3R62A

Structure of complement regulator factor h mutant, t1184r.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
125
structure length
125
Chain Sequence
GKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWRAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement factor H
publication title Crystallographic determination of the disease-associated T1184R variant of the complement Factor H.
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 24
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3r62A01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3r62A02
3GXEA 1GPZA 1OK2A 3IX0A 2RKYA 3O8EB 1G4GA 1MD7A 3IU3I 4CSYA 4A5WB 1GHQB 2A55A 3T5OA 4B2RA 5HYUB 3CALA 1VVCA 4LOSA 3RJ3D 4ZH1D 1GKGA 3ZD1A 1OJVA 3GOVA 1SS2A 1GKNA 5FO8C 4C16A 1ELVA 1QUBA 2W80A 4LOTA 2CG6A 1OJWA 3EJHA 1E5GA 2G7IA 2QY0A 4AYDA 4PZ5A 2MCYA 1CKLA 2LOJA 1H2PP 3M7PA 2JGWA 2ERJA 2UWNA 1OJYA 3INBC 3OEDC 3TVJA 4F4OC 4AYMA 3OP8A 1O9AA 5HZPB 2YRAA 1NWVA 3SW0X 1Z92B 3NFPI 2EHFA 2MCZA 2XRDA 1OK3A 5I0QB 2W81A 3ZRZA 4YNXA 2XWBF 3ZD2A 1VVDA 3R62A 1G4FA 1C1ZA 2V8EA 1Q3XA 2EC3A 1TPGA 2KRIA 2RL0A 2IZ3A 4MUCA 1U5MA 2RLQA 4J38B 1FBRA 2RLPA 4KKDA 2XRBA 2O39C 4FXGG 1UOTP 4AYEA 1HFIA 2B5ID 4IGDA 2KMSA 2RKZA 3MQLA 1E8BA 3ERBA 1ZJKA 2JGXA 5HYPA 2CG7A 3KXVA 1E88A 1H2QP 1MD8A 3OXUD 4JHSA 3KZJA 4K12A 2WIIC 1TPNA 2JRAA 2XQWC 1QGBA 2BZMA 4WJG2 5JPMG 1OK9A 1LY2A 4AYIA 4DJZA 2YBYA 1HCCA 1TPMA 1PPQA 1H04P 5HYTB 1OK1A 2CKUA 4ONTD 1H03P 2XWJI 4B2SA 2IZ4A 1HFHA 3L89M 1QO6A 1SRZA
chains in the Genus database with same CATH superfamily
3GXEA 2Y8TA 1GPZA 1OK2A 3IX0A 2RKYA 3O8EB 4APLA 1G4GA 1MD7A 3IU3I 4CSYA 4A5WB 1GHQB 2A55A 3T5OA 4B2RA 5HYUB 3CALA 1VVCA 4LOSA 3RJ3D 3FGTA 2Y8RA 4ZH1D 1GKGA 3ZD1A 1OJVA 3GOVA 1SS2A 1GKNA 5FO8C 4C16A 1ELVA 1QUBA 2W80A 4LOTA 2CG6A 1OJWA 3EJHA 1E5GA 2G7IA 2QY0A 4AYDA 4PZ5A 2MCYA 4BWCA 1CKLA 2LOJA 1H2PP 3M7PA 3ZLDA 2JGWA 2ERJA 2UWNA 1OJYA 3F6KA 3INBC 3OEDC 3TVJA 4F4OC 4AYMA 3OP8A 1O9AA 2I2LA 3ZLEA 5HZPB 5DN4A 2YRAA 3VWOA 1NWVA 3SW0X 1Z92B 3CI0J 3NFPI 1RLHA 2EHFA 2MCZA 2XRDA 4YIZA 1OK3A 5I0QB 2W81A 3ZRZA 4YNXA 2XWBF 3ZD2A 3FGRA 2X2ZA 1VVDA 3R62A 1G4FA 1C1ZA 2V8EA 1Q3XA 4PO7A 2EC3A 1TPGA 3WSYA 2KRIA 2RL0A 2IZ3A 4MUCA 1U5MA 2RLQA 4MSLA 4J38B 1FBRA 2RLPA 4KKDA 2XRBA 2O39C 3NJAA 4FXGG 1UOTP 4AYEA 1HFIA 3WSXA 2ZYCA 2B5ID 4IGDA 2KMSA 2RKZA 3MQLA 1E8BA 3ERBA 1ZJKA 2JGXA 5HYPA 2CG7A 3KXVA 1E88A 1H2QP 1MD8A 3OXUD 4JHSA 3KZJA 4K12A 5DN5A 2WIIC 1TPNA 2Y8SA 2JRAA 3K3TA 2XQWC 1QGBA 2BZMA 4WJG2 5JPMG 1OK9A 1LY2A 4AYIA 4DJZA 2YBYA 1HCCA 1TPMA 1PPQA 1H04P 5HYTB 1OK1A 2CKUA 4ONTD 1H03P 2XWJI 4B2SA 2IZ4A 4N7EA 1HFHA 3L89M 1QO6A 1SRZA
chains in the Genus database with same CATH topology
3GXEA 1GPZA 1OK2A 3IX0A 2RKYA 3O8EB 1G4GA 1MD7A 3IU3I 4CSYA 4A5WB 1GHQB 2A55A 3T5OA 4B2RA 5HYUB 3CALA 1VVCA 4LOSA 3RJ3D 4ZH1D 1GKGA 3ZD1A 1OJVA 3GOVA 1SS2A 1GKNA 5FO8C 4C16A 1ELVA 1QUBA 2W80A 4LOTA 2CG6A 1OJWA 3EJHA 1E5GA 2G7IA 2QY0A 4AYDA 4PZ5A 2MCYA 1CKLA 2LOJA 1H2PP 3M7PA 2JGWA 2ERJA 2UWNA 1OJYA 3INBC 3OEDC 3TVJA 4F4OC 4AYMA 3OP8A 1O9AA 5HZPB 2YRAA 1NWVA 3SW0X 1Z92B 3NFPI 2EHFA 2MCZA 2XRDA 1OK3A 5I0QB 2W81A 3ZRZA 4YNXA 2XWBF 3ZD2A 1VVDA 3R62A 1G4FA 1C1ZA 2V8EA 1Q3XA 2EC3A 1TPGA 2KRIA 2RL0A 2IZ3A 4MUCA 1U5MA 2RLQA 4J38B 1FBRA 2RLPA 4KKDA 2XRBA 2O39C 4FXGG 1UOTP 4AYEA 1HFIA 2B5ID 4IGDA 2KMSA 2RKZA 3MQLA 1E8BA 3ERBA 1ZJKA 2JGXA 5HYPA 2CG7A 3KXVA 1E88A 1H2QP 1MD8A 3OXUD 4JHSA 3KZJA 4K12A 2WIIC 1TPNA 2JRAA 2XQWC 1QGBA 2BZMA 4WJG2 5JPMG 1OK9A 1LY2A 4AYIA 4DJZA 2YBYA 1HCCA 1TPMA 1PPQA 1H04P 5HYTB 1OK1A 2CKUA 4ONTD 1H03P 2XWJI 4B2SA 2IZ4A 1HFHA 3L89M 1QO6A 1SRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GXE A;  1GPZ A;  1OK2 A;  3IX0 A;  2RKY A;  3O8E B;  1G4G A;  1MD7 A;  3IU3 I;  4CSY A;  4A5W B;  1GHQ B;  2A55 A;  3T5O A;  4B2R A;  5HYU B;  3CAL A;  1VVC A;  4LOS A;  3RJ3 D;  4ZH1 D;  1GKG A;  3ZD1 A;  1OJV A;  3GOV A;  1SS2 A;  1GKN A;  5FO8 C;  4C16 A;  1ELV A;  1QUB A;  2W80 A;  4LOT A;  2CG6 A;  1OJW A;  3EJH A;  1E5G A;  2G7I A;  2QY0 A;  4AYD A;  4PZ5 A;  2MCY A;  1CKL A;  2LOJ A;  1H2P P;  3M7P A;  2JGW A;  2ERJ A;  2UWN A;  1OJY A;  3INB C;  3OED C;  3TVJ A;  4F4O C;  4AYM A;  3OP8 A;  1O9A A;  5HZP B;  2YRA A;  1NWV A;  3SW0 X;  1Z92 B;  3NFP I;  2EHF A;  2MCZ A;  2XRD A;  1OK3 A;  5I0Q B;  2W81 A;  3ZRZ A;  4YNX A;  2XWB F;  3ZD2 A;  1VVD A;  3R62 A;  1G4F A;  1C1Z A;  2V8E A;  1Q3X A;  2EC3 A;  1TPG A;  2KRI A;  2RL0 A;  2IZ3 A;  4MUC A;  1U5M A;  2RLQ A;  4J38 B;  1FBR A;  2RLP A;  4KKD A;  2XRB A;  2O39 C;  4FXG G;  1UOT P;  4AYE A;  1HFI A;  2B5I D;  4IGD A;  2KMS A;  2RKZ A;  3MQL A;  1E8B A;  3ERB A;  1ZJK A;  2JGX A;  5HYP A;  2CG7 A;  3KXV A;  1E88 A;  1H2Q P;  1MD8 A;  3OXU D;  4JHS A;  3KZJ A;  4K12 A;  2WII C;  1TPN A;  2JRA A;  2XQW C;  1QGB A;  2BZM A;  4WJG 2;  5JPM G;  1OK9 A;  1LY2 A;  4AYI A;  4DJZ A;  2YBY A;  1HCC A;  1TPM A;  1PPQ A;  1H04 P;  5HYT B;  1OK1 A;  2CKU A;  4ONT D;  1H03 P;  2XWJ I;  4B2S A;  2IZ4 A;  1HFH A;  3L89 M;  1QO6 A;  1SRZ A; 
#chains in the Genus database with same CATH topology
 3GXE A;  2Y8T A;  1GPZ A;  1OK2 A;  3IX0 A;  2RKY A;  3O8E B;  4APL A;  1G4G A;  1MD7 A;  3IU3 I;  4CSY A;  4A5W B;  1GHQ B;  2A55 A;  3T5O A;  4B2R A;  5HYU B;  3CAL A;  1VVC A;  4LOS A;  3RJ3 D;  3FGT A;  2Y8R A;  4ZH1 D;  1GKG A;  3ZD1 A;  1OJV A;  3GOV A;  1SS2 A;  1GKN A;  5FO8 C;  4C16 A;  1ELV A;  1QUB A;  2W80 A;  4LOT A;  2CG6 A;  1OJW A;  3EJH A;  1E5G A;  2G7I A;  2QY0 A;  4AYD A;  4PZ5 A;  2MCY A;  4BWC A;  1CKL A;  2LOJ A;  1H2P P;  3M7P A;  3ZLD A;  2JGW A;  2ERJ A;  2UWN A;  1OJY A;  3F6K A;  3INB C;  3OED C;  3TVJ A;  4F4O C;  4AYM A;  3OP8 A;  1O9A A;  2I2L A;  3ZLE A;  5HZP B;  5DN4 A;  2YRA A;  3VWO A;  1NWV A;  3SW0 X;  1Z92 B;  3CI0 J;  3NFP I;  1RLH A;  2EHF A;  2MCZ A;  2XRD A;  4YIZ A;  1OK3 A;  5I0Q B;  2W81 A;  3ZRZ A;  4YNX A;  2XWB F;  3ZD2 A;  3FGR A;  2X2Z A;  1VVD A;  3R62 A;  1G4F A;  1C1Z A;  2V8E A;  1Q3X A;  4PO7 A;  2EC3 A;  1TPG A;  3WSY A;  2KRI A;  2RL0 A;  2IZ3 A;  4MUC A;  1U5M A;  2RLQ A;  4MSL A;  4J38 B;  1FBR A;  2RLP A;  4KKD A;  2XRB A;  2O39 C;  3NJA A;  4FXG G;  1UOT P;  4AYE A;  1HFI A;  3WSX A;  2ZYC A;  2B5I D;  4IGD A;  2KMS A;  2RKZ A;  3MQL A;  1E8B A;  3ERB A;  1ZJK A;  2JGX A;  5HYP A;  2CG7 A;  3KXV A;  1E88 A;  1H2Q P;  1MD8 A;  3OXU D;  4JHS A;  3KZJ A;  4K12 A;  5DN5 A;  2WII C;  1TPN A;  2Y8S A;  2JRA A;  3K3T A;  2XQW C;  1QGB A;  2BZM A;  4WJG 2;  5JPM G;  1OK9 A;  1LY2 A;  4AYI A;  4DJZ A;  2YBY A;  1HCC A;  1TPM A;  1PPQ A;  1H04 P;  5HYT B;  1OK1 A;  2CKU A;  4ONT D;  1H03 P;  2XWJ I;  4B2S A;  2IZ4 A;  4N7E A;  1HFH A;  3L89 M;  1QO6 A;  1SRZ A; 
#chains in the Genus database with same CATH homology
 3GXE A;  1GPZ A;  1OK2 A;  3IX0 A;  2RKY A;  3O8E B;  1G4G A;  1MD7 A;  3IU3 I;  4CSY A;  4A5W B;  1GHQ B;  2A55 A;  3T5O A;  4B2R A;  5HYU B;  3CAL A;  1VVC A;  4LOS A;  3RJ3 D;  4ZH1 D;  1GKG A;  3ZD1 A;  1OJV A;  3GOV A;  1SS2 A;  1GKN A;  5FO8 C;  4C16 A;  1ELV A;  1QUB A;  2W80 A;  4LOT A;  2CG6 A;  1OJW A;  3EJH A;  1E5G A;  2G7I A;  2QY0 A;  4AYD A;  4PZ5 A;  2MCY A;  1CKL A;  2LOJ A;  1H2P P;  3M7P A;  2JGW A;  2ERJ A;  2UWN A;  1OJY A;  3INB C;  3OED C;  3TVJ A;  4F4O C;  4AYM A;  3OP8 A;  1O9A A;  5HZP B;  2YRA A;  1NWV A;  3SW0 X;  1Z92 B;  3NFP I;  2EHF A;  2MCZ A;  2XRD A;  1OK3 A;  5I0Q B;  2W81 A;  3ZRZ A;  4YNX A;  2XWB F;  3ZD2 A;  1VVD A;  3R62 A;  1G4F A;  1C1Z A;  2V8E A;  1Q3X A;  2EC3 A;  1TPG A;  2KRI A;  2RL0 A;  2IZ3 A;  4MUC A;  1U5M A;  2RLQ A;  4J38 B;  1FBR A;  2RLP A;  4KKD A;  2XRB A;  2O39 C;  4FXG G;  1UOT P;  4AYE A;  1HFI A;  2B5I D;  4IGD A;  2KMS A;  2RKZ A;  3MQL A;  1E8B A;  3ERB A;  1ZJK A;  2JGX A;  5HYP A;  2CG7 A;  3KXV A;  1E88 A;  1H2Q P;  1MD8 A;  3OXU D;  4JHS A;  3KZJ A;  4K12 A;  2WII C;  1TPN A;  2JRA A;  2XQW C;  1QGB A;  2BZM A;  4WJG 2;  5JPM G;  1OK9 A;  1LY2 A;  4AYI A;  4DJZ A;  2YBY A;  1HCC A;  1TPM A;  1PPQ A;  1H04 P;  5HYT B;  1OK1 A;  2CKU A;  4ONT D;  1H03 P;  2XWJ I;  4B2S A;  2IZ4 A;  1HFH A;  3L89 M;  1QO6 A;  1SRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...