3R66A

Crystal structure of human isg15 in complex with ns1 n-terminal region from influenza virus b, northeast structural genomics consortium target ids hx6481, hr2873, and or2
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
96
structure length
96
Chain Sequence
TTQIEVGPGATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRMSLEERKAIGVKMMKVLLFMDPSAGIEGFEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the complex of ISG15 and Influenza B virus NS1 Protein: implications for the mechanism of SN1-mediated inhibition of ISG15 conjugation
rcsb
source organism Influenza b virus
molecule tags Viral protein/antiviral protein
molecule keywords Non-structural protein 1
total genus 36
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3r66A00
5A2QN 1XEQA 1AILA 4JI6O 4JI4O 1IBMO 4B3SO 3SDLA 3R66A 4YY3O 2VQFO 4DR5O 1J5EO 3O65A 4K0KO 2DOSA 2ZKOA 4NXNO 4LF5O 1DK1A 4DR4O 4JV5O 4DV4O 4OPHA 4LF4O 4KHPO 2UXCO 4JI1O 2UU9O 4B3TO 1XNQO 4LF7O 5IWAO 1N33O 4DV6O 2ZM6O 4DV3O 4LFCO 4DUYO 3OTOO 2UXBO 1R6TA 1AB3A 5FLXN 5BXZA 1XMQO 4DR1O 4LFBO 4JI3O 1FJGO 3RT3C 4LFAO 2E5LO 2UUBO 2N74A 3JAMN 5BR8O 1N36O 3T1YO 4LF8O 1FYJA 4AQYO 1N34O 4JI2O 2FKXA 1HNWO 4X64O 1FKAO 1NS1A 2UUCO 2VQEO 4JI7O 2JRIA 4DR7O 3F5TA 2DJVA 3J81N 1XMOO 2Z0AA 4LF9O 4OPAA 4GKJO 5H5NA 5LMUO 3J7AU 1A32A 1D2DA 5LMNO 2UUAO 2HHHO 1X59A 4JI5O 1G1XB 4DR3O 4X62O 4YHHO 4DV5O 4JYAO 3J80N 1F7YA 5LL6Y 1IBLO 4DR2O 4A5UB 5BY1A 1I94O 4OX9O 1XNRO 3M8AA 2F4VO 4B3RO 1N32O 4NXMO 2UXDO 1IBKO 1HR0O 4DV7O 4X65O 4GKKO 4DV2O 4DUZO 1HNXO 3T1HO 4DV1O 4B3MO 2AGAA 4LF6O 1R1BA 4DV0O 1KUQA 1YZBA 4JI0O 4X66O 1HNZO 5IT9N 2LW7A 4DR6O 4JI8O
chains in the Genus database with same CATH superfamily
3ZCCA 2CE4A 3L9DA 1V54C 1JX9A 4AQYB 3JCZA 1GM9A 4TUYA 4IHJA 3CS5A 4U7OA 4RUFA 2ZKOA 1XUQA 2OIGA 1BZKA 4UCRA 3KKYA 4JAVA 2G38A 5IYZB 2YS8A 1L1FA 1AI6A 3E83A 2QWPB 1YEWA 2ZR2A 5ITZA 2EIKC 1COWG 2Q8VA 5KA5A 4LFCB 1WA8B 2ZM6O 1UFIA 1NH2D 2V4DA 4WFEA 1NVPD 1OCOC 5L3BA 1R6TA 3OUSA 3JATB 1Q6IA 1XMQO 5KMGA 4JV5B 1FJGO 3CHXA 1HNZB 3MAQA 3SJBC 3CWBH 3UQ8A 5EIBC 4N21A 3L75H 4ZHQA 3FYIB 4OXSA 1YITV 2UUCO 1Q3EA 4MTGA 2JRIA 3CCLV 5K1PA 3CSXA 3CCJV 5EK0A 4NKGB 4DR6B 1M57C 4EFEA 3ICXA 3X2QB 3K58A 4PA9A 1KP3A 1M57B 4JI5O 5GTIZ 4JTDB 1HR0B 5H2FZ 4O4JA 4X8AA 5LHHA 1I0HA 5JH7A 3SJAC 4WBNB 2EBOA 2ZR3A 1I94O 4LWSA 1CPYA 2WLLB 3WB0A 4X65O 5H6RA 2ZE8A 3AG4B 3HKEB 1GAXA 4DR1B 1AJPA 4LP8A 4MVSA 4O2AA 4X66O 1SQFA 2A0LA 3E35A 1QR9A 4QIWF 1XHZA 3ZHSA 1O9GA 2XT9A 3UT5A 2FB5A 4XBFA 3FAVA 1KC8W 4BIUA 3B8MA 3A2FA 3RYIA 1RP3B 5LP6A 2ZCEA 2VQFO 4I9WA 1XREA 3ZRWB 3JSLA 5HFLA 1S77D 1PP9H 3ZJZA 5CBFA 3K04A 1K73W 4NXNO 5JCOA 4CZZA 4DK0A 3AG1B 2HEPA 3FYEB 2QKAA 4N23A 1BT8A 4UCOA 1H8HG 3LDDA 1YJ9V 5BR8B 4B3TO 3QO7A 3OTFA 2B9ZA 3E89A 4HNAA 2Q67A 4X20B 1RPOA 1QR8A 1AI7A 1M90W 4PDVA 4WFBV 1RM1C 3ZMTA 2HHHB 4LFAO 3A8TA 1K4DC 3OW2U 4NXNB 3BRCA 4QGPA 2Q69A 2XAFA 4BW9A 3ML0A 2FKXA 3RN4A 4X64O 4QE9A 4NTYA 4Z2WA 4H37A 1YIJV 4LF9O 1PNMA 3TK1A 3K59A 3B77A 1T5EA 1BHBA 2YICA 1GRJA 4BW5A 1RSOA 4DR3O 4DV4B 1SQBH 1N36B 4O2AB 3J80N 4FVMA 4QNHB 4DR2O 4JI6B 2DWDC 1AP6A 5JCOC 1K5SA 4CBCA 1Q6HA 2GBOA 1AR1B 4HZ3A 4DV1O 1EZVH 3B8NA 1VARA 4I9QA 1FXKA 4J41A 4DV0O 1N8RW 4JI5B 1NJIW 3ETQA 3RW0A 5DN6G 1TVKB 2HJDA 4PELA 5KLVH 1XEQA 1VQKV 1VQPV 3SDLA 1R3IC 2GUZB 3ZMZA 3AG1C 3BPZA 1JVMA 3EXAA 4F6RB 4JZ2A 4KHPB 4NTXA 2L6LA 3CEIA 3HKCA 3PN1A 4MW3A 5B3SB 2C2AA 1K4CC 1GK9A 4FLXA 1XNQB 4NXMB 4TSFG 3JALB 1IX9A 1YDXA 1YXBA 4BR6A 3JATA 1XMQB 5IWAO 5H6QA 3RBZA 4I5SA 4LFCO 2Y0IA 2RJZA 4HNAB 4O4IA 3RFRA 4YY3B 4E4EA 3OD4A 1P7GA 4CS2A 1N0JA 4K8ZA 3CJHA 2KB1A 2BTQB 2NNUA 3DSQA 1NT2B 2F93B 1N36O 1HDJA 4LH7A 3B2EE 1N34O 1FXVA 1S3JA 2YI9A 1PM9A 1OCRC 1S5HC 4UV9A 4R7CA 2ADPA 3J81N 4WF9V 4FLUA 4JI8B 4O2BB 4XDKA 2JJ1G 4GKJB 2HHHO 4FLZA 2EJ7A 4X62O 2JGUA 4DV5O 1VIBA 2QKCA 2ZIMA 4ZOLB 3ZN0A 4A5UB 1AR5A 1F51A 2MK3A 1FFXB 2JEXA 2JS3A 3LDEA 1OCOB 1VQ7V 3K5OA 2Q5ZA 1VF7A 1MOFA 4JGSA 4O4HB 4X1IB 1K7DA 2ZNJA 4B3TB 2RMKB 5IJ0B 3E22A 3ABKC 4UCUA 4IYIA 1JJ2U 3ASNB 1QVFU 2ZINA 4JI4O 4KL1A 3DC5A 3W7UA 5KA6A 2X7RB 2R9RB 3OGIB 1ROPA 5IJ0A 4JF3A 1XILA 5LYJA 1BE3H 4MT8A 5EYPB 2XASA 5EZYA 2KSDA 3CJHB 5JVDB 1PV0A 2AXTZ 2P7TC 3OE7G 3B4SA 3E8GA 4PV1B 4YXWG 1IVSA 2P90A 1URFA 3HKBA 4J11A 4JPRA 2VQEB 2UXBO 3E8HA 3QG5A 5J2UB 5BXZA 1GKFA 1W59A 2QM7A 3CMEV 2W0XA 2LQTA 4FK5C 5C8YB 2WLIB 2WLKA 1KKCA 3ABMC 3SYQA 4JI2O 3FB5C 2RNBA 4P9PA 2Z3YA 3HKCB 2WAMA 2FMLA 2JVDA 5CBGA 2BSKA 4WFHA 5FPOA 1NQTA 3G6BA 3SPJA 3ZHTA 2IW5A 3FB6C 2WWWA 2QWOB 1J95A 4DO2A 4I50A 1JJOA 1H2NA 1OCCB 3WFVA 5LMNO 2BTOA 2CDYA 3JSNA 4UFZA 1ZX3A 2PI4A 5B1NA 2Q6AA 2EIMB 5BZBA 1YTFB 1H2SB 5KHKA 2BTQA 3N2KA 2M7WA 3W7SA 3OEHG 3ZEDA 2ILMA 1PD3A 4C7UA 1SQQH 2ITCC 2P06A 1SA0B 2UXXA 2ZD9A 4DV1B 4TV9B 4J9ZB 1L0LH 1ORQC 4EB6B 2L35A 1EN6A 1VQLV 3R66A 1VF6A 1US6A 1IBKB 1W0JG 3O65A 4LC1A 1K8AW 3A0RA 1YJNV 3C3TA 3K5NA 3K57A 3HKDA 3LDCA 1PL4A 4KXRA 2DYSC 4OPHA 4LF4O 1JQ0A 3I55V 1KBHA 4NTWA 3ETDA 4YJ3B 3T4ZA 3C90A 2F4VB 2JK5C 3VQVA 3K5MA 4CH3A 3OTOO 1QLEB 3STLC 1K34A 1Y6XA 3I5DA 4B7KA 2P22C 2IH3C 3R65A 4UVCA 3K06A 3SPGA 5BR8O 3G71V 4YHHB 3T1YO 1L0NH 2DQ3A 1Q86W 1IXMA 3K08A 5IJ9A 5GW7A 1AJQA 4MVRA 2F1MA 2EIMC 5LP6B 4X62B 1N4CA 3DXRA 2YIBD 3OUFA 2FTKA 4GKJO 5IY5B 1OCCC 1BQ0A 4O4IB 1QVGU 2UUAO 3OAAG 1IURA 1Y74A 1EN4A 3OMNB 2UUAB 4X20A 4F6EA 5CB4A 3GWKC 3ZHVA 3ZRSA 5EBWC 3M8AA 1AP5A 2UXDO 1TGOA 4X1KB 1DGSA 2Q0OC 4DV7O 1VQNV 5JH7B 1HNXO 1NR1A 1FPOA 2P6JA 3WU2Z 2AHYA 2PGGA 1YF2A 4DRXA 3L71H 5K1XA 4F6RA 4BWAA 1N0NA 4I4TB 1XOUA 1FAFA 3OM3B 1NH2B 3ZRVA 4Q6GA 5JJEB 2QJ1A 2RN9A 2YUAA 2ZNIA 5EBLC 4P30A 4DV5B 4H0LB 1K33A 1BS3A 2EJRA 2EX3A 2WLNA 1AJNA 1W0KG 4MSWC 4XDLA 2P4KA 4FFBB 4JAAA 5L3EA 1LNQA 2DQ0A 1QU7A 2YEVA 5F2VO 4PI2A 3RT3C 5JWPA 1V55B 1XL6A 4R8CA 2DMXA 5LA6A 2W0FC 5LGTA 1FYJA 2Q73A 1AR4A 3F7YC 4LNUA 1DF5A 2X6AA 3X2QC 2GHYA 2QEXV 4JZGA 5B1OA 2R70A 1LUVA 4UVAA 1I94B 1NTMH 4UVBA 1RFYA 1NVPB 2ETNA 1S5LZ 4FFBA 4JTCB 2BOCC 5LMNB 5LL6Y 5CN0A 5IYBO 1GN2A 5BY1A 3WG7C 3H1JH 4GKKO 3JAKA 3S3XA 1XQ8A 3N2GA 2Y0PA 1RPRA 1I7FA 5B3SC 4RUEA 5IT9N 2PYLA 3P32A 3D36A 1Q8IA 1HNXB 1AILA 4K8XA 4B3SO 3DXRB 5IYZA 1X4TA 2Z5UA 4IT5A 5GONA 3IFXA 1H2LA 3CP1A 1FD9A 2XHBA 4PI0A 4L87A 2ATKC 1WPBA 3S3WA 3JD3A 1DLBA 4MTXA 5DEDA 3BA9A 3SR2C 4LR3A 4O4LA 1TUEB 4FM0A 1H2MA 4ABMA 5J2UA 1S72V 1PKXA 2IJJA 2D2CB 4DR1O 4I55B 4JYYA 3SJCC 1IBLB 4X65B 1SRYA 2PTMA 1VF5B 3BHPA 4DUYB 1K3EA 2MW2B 4MTOA 1TA8A 1N33B 1QCEA 4CC6A 5GTHZ 2HR3A 1M1KW 4JI7O 1Y76B 1CXZB 2A06H 2E74B 1R3JC 1Q5OA 3D36C 2JS5A 1GN6A 2HKOA 3CCEV 5LMUO 5B1AC 4PDMA 3QO8A 4YJ2B 3BA8A 4F4LA 4ZKIA 3I56V 1WB8A 3CRMA 3UO3A 4I0XA 2WPDG 4TV9A 4GKKB 4IIJB 4JYAO 5CA1B 1VQ6V 3L70H 1R73A 3CCQV 1KECA 4OX9O 2Q7GA 1BQZA 4ZI7B 1E79G 3SPHA 4FLWA 4WCEV 4DV2O 2UXCB 1Y66A 4DV6B 4B3MO 4PD4F 5CA1A 4LF6O 2E75B 2M6YA 4JI0O 4G2KA 2EULA 2WSSG 1U96A 3G80A 2LW7A 4PA3A 3MDSA 4BIZA 3RYCB 5LGNA 1SETA 2IJIA 4JI6O 3KZIZ 4GLXA 3LNNA 1GH6A 2GSMB 4LCUC 4PDRA 2W6JG 2EILC 3ZMUA 4K0KO 5L3GA 4CH5A 1ZL8B 5IDJA 2CTWA 3ZHQA 1IBMB 1V54B 3K0DA 2JIZG 1YVWA 5HFMA 1XI1A 2UXCO 4UCVA 3ASNC 2N05A 1UJWB 4OGQB 3JASB 2QWNB 2UU9O 1FFTB 3OT7A 3JAWA 2KQXA 3CCUV 5D5QA 4B3RB 3EFFK 1BCCH 4JYBA 4LF7B 4G28B 4JYCA 2R9AA 1NU1H 2QTSA 4O4HA 4X1IA 1QLNA 4LF5B 5JVDA 2YXLA 1HP8A 1I5YA 1NR7A 3ZBHA 2ZDIA 2N74A 5EYPA 4AI8A 3JAMN 2H94A 5LGUA 3CCSV 1JPXA 3E8BA 3STZC 1HNWO 1OCZB 2JGDB 1YJWV 4J7JA 4YIPA 5KX5A 1VP7A 2DJVA 1J5EB 2QGNA 4PA4A 4IGGA 3KCYA 5LP6C 3W7XA 4DV7B 2XAHA 2LFRA 2QTOA 4AHCA 3ZMSA 5IYDO 3IGAC 3AK1A 2Y4TA 5KX5B 3GB7C 3K9AA 1K9MW 1I5XA 1R6NA 1EN5A 2ZQMA 2XAGA 4FZ1A 4X66B 4J9YB 3VOUA 1N32O 1KQSU 2XAJA 3PJSK 4RQEA 2F43G 1IDSA 5KHHA 1BGYH 3T4DA 2AGAA 3L73H 2ADQB 3HKBB 1VQ9V 3CC4V 2NR5A 4O2BA 4Q20A 3SYCA 4FIPC 2ZXWC 1H2KA 4B3MB 1MSDA 3JASA 4YY3O 1H2GA 1WPXA 2K9PA 3JYCA 1VF6C 3RYHB 1WJZA 1H8EG 2DOSA 3ABKB 1JR9A 2LGWA 4LF5O 3JAKB 2O57A 1F4NA 3FFQA 4KHPO 3VQXA 3TXQA 4I7ZB 1D5AA 5KHGA 3ASOB 2CGOA 1SQPH 3E22B 1RSOB 4NB5A 5FNVB 5JJNB 5CA0A 1TUBB 1GMGA 2QWQB 1N34B 4LFBO 3JALA 3H1KH 4DK1A 5DM6V 2UUBO 3CD6V 3LSQA 3M99B 2OCCB 4TQDA 2XTAA 2LO1A 2Y69C 2YIBA 1Q81W 4I0XB 2CTPA 4RWUA 2B1GA 2VQEO 3ABLB 3W7WA 2GTAA 2HG5C 2YIDA 5KHJA 1R3KC 3ZMVA 2F66C 4LBEC 1EZJA 3RWRD 1MSWD 4MVOA 3ZIAG 2Y48A 4HYOA 1E1RG 4D7TA 4FM2A 4LF8B 2AZ0A 4NVPA 2EIJC 2DE0X 2X6BA 3JARA 2JJ2G 2BCCH 5B5EZ 3H1LH 4K3AA 5CB4B 2AW9A 3ZRWA 1HNZO 2KG7B 2DWEC 2EIKB 3CC7V 3SPIA 1SS3A 2XUMA 5TISZ 5JJJB 2P67A 5E1AC 4JI7B 2IBZH 2KG7A 1AI4A 1OZ0A 2OYQA 1FXKB 3WB1A 4ZHQB 4WFGA 3UO2A 2D3OW 3LSSA 5A9GA 1FXKC 2UXNA 2VRZA 3QVNA 4B7EA 1KYOF 2UXDB 3K5LA 2YEVB 4LF9B 4PHZA 3UT5B 2ODMA 5J2TB 3UM7A 1FXHA 3ZN1A 1NTKH 3RVZA 2VWJA 3SPCA 4ZBMA 4ASUG 4WFFA 4LH6A 1NKDA 1WP8A 2YI8A 3U0ZA 1YSCA 2VS0A 2ZIOA 4LNUB 1GM8A 5KUKA 1NS1A 1ZSPA 3JD2A 4LFAB 1K92A 3Q4HA 3P3NA 1ZWIC 3E2EA 1YI2V 1QLEC 2OIEA 4UV8A 1WLEA 1S5JA 1X59A 3QTCA 1Q6UA 3MHHC 4FZ0A 5JQGA 4U3JA 5LOVB 3ABMB 3A0BZ 5IJ9B 3KCXA 3N2GB 1VQMV 3JARB 4LF4B 2AZ2A 1YHQV 4UUJC 1R6KA 2RCVA 2OCCC 3F5WC 3OR6C 2GV9A 2IH1C 4MW8A 4U7NA 1CEZA 1VQ4V 3K0GA 2EZOA 2ZT9B 4NR1A 2DN9A 4RO2A 4K0KB 3JD0A 1AVMA 5A2QN 3VQWA 3ZS8C 1V9PA 3B09A 1IBMO 1PNKA 3OMAB 2HVKC 5E79Z 1O9HA 2ZXWB 4FPPA 3L72H 2JGDA 1KB9F 4JI0B 2AHZA 4IHJB 2HFEC 2XNDG 5B66Z 2PY5A 3N2KB 5C8YA 3SYOA 4DV4O 4CH6A 3BCCH 3MD0A 2QWRB 4GYCB 2NN4A 1UPGA 1IZ3A 1XNQO 4LFBB 4O4JB 4EB6A 4H44B 4DRXB 4RAIA 1S0VA 4TV8A 3QO5A 4I50B 4OX9B 2GDSA 4K35A 5D5PA 4PDLA 1GM7A 1THZA 2CTQA 3AG3C 1AI5A 1ZTEA 3T1YB 1DF4A 2ZE6A 2E5LO 2P5OA 4P2ZA 2OT5A 4EKWA 4LWSB 1HW7A 1NTZH 3T1CA 4FLYA 1Y74B 2WLIA 4DR7O 4QJFB 3NR7A 1XNRB 3ZX6A 2QSAA 3CB2A 4P9OA 4OPAA 5H5NA 3AEIA 3ASOC 1BMFG 4X1YB 1SA0A 3GWOA 1F7YA 1IBLO 3BEHA 2IJHA 4KUMA 3AG7A 1XBLA 1IBKO 4BIOA 5BMVB 4TT3G 3D3QA 1WN7A 4QPJA 3UKMA 4BAYA 1B06A 1GN4A 1WB7A 4L8JA 3RYFA 2WA4A 2PF4E 3H9VA 3FD9A 4X64B 2A7WA 3IC7A 4GX5A 4DR5O 3HKDB 3OGCC 4CH4A 3LUTB 1ZL8A 2CH7A 3K79A 3OTOB 4B3SB 2HJFC 1JFFA 4WFAV 4H13B 5BMVA 1NBMG 2Q9LA 3D3IA 1M4UA 4JI1O 1G8MA 1G4YB 3JCUZ 5LXTA 2DW4A 3JD4A 4GZRB 4J10A 4LF7O 1Y4MA 4IIJA 4FFKA 4DV3O 3CMAV 2RDCA 4YJ3A 5ITZB 5LXTB 3ABTA 1NZ6A 1H38A 2H8PC 1BSMA 5L3FA 3ETEA 4TOIA 3H1HH 4MS2A 3FKSG 3BAAA 5KAIZ 2GUZA 3BFRA 1FS0G 2B1IA 4J80A 1YCIA 2OTJV 1M5IA 3OFNG 4FLVA 3WB2A 1G1XB 4MTFA 1Y76A 4DYLA 2HP8A 2KKWA 3ABLC 4W4KA 4YIOA 1SC5B 1QQCA 1Q7YW 1WAZA 3VBBA 5EC2C 4EEQA 2RQ6A 3D8CA 4MVZA 1XNRO 1RM1B 5EZYB 4NXMO 1MNGA 1ZUQA 1XDCA 4X88A 1HR0O 4ZOLA 3SYAA 4JYAB 1P84F 1M9NA 4JI4B 1G6UA 3M7MX 3P30A 2E3CA 1KUQA 1YZBA 2W6IG 2PYJA 3G6EV 3C3SA 3MHSC 4JI2B 1NI8A 4JI1B 2QM8A 5IE9A 3NXSA 3CRCA 1FJGB 1OJHA 1JFFB 5C93A 1P7BA 4GCZA 3SGIA 2R72A 2N04A 2UXBB 2ITDC 1MZFA 3DGEA 1GTOA 5LA6B 2IU3A 4R50A 2WLHA 4I55A 2DYRB 1SKVA 2ZM6B 3VQYA 2Q68A 1M56C 3B40A 4HAMA 1N32B 1ENVA 5LOVA 3L74H 4UCSA 4KFMA 2VQFB 3AG4C 1WNSA 2IU0A 4Z1VA 3N27A 2Q7EA 5J2TA 2QDOA 4FJCC 3CCRV 1PPJH 2BE3A 3CCVV 4UCTA 1PNLA 4AQYO 2JEUA 2ZDIC 2YXHA 5B1BC 3ETGA 1LR1A 1KU9A 3AG2B 2LFSA 4DV3B 2WLJA 3F5TA 3LNMB 3K3WA 3HB3B 4CS3A 2Z0AA 5IWAB 1V55C 4GUNA 2QA4V 2VWKA 3FAVB 4EFBA 4TV8B 1P49A 5CA3A 3CPWU 4GX0A 5CBHA 4ZIBA 2Q0AA 1HNWB 2R9IA 2YIAA 4H33A 2BOBC 4GX1A 1D5NA 4XDJA 1AROP 2DYSB 3BY6A 3G67A 1Q90D 2H3OA 4B3RO 2K1EA 1MABG 1FFXA 1F4MA 3OEEG 2E5LB 1JA8A 3T1HO 4CS4A 3P3PA 4QPKA 1R1BA 2ZE5A 5L3DA 5JQGB 3GVMA 4JI8O 4HBNA 2XAQA 5AG2A 1Z5VA 3IJ4A 5LHGA 2EINC 2NLJC 1VQOV 3DC6A 1VEWA 2A9HA 3CC2V 2HVJC 5EIBD 3ZHRA 1KP2A 5DECA 4Z1MG 1LUWA 1OV9A 1DK1A 3ZRXA 2OWOA 4UXNA 1B3QA 2CGNA 2UUBB 1GN3A 1SQVH 2YDEA 3CE2A 5L3CA 1M93A 5EBMC 4KP4A 2GTSA 5CA0B 4DV6O 4R6ZA 4DR4B 4LF6B 5J9PC 1SZXA 2YC0A 1SESA 4QE7A 1AB3A 1S76D 3AK3A 1Z5WA 2QE7G 4IL6Z 4X1KA 3AG2C 3Q4HB 5IY5C 3JD1A 2CTRA 4J7KA 1SF9A 4PJ0Z 3CRQA 5LHIA 2F95B 3E8FA 4IYHA 4U3JB 3G4SV 5IYCO 4DV0B 1CP9A 1K5QA 4X89A 3QNEA 5KMGB 1QHTA 4I4TA 3U11A 2XOKG 2A79B 2B5UA 2Y69B 3IAYA 4DR2B 5KAFZ 1MG1A 3RVYA 1Q43A 5KUMA 2P4VA 4WBNA 4X9QA 1JCHA 3AG3B 5KHIA 1TAEA 2ARHA 4NYKA 1M56B 3CXHF 1KD1W 1R3LC 3FB8C 1JMKC 1WA8A 4J7ZA 4TQFA 4FM1A 1GO3F 1I08A 3APOA 1Q82W 2PUSA 3AK2A 3DTUB 4GT1A 4AILC 3TJTA 4JAUA 4JI3B 1J5EO 4PA6A 3FX7A 4PA7A 1OHHG 2HLDG 3QF7A 3T1HB 2OCHA 1EFRG 3K03A 2ZE7A 3CX5F 4DR7B 1BHAA 4TWKA 3FB7C 3TCUA 3KG2A 2WLLA 1KKDA 3CXCU 4UB8Z 1Y67A 2EINB 1KMIZ 4DR5B 5FNVA 3T2MA 1VQ5V 1E1QG 1SQXH 2EIJB 5FLXN 2LGQA 4J42A 3TXSA 4RQFA 2V7QG 3E86A 1W2BU 4JI3O 2F23A 1EM1A 4ICGA 2UU9B 1XMOB 5H9CA 4UB6Z 1BL8A 4LF8O 3WG7B 3CCMV 2CH7B 1FKAO 2IJKA 2E76B 2IM9A 4U3FH 5B1BB 3RYIB 2CK3G 4MVUA 1U97A 1P4RA 2Q4PA 4B08A 3J7AU 1A32A 1Z2GA 2PZSA 1D2DA 3RYCA 2LW1A 1OCZC 3SYPA 3LSUA 4DXWA 2JDIG 3HKEA 4FMTA 4DV2B 1MZEA 2CUGA 2V1DA 4DUZO 3UCSC 4CC5A 2YSUB 3RYHA 1EBOA 1B6QA 3OR7C 2A3QA 4DR6O 1VMGA 3JAWB 4YJ2A 2WLMA 2PI5A 3TETA 3TGUH 4E2LA 2UUCB 2DYRC 1YTFD 5LMUB 3EHBB 4MVQA 3APQA 3ABUA 2WA3A 1DTOA 1XL4A 2EILB 2QKSA 4D6TH 3K9SA 3A0HZ 2EZPA 4TUYB 4DR4O 4JV5O 4DUZB 1SQGA 4ZI7A 2Q7HA 4JASA 1SERA 4D7SA 4GX2A 1TUBA 3CRAA 3ZHUA 1N33O 2YXYA 1VQ8V 3W7TA 2QR4A 4DUYO 3H1IH 1HWYA 4DR3B 1MMMA 1ZAUA 3H01A 1MA1A 1PL0A 3O9OA 2CAZC 3SJQC 5FPRA 4JTAB 1QNMA 3CRRA 3HR0A 1K97A 2LJ2A 1IXBA 1L8DA 5CMUA 2X0LA 5B1AB 3OMIB 4X1YA 1F23A 4G27B 2Y4UA 4DW1A 5FL7G 1XMOO 3IC9A 1QBZA 3RYFB 3BVOA 1TVKA 3EVKA 2BSKB 1SZTA 3RGBA 4YHHO 2QM4A 1XHXA 1OCRB 4W4LA 4FLTA 3U10A 4O4LB 1WP7A 2F4VO 3HPLC 1B04A 4DW0A 5LYJB 4MVMA 1ZLZA 2FL4A 5EC1C 3THOA 2OTLV 2FYUH 3F7VC 5GONB 2LP7A 2X6CA 5LBQA 1JOYA 3BABA 3CYOA
chains in the Genus database with same CATH topology
5A2QN 1XEQA 1AILA 4JI6O 4JI4O 1IBMO 4B3SO 3SDLA 3R66A 4YY3O 2VQFO 4DR5O 1J5EO 3O65A 4K0KO 2DOSA 2ZKOA 4NXNO 4LF5O 1DK1A 4DR4O 4JV5O 4DV4O 4OPHA 4LF4O 4KHPO 2UXCO 4JI1O 2UU9O 4B3TO 1XNQO 4LF7O 5IWAO 1N33O 4DV6O 2ZM6O 4DV3O 4LFCO 4DUYO 3OTOO 2UXBO 1R6TA 1AB3A 5FLXN 5BXZA 1XMQO 4DR1O 4LFBO 4JI3O 1FJGO 3RT3C 4LFAO 2E5LO 2UUBO 2N74A 3JAMN 5BR8O 1N36O 3T1YO 4LF8O 1FYJA 4AQYO 1N34O 4JI2O 2FKXA 1HNWO 4X64O 1FKAO 1NS1A 2UUCO 2VQEO 4JI7O 2JRIA 4DR7O 3F5TA 2DJVA 3J81N 1XMOO 2Z0AA 4LF9O 4OPAA 4GKJO 5H5NA 5LMUO 3J7AU 1A32A 1D2DA 5LMNO 2UUAO 2HHHO 1X59A 4JI5O 1G1XB 4DR3O 4X62O 4YHHO 4DV5O 4JYAO 3J80N 1F7YA 5LL6Y 1IBLO 4DR2O 4A5UB 5BY1A 1I94O 4OX9O 1XNRO 3M8AA 2F4VO 4B3RO 1N32O 4NXMO 2UXDO 1IBKO 1HR0O 4DV7O 4X65O 4GKKO 4DV2O 4DUZO 1HNXO 3T1HO 4DV1O 4B3MO 2AGAA 4LF6O 1R1BA 4DV0O 1KUQA 1YZBA 4JI0O 4X66O 1HNZO 5IT9N 2LW7A 4DR6O 4JI8O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q N;  1XEQ A;  1AIL A;  4JI6 O;  4JI4 O;  1IBM O;  4B3S O;  3SDL A;  3R66 A;  4YY3 O;  2VQF O;  4DR5 O;  1J5E O;  3O65 A;  4K0K O;  2DOS A;  2ZKO A;  4NXN O;  4LF5 O;  1DK1 A;  4DR4 O;  4JV5 O;  4DV4 O;  4OPH A;  4LF4 O;  4KHP O;  2UXC O;  4JI1 O;  2UU9 O;  4B3T O;  1XNQ O;  4LF7 O;  5IWA O;  1N33 O;  4DV6 O;  2ZM6 O;  4DV3 O;  4LFC O;  4DUY O;  3OTO O;  2UXB O;  1R6T A;  1AB3 A;  5FLX N;  5BXZ A;  1XMQ O;  4DR1 O;  4LFB O;  4JI3 O;  1FJG O;  3RT3 C;  4LFA O;  2E5L O;  2UUB O;  2N74 A;  3JAM N;  5BR8 O;  1N36 O;  3T1Y O;  4LF8 O;  1FYJ A;  4AQY O;  1N34 O;  4JI2 O;  2FKX A;  1HNW O;  4X64 O;  1FKA O;  1NS1 A;  2UUC O;  2VQE O;  4JI7 O;  2JRI A;  4DR7 O;  3F5T A;  2DJV A;  3J81 N;  1XMO O;  2Z0A A;  4LF9 O;  4OPA A;  4GKJ O;  5H5N A;  5LMU O;  3J7A U;  1A32 A;  1D2D A;  5LMN O;  2UUA O;  2HHH O;  1X59 A;  4JI5 O;  1G1X B;  4DR3 O;  4X62 O;  4YHH O;  4DV5 O;  4JYA O;  3J80 N;  1F7Y A;  5LL6 Y;  1IBL O;  4DR2 O;  4A5U B;  5BY1 A;  1I94 O;  4OX9 O;  1XNR O;  3M8A A;  2F4V O;  4B3R O;  1N32 O;  4NXM O;  2UXD O;  1IBK O;  1HR0 O;  4DV7 O;  4X65 O;  4GKK O;  4DV2 O;  4DUZ O;  1HNX O;  3T1H O;  4DV1 O;  4B3M O;  2AGA A;  4LF6 O;  1R1B A;  4DV0 O;  1KUQ A;  1YZB A;  4JI0 O;  4X66 O;  1HNZ O;  5IT9 N;  2LW7 A;  4DR6 O;  4JI8 O; 
#chains in the Genus database with same CATH topology
 3ZCC A;  2CE4 A;  3L9D A;  1V54 C;  1JX9 A;  4AQY B;  3JCZ A;  1GM9 A;  4TUY A;  4IHJ A;  3CS5 A;  4U7O A;  4RUF A;  2ZKO A;  1XUQ A;  2OIG A;  1BZK A;  4UCR A;  3KKY A;  4JAV A;  2G38 A;  5IYZ B;  2YS8 A;  1L1F A;  1AI6 A;  3E83 A;  2QWP B;  1YEW A;  2ZR2 A;  5ITZ A;  2EIK C;  1COW G;  2Q8V A;  5KA5 A;  4LFC B;  1WA8 B;  2ZM6 O;  1UFI A;  1NH2 D;  2V4D A;  4WFE A;  1NVP D;  1OCO C;  5L3B A;  1R6T A;  3OUS A;  3JAT B;  1Q6I A;  1XMQ O;  5KMG A;  4JV5 B;  1FJG O;  3CHX A;  1HNZ B;  3MAQ A;  3SJB C;  3CWB H;  3UQ8 A;  5EIB C;  4N21 A;  3L75 H;  4ZHQ A;  3FYI B;  4OXS A;  1YIT V;  2UUC O;  1Q3E A;  4MTG A;  2JRI A;  3CCL V;  5K1P A;  3CSX A;  3CCJ V;  5EK0 A;  4NKG B;  4DR6 B;  1M57 C;  4EFE A;  3ICX A;  3X2Q B;  3K58 A;  4PA9 A;  1KP3 A;  1M57 B;  4JI5 O;  5GTI Z;  4JTD B;  1HR0 B;  5H2F Z;  4O4J A;  4X8A A;  5LHH A;  1I0H A;  5JH7 A;  3SJA C;  4WBN B;  2EBO A;  2ZR3 A;  1I94 O;  4LWS A;  1CPY A;  2WLL B;  3WB0 A;  4X65 O;  5H6R A;  2ZE8 A;  3AG4 B;  3HKE B;  1GAX A;  4DR1 B;  1AJP A;  4LP8 A;  4MVS A;  4O2A A;  4X66 O;  1SQF A;  2A0L A;  3E35 A;  1QR9 A;  4QIW F;  1XHZ A;  3ZHS A;  1O9G A;  2XT9 A;  3UT5 A;  2FB5 A;  4XBF A;  3FAV A;  1KC8 W;  4BIU A;  3B8M A;  3A2F A;  3RYI A;  1RP3 B;  5LP6 A;  2ZCE A;  2VQF O;  4I9W A;  1XRE A;  3ZRW B;  3JSL A;  5HFL A;  1S77 D;  1PP9 H;  3ZJZ A;  5CBF A;  3K04 A;  1K73 W;  4NXN O;  5JCO A;  4CZZ A;  4DK0 A;  3AG1 B;  2HEP A;  3FYE B;  2QKA A;  4N23 A;  1BT8 A;  4UCO A;  1H8H G;  3LDD A;  1YJ9 V;  5BR8 B;  4B3T O;  3QO7 A;  3OTF A;  2B9Z A;  3E89 A;  4HNA A;  2Q67 A;  4X20 B;  1RPO A;  1QR8 A;  1AI7 A;  1M90 W;  4PDV A;  4WFB V;  1RM1 C;  3ZMT A;  2HHH B;  4LFA O;  3A8T A;  1K4D C;  3OW2 U;  4NXN B;  3BRC A;  4QGP A;  2Q69 A;  2XAF A;  4BW9 A;  3ML0 A;  2FKX A;  3RN4 A;  4X64 O;  4QE9 A;  4NTY A;  4Z2W A;  4H37 A;  1YIJ V;  4LF9 O;  1PNM A;  3TK1 A;  3K59 A;  3B77 A;  1T5E A;  1BHB A;  2YIC A;  1GRJ A;  4BW5 A;  1RSO A;  4DR3 O;  4DV4 B;  1SQB H;  1N36 B;  4O2A B;  3J80 N;  4FVM A;  4QNH B;  4DR2 O;  4JI6 B;  2DWD C;  1AP6 A;  5JCO C;  1K5S A;  4CBC A;  1Q6H A;  2GBO A;  1AR1 B;  4HZ3 A;  4DV1 O;  1EZV H;  3B8N A;  1VAR A;  4I9Q A;  1FXK A;  4J41 A;  4DV0 O;  1N8R W;  4JI5 B;  1NJI W;  3ETQ A;  3RW0 A;  5DN6 G;  1TVK B;  2HJD A;  4PEL A;  5KLV H;  1XEQ A;  1VQK V;  1VQP V;  3SDL A;  1R3I C;  2GUZ B;  3ZMZ A;  3AG1 C;  3BPZ A;  1JVM A;  3EXA A;  4F6R B;  4JZ2 A;  4KHP B;  4NTX A;  2L6L A;  3CEI A;  3HKC A;  3PN1 A;  4MW3 A;  5B3S B;  2C2A A;  1K4C C;  1GK9 A;  4FLX A;  1XNQ B;  4NXM B;  4TSF G;  3JAL B;  1IX9 A;  1YDX A;  1YXB A;  4BR6 A;  3JAT A;  1XMQ B;  5IWA O;  5H6Q A;  3RBZ A;  4I5S A;  4LFC O;  2Y0I A;  2RJZ A;  4HNA B;  4O4I A;  3RFR A;  4YY3 B;  4E4E A;  3OD4 A;  1P7G A;  4CS2 A;  1N0J A;  4K8Z A;  3CJH A;  2KB1 A;  2BTQ B;  2NNU A;  3DSQ A;  1NT2 B;  2F93 B;  1N36 O;  1HDJ A;  4LH7 A;  3B2E E;  1N34 O;  1FXV A;  1S3J A;  2YI9 A;  1PM9 A;  1OCR C;  1S5H C;  4UV9 A;  4R7C A;  2ADP A;  3J81 N;  4WF9 V;  4FLU A;  4JI8 B;  4O2B B;  4XDK A;  2JJ1 G;  4GKJ B;  2HHH O;  4FLZ A;  2EJ7 A;  4X62 O;  2JGU A;  4DV5 O;  1VIB A;  2QKC A;  2ZIM A;  4ZOL B;  3ZN0 A;  4A5U B;  1AR5 A;  1F51 A;  2MK3 A;  1FFX B;  2JEX A;  2JS3 A;  3LDE A;  1OCO B;  1VQ7 V;  3K5O A;  2Q5Z A;  1VF7 A;  1MOF A;  4JGS A;  4O4H B;  4X1I B;  1K7D A;  2ZNJ A;  4B3T B;  2RMK B;  5IJ0 B;  3E22 A;  3ABK C;  4UCU A;  4IYI A;  1JJ2 U;  3ASN B;  1QVF U;  2ZIN A;  4JI4 O;  4KL1 A;  3DC5 A;  3W7U A;  5KA6 A;  2X7R B;  2R9R B;  3OGI B;  1ROP A;  5IJ0 A;  4JF3 A;  1XIL A;  5LYJ A;  1BE3 H;  4MT8 A;  5EYP B;  2XAS A;  5EZY A;  2KSD A;  3CJH B;  5JVD B;  1PV0 A;  2AXT Z;  2P7T C;  3OE7 G;  3B4S A;  3E8G A;  4PV1 B;  4YXW G;  1IVS A;  2P90 A;  1URF A;  3HKB A;  4J11 A;  4JPR A;  2VQE B;  2UXB O;  3E8H A;  3QG5 A;  5J2U B;  5BXZ A;  1GKF A;  1W59 A;  2QM7 A;  3CME V;  2W0X A;  2LQT A;  4FK5 C;  5C8Y B;  2WLI B;  2WLK A;  1KKC A;  3ABM C;  3SYQ A;  4JI2 O;  3FB5 C;  2RNB A;  4P9P A;  2Z3Y A;  3HKC B;  2WAM A;  2FML A;  2JVD A;  5CBG A;  2BSK A;  4WFH A;  5FPO A;  1NQT A;  3G6B A;  3SPJ A;  3ZHT A;  2IW5 A;  3FB6 C;  2WWW A;  2QWO B;  1J95 A;  4DO2 A;  4I50 A;  1JJO A;  1H2N A;  1OCC B;  3WFV A;  5LMN O;  2BTO A;  2CDY A;  3JSN A;  4UFZ A;  1ZX3 A;  2PI4 A;  5B1N A;  2Q6A A;  2EIM B;  5BZB A;  1YTF B;  1H2S B;  5KHK A;  2BTQ A;  3N2K A;  2M7W A;  3W7S A;  3OEH G;  3ZED A;  2ILM A;  1PD3 A;  4C7U A;  1SQQ H;  2ITC C;  2P06 A;  1SA0 B;  2UXX A;  2ZD9 A;  4DV1 B;  4TV9 B;  4J9Z B;  1L0L H;  1ORQ C;  4EB6 B;  2L35 A;  1EN6 A;  1VQL V;  3R66 A;  1VF6 A;  1US6 A;  1IBK B;  1W0J G;  3O65 A;  4LC1 A;  1K8A W;  3A0R A;  1YJN V;  3C3T A;  3K5N A;  3K57 A;  3HKD A;  3LDC A;  1PL4 A;  4KXR A;  2DYS C;  4OPH A;  4LF4 O;  1JQ0 A;  3I55 V;  1KBH A;  4NTW A;  3ETD A;  4YJ3 B;  3T4Z A;  3C90 A;  2F4V B;  2JK5 C;  3VQV A;  3K5M A;  4CH3 A;  3OTO O;  1QLE B;  3STL C;  1K34 A;  1Y6X A;  3I5D A;  4B7K A;  2P22 C;  2IH3 C;  3R65 A;  4UVC A;  3K06 A;  3SPG A;  5BR8 O;  3G71 V;  4YHH B;  3T1Y O;  1L0N H;  2DQ3 A;  1Q86 W;  1IXM A;  3K08 A;  5IJ9 A;  5GW7 A;  1AJQ A;  4MVR A;  2F1M A;  2EIM C;  5LP6 B;  4X62 B;  1N4C A;  3DXR A;  2YIB D;  3OUF A;  2FTK A;  4GKJ O;  5IY5 B;  1OCC C;  1BQ0 A;  4O4I B;  1QVG U;  2UUA O;  3OAA G;  1IUR A;  1Y74 A;  1EN4 A;  3OMN B;  2UUA B;  4X20 A;  4F6E A;  5CB4 A;  3GWK C;  3ZHV A;  3ZRS A;  5EBW C;  3M8A A;  1AP5 A;  2UXD O;  1TGO A;  4X1K B;  1DGS A;  2Q0O C;  4DV7 O;  1VQN V;  5JH7 B;  1HNX O;  1NR1 A;  1FPO A;  2P6J A;  3WU2 Z;  2AHY A;  2PGG A;  1YF2 A;  4DRX A;  3L71 H;  5K1X A;  4F6R A;  4BWA A;  1N0N A;  4I4T B;  1XOU A;  1FAF A;  3OM3 B;  1NH2 B;  3ZRV A;  4Q6G A;  5JJE B;  2QJ1 A;  2RN9 A;  2YUA A;  2ZNI A;  5EBL C;  4P30 A;  4DV5 B;  4H0L B;  1K33 A;  1BS3 A;  2EJR A;  2EX3 A;  2WLN A;  1AJN A;  1W0K G;  4MSW C;  4XDL A;  2P4K A;  4FFB B;  4JAA A;  5L3E A;  1LNQ A;  2DQ0 A;  1QU7 A;  2YEV A;  5F2V O;  4PI2 A;  3RT3 C;  5JWP A;  1V55 B;  1XL6 A;  4R8C A;  2DMX A;  5LA6 A;  2W0F C;  5LGT A;  1FYJ A;  2Q73 A;  1AR4 A;  3F7Y C;  4LNU A;  1DF5 A;  2X6A A;  3X2Q C;  2GHY A;  2QEX V;  4JZG A;  5B1O A;  2R70 A;  1LUV A;  4UVA A;  1I94 B;  1NTM H;  4UVB A;  1RFY A;  1NVP B;  2ETN A;  1S5L Z;  4FFB A;  4JTC B;  2BOC C;  5LMN B;  5LL6 Y;  5CN0 A;  5IYB O;  1GN2 A;  5BY1 A;  3WG7 C;  3H1J H;  4GKK O;  3JAK A;  3S3X A;  1XQ8 A;  3N2G A;  2Y0P A;  1RPR A;  1I7F A;  5B3S C;  4RUE A;  5IT9 N;  2PYL A;  3P32 A;  3D36 A;  1Q8I A;  1HNX B;  1AIL A;  4K8X A;  4B3S O;  3DXR B;  5IYZ A;  1X4T A;  2Z5U A;  4IT5 A;  5GON A;  3IFX A;  1H2L A;  3CP1 A;  1FD9 A;  2XHB A;  4PI0 A;  4L87 A;  2ATK C;  1WPB A;  3S3W A;  3JD3 A;  1DLB A;  4MTX A;  5DED A;  3BA9 A;  3SR2 C;  4LR3 A;  4O4L A;  1TUE B;  4FM0 A;  1H2M A;  4ABM A;  5J2U A;  1S72 V;  1PKX A;  2IJJ A;  2D2C B;  4DR1 O;  4I55 B;  4JYY A;  3SJC C;  1IBL B;  4X65 B;  1SRY A;  2PTM A;  1VF5 B;  3BHP A;  4DUY B;  1K3E A;  2MW2 B;  4MTO A;  1TA8 A;  1N33 B;  1QCE A;  4CC6 A;  5GTH Z;  2HR3 A;  1M1K W;  4JI7 O;  1Y76 B;  1CXZ B;  2A06 H;  2E74 B;  1R3J C;  1Q5O A;  3D36 C;  2JS5 A;  1GN6 A;  2HKO A;  3CCE V;  5LMU O;  5B1A C;  4PDM A;  3QO8 A;  4YJ2 B;  3BA8 A;  4F4L A;  4ZKI A;  3I56 V;  1WB8 A;  3CRM A;  3UO3 A;  4I0X A;  2WPD G;  4TV9 A;  4GKK B;  4IIJ B;  4JYA O;  5CA1 B;  1VQ6 V;  3L70 H;  1R73 A;  3CCQ V;  1KEC A;  4OX9 O;  2Q7G A;  1BQZ A;  4ZI7 B;  1E79 G;  3SPH A;  4FLW A;  4WCE V;  4DV2 O;  2UXC B;  1Y66 A;  4DV6 B;  4B3M O;  4PD4 F;  5CA1 A;  4LF6 O;  2E75 B;  2M6Y A;  4JI0 O;  4G2K A;  2EUL A;  2WSS G;  1U96 A;  3G80 A;  2LW7 A;  4PA3 A;  3MDS A;  4BIZ A;  3RYC B;  5LGN A;  1SET A;  2IJI A;  4JI6 O;  3KZI Z;  4GLX A;  3LNN A;  1GH6 A;  2GSM B;  4LCU C;  4PDR A;  2W6J G;  2EIL C;  3ZMU A;  4K0K O;  5L3G A;  4CH5 A;  1ZL8 B;  5IDJ A;  2CTW A;  3ZHQ A;  1IBM B;  1V54 B;  3K0D A;  2JIZ G;  1YVW A;  5HFM A;  1XI1 A;  2UXC O;  4UCV A;  3ASN C;  2N05 A;  1UJW B;  4OGQ B;  3JAS B;  2QWN B;  2UU9 O;  1FFT B;  3OT7 A;  3JAW A;  2KQX A;  3CCU V;  5D5Q A;  4B3R B;  3EFF K;  1BCC H;  4JYB A;  4LF7 B;  4G28 B;  4JYC A;  2R9A A;  1NU1 H;  2QTS A;  4O4H A;  4X1I A;  1QLN A;  4LF5 B;  5JVD A;  2YXL A;  1HP8 A;  1I5Y A;  1NR7 A;  3ZBH A;  2ZDI A;  2N74 A;  5EYP A;  4AI8 A;  3JAM N;  2H94 A;  5LGU A;  3CCS V;  1JPX A;  3E8B A;  3STZ C;  1HNW O;  1OCZ B;  2JGD B;  1YJW V;  4J7J A;  4YIP A;  5KX5 A;  1VP7 A;  2DJV A;  1J5E B;  2QGN A;  4PA4 A;  4IGG A;  3KCY A;  5LP6 C;  3W7X A;  4DV7 B;  2XAH A;  2LFR A;  2QTO A;  4AHC A;  3ZMS A;  5IYD O;  3IGA C;  3AK1 A;  2Y4T A;  5KX5 B;  3GB7 C;  3K9A A;  1K9M W;  1I5X A;  1R6N A;  1EN5 A;  2ZQM A;  2XAG A;  4FZ1 A;  4X66 B;  4J9Y B;  3VOU A;  1N32 O;  1KQS U;  2XAJ A;  3PJS K;  4RQE A;  2F43 G;  1IDS A;  5KHH A;  1BGY H;  3T4D A;  2AGA A;  3L73 H;  2ADQ B;  3HKB B;  1VQ9 V;  3CC4 V;  2NR5 A;  4O2B A;  4Q20 A;  3SYC A;  4FIP C;  2ZXW C;  1H2K A;  4B3M B;  1MSD A;  3JAS A;  4YY3 O;  1H2G A;  1WPX A;  2K9P A;  3JYC A;  1VF6 C;  3RYH B;  1WJZ A;  1H8E G;  2DOS A;  3ABK B;  1JR9 A;  2LGW A;  4LF5 O;  3JAK B;  2O57 A;  1F4N A;  3FFQ A;  4KHP O;  3VQX A;  3TXQ A;  4I7Z B;  1D5A A;  5KHG A;  3ASO B;  2CGO A;  1SQP H;  3E22 B;  1RSO B;  4NB5 A;  5FNV B;  5JJN B;  5CA0 A;  1TUB B;  1GMG A;  2QWQ B;  1N34 B;  4LFB O;  3JAL A;  3H1K H;  4DK1 A;  5DM6 V;  2UUB O;  3CD6 V;  3LSQ A;  3M99 B;  2OCC B;  4TQD A;  2XTA A;  2LO1 A;  2Y69 C;  2YIB A;  1Q81 W;  4I0X B;  2CTP A;  4RWU A;  2B1G A;  2VQE O;  3ABL B;  3W7W A;  2GTA A;  2HG5 C;  2YID A;  5KHJ A;  1R3K C;  3ZMV A;  2F66 C;  4LBE C;  1EZJ A;  3RWR D;  1MSW D;  4MVO A;  3ZIA G;  2Y48 A;  4HYO A;  1E1R G;  4D7T A;  4FM2 A;  4LF8 B;  2AZ0 A;  4NVP A;  2EIJ C;  2DE0 X;  2X6B A;  3JAR A;  2JJ2 G;  2BCC H;  5B5E Z;  3H1L H;  4K3A A;  5CB4 B;  2AW9 A;  3ZRW A;  1HNZ O;  2KG7 B;  2DWE C;  2EIK B;  3CC7 V;  3SPI A;  1SS3 A;  2XUM A;  5TIS Z;  5JJJ B;  2P67 A;  5E1A C;  4JI7 B;  2IBZ H;  2KG7 A;  1AI4 A;  1OZ0 A;  2OYQ A;  1FXK B;  3WB1 A;  4ZHQ B;  4WFG A;  3UO2 A;  2D3O W;  3LSS A;  5A9G A;  1FXK C;  2UXN A;  2VRZ A;  3QVN A;  4B7E A;  1KYO F;  2UXD B;  3K5L A;  2YEV B;  4LF9 B;  4PHZ A;  3UT5 B;  2ODM A;  5J2T B;  3UM7 A;  1FXH A;  3ZN1 A;  1NTK H;  3RVZ A;  2VWJ A;  3SPC A;  4ZBM A;  4ASU G;  4WFF A;  4LH6 A;  1NKD A;  1WP8 A;  2YI8 A;  3U0Z A;  1YSC A;  2VS0 A;  2ZIO A;  4LNU B;  1GM8 A;  5KUK A;  1NS1 A;  1ZSP A;  3JD2 A;  4LFA B;  1K92 A;  3Q4H A;  3P3N A;  1ZWI C;  3E2E A;  1YI2 V;  1QLE C;  2OIE A;  4UV8 A;  1WLE A;  1S5J A;  1X59 A;  3QTC A;  1Q6U A;  3MHH C;  4FZ0 A;  5JQG A;  4U3J A;  5LOV B;  3ABM B;  3A0B Z;  5IJ9 B;  3KCX A;  3N2G B;  1VQM V;  3JAR B;  4LF4 B;  2AZ2 A;  1YHQ V;  4UUJ C;  1R6K A;  2RCV A;  2OCC C;  3F5W C;  3OR6 C;  2GV9 A;  2IH1 C;  4MW8 A;  4U7N A;  1CEZ A;  1VQ4 V;  3K0G A;  2EZO A;  2ZT9 B;  4NR1 A;  2DN9 A;  4RO2 A;  4K0K B;  3JD0 A;  1AVM A;  5A2Q N;  3VQW A;  3ZS8 C;  1V9P A;  3B09 A;  1IBM O;  1PNK A;  3OMA B;  2HVK C;  5E79 Z;  1O9H A;  2ZXW B;  4FPP A;  3L72 H;  2JGD A;  1KB9 F;  4JI0 B;  2AHZ A;  4IHJ B;  2HFE C;  2XND G;  5B66 Z;  2PY5 A;  3N2K B;  5C8Y A;  3SYO A;  4DV4 O;  4CH6 A;  3BCC H;  3MD0 A;  2QWR B;  4GYC B;  2NN4 A;  1UPG A;  1IZ3 A;  1XNQ O;  4LFB B;  4O4J B;  4EB6 A;  4H44 B;  4DRX B;  4RAI A;  1S0V A;  4TV8 A;  3QO5 A;  4I50 B;  4OX9 B;  2GDS A;  4K35 A;  5D5P A;  4PDL A;  1GM7 A;  1THZ A;  2CTQ A;  3AG3 C;  1AI5 A;  1ZTE A;  3T1Y B;  1DF4 A;  2ZE6 A;  2E5L O;  2P5O A;  4P2Z A;  2OT5 A;  4EKW A;  4LWS B;  1HW7 A;  1NTZ H;  3T1C A;  4FLY A;  1Y74 B;  2WLI A;  4DR7 O;  4QJF B;  3NR7 A;  1XNR B;  3ZX6 A;  2QSA A;  3CB2 A;  4P9O A;  4OPA A;  5H5N A;  3AEI A;  3ASO C;  1BMF G;  4X1Y B;  1SA0 A;  3GWO A;  1F7Y A;  1IBL O;  3BEH A;  2IJH A;  4KUM A;  3AG7 A;  1XBL A;  1IBK O;  4BIO A;  5BMV B;  4TT3 G;  3D3Q A;  1WN7 A;  4QPJ A;  3UKM A;  4BAY A;  1B06 A;  1GN4 A;  1WB7 A;  4L8J A;  3RYF A;  2WA4 A;  2PF4 E;  3H9V A;  3FD9 A;  4X64 B;  2A7W A;  3IC7 A;  4GX5 A;  4DR5 O;  3HKD B;  3OGC C;  4CH4 A;  3LUT B;  1ZL8 A;  2CH7 A;  3K79 A;  3OTO B;  4B3S B;  2HJF C;  1JFF A;  4WFA V;  4H13 B;  5BMV A;  1NBM G;  2Q9L A;  3D3I A;  1M4U A;  4JI1 O;  1G8M A;  1G4Y B;  3JCU Z;  5LXT A;  2DW4 A;  3JD4 A;  4GZR B;  4J10 A;  4LF7 O;  1Y4M A;  4IIJ A;  4FFK A;  4DV3 O;  3CMA V;  2RDC A;  4YJ3 A;  5ITZ B;  5LXT B;  3ABT A;  1NZ6 A;  1H38 A;  2H8P C;  1BSM A;  5L3F A;  3ETE A;  4TOI A;  3H1H H;  4MS2 A;  3FKS G;  3BAA A;  5KAI Z;  2GUZ A;  3BFR A;  1FS0 G;  2B1I A;  4J80 A;  1YCI A;  2OTJ V;  1M5I A;  3OFN G;  4FLV A;  3WB2 A;  1G1X B;  4MTF A;  1Y76 A;  4DYL A;  2HP8 A;  2KKW A;  3ABL C;  4W4K A;  4YIO A;  1SC5 B;  1QQC A;  1Q7Y W;  1WAZ A;  3VBB A;  5EC2 C;  4EEQ A;  2RQ6 A;  3D8C A;  4MVZ A;  1XNR O;  1RM1 B;  5EZY B;  4NXM O;  1MNG A;  1ZUQ A;  1XDC A;  4X88 A;  1HR0 O;  4ZOL A;  3SYA A;  4JYA B;  1P84 F;  1M9N A;  4JI4 B;  1G6U A;  3M7M X;  3P30 A;  2E3C A;  1KUQ A;  1YZB A;  2W6I G;  2PYJ A;  3G6E V;  3C3S A;  3MHS C;  4JI2 B;  1NI8 A;  4JI1 B;  2QM8 A;  5IE9 A;  3NXS A;  3CRC A;  1FJG B;  1OJH A;  1JFF B;  5C93 A;  1P7B A;  4GCZ A;  3SGI A;  2R72 A;  2N04 A;  2UXB B;  2ITD C;  1MZF A;  3DGE A;  1GTO A;  5LA6 B;  2IU3 A;  4R50 A;  2WLH A;  4I55 A;  2DYR B;  1SKV A;  2ZM6 B;  3VQY A;  2Q68 A;  1M56 C;  3B40 A;  4HAM A;  1N32 B;  1ENV A;  5LOV A;  3L74 H;  4UCS A;  4KFM A;  2VQF B;  3AG4 C;  1WNS A;  2IU0 A;  4Z1V A;  3N27 A;  2Q7E A;  5J2T A;  2QDO A;  4FJC C;  3CCR V;  1PPJ H;  2BE3 A;  3CCV V;  4UCT A;  1PNL A;  4AQY O;  2JEU A;  2ZDI C;  2YXH A;  5B1B C;  3ETG A;  1LR1 A;  1KU9 A;  3AG2 B;  2LFS A;  4DV3 B;  2WLJ A;  3F5T A;  3LNM B;  3K3W A;  3HB3 B;  4CS3 A;  2Z0A A;  5IWA B;  1V55 C;  4GUN A;  2QA4 V;  2VWK A;  3FAV B;  4EFB A;  4TV8 B;  1P49 A;  5CA3 A;  3CPW U;  4GX0 A;  5CBH A;  4ZIB A;  2Q0A A;  1HNW B;  2R9I A;  2YIA A;  4H33 A;  2BOB C;  4GX1 A;  1D5N A;  4XDJ A;  1ARO P;  2DYS B;  3BY6 A;  3G67 A;  1Q90 D;  2H3O A;  4B3R O;  2K1E A;  1MAB G;  1FFX A;  1F4M A;  3OEE G;  2E5L B;  1JA8 A;  3T1H O;  4CS4 A;  3P3P A;  4QPK A;  1R1B A;  2ZE5 A;  5L3D A;  5JQG B;  3GVM A;  4JI8 O;  4HBN A;  2XAQ A;  5AG2 A;  1Z5V A;  3IJ4 A;  5LHG A;  2EIN C;  2NLJ C;  1VQO V;  3DC6 A;  1VEW A;  2A9H A;  3CC2 V;  2HVJ C;  5EIB D;  3ZHR A;  1KP2 A;  5DEC A;  4Z1M G;  1LUW A;  1OV9 A;  1DK1 A;  3ZRX A;  2OWO A;  4UXN A;  1B3Q A;  2CGN A;  2UUB B;  1GN3 A;  1SQV H;  2YDE A;  3CE2 A;  5L3C A;  1M93 A;  5EBM C;  4KP4 A;  2GTS A;  5CA0 B;  4DV6 O;  4R6Z A;  4DR4 B;  4LF6 B;  5J9P C;  1SZX A;  2YC0 A;  1SES A;  4QE7 A;  1AB3 A;  1S76 D;  3AK3 A;  1Z5W A;  2QE7 G;  4IL6 Z;  4X1K A;  3AG2 C;  3Q4H B;  5IY5 C;  3JD1 A;  2CTR A;  4J7K A;  1SF9 A;  4PJ0 Z;  3CRQ A;  5LHI A;  2F95 B;  3E8F A;  4IYH A;  4U3J B;  3G4S V;  5IYC O;  4DV0 B;  1CP9 A;  1K5Q A;  4X89 A;  3QNE A;  5KMG B;  1QHT A;  4I4T A;  3U11 A;  2XOK G;  2A79 B;  2B5U A;  2Y69 B;  3IAY A;  4DR2 B;  5KAF Z;  1MG1 A;  3RVY A;  1Q43 A;  5KUM A;  2P4V A;  4WBN A;  4X9Q A;  1JCH A;  3AG3 B;  5KHI A;  1TAE A;  2ARH A;  4NYK A;  1M56 B;  3CXH F;  1KD1 W;  1R3L C;  3FB8 C;  1JMK C;  1WA8 A;  4J7Z A;  4TQF A;  4FM1 A;  1GO3 F;  1I08 A;  3APO A;  1Q82 W;  2PUS A;  3AK2 A;  3DTU B;  4GT1 A;  4AIL C;  3TJT A;  4JAU A;  4JI3 B;  1J5E O;  4PA6 A;  3FX7 A;  4PA7 A;  1OHH G;  2HLD G;  3QF7 A;  3T1H B;  2OCH A;  1EFR G;  3K03 A;  2ZE7 A;  3CX5 F;  4DR7 B;  1BHA A;  4TWK A;  3FB7 C;  3TCU A;  3KG2 A;  2WLL A;  1KKD A;  3CXC U;  4UB8 Z;  1Y67 A;  2EIN B;  1KMI Z;  4DR5 B;  5FNV A;  3T2M A;  1VQ5 V;  1E1Q G;  1SQX H;  2EIJ B;  5FLX N;  2LGQ A;  4J42 A;  3TXS A;  4RQF A;  2V7Q G;  3E86 A;  1W2B U;  4JI3 O;  2F23 A;  1EM1 A;  4ICG A;  2UU9 B;  1XMO B;  5H9C A;  4UB6 Z;  1BL8 A;  4LF8 O;  3WG7 B;  3CCM V;  2CH7 B;  1FKA O;  2IJK A;  2E76 B;  2IM9 A;  4U3F H;  5B1B B;  3RYI B;  2CK3 G;  4MVU A;  1U97 A;  1P4R A;  2Q4P A;  4B08 A;  3J7A U;  1A32 A;  1Z2G A;  2PZS A;  1D2D A;  3RYC A;  2LW1 A;  1OCZ C;  3SYP A;  3LSU A;  4DXW A;  2JDI G;  3HKE A;  4FMT A;  4DV2 B;  1MZE A;  2CUG A;  2V1D A;  4DUZ O;  3UCS C;  4CC5 A;  2YSU B;  3RYH A;  1EBO A;  1B6Q A;  3OR7 C;  2A3Q A;  4DR6 O;  1VMG A;  3JAW B;  4YJ2 A;  2WLM A;  2PI5 A;  3TET A;  3TGU H;  4E2L A;  2UUC B;  2DYR C;  1YTF D;  5LMU B;  3EHB B;  4MVQ A;  3APQ A;  3ABU A;  2WA3 A;  1DTO A;  1XL4 A;  2EIL B;  2QKS A;  4D6T H;  3K9S A;  3A0H Z;  2EZP A;  4TUY B;  4DR4 O;  4JV5 O;  4DUZ B;  1SQG A;  4ZI7 A;  2Q7H A;  4JAS A;  1SER A;  4D7S A;  4GX2 A;  1TUB A;  3CRA A;  3ZHU A;  1N33 O;  2YXY A;  1VQ8 V;  3W7T A;  2QR4 A;  4DUY O;  3H1I H;  1HWY A;  4DR3 B;  1MMM A;  1ZAU A;  3H01 A;  1MA1 A;  1PL0 A;  3O9O A;  2CAZ C;  3SJQ C;  5FPR A;  4JTA B;  1QNM A;  3CRR A;  3HR0 A;  1K97 A;  2LJ2 A;  1IXB A;  1L8D A;  5CMU A;  2X0L A;  5B1A B;  3OMI B;  4X1Y A;  1F23 A;  4G27 B;  2Y4U A;  4DW1 A;  5FL7 G;  1XMO O;  3IC9 A;  1QBZ A;  3RYF B;  3BVO A;  1TVK A;  3EVK A;  2BSK B;  1SZT A;  3RGB A;  4YHH O;  2QM4 A;  1XHX A;  1OCR B;  4W4L A;  4FLT A;  3U10 A;  4O4L B;  1WP7 A;  2F4V O;  3HPL C;  1B04 A;  4DW0 A;  5LYJ B;  4MVM A;  1ZLZ A;  2FL4 A;  5EC1 C;  3THO A;  2OTL V;  2FYU H;  3F7V C;  5GON B;  2LP7 A;  2X6C A;  5LBQ A;  1JOY A;  3BAB A;  3CYO A; 
#chains in the Genus database with same CATH homology
 5A2Q N;  1XEQ A;  1AIL A;  4JI6 O;  4JI4 O;  1IBM O;  4B3S O;  3SDL A;  3R66 A;  4YY3 O;  2VQF O;  4DR5 O;  1J5E O;  3O65 A;  4K0K O;  2DOS A;  2ZKO A;  4NXN O;  4LF5 O;  1DK1 A;  4DR4 O;  4JV5 O;  4DV4 O;  4OPH A;  4LF4 O;  4KHP O;  2UXC O;  4JI1 O;  2UU9 O;  4B3T O;  1XNQ O;  4LF7 O;  5IWA O;  1N33 O;  4DV6 O;  2ZM6 O;  4DV3 O;  4LFC O;  4DUY O;  3OTO O;  2UXB O;  1R6T A;  1AB3 A;  5FLX N;  5BXZ A;  1XMQ O;  4DR1 O;  4LFB O;  4JI3 O;  1FJG O;  3RT3 C;  4LFA O;  2E5L O;  2UUB O;  2N74 A;  3JAM N;  5BR8 O;  1N36 O;  3T1Y O;  4LF8 O;  1FYJ A;  4AQY O;  1N34 O;  4JI2 O;  2FKX A;  1HNW O;  4X64 O;  1FKA O;  1NS1 A;  2UUC O;  2VQE O;  4JI7 O;  2JRI A;  4DR7 O;  3F5T A;  2DJV A;  3J81 N;  1XMO O;  2Z0A A;  4LF9 O;  4OPA A;  4GKJ O;  5H5N A;  5LMU O;  3J7A U;  1A32 A;  1D2D A;  5LMN O;  2UUA O;  2HHH O;  1X59 A;  4JI5 O;  1G1X B;  4DR3 O;  4X62 O;  4YHH O;  4DV5 O;  4JYA O;  3J80 N;  1F7Y A;  5LL6 Y;  1IBL O;  4DR2 O;  4A5U B;  5BY1 A;  1I94 O;  4OX9 O;  1XNR O;  3M8A A;  2F4V O;  4B3R O;  1N32 O;  4NXM O;  2UXD O;  1IBK O;  1HR0 O;  4DV7 O;  4X65 O;  4GKK O;  4DV2 O;  4DUZ O;  1HNX O;  3T1H O;  4DV1 O;  4B3M O;  2AGA A;  4LF6 O;  1R1B A;  4DV0 O;  1KUQ A;  1YZB A;  4JI0 O;  4X66 O;  1HNZ O;  5IT9 N;  2LW7 A;  4DR6 O;  4JI8 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...