3R62A

Structure of complement regulator factor h mutant, t1184r.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
125
structure length
125
Chain Sequence
GKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWRAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement factor H
publication title Crystallographic determination of the disease-associated T1184R variant of the complement Factor H.
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 24
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3r62A01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3r62A02
1GKGA 1GKNA 2RKYA 2XRDA 4IGDA 1OK3A 3ZD1A 3ERBA 3IX0A 1CKLA 4AYEA 4FXGG 2UWNA 3IU3I 5HZPB 1TPGA 2XRBA 2JGXA 1HFHA 1OJVA 2O39C 3CALA 3TVJA 1Z92B 4CSYA 1OK9A 1QO6A 4LOSA 3T5OA 1OK2A 1H2QP 1E5GA 2QY0A 5JPMG 4WJG2 4LOTA 4KKDA 4B2RA 1H03P 2A55A 5HYUB 4AYIA 1QUBA 2MCZA 3MQLA 3GOVA 2V8EA 2IZ3A 3OXUD 5FO8C 4DJZA 5HYTB 1VVDA 3KXVA 1ZJKA 4B2SA 1E88A 1FBRA 1VVCA 3RJ3D 2LOJA 5I0QB 4A5WB 3ZRZA 4ONTD 2XWJI 3M7PA 1SS2A 1TPMA 1OJYA 2EHFA 2WIIC 3O8EB 2KRIA 1H04P 1OJWA 2ERJA 1PPQA 2W80A 4AYMA 1OK1A 2CG7A 1O9AA 2JGWA 4JHSA 2CKUA 1TPNA 4ZH1D 2YRAA 4MUCA 4YNXA 4F4OC 2IZ4A 1GPZA 2JRAA 1UOTP 1GHQB 3L89M 3KZJA 4AYDA 3OEDC 2EC3A 2BZMA 2RLQA 1U5MA 2W81A 2RL0A 3INBC 1E8BA 1C1ZA 1LY2A 4J38B 1H2PP 1ELVA 2RKZA 2CG6A 2XWBF 1QGBA 1NWVA 1G4GA 1SRZA 3NFPI 3ZD2A 1HFIA 1HCCA 1G4FA 1Q3XA 3EJHA 4PZ5A 3R62A 4K12A 3SW0X 2KMSA 2YBYA 5HYPA 3OP8A 1MD8A 3GXEA 2RLPA 2XQWC 1MD7A 4C16A 2MCYA 2G7IA 2B5ID
chains in the Genus database with same CATH superfamily
1GKGA 1GKNA 5DN5A 2RKYA 2XRDA 4IGDA 1OK3A 3ZD1A 3ERBA 3IX0A 1CKLA 4AYEA 4FXGG 2UWNA 3IU3I 5HZPB 1TPGA 2XRBA 2JGXA 1HFHA 1OJVA 2O39C 3CALA 3NJAA 3TVJA 1RLHA 1Z92B 4CSYA 1OK9A 1QO6A 4LOSA 3T5OA 1OK2A 3ZLDA 1H2QP 1E5GA 2QY0A 5JPMG 4WJG2 4LOTA 4KKDA 4B2RA 1H03P 2A55A 5HYUB 4AYIA 1QUBA 2MCZA 3MQLA 3FGTA 2X2ZA 3GOVA 2V8EA 2IZ3A 3OXUD 5FO8C 4DJZA 2Y8TA 5HYTB 1VVDA 3KXVA 1ZJKA 4B2SA 1E88A 1FBRA 1VVCA 3RJ3D 2LOJA 5I0QB 4APLA 4YIZA 4A5WB 3K3TA 3ZLEA 3FGRA 3ZRZA 4ONTD 2XWJI 3M7PA 3CI0J 1SS2A 1TPMA 1OJYA 2EHFA 2WIIC 3O8EB 3VWOA 2KRIA 1H04P 1OJWA 2ERJA 1PPQA 2W80A 4AYMA 2I2LA 1OK1A 2CG7A 1O9AA 2JGWA 4JHSA 2CKUA 1TPNA 4ZH1D 2YRAA 4MUCA 4YNXA 4F4OC 2IZ4A 1GPZA 2JRAA 1UOTP 4PO7A 4N7EA 1GHQB 3L89M 3KZJA 4AYDA 3OEDC 2EC3A 3WSXA 4MSLA 2BZMA 2RLQA 1U5MA 2W81A 2RL0A 3INBC 1E8BA 2Y8RA 1C1ZA 1LY2A 4J38B 1H2PP 1ELVA 2Y8SA 2RKZA 2CG6A 2XWBF 1QGBA 1NWVA 1G4GA 1SRZA 3NFPI 3ZD2A 1HFIA 2ZYCA 1HCCA 1G4FA 1Q3XA 3EJHA 4PZ5A 3WSYA 3R62A 4K12A 3SW0X 2KMSA 2YBYA 5HYPA 3OP8A 1MD8A 3GXEA 5DN4A 2RLPA 2XQWC 1MD7A 4C16A 3F6KA 4BWCA 2MCYA 2G7IA 2B5ID
chains in the Genus database with same CATH topology
1GKGA 1GKNA 2RKYA 2XRDA 4IGDA 1OK3A 3ZD1A 3ERBA 3IX0A 1CKLA 4AYEA 4FXGG 2UWNA 3IU3I 5HZPB 1TPGA 2XRBA 2JGXA 1HFHA 1OJVA 2O39C 3CALA 3TVJA 1Z92B 4CSYA 1OK9A 1QO6A 4LOSA 3T5OA 1OK2A 1H2QP 1E5GA 2QY0A 5JPMG 4WJG2 4LOTA 4KKDA 4B2RA 1H03P 2A55A 5HYUB 4AYIA 1QUBA 2MCZA 3MQLA 3GOVA 2V8EA 2IZ3A 3OXUD 5FO8C 4DJZA 5HYTB 1VVDA 3KXVA 1ZJKA 4B2SA 1E88A 1FBRA 1VVCA 3RJ3D 2LOJA 5I0QB 4A5WB 3ZRZA 4ONTD 2XWJI 3M7PA 1SS2A 1TPMA 1OJYA 2EHFA 2WIIC 3O8EB 2KRIA 1H04P 1OJWA 2ERJA 1PPQA 2W80A 4AYMA 1OK1A 2CG7A 1O9AA 2JGWA 4JHSA 2CKUA 1TPNA 4ZH1D 2YRAA 4MUCA 4YNXA 4F4OC 2IZ4A 1GPZA 2JRAA 1UOTP 1GHQB 3L89M 3KZJA 4AYDA 3OEDC 2EC3A 2BZMA 2RLQA 1U5MA 2W81A 2RL0A 3INBC 1E8BA 1C1ZA 1LY2A 4J38B 1H2PP 1ELVA 2RKZA 2CG6A 2XWBF 1QGBA 1NWVA 1G4GA 1SRZA 3NFPI 3ZD2A 1HFIA 1HCCA 1G4FA 1Q3XA 3EJHA 4PZ5A 3R62A 4K12A 3SW0X 2KMSA 2YBYA 5HYPA 3OP8A 1MD8A 3GXEA 2RLPA 2XQWC 1MD7A 4C16A 2MCYA 2G7IA 2B5ID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GKG A;  1GKN A;  2RKY A;  2XRD A;  4IGD A;  1OK3 A;  3ZD1 A;  3ERB A;  3IX0 A;  1CKL A;  4AYE A;  4FXG G;  2UWN A;  3IU3 I;  5HZP B;  1TPG A;  2XRB A;  2JGX A;  1HFH A;  1OJV A;  2O39 C;  3CAL A;  3TVJ A;  1Z92 B;  4CSY A;  1OK9 A;  1QO6 A;  4LOS A;  3T5O A;  1OK2 A;  1H2Q P;  1E5G A;  2QY0 A;  5JPM G;  4WJG 2;  4LOT A;  4KKD A;  4B2R A;  1H03 P;  2A55 A;  5HYU B;  4AYI A;  1QUB A;  2MCZ A;  3MQL A;  3GOV A;  2V8E A;  2IZ3 A;  3OXU D;  5FO8 C;  4DJZ A;  5HYT B;  1VVD A;  3KXV A;  1ZJK A;  4B2S A;  1E88 A;  1FBR A;  1VVC A;  3RJ3 D;  2LOJ A;  5I0Q B;  4A5W B;  3ZRZ A;  4ONT D;  2XWJ I;  3M7P A;  1SS2 A;  1TPM A;  1OJY A;  2EHF A;  2WII C;  3O8E B;  2KRI A;  1H04 P;  1OJW A;  2ERJ A;  1PPQ A;  2W80 A;  4AYM A;  1OK1 A;  2CG7 A;  1O9A A;  2JGW A;  4JHS A;  2CKU A;  1TPN A;  4ZH1 D;  2YRA A;  4MUC A;  4YNX A;  4F4O C;  2IZ4 A;  1GPZ A;  2JRA A;  1UOT P;  1GHQ B;  3L89 M;  3KZJ A;  4AYD A;  3OED C;  2EC3 A;  2BZM A;  2RLQ A;  1U5M A;  2W81 A;  2RL0 A;  3INB C;  1E8B A;  1C1Z A;  1LY2 A;  4J38 B;  1H2P P;  1ELV A;  2RKZ A;  2CG6 A;  2XWB F;  1QGB A;  1NWV A;  1G4G A;  1SRZ A;  3NFP I;  3ZD2 A;  1HFI A;  1HCC A;  1G4F A;  1Q3X A;  3EJH A;  4PZ5 A;  3R62 A;  4K12 A;  3SW0 X;  2KMS A;  2YBY A;  5HYP A;  3OP8 A;  1MD8 A;  3GXE A;  2RLP A;  2XQW C;  1MD7 A;  4C16 A;  2MCY A;  2G7I A;  2B5I D; 
#chains in the Genus database with same CATH topology
 1GKG A;  1GKN A;  5DN5 A;  2RKY A;  2XRD A;  4IGD A;  1OK3 A;  3ZD1 A;  3ERB A;  3IX0 A;  1CKL A;  4AYE A;  4FXG G;  2UWN A;  3IU3 I;  5HZP B;  1TPG A;  2XRB A;  2JGX A;  1HFH A;  1OJV A;  2O39 C;  3CAL A;  3NJA A;  3TVJ A;  1RLH A;  1Z92 B;  4CSY A;  1OK9 A;  1QO6 A;  4LOS A;  3T5O A;  1OK2 A;  3ZLD A;  1H2Q P;  1E5G A;  2QY0 A;  5JPM G;  4WJG 2;  4LOT A;  4KKD A;  4B2R A;  1H03 P;  2A55 A;  5HYU B;  4AYI A;  1QUB A;  2MCZ A;  3MQL A;  3FGT A;  2X2Z A;  3GOV A;  2V8E A;  2IZ3 A;  3OXU D;  5FO8 C;  4DJZ A;  2Y8T A;  5HYT B;  1VVD A;  3KXV A;  1ZJK A;  4B2S A;  1E88 A;  1FBR A;  1VVC A;  3RJ3 D;  2LOJ A;  5I0Q B;  4APL A;  4YIZ A;  4A5W B;  3K3T A;  3ZLE A;  3FGR A;  3ZRZ A;  4ONT D;  2XWJ I;  3M7P A;  3CI0 J;  1SS2 A;  1TPM A;  1OJY A;  2EHF A;  2WII C;  3O8E B;  3VWO A;  2KRI A;  1H04 P;  1OJW A;  2ERJ A;  1PPQ A;  2W80 A;  4AYM A;  2I2L A;  1OK1 A;  2CG7 A;  1O9A A;  2JGW A;  4JHS A;  2CKU A;  1TPN A;  4ZH1 D;  2YRA A;  4MUC A;  4YNX A;  4F4O C;  2IZ4 A;  1GPZ A;  2JRA A;  1UOT P;  4PO7 A;  4N7E A;  1GHQ B;  3L89 M;  3KZJ A;  4AYD A;  3OED C;  2EC3 A;  3WSX A;  4MSL A;  2BZM A;  2RLQ A;  1U5M A;  2W81 A;  2RL0 A;  3INB C;  1E8B A;  2Y8R A;  1C1Z A;  1LY2 A;  4J38 B;  1H2P P;  1ELV A;  2Y8S A;  2RKZ A;  2CG6 A;  2XWB F;  1QGB A;  1NWV A;  1G4G A;  1SRZ A;  3NFP I;  3ZD2 A;  1HFI A;  2ZYC A;  1HCC A;  1G4F A;  1Q3X A;  3EJH A;  4PZ5 A;  3WSY A;  3R62 A;  4K12 A;  3SW0 X;  2KMS A;  2YBY A;  5HYP A;  3OP8 A;  1MD8 A;  3GXE A;  5DN4 A;  2RLP A;  2XQW C;  1MD7 A;  4C16 A;  3F6K A;  4BWC A;  2MCY A;  2G7I A;  2B5I D; 
#chains in the Genus database with same CATH homology
 1GKG A;  1GKN A;  2RKY A;  2XRD A;  4IGD A;  1OK3 A;  3ZD1 A;  3ERB A;  3IX0 A;  1CKL A;  4AYE A;  4FXG G;  2UWN A;  3IU3 I;  5HZP B;  1TPG A;  2XRB A;  2JGX A;  1HFH A;  1OJV A;  2O39 C;  3CAL A;  3TVJ A;  1Z92 B;  4CSY A;  1OK9 A;  1QO6 A;  4LOS A;  3T5O A;  1OK2 A;  1H2Q P;  1E5G A;  2QY0 A;  5JPM G;  4WJG 2;  4LOT A;  4KKD A;  4B2R A;  1H03 P;  2A55 A;  5HYU B;  4AYI A;  1QUB A;  2MCZ A;  3MQL A;  3GOV A;  2V8E A;  2IZ3 A;  3OXU D;  5FO8 C;  4DJZ A;  5HYT B;  1VVD A;  3KXV A;  1ZJK A;  4B2S A;  1E88 A;  1FBR A;  1VVC A;  3RJ3 D;  2LOJ A;  5I0Q B;  4A5W B;  3ZRZ A;  4ONT D;  2XWJ I;  3M7P A;  1SS2 A;  1TPM A;  1OJY A;  2EHF A;  2WII C;  3O8E B;  2KRI A;  1H04 P;  1OJW A;  2ERJ A;  1PPQ A;  2W80 A;  4AYM A;  1OK1 A;  2CG7 A;  1O9A A;  2JGW A;  4JHS A;  2CKU A;  1TPN A;  4ZH1 D;  2YRA A;  4MUC A;  4YNX A;  4F4O C;  2IZ4 A;  1GPZ A;  2JRA A;  1UOT P;  1GHQ B;  3L89 M;  3KZJ A;  4AYD A;  3OED C;  2EC3 A;  2BZM A;  2RLQ A;  1U5M A;  2W81 A;  2RL0 A;  3INB C;  1E8B A;  1C1Z A;  1LY2 A;  4J38 B;  1H2P P;  1ELV A;  2RKZ A;  2CG6 A;  2XWB F;  1QGB A;  1NWV A;  1G4G A;  1SRZ A;  3NFP I;  3ZD2 A;  1HFI A;  1HCC A;  1G4F A;  1Q3X A;  3EJH A;  4PZ5 A;  3R62 A;  4K12 A;  3SW0 X;  2KMS A;  2YBY A;  5HYP A;  3OP8 A;  1MD8 A;  3GXE A;  2RLP A;  2XQW C;  1MD7 A;  4C16 A;  2MCY A;  2G7I A;  2B5I D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...