL 2EXYC 1BQ5A 2YRZA 3BKML 5ACZB 2WANA 1WBYA 3BT2L 4RWYH 3CFUA 4UT9L 1PKQB 2ZWKA 1MWAH 1TVHA 2PN5A 3D2UB 3FN0L 5F1SA 1E4WH 5FYKH 4I0PC 4FG6C 1A7BA 1OP5K 1J8RA 3VGHA 4KK5D 3GRWA 4O02B 3VTTA 5LCVH 4K4KA 3QZOA 3PGDB 2YD2A 5DJYA 4YXLH 2HTLD 3MV8D 1F2XK 1Q9OA 1E30A 2L7EA 1ZVSA 4RMWA 1NFDA 1BEYH 4ZO7A 1AGBA 4G9DB 1RFDH 3MZGB 3LJ3A 4EO5A 3BUTA 3E3QE 5KANI 1Y1DA 4OF3A 5D55A 1W0VB 3L3OC 3T8XB 4PSRA 5L9DL 5DD6A 2X6VA 3AG4B 3VA6A 2DV6A 2HA1A 5I18L 1R4XA 4M02A 5EO0B 3WN5C 2WNXA 5D2NE 4UQAA 4DGIL 4ZFQA 3JTBA 3LOWA 1UA6H 1U8CB 2HKHL 2YJLA 3O4LD 4MXWH 4PB9H 4M9OA 1WC7B 3U0TA 2HVJB 4LLUA 4W93A 1WWAX 4EXKA 4CN1A 2PCYA 4Y9EA 4RAVA 3K2UH 2CLZA 3GJFA 1FG2B 2NX5A 4Q0XH 3FH8A 4I7ZC 5DUBA 1PZ5A 2DKMA 1NEPA 2JJSC 5T1JA 1JD7A 1R19A 4OR1A 3ZQXA 2GBVA 3U4BL 4LL1A 2JB6B 3DXAB 3CPLA 4GRMA 4N9GA 2P9RA 2X1QA 4JFYA 4ICWA 3WMPA 4Z7WF 1G6RL 4OFIA 1XV8A 1GIGL 4UQIM 3ESUF 3C5ZC 2LHAA 1CBVH 1CFVH 3BX7C 4KVCH 1RZ7L 3KPQA 3X3FL 4M8UA 4RAHA 3KEDA 2Y3NA 3ULVC 1KG0A 2NTFA 3HPLA 1BVLA 3ENEA 4PP2B 3ARXA 4RCAA 2AEIT 2ADFH 1PG7L 3CFBA 2LLNA 3ISWA 3PS6A 4J4PC 5INCB 3RLSA 4P4KB 1HTYA 2ZJSH 3EO9H 5GRVK 5I66B 1WICA 2OR8A 5AUMA 3TF4A 2NZ1A 1NFDF 2BVPB 4OD1H 5IW6A 4PHXA 1M7XA 3JWDL 3RUGB 3FQTA 4KKZA 4YDZA 1KN2H 2A38A 5AVTB 2LTQB 4KKQA 3CDCA 4M43L 3E38A 2AJYH 4NGHH 4LCWB 3O8XD 4ZMZA 1GPOL 5IJBC 4FFYL 2EE0A 3HN8A 4PY7A 2ALAA 2B2XL 4HLZG 4DP4X 2NUTB 2GAZB 3TS8A 4R7VA 4AQ1B 2BHFA 1Z9PA 4JAMB 4BFNA 4BDVA 4LRIA 4CW1A 3TYGH 3POCA 1B3IA 4L5FL 1YA5A 1JZ2A 3F7LA 5SX5H 4EDXB 3BSZL 5IROD 1T89C 5EZOH 2CH8A 3LH2H 3W39B 3VMPA 5AW9B 2D03L 4DVBA 4JPKL 3JBG7 1GHFL 1C5CH 2EDRA 4GAAA 3MREB 1PNCA 5FA4A 1FLRH 2MJWA 4WO4A 5ITBH 1TJIH 4HK0B 2IBZX 4EE2A 1T22B 1KNOB 2YKLH 3FB5A 5IBTH 1A4KA 4OH2A 4ZFGL 1IFHH 2CBTA 4P5KA 3MN8A 3HZKB 5AZ2L 2J6WA 3IDGB 3QT2A 3SCMC 4YXHL 3E1ZA 2VUYA 4QY8A 2R1XA 2Q3ZA 4GI6A 3QCUH 4CMHC 2NZ9C 4JHUA 2N59A 4LHUA 1T2JA 5D71H 4NERA 4XI5D 3CCHB 1F11A 1K8IA 4Y5VC 5ADPH 4F1SA 1C7SA 3RL2B 1SLWA 1MW2A 4LLVB 5DD5H 4R7NB 4JDEB 4ETQA 3PWPA 1XF2B 2IWFA 3HC3H 1Z9SA 4DZBB 3R4RA 4HBCH 1EDQA 2NY5C 4G6JH 5DUPH 5TE7L 4Z8FH 4JFEA 2NNAB 5I1IH 3RTQB 4HJGB 2ENPA 1CFNA 1EVTC 1PQZB 3LEYL 4J28A 4NFCA 2AEWA 3QS3A 4XGZA 2AANA 1QSEA 5JW4R 2WBKA 1A6ZA 2O6DA 1HXYB 2WNGA 1LO2H 2WM0A 3P4LA 3GIVB 1KELH 3UP6A 1NBYB 2J1WA 2O6FA 2YSSB 3GMOA 3A23A 4HJUA 5CJQH 5JQIB 1H3TA 1R5VA 2CK0H 1GZPB 3O3BA 1G7LA 4G2AA 3BVVA 3V4PL 3PL6B 3PWUA 5ALCH 2GHWB 3LKNB 3EBHA 4J2QA 3WEXA 1P4LA 1TLMA 3CUPA 2DIJA 4NZDA 4JKKA 1AXSA 4G59C 5LVEA 3V0VA 3UGXA 1AYRA 3QZLA 1DQJB 4UILH 1INQB 1YNTB 2YZ8A 3H0TA 1ED3B 2CDEA 4H8WH 4OCWH 5IMKA 4AG4L 3FQWA 5ECGA 2EDQA 1ZV5A 1LMIA 3KVQA 3LZOA 4AVJA 1BWWA 4R4FH 1SQ2N 4UQEA 2OMXA 4X8XA 5D4QA 5IB4B 5C0RH 5FOJA 3MTXA 1U8JB 2Z4TA 4I18B 4JQIL 5GS3A 2B1AH 3RWDA 1DVZA 4RESB 5E2TL 5IF0B 3NGBC 5HHQB 1CR9H 3DUUA 3WXVH 5I2IB 2F58H 4S2SB 2H41A 2GJ6D 1JGEA 4FFVD 2JKLA 3ZT7A 4GSDL 1DSYA 3CBJB 2GB2A 3ULVE 3P4OB 5ABZA 2I25N 2FVNA 2XZQH 5M7QA 1AFVL 5LWYL 2K7QA 5HDBE 2DAVA 2ZIDA 3RVWC 3PJNA 3RGHA 3CH1B 5HGAB 1EAJA 5IIEB 2E74C 2J1ZA 4MXVE 1U42A 1E7UA 4N2CA 1HNGA 1EANA 2XC8A 4TSCH 2A5UA 1MIEH 1TPXC 3WKPA 2R39A 3L08A 4ZW5A 4FADA 4IOFD 5IT2L 3ARQA 2X0VA 4FFZH 3T3PE 5CF3A 3FQRB 4UB0L 4DP6X 2NLJB 3CLFL 3TJHC 4PJDA 4OLZH 3S36H 4IMKC 3PWNB 5ACZA 5FHAL 4V1DD 3IFPB 4WDIA 4F57L 5L4JA 1MCPH 1UZGA 2AS5M 1J8HD 5KG9B 3LEVH 2DYRB 3I3BA 4KZEL 3OF6D 2BFVL 3NN8B 3QJQB 3OKLA 3SYAA 3ABLB 1U8QB 2IEPA 3FDWA 3LMJH 4YK4B 5D1XE 1GL4B 1NCIA 5JHLA 1KJ2L 5J57B 5CEZL 5IP4A 3V0EA 1A3LH 1IEBB 3QUMH 4B7IA 4ODBD 4XPAH 4YUEH 3V4VB 2EIMB 2AI0L 1SJEA 2A73A 4MQXD 3MA9L 4UT6H 4I87A 4D3CL 4FKEA 2NNCA 3L6FB 3LHAA 4XBEL 4XP6L 5BRPA 1ECZA 4PVNA 3LNDA 1HFUA 3LH9A 5DF0A 3V5KB 4FNLL 4E0RA 1P4BL 4OJEH 3OWEA 3ROOB 3JV4B 2H26B 1KZQA 4LASL 2IPTH 3P4NA 5B8CA 1WITA 4C58B 1XIWD 3WNOA 1DANU 5J1AB 1N5AA 4WY7L 1P69B 3MFGB 1UC6A 1CG9B 1N0LA 3ZXAC 4LCUB 1PSKH 1SUJA 4ANXA 1L9SA 4UT9A 4I13B 3NCYS 3ERXA 4NI3A 4C56A 3EIFA 1PLGL 3N85H 2OJ1A 4F20A 2B0SH 3SBRA 3D0AA 4MQSB 2ED8A 3NUKA 1I7UB 4UDUA 3HLKA 1KYUA 2Y4SA 1J1PH 4APXA 1I3RB 4EZJA 4HD5A 2F53A 2P8PA 5C9JB 2AXFB 3FT9A 4FYRA 4PW3A 1NUGA 4K7PH 4L29B 4X98A 2Z91B 3Q6FB 3ATAA 1ZWIA 3D3VA 4JRYD 4RRPA 3RPBA 1YQVH 5IFHH 3SDAA 4Z3JA 1KLUA 2DQEH 3C5ZB 3FQUA 2VQ1A 3Q8AA 4IJTA 5IW1B 4KHTL 2WB7A 3QJTB 3LNFA 5E9DE 4P2QD 3KLHC 3VQLA 2VDNH 2VERA 2Z31A 3OLEA 4J3TA 2K9UA 4G6FD 1MRCL 4JPWH 3VRLE 3VX1A 2N7SA 1DBKL 5BS0D 4XC3L 1LDPL 1UYWL 3MRRB 5I0XA 3OSVA 3GXTA 3QYMA 2DQFA 5DO2C 2L8AA 4RWHA 3LSOB 3SYPA 4HC1L 1R3IH 5MHSD 2CHXA 2WXIA 3ASNB 5DEFA 3CDGB 2J2ZA 4GAYA 4HIHB 4AYBA 1T6VN 4L1BA 5IB5B 1G6RA 5LB1A 1TTCA 2V6HA 1IGFL 1ZEAL 5E5UB 2RCSH 4EN3C 1IAKB 1U3JA 1AZZC 3LZFL 1JDCA 2FZ3B 2D7TH 3F58L 1ET8A 4UV4H 1RUKL 4YDKL 4I4WB 1MCDA 1ZT1B 1YMHA 1KN4L 1JPFB 3ARUA 2ITCA 4YMPA 3VFGH 4ZFFA 2Y1VA 4WHYG 3ARGD 3PREA 4HIEA 3MR9B 2WVTA 1XGTA 3EYFA 3KPRB 4YX2H 5F0MB 1FFNA 2OQJB 3QZWB 5K39B 1EFXA 4DWHA 3ZO0A 3GS4A 3QFJD 2W0PA 4BWUA 1HU8A 4Y1AE 2IXQB 4H8HA 2C26A 4PR5B 5IHUH 3T8MA 2HG5A 3FU5A 3HKZA 3MLRL 1YQ2A 2XU9A 3K5RA 3PY9A 2CWRA 4GEIA 4JPIB 4N2AA 1NAKL 3TV8A 4PWGA 4X9YA 5AYTA 4X6DA 5KVFE 3P40A 4R83A 2Y7LA 3G5VA 2V8MA 3EDKA 2VGLM 1JNLH 2RFXA 3DTDA 1E5UI 5DTFA 3WMSA 4A7QA 1FH2A 3FOLB 4FFYA 1MFBH 4X7FC 4U7MA 4M1DH 3BUYA 2NTSP 1D7DA 4IRZL 1NC4B 3CHSA 5GGTL 3NIDE 1KTKE 1N0XL 5IMOA 3WMQA 1QLEB 4BSVA 4JFPA 1IQWL 1EK3A 2I7OA 3RUGF 4Q9CA 4KO9A 5HHMD 3NQIA 2ENSA 4LOVA 3S3BB 4CMHB 1N70A 2VL5A 4AM0Q 1RZKC 3S9DB 3BSZA 1FWXA 1GMIA 2NY2C 5BZWA 1O75A 3DHPA 1EHKB 2ATAA 4Y5VB 4G43A 5INDA 5T1MA 1UXWB 4NQSB 2WUBH 3WGUB 1IE4A 1JRHL 1CVSC 1XB3A 3U4EA 4LEXH 5IMLB 3OX8B 1L6PA 1RU9H 4L3AA 1NCDH 4MTMA 4IMLA 1SYVB 5CLXA 1I75A 1RZ8A 1H9VA 4WHTB 3VMNA 2XJLA 3UTTD 2WO4A 3VO0A 1CDBA 2OLDA 1JHTA 5FO7A 1ZGLP 4JFDD 5GIRA 1CE1L 5TDOB 1ANUA 3ATBA 3FSVA 4GMSH 1NCAH 3V4LA 1DUZB 2A6IB 4NO0A 1QWHA 2K3TA 1DQJA 2BSRB 2VDRL 3D9AL 3VXSB 4HV8B 2ZXCA 2O6CA 1RLWA 3DOSA 4IU2A 5DEGB 2YBRA 4QHNA 4YAQA 4ODHL 4TLTA 1A02N 3CC5B 2CD0A 1K5NB 2XZCL 4I18A 4L4VE 1T1XA 1N3NB 5C0EB 5I30H 1CFQA 1YECL 1UURA 3LKPA 3MV7B 2OSYA 4OKVB 4BFEA 2PYEA 3RPKA 4LQ1A 4RMQA 5A2BA 1LO5A 2QPSA 2ZAGA 4LPCA 1QBMH 4M7LL 3GC3A 2W95A 3HRZC 5T1LA 2WOYA 3NGBB 3V4PA 2KI6A 5ITFB 1T6WA 3DVIA 1RD6A 5DHVH 1UH4A 3B9DA 3OXSA 4LCIH 2YC1A 5CP3H 3DSNB 3GNMH 4ELDA 4CSTA 1QWNA 5GRXG 4U3SB 1FE8L 1IM9A 1YYLH 1Y6NR 4HS8L 5KVDE 5HD8C 4KK6D 4JGNA 4K9EC 5EH1A 4GG6A 3FXIC 5IW3A 1BVKB 4TQ8A 1T0MB 3QORC 3IRZA 3EFDL 2MQ3A 5DD1L 1NGQH 3TBBA 4IDLA 4JQIA 4MASA 3DWTA 4NPJA 4X4XB 2H4EA 5KSUA 3SBWA 1TPXB 1JPSH 1M3IA 1WEJH 3ARVA 3KDMA 4G9FB 2JJTA 5PCYA 2JB5L 4L3FA 3SQOL 1X7QB 4B3VA 2UZYB 3B1UA 4OUUA 3ZIYA 1YNTF 4Y2DD 2R0KH 2P5EB 3OD3A 2UZIH 3MOAL 4GP5B 3B3IA 4TF4A 5H37H 1G7MB 4KFMA 2OSLA 1ZLSL 4NKIH 5E4IA 4UM9B 5CSZB 1RLBA 3BUBA 5JIPA 2VQUA 2WTRA 4MD4A 5FDWB 1U36A 2IC2A 4MNQE 4AUUA 4ELMA 2V9UA 4MA7L 1BF2A 2M2DA 2ORBL 3KVDD 4LCCC 1KB9K 2QJDA 2AV7A 5I1AA 2AEOA 2F15A 4D9RD 2O5YH 4PLNC 3CJJA 5GGSY 5J3HC 4JANA 1CFTB 3JV4A 1YLBB 2B59B 4AV5A 5D1QD 3EYVA 1BAFL 3K3QA 4CKVX 4GY4A 3MCYA 4NZJA 4NSKB 1OGTB 1MCRA 3LIUA 1QQDB 3JTTA 4NN7B 1FFPA 3S2AA 3TU6A 4R2GD 2JELH 5KYWA 5T3ZD 4OGAD 5LO7A 4KNTA 2C3VB 3PHQA 4XOBA 4Z3GA 3FFCA 4ZT1A 4OFPA 4Z3FA 1B0GB 5IREA 1ZLWK 1KJ2A 2A83B 3WDJA 1F02I 3IGAA 1DANT 2YFOA 1NTDA 1I3RA 5I5RA 3IF1A 2OL3B 1DLHA 4MJ5A 4A7GF 2OMVB 1DBBH 4YFDB 3CSTA 4LK4A 5KJRH 3BHBA 5I6LA 5T5FL 4HUMB 2X4UB 3NSFA 4LPXA 4LSUH 3FQNB 1LWJA 3V0HA 1T21B 2E4FA 2X42A 4JFQB 3HE7C 3NP4A 1SVBA 3L81A 5GS0L 3LS5L 3TC9A 3VD4A 3DV4A 4YBHA 2B1HH 3KWTA 2VIRA 5F1IB 5CEYB 4M6OH 5C2BL 4L8CB 1YDPB 3A0OA 3C6LD 3IETA 2FRGP 1KXHA 4QRQA 5F44A 3VXNA 4WENB 3FRPB 2CIIB 3LQAH 4P9HH 5F1OB 2DJUA 1JWUA 4H8PA 1CYWA 5ILTH 3IPFA 3VFOA 3S34H 3O0LA 5JA8B 3ZL4L 4F24A 1OB0A 1R5IB 5E6YA 1OP3K 3TGXA 1FVCA 3SIKA 5FYJU 1MQ8A 5ES4B 3OR7A 4WAFA 1NDMB 3OJMB 3FUHA 4KK9C 4ESKA 1HZLA 1XZWA 5HGHB 1C16B 4H40A 4U1IA 4KKRA 1PZAA 3OKMA 2GY7B 4YDNA 3T0EC 5IHZA 3QIBB 5HVWA 1IQDA 1TJGH 1V7NL 1MIMH 4HCRL 5ENWA 4OCRH 5ESQA 2PO6D 4GEJA 4Z7QB 4NAQA 2OQJA 4PJ7B 5DC9B 1XAKA 5BV7H 4HT1H 2VKXA 3BAXA 1S7RA 1TQVA 1RVFH 3EJZC 3M86A 3MV8A 2HJKA 4MB4A 5D7JA 4RFNC 5H35A 5F6HI 3LS4L 1KLGA 2W9LA 2DQTH 5HI4D 4M5YL 4HC1A 5IM7B 3OKNA 1P7QB 3BAEH 3O0RL 3BQUD 5LKNA 2D0GA 3HG1E 3RX9A 3HUJB 3VCLB 4F8PA 2VERN 1WH0A 2A9CA 3QQ3A 2JCCA 1KCSL 1NC4A 2XWRA 3AC0A 1AJ7H 3B9KD 4NQCE 3CVHH 4PCKA 3QCVL 5EN2A 1NKOA 3QQXA 5FFGA 3SGEH 1CIDA 3BKCH 4U31A 3SDYL 2Q76B 2ZG1A 4PFEA 4JG0L 1U21A 4Y7MA 4MAYC 2R2EB 3MLYH 4PJ9C 2R2BB 5D7LD 4FI7A 3S36X 4QHMA 1VF5C 3M8OH 3MU3A 5K93A 3GHEL 5F9WC 2VN5A 4U4IA 3DRQA 3FTGB 4I1NB 4PYHA 3D39E 3AJ7A 1BZ7A 3I6LD 5IMLA 1RZFL 4HLEA 1EA9C 1EXUB 2I60H 1X5XA 4G8AC 4ONFL 4XAKE 4NWUL 3LN5B 2KUTA 3ZTEA 1KTLB 3WENA 4F1ZA 1WWWX 1ZHNB 3EAKA 2ESVD 1JGLH 2NY2B 5D5ME 3K72A 3FS9A 3QNXB 1VZHA 3UYPB 2VDMB 3GWJA 1ETZA 5LQBL 3H54A 1HSBB 2EXWD 1T0NB 3HHMA 4IYKA 3LRSB 4N85A 4KI5C 5DRWA 3CN3A 4HHWA 5E0FA 5AAMA 2VZ3A 4IRSD 3V6OC 2VW7A 4E9XA 4FMVA 4IRZA 4JG9A 3FUJA 5GGTA 1TJHL 2CA3A 3QISA 3VXSA 4ORGA 3D48R 5IQ7H 1R0AL 3A6BH 5JIIA 2YPLD 3CSYB 3FQYA 3GO1H 5E1HB 2A6DB 4FXGA 5IFAL 3IGKA 2X7LB 5TF1H 2LU4A 4NO5A 2CKBH 3QR0A 3CIAA 3CLEH 5IBLD 4P2RB 3JV6B 4J3OD 3EGDA 1SYSB 1U58B 1XF3A 1BXVA 1KTRL 2JCCF 1T2QL 3MCLH 1EJ8A 4I1PA 3D0VB 1TVBB 2F5AH 3MRJA 5JNYB 4HWEH 1KB9J 2FX7L 2WP3O 2KMWA 2BIQA 5C0AD 4DGVH 3V9FA 2EKSA 4XOCA 2IAMD 1BM3L 4MB3A 3MRDA 5JQHC 5B4MC 3SY0A 1A65A 4LRNH 4BZ2H 2J20A 2IV8A 3HRZB 3JT0A 3MRLB 2XT1B 4ONHB 2G9HA 1T1WA 2ZKXA 4NI6A 1BVKA 5I1EL 1GS8A 1VACB 1A4BA 1EDHA 1NMAH 1SY6L 2CJTA 1LK3H 3O2WH 4ZUWA 4Q9RH 3ULUL 4Y5XC 2NY3C 3QIUC 4HIJA 3HHSA 3DSFH 5DZOA 4GKNB 2UYLA 4YEFA 3QORB 5KBPA 2HX9A 1UTDA 1T4WA 2DQGL 2DICA 5EWIL 4P23D 3BRGC 1F4YL 1PZDA 3MJ9L 4W9IC 1MHPH 4FF9A 3CHQA 3VRJB 4YE4H 3QJFB 2J6EH 5C0CB 3FT0A 1GR7A 3PGFL 5JR1L 3AMLA 2VDQL 4KVNH 4TMPA 1TQBC 4WFFD 4FDWA 4IGBC 4KQ3H 4Q4IA 4NUPA 2ZTBA 3H9HA 1AS6A 3GSOA 4GXVH 2WJ5A 1AYOA 4JM2A 3WUWB 3LTVA 1E6OH 2WP3T 4OY9A 4AOFA 1MFDH 3RAJH 4BZ1H 2QZQA 2VRQA 4EVNA 5EZLB 1A22B 5F9OH 4RFEA 2G9KA 4RGNC 5TE6L 4AIEA 2KERA 1NUNB 3IDYC 1YUKB 2ATPA 3CN0A 3KYMA 4QF1A 2PCPB 2Z93A 5TF0A 4PS3A 3DBSA 4HJ0D 4TM9A 4LCCB 4YSTA 1YPZB 4ZXBC 1RIVH 5MENB 2JKWA 1IU1A 5BVJA 2UUDH 3MLSL 3L3IB 2KLSA 2V2XA 2BM3A 5CLWA 1II4E 4DVRL 4B0MM 3MROA 4MX7A 1V7ML 4GW4B 3GKZA 4TVPE 4HU2A 4GI9A 3EFOB 4K8RD 5CJ5A 1D5MB 3UTZA 4DNLA 3MMEB 2ZG3A 5IY5B 4ZPTB 2OMBA 3TN0C 4AL8H 2PP7A 5CO1A 3ZDZE 1L7TL 5GISL 4CN6A 3OC8A 2VDQB 4OGXL 4ZUSA 4DW2H 3PIQB 1EZUA 3I75B 4FQXD 2DEXX 5LBGA 4FNTA 4QRPD 5C97A 5I1GH 2OYKA 5AZEL 2JMRA 4GRWB 2I27N 2X4UA 1GYUA 3IXAB 2GJ6A 3NMEA 4XCFL 2VISA 3G6JB 3V52H 3ZE0E 2R0ZL 4BGDA 2EVJA 2EEBA 4MJID 5IQLA 1TJXA 4XMPL 3T2QA 4HGWB 3VFVA 4IKJA 3W56A 4NJ9H 3BEWB 2VDOB 3VFWA 1HEZB 1VRSA 3NZUA 1X3DA 2GIYA 2EACA 1ITBB 1E40A 2WIIB 4PIBA 3GJEB 2BIMA 4KI5E 4JM2F 2I85A 4PJFA 3N1MC 1ID5I 2DTSA 3HE7B 2X5PA 2EC8A 5C6WH 3GIZL 3QPXL 4NT6B 4DP9X 1BZ9B