3R6GA

Crystal structure of active caspase-2 bound with ac-vdvad-cho
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
159
structure length
157
Chain Sequence
MQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and enzymatic insights into caspase-2 protein substrate recognition and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-2 subunit p18
total genus 56
structure length 157
sequence length 159
chains with identical sequence C
ec nomenclature ec 3.4.22.55: Caspase-2.
pdb deposition date 2011-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r6gA00
5IAKA 2Y1LA 1M72A 2H54A 5IC6A 2CJYA 4NBKA 1NW9B 1GQFA 3PD0A 4NOMA 4I1PA 2H51A 1SC4A 4PRYA 2QL7A 1RHQA 2XZTA 3E4CA 4JQZA 4QTYA 2H4WA 4EJFA 4JJ7A 2Y0BA 1PYOA 2CNLA 4JR0A 5I9BA 4M9RA 4NOJA 3DEJA 2FQQA 4JQYA 4DCJA 2J31A 5LU9A 3H1PA 5K20A 1RHUA 1KMCA 4D3XA 3GJTA 4HVAA 3NR2A 1BMQA 2H4YA 4NBLA 4PS0A 2QLBA 3V6MA 4AWAA 1CVRA 3KJQA 1ICEA 1RHMA 3KJNA 4EHLA 2QLFA 1RWMA 2C2MA 1PAUA 2C1EA 2J30A 4D3ZA 2HBZA 3R6GA 3R7BA 2XYGA 5I9TA 3H11A 1RWOA 3GJRA 4IYRA 3R7NA 3ITNA 4QTXA 4PS1A 4QUBA 3V3KA 4EHHA 5LU8A 1SC3A 2FP3A 4FXOA 4JR1A 3SIPA 1RHJA 2XYPA 5LUBA 4EHNA 4EHFA 1RWPA 2J33A 1RHRA 5JFTA 4I1RA 4N6GA 4QU5A 3R5KA 4NBNA 4QUEA 1RWXA 3V4LA 3V6LA 3D6HA 3H11B 3UO8B 4FGUA 2H48A 4JJ8A 2H5JA 3DEHA 1RWNA 4PRZA 5H0IA 4DCPA 2XYHA 2DKOA 4FDLA 2CNKA 3DEIA 3KJFA 4FEAA 4HQ0A 4JJEA 1SC1A 2HBQA 4QUIA 1F9EA 4D3YA 5IARA 1NMEA 4QUDA 4ZVPA 4NOLA 2H65A 1SHJA 1RWWA 2CJXA 4NOKA 3SIRA 5IASA 3IBFA 4N5DA 2H5IA 3P4UA 1RHKA 3V4OA 3EDRA 4LSZA 1I4EB 3NS7A 3IBCA 4ZVRA 4N6NA 4AW9A 3GJSA 4EHAA 3V55A 2C2ZA 1K88A 4JR2A 2AR9A 1I3OA 1NMSA 4QU9A 3P45A 5IBPA 1QTNA 5IAGA 2C2OA 2WDPA 4QUJA 4DCOA 1GFWA 2P2CA 2K7ZA 1NMQA 4HQRA 4ZVSA 5IAJA 1QDUA 5IBCA 3R5JA 1RE1A 2FUNB 2HBYA 3S8EA 2QL9A 5IABA 2CDRA 4EHDA 3OD5A 3PD1A 1QX3A 3R7SA 5IANA 2J32A 3NKFA 3D6MA 4QU8A 4N7JA 1F1JA 1SHLA 4ZVOA 1I4OA 2CNNA 4ZVUA 4ZVQA 3H0EA 4QUAA 2QLJA 2QL5A 1I51A 2XZDA 3H13A 2HBRA 3BIJA 4QUGA 3K7EA 1RWVA 2CNOA 3EDQA 3R6LA 4AWBA 4QU0A 4ZVTA 3RJMA 5LUAA 3GJQA 2NN3C 4QUHA 1CP3A 4QULA 4EHKA 3PCXA 3D6FA 5IBRA 4IEFB 3DEKA 1IBCA 2C2KA 3QNWA 5IAEA 3UOAB 5IC4A 1RWKA 1JXQA 1K86A 4N6OA 3S70A 4N7MA 4JB8A
chains in the Genus database with same CATH superfamily
3LF2A 5E1OA 2XAUA 1DEKA 2CFCA 1TKBA 3LKDA 4DCMA 1XTZA 1U1EA 4P83A 2XUAA 4FYKA 2BP7A 1T9CA 2OD2A 4JP8A 4OI2A 1DKMA 4BNDB 4CDNA 4CQJA 3DBLA 4PSUA 1TK3A 1SHTX 4PONA 1H4TA 2AJCA 4M8IA 4C6HA 2Z9BA 3RKRA 2QZJA 1XXLA 1NX6A 3I42A 3BE4A 1YMUA 4RU1A 1BXGB 1W5TA 4DC9A 4LZOA 2QV7A 3HJGA 3OIWA 1XOIA 2OC4A 1GXSA 4KRXA 3INTA 4LOKA 2LCFA 4G4IA 2B5WA 4GGOA 2LDXA 2Q28A 5MF6A 1QG6A 4C6TB 1DFGA 2VO1A 4KFTA 1CJBA 4G9BA 2MSCB 1QZZA 3DE6X 3EZXA 1IWPB 1U0OC 2ZBEA 3LY8A 3QVLA 1TK9A 2J0EA 4FI3C 3LDUA 4GQAA 2H1WA 5AKEA 4WZBE 2G9NA 1JILA 4YAKA 3LQKA 4Z54A 1UCFA 3SOZA 3NC4A 3RYCB 2CEAA 1BYUA 2G71A 1TM7E 3L6EA 1R27A 4JA0A 2Q6OA 1PR9A 1RHRA 1GIAA 2QPAA 2XB8A 5FQOA 5T5QA 3WXMA 1J0DA 4LPSA 3OTGA 1FSPA 4M21A 3X2SA 1X3LA 3OE4A 4QLAA 1PZMA 2DYKA 1VLQA 2ZTVA 2YQ5A 4DIUA 1C0IA 1BIFA 3NVKI 3ZE0B 4BNFA 3EPPA 5D87A 3D6TB 3EIWA 2QJRA 1Q0UA 4JT2A 3S55A 1YAJA 3NHUA 3CBQA 1FQKA 1M5RA 4L5CA 3FUVA 5KDLA 2EF0A 2NAFA 2W2XA 1W87A 3QVOA 3PP8A 1KDRA 1WUIS 4TUYF 4FTWA 1VHDA 2NZ2A 4FYHA 1KVSA 1ZIXA 4Y9SA 5CR9A 2QVZX 2BF7A 2OT3B 2D59A 3G23A 1RADA 3KHTA 5D1HA 4QREA 5HEKA 2VXYA 1YE5A 2MSKA 3OPXA 5ALQA 1NBHA 1I3OA 4O6VA 2QY6A 5K8CA 1RXYA 5E3IA 2D06A 4FHCA 4A8JC 5LYJF 2VYNA 5IW8A 5L3SB 2VKQA 2YX1A 2B6HA 2EKBA 2WJIA 3OM9A 4FNOA 2AJ8A 3G2KA 4MRMB 2O2CA 1FDWA 3P97A 2II6A 3HY3A 3SKYA 2VYVA 3T54A 3GMIA 2NW6A 3AHDA 2VOJA 5E0KB 4BC0A 2HBYA 2QRVB 4BQEA 1HDZA 1U02A 4P6VF 4QFBA 4U7WA 3VR4H 1XNJA 4DJTA 3HBLA 4YRTA 2F90A 3ZKWB 3VR4A 3CLRC 3EZLA 4P98A 2LIVA 3B85A 3RASA 3IT1A 1T5DX 4UPDA 4UFOA 4DR5B 1NI4B 1GPLA 1EVZA 2P6PA 1OYVA 2AA3A 4WLOA 1T29A 1O6GA 5FX2A 3B3QA 4G85A 3UBTA 3W2IA 3PFNA 2IY8A 2PZFA 1P2DA 2DR3A 4C7MA 3TPZA 4MGKR 4CN9A 4EVRA 5EJ6A 2VBIA 3OTIA 4NMMA 1QQAA 1KAEA 5I7SA 1BX0A 1REQA 3GFFA 2X4LA 1ONOA 2G4LA 5A5GA 4C78A 5BNWA 1DVRA 4IR7A 4UASA 4LDJA 3VO1A 4YQEA 5BNFA 1ZNQO 3IKLA 3KOMA 5EZYB 1I7DA 1H3EA 4RZXA 3KTDA 4ZN6A 2FJUA 1LDNA 2CJYA 4GC5A 4WEQA 1KAHA 3NBYC 5LZ7A 3D64A 4QEKA 3VA7A 1K92A 3T95A 1TW2A 2DERA 2GBCA 2VOEA 4JBXA 2IRWA 4U00A 3T1TA 5CX1B 4GI7A 3JRNA 3FOAA 3KUCA 4DY4A 2ABWA 1XQYA 5K6RA 3F71A 3VX4A 4ES6A 2B7LA 3AEKB 2QIOA 4I9GA 4YP6A 4AP6A 5THQA 1PG0A 2QJOA 2GTPA 4H7PA 5I4KA 3R9XB 2XQKA 2DH6A 4MICA 4RD0A 3KOOA 4UVHA 2COKA 5LKRA 3AVYA 2JGKA 5EIHA 5FBQB 2SCUA 1Z4IA 3LO8A 3VV3A 2AFRA 1T2DA 3NEJA 4M8SA 5THKA 1FK8A 1KETA 4CM8A 4B87A 3OLQA 1SFRA 3WSWA 1Z6XA 2XYRA 3GFQA 2WOJA 1PNRA 3CKMA 4PS1A 1U1CA 3EIUA 4OQ4A 2JRLA 1JS1X 1R16A 4UNNA 1BQ4A 1ZD3A 3ESXA 4LXIA 4PO1A 5HFJA 1YGYA 3HRKA 4BJ1A 5FTLA 1CFZA 1F4VA 2A4KA 2R6HA 4IJQA 4R2MA 5ICEA 5ISMA 2VZEA 3AKYA 4LG1A 3GHYA 1TA4A 3ZJ5A 1GQQA 2CXUA 2FW1A 3HU1A 2X41A 3QOYA 1TMYA 4V0ME 1LI4A 1WCYA 1P7CA 4G1FA 4B2LA 1NBEA 2OSBA 2PKXA 3GQBA 5FWYB 1D6MA 1Q3KA 1XTJA 1XZIA 5FO1A 3VGPA 1DRVA 1QPBA 2FG6C 3VPBA 1WHSB 1VL0A 4V3BA 4ALKA 3PQ6A 1GDHA 4QPJC 4X8HA 1PJQA 1XCGB 3S2SA 3ER6A 3OMWA 4A91A 2GD2A 4LYDA 1PEYA 1W581 2QU7A 5H70A 2UYCA 2G0AA 1Z06A 3OKFA 3U9TA 5JXIA 5EUMA 4IIUA 3LUJA 3BS4A 3H6KA 3HA3A 5TQ2B 4JI6B 3T4UA 4BBJA 5C51B 3RAEC 3FFTA 3AF4A 5FO0A 3R6DA 1P1RA 3SWWA 5F1YA 1U99A 3N8DA 3H9GA 3GG2A 5CP8A 5CT8A 1V39A 2AR9A 3BIXA 3JZIA 3NIBA 3PGA1 1B1AA 1DPFA 1MAAA 1VL2A 3GT3A 4IQ8A 4ZAFA 1PFUA 3GEMA 2WE8A 3HGTA 4ZK2A 3LT1A 4EARA 4XVRA 4TYWA 3KD3A 4P2GA 4CDMA 4LMPA 4RM3A 1GUDA 1PJ4A 1DE0A 3AJ9A 4LYHA 3QWBA 1EVEA 2M6RA 3EG9A 3OG9A 4OMCA 1RE0A 1CEEA 3LG2A 4X1IB 4H18A 4PLTA 1VIDA 3DMGA 4KAXA 1Z4KA 3U13A 2I2AA 3NKFA 5BNIA 1PR0A 3AUKA 4Q02A 5EWJB 2JIQA 5IKMA 3QHPA 2HJ9A 3CZ4A 2HXYA 2WHPB 3GGGA 4UARA 4BO7A 5CK4A 4F5ZA 1M83A 1II0A 2CBXA 2I55A 1ISIA 2GNOA 4H3KB 4UULA 2Y6UA 2NU7B 1Q44A 1C4KA 4UMDA 2WYHA 1WPQA 1XBTA 2JLVA 1BGXT 4JOBA 2WT8A 2DJ5A 2XNKA 4IQFA 1OIWA 1DPGA 3UGTA 1N77A 2P4SA 3A4TA 1ESNA 3LVQE 3BK7A 3MHTA 4ND8B 2WJ6A 3U40A 1GARA 2IEAA 2H3EA 3U3ZA 5FTMA 4KL8S 4D81A 5HMMA 1KQFA 4OXRA 2Y1CA 5IC6A 4BNMA 5E6RA 4Q37A 3CLKA 1DEAA 3DZKA 1PWEA 3PRYA 1QG4A 5IZ4A 4Z4IA 3O75A 1YDFA 3LUAA 3PHIA 3GEHA 1GN9A 4HX2A 5G41A 3A28A 4RPHA 4BMSA 1L4LA 2FU5C 3DHYA 3HFSA 4Q1BA 4TV9F 4D0LB 1MCZA 4ZHQA 2GN0A 1ICIA 1TMGE 1VL1A 3DVSX 4TWJA 1M67A 3BGVA 3DAYA 2WB2A 1T0JB 3ELBA 3H2KA 1L8AA 2BONA 1W0JA 2HI0A 2K2WA 4AX4A 4C4AA 1X1DA 2PANA 5CUQA 2DOKA 2EDAA 4DG8A 4PX9A 4F2HA 3K70B 3OPVA 5LSAA 1XRRA 4NSNA 1OHHD 4MDHA 2P67A 4MIOA 4W7SA 2VSXA 2C8JA 3JSAA 1ADGA 5EP4A 4BMYA 3N2YA 1KBZA 4C7BA 1ZMOA 3LBIA 3EQZA 2Z30A 3PFIA 3F4LA 4CV1A 4J0EA 1WUYA 4M0DA 4DWWA 2HIMA 4MWCA 3GZNA 3HU5A 3TW4A 2GVDC 1PSZA 3WKBA 2Q2VA 2BEVA 2ZRKA 3BC1A 2FPIB 4V0LA 4EUEA 3W2HA 3KFVA 5FI5A 4N65A 3U3JA 5KOHA 1A5AB 2HDWA 2FXVA 1R50A 1OXBB 3L6RA 5B3AA 3WB2A 3HKDA 1DKOA 4WXMA 2RHJA 2GO7A 3QWHA 3UMYA 3IQIX 3D5EA 3OFJA 4FGSA 4F3CA 1JDSA 1XE3A 5ILQA 4PN7A 3MUFA 5JH7F 4DREA 4WOCA 5AJHA 3VNVA 4KVAA 3W78A 1Z15A 3ZIAD 5FI0B 3L6OO 4FR5A 2ZJ3A 1E64A 1YCDA 2PQ6A 3B6EA 5MN4A 1A72A 1FW6A 4IVPA 5AYVA 3TTYA 5A5EA 721PA 1FBNA 1H69A 1NMEA 1NVXQ 2H2FA 1FSZA 3EQ9A 2BR4A 1KDZA 1U0EA 1E5QA 5AKKA 5GM1A 3A37A 3I2HA 4Q9NA 3OBBA 3KXIA 4QQFA 3NHFA 1NE2A 4RIIA 4TSRA 4XJVA 1S96A 1OY1A 4HOYA 2BRUA 3R5FA 4J3FA 6PFKA 3RG2A 3V32A 5L8VA 3UK2A 1XD9A 4MKGA 1EK1A 4MP3A 1OI3A 1EK5A 1E1NA 3UOWA 2D1FA 2Q4OA 3FPFA 3OOHA 2A1TS 5LDGA 1TL7C 4JGBA 3A58B 5JOQA 1LBHA 3PQDA 1PJ2A 1RTTA 1DKPA 3EVAA 4ER3A 1V47A 2RDMA 3QV2A 2E2WA 5KYKA 3FNQA 4PQEA 5D7NA 1U7DA 4DV1B 4IO1A 1U7WA 2Q5JA 3Q2IA 4AJOA 5I7WA 1LLUA 3MWGA 5LC1A 2XT9A 2YXNA 2V9PA 3W34A 5CDYA 3I05A 4YJGB 1HG0A 1FMJA 1E20A 2J3JA 1HMPA 4RGVA 4H60A 1WXQA 1DX6A 3L05A 1J8MF 2C4UA 2C5AA 1YR9A 2BSQA 5KAPA 1QR6A 3T7TA 2YJGA 4G0XA 3LQFA 1UMCB 5JPIA 2REXB 3ONEA 1OX5A 1YRWA 2F1JA 3K92A 3GGSA 4H6XA 3NHMA 1B8UA 2QT1A 4PAGA 2QUKA 1JEYA 1DFHA 3I53A 3N8GA 4WACA 1MJGA 2AD1A 2Q07A 5DMHA 1NTRA 1RQLA 4IHJF 3LWDA 4B47A 4D9EA 1OC4A 2P2YA 1LVUA 3WFZA 2A58A 2CXOA 1EDZA 5ALHA 4FOOA 4AUNA 4I3FA 3ZK7A 1RW4A 3V00A 5EEHA 1JIQA 2PZEA 4C88A 1THGA 4QD3A 3DQZA 4MGHA 2EZTA 4OOEA 1R5JA 4B35A 5KJCA 2QD4A 5KYTA 3L5OA 3UAYA 5EWLA 2X13A 1JDVA 2F9LA 2ZQYA 3S6JA 1IN8A 2OXTA 4WJLA 3TZQA 1P0FA 3WL6A 1MJGM 3SJUA 3EFOA 4D46A 4ZAZA 1OV4A 1Q1EA 3NAQA 5B6PA 1E61A 2VJPA 4XIYA 4JODA 3SMQA 1QYDA 2ZIWB 5BRJA 3IPLA 4DCTA 1PJTA 5CFLA 3LS2A 1RYMA 1KI6A 2PMDA 4MQ5A 3HA2A 4URFA 5F33A 1TD9A 3CO0S 3O8OA 5HM8A 3CBGA 2PMFA 2XF2A 5BN3A 4IY1A 1BE8A 1XEXA 4LRWA 1UT6A 2EKDA 2HU2A 2PS3A 1P7WA 1VC2A 4NONA 1F48A 2XKBA 4DM4A 4PF1A 5AHRA 3JVEA 3KQQA 3ZY5A 4TQ9A 3I6BA 4IPTA 3AEXA 1J0AA 4QTXA 4BGUA 1UDXA 1L5LA 4G1VA 1G7SA 2CYAA 2OXRA 2QRKA 4IIDA 2ODAA 4EG3A 3DBOB 3TR0A 1AO3A 3FD8A 4LBWA 2HWUA 1L1RA 4LV6A 1AS0A 3OQHA 5E4FA 2EGUA 3HDTA 4K6HA 2FX2A 5CNJA 4R8KA 4B76A 2XBMA 3FCUB 2J9GA 3B20A 3CRZA 4RVGA 1E69A 3BCSA 3D4NA 5J5CA 2PBRA 2Y1EA 4K03A 1MJHA 4NBSA 4KQ6A 3UHAA 1E9DA 1T6XA 2NUPB 4KDRA 4NMXB 3ENZA 1M1YB 5JO9A 4O3MA 3P2MA 5KOYA 3IP1A 2PUFA 2IL1A 3KVRA 5B7PA 4B8ZA 2R9VA 3RUCA 4CLHA 6NULA 3EXG1 2VQEB 4BVFA 3ICQB 1T1EA 4XUGB 5EIWA 4EFNA 3FMGA 4ND7A 3L49A 2E5WA 3HXLA 2SNIE 5HJ7A 2C4HA 2C8LA 2WZCA 1T9HA 5KBYA 1ZU4A 2WWYA 3P52A 4DJJA 2GKOA 3HVUA 4RPGA 1MC4A 1JG4A 2Z0MA 2ZSUA 3CT6A 5GJBA 4OSEA 4IQGA 5K0LA 4CKWA 4OBBA 1B8NA 4NV3A 3H3XA 3HV0A 2QL6A 4LGYA 2IK8A 1MP0A 5IBQA 2SHKA 4YWJA 2XUIA 5EEGA 1ZW1A 2H1CA 1BQ3A 4IX9A 2XCTB 2BZ0A 1MRSA 2PH3A 4BNUA 3PEVA 2IUSA 5CH8A 4HRVA 4Q66C 4EDFA 4WKOA 1F4PA 4AY5A 4IEIA 1NWCA 2XT0A 1VSBA 3DEYX 4RVHA 2BOVA 4A26A 3GQBB 2BYTA 4PC1A 5FIUA 4A15A 2YHIA 1YK1A 1XR3A 2J5BA 1OXMA 1V8FA 2PFSA 4URHA 4WBXC 3COSA 1VBFA 1WV0A 3HN6A 3C16C 2XV1A 1AQ6A 1MA0A 2EV9A 2QIPA 2R60A 2V6JA 3LD9A 1OBCA 1WUHS 3UH0A 3WMRA 9ABPA 4P0QB 2ECQA 1L6RA 4D41A 4WXHA 2GCGA 1CY8A 4PAMA 2D7CA 1ILEA 3A10A 5ALMA 1IUOA 1G0OA 4LQDA 5E8RA 5T6MA 4I5FA 3F67A 4DIEA 5HWSA 3QJGA 5ILGA 1ESZA 3CC8A 4L0DA 3TS1A 4AKSA 1OIVA 3QNWA 2VATA 1TYDE 2X4DA 2RGUA 2BMJA 3DFIA 4U3JA 1ZIOA 1NVTA 1NYRA 5AJVB 3C85A 4CKYA 1MENA 2IWRA 1FA9A 4CXMA 3TGPA 3OP4A 5JV5A 4FFRA 2XRZA 2NSDA 4AY6A 5EN4A 1NASA 2FSVA 4OHCA 3VKGA 3D54D 2AJLI 1YONA 2AC4A 2CF6A 3IESA 3LC0A 3UJPA 4JJ7A 1CJVC 1JR2A 3C5CA 1T10A 4KMRA 4WADA 5JS7A 3A3YA 1EFRA 3TH5A 3DPIA 5AIAA 2QTZA 4DEVA 4RTMA 2X3FA 4RD3A 4A36A 4WZBA 4QDUA 4TMTA 1W5AA 2JFBA 2O0MA 3L8GA 1E2IA 2QPOA 3N6RA 4KREA 4D4LA 4AWAA 5BSFA 2I6UA 2Y77A 2QHXA 3PJEA 4Y30A 2QE6A 5E4JA 5HRAA 1EP2B 1Z75A 1NJSA 3OH8A 1FJXA 5AI4A 5B64A 4WLUA 4D3ZA 5DBFA 2FK7A 1EPUA 1GZVA 4ZQCB 2D0OB 2WSLA 1XZQA 1MXHA 3NHAA 5B12A 5K99A 2I80A 3CR3C 2C95A 3DA8A 1ZMRA 2W4MA 3Q9LA 3R7NA 1Z36A 4BNNA 1M2GA 3K4HA 4CF5A 3JVVA 4ZOLB 2AQIA 1Z6AA 4Z4FA 3GEIA 1MOPA 4JHLA 3VR6A 1DKRA 3OOWA 3B5IA 2L42A 4K8OA 5GVSA 5K8JB 3QHAA 3HBJA 5JECA 5FTWA 4F4UA 5CFNA 1NPYA 1SC6A 2QLMA 2WEKA 4HPJB 4OTZA 4R2WA 3W2GA 3WR5A 6REQB 4ZHSA 1FLDA 3GYGA 4CMKA 1PHPA 1TEVA 3QOWA 3U19A 4IVRA 3ID6C 4HP8A 4M9CA 3SEZA 5K03A 1QB7A 3TRHA 1TNDA 2O19A 2JIZD 1R0XA 4X64B 2G07A 3H99A 3UXHA 1ZISA 2J85A 1UMKA 5DTIA 3RSLA 3BJRA 5G1PA 3OVMA 3KJEA 3KHSA 5D01A 1J5PA 3FIUA 1UBNA 2XUOA 3AHEA 3ZV5A 2VJLA 1XU9A 3CR8A 3TAUA 2GXAA 3FCEA 1N6PA 1T8SA 4F9TA 2FV8A 2NTYC 2WSBA 3DYIA 3GCGA 3P7MA 3OFNA 4OK6A 4P4NA 1SJ9A 3OE7A 4YROA 5FOSA 3K9WA 3SVTA 3B89A 4TVOA 1FUIA 1C4WA 4X95A 4BMXA 2GN8A 3PX7A 2ZEJA 3RWOA 4K9MA 1LB1B 1MNQA 2FSVC 4YAFA 5DSZA 5IJZA 1PGPA 3U4GA 1IXRC 1FVFA 1XTPA 3UVEA 4IDNA 1D2EA 1XHLA 2QI9C 2C3YA 2HJVA 1L4FA 3MW8A 5TC4A 4YRNA 3FWZA 3RIXA 1DBWA 3N2KB 4LI0A 4U7PB 4CNBA 2ODNA 3O9VA 1EG7A 3BIWA 1U3GA 3KTAB 5IANA 1P5ZB 4FWBA 4M1EA 5CG2A 1SHLA 1XQ1A 2HHCA 2YW2A 4RD1A 4JQSA 3ZDZB 1E0AA 3AC0A 4U2KA 4BX9A 2ID8A 1H0SA 2EP5A 4ZC8A 2BM1A 5EIBD 3LBHA 4FDUA 4FDVA 3IKTA 1NURA 3LHSA 4GKVA 3V1LA 4U3JB 3G8DA 3KVYA 3LUCA 5BOSA 3PKZA 5JEEA 3LC7O 2CXHA 3BX1A 4XR4A 1BFUA 1UJMA 1V1JA 3KQWA 3O4RA 3GHHA 3O8DA 1A2OA 1WSAA 4HB3A 1KR2A 3WOVA 3TRIA 5EIOA 2PDAA 4ZXPA 2GX6A 3E1GA 4FI3F 4YRBA 1FLNA 3R5SA 2LWIA 4UBMA 2H54A 4HDKA 3CJRA 4FCWA 4DZRA 3BXPA 1HQKA 4HSEA 2JFQA 3PUVA 2R8BA 1J33A 2QMQA 1ZEMA 1NDHA 2CXXA 3TOVA 1T9GS 2Q41A 4PWZA 3ABZA 3DL4A 4HMPA 3RUFA 2AZDA 2W37A 2YYYA 3EIQA 4R7ZA 4Y1RB 4R8VA 1QK5A 1B2RA 3EZGA 3BJIC 3GX1A 4KVGA 1U1FA 2JS7A 1G8FA 4MUJA 2H4ZA 4PZLA 1U0RA 3EVNA 2OQVA 2WYUA 3KYJB 3CMCO 5G0TA 3TSYA 4DIMA 2VAVA 3HP1A 3Q6MA 2R7LA 1UBTS 1GAJA 2C04A 2JD0A 5H68A 3KTOA 5COAA 1C3JA 1TQDA 4IIXA 1C9KA 1T6NA 1XGKA 4HDQB 3C74A 1KI1A 1RWMA 2RAVA 3MB8A 1TFRA 3QXGA 4IOMA 5FLXA 4OGKA 2VQ3A 2HWXA 4NV1A 4PLVA 3M4JA 4U6SA 3G8AA 1JLLA 1UK9A 4LHZA 2HCTA 1YL5A 1KS9A 4RK1A 2H9AA 2DPYA 2EOAA 2XUJA 3EA4A 5JAQA 4YUXA 4BTVA 3KUKA 1JFVA 1KMMA 5GJCA 5EHXA 2YFQA 3SIPA 1ZGHA 3KXLA 3KQLA 6CHYA 1Z2EA 2ZBQA 3T7IA 3Q72A 2IBTA 3PFBA 1GGHA 1A7AA 1QGAA 3TZBA 1QZTA 1GTJ1 1R3UA 1T5BA 3HNRA 2VPPA 1PWYE 2OHOA 4MRNA 2MR6A 1PNVA 3UOGA 3OHSX 1KO5A 4BCBA 1A97A 4Y9TA 1AQLA 1RFGE 4GDMA 3D3EA 3EBLA 1WCXA 3EH2A 3RABA 1PGJA 1DQZA 1U7ZA 3IR5A 4QYSA 3L6BA 4JP5A 1KSGA 4EGAA 5AM0A 3WLRA 4D9KA 4R7GA 3QKTA 3A6LA 5TQ0A 5ALLA 1FNCA 3WIBA 1EP1B 1OU4A 2GXSA 3NANA 2BMFA 1EGAA 2Q7OE 4C43A 2PT5A 3BREA 4DJDC 4J6EA 4IHJB 1PT8A 2C5BA 1E4OA 2FKNA 3GPBA 5C81A 2I8LA 1AS2A 3AI2A 1BZYA 5KNDD 5REQB 4E15A 3T7JA 1HORA 3K6RA 1JAHA 1G98A 1CIVA 2PIAA 5T4FA 2XCLA 4EJSA 2GEVA 5SZKB 1IHUA 1GFWA 1NMQA 2HV8A 5A71A 5IEBA 1QDUA 4JJFA 2XDAA 4RKQA 2F48A 1FYFA 2G1KA 2GD1O 2H7YA 4Y2XA 4DNQA 3HBAA 1H0RA 2OBNA 4Y2JA 1DEOA 5LMUB 3RUEA 1KPIA 4ZRDA 1C5KA 1T5TA 5CXSA 1UPXA 2P2ZA 4R6XA 2OCBA 4Q34A 4HDCA 3VKWA 4DEXA 2X0FA 2I99A 3OZBA 4CLOB 2IHVA 5DLPA 1FDUA 3HSSA 4CV2A 4WUVA 4NZOA 3GC6A 3MGAA 4BLRA 5ALGA 4HT3B 4L22A 5JSYA 4WBNF 1VKNA 5B3JC 3C8ZA 4JA2A 3U4AA 2IF2A 3OQIA 4MWSA 2ZTUA 3PDJA 1CP3A 2XJ9A 1A9QA 1GCUA 4PC3A 1XL1A 3DF7A 5TEWA 5HTKA 3QUAA 3O0TA 3QKUA 4RC9A 3CUTA 1R0BA 3DOJA 1WB5A 4ND1A 5KHAA 3TO5A 3TQCA 3U56A 3AY0A 5KJEA 3PC3A 4LVOA 4OJTA 4V1CB 4XIIA 1W0KD 3NC0C 3Q3GE 4NBKA 3V7FA 5H8WA 1TCAA 2ZZNA 3C3PA 3NNSA 1X19A 3H6GA 1NXSA 3IA7A 1PCXA 3Q7TA 3K35A 4H27A 4JJGA 4FOTA 4NCHA 3QVUA 1JR3A 2CL5A 1C3OA 1XTUA 2ET6A 2P0EA 5BYBA 5ULLA 4ZVMA 3U7RA 4OCZA 4MS4B 1EUCB 4KQGA 3RRXA 2GERA 3DNMA 1CQJB 5DYIA 2NXWA 2VJAA 3ELDA 4EMTA 4WBNA 1NBME 2I5PO 3ESCA 4E1VA 5CTJA 4IMRA 2ZBPA 2XAAA 3ORQA 4TQUS 1I30A 8ABPA 1VCOA 3L8DA 5KI6A 1DO8A 3GCWA 3T5GA 4R0MA 1U2GA 5KTPA 2HXSA 4PGAA 5EMLA 1BFDA 1CNFA 1D7AA 2XMCA 3CUYA 3I01A 4G0YA 2IUFA 4E2XA 1Q1NA 4ZJYA 1NU8A 1QTQA 3PI7A 1XKTA 2JGFA 4EY8A 2A9JA 1I5OA 4GLLA 1XZMA 1NW7A 2WG2A 2IBMA 2WHQA 3DZIA 2WF5A 1Q1QA 4MKFA 4E51A 2BIFA 4BVBA 3G0BA 4GUAA 4C2UA 1LU9A 1IEVA 2NZJA 3QUCA 1UM8A 4JYPA 1WPXA 1JSXA 1JTVA 3RK4A 3RU7A 1T2VA 1JHPA 4U5XA 3OQNA 1U80A 2RE8A 3QA9A 4NARA 2ZYUX 3OWOA 5A4KA 4HR7A 1K8XB 2CLOB 2IE0A 1AM4D 2VT7A 2R8PA 3VPHA 2YVQA 3E1KA 1KP2A 2HL6A 1P61B 3ISJA 4HAYA 2QTGA 3NRCA 4IUDS 4BTEA 3U0BA 4LN1A 1KJYA 2MSWA 2MINA 5FPPA 2NM0A 1GUBA 1PLKA 1Z28A 4UAUA 4ALLA 4KXYA 1GZUA 1KDPA 1KRHA 3SZRA 4HLDA 1X9GA 1E3DA 3T3NA 2BD0A 4UAGA 2GJAA 5HTOA 3QX3A 3IUYA 2FPSA 2BGRA 5LQUA 3DHNA 1N92A 3OD1A 3AOEA 4RLHA 3K6SB 3JQ9C 5AW2A 1YBFA 3NKVA 3OC0A 4WDQA 3QE2A 5CA0A 3ZWVA 3E22A 3QYFA 3R7WB 1KH1A 2HPAA 5B58C 1FB5A 2AN9A 1A4UA 5CGZA 1I4TD 4QL3A 3QH4A 5CTAA 3H9CA 3K09C 1S3SA 1XTIA 5T64A 4XM2A 3IPAA 5FI3A 5A3SA 4OXKA 1P0MA 4BLOA 1T5HX 2PRJA 1UEJA 2AKYA 2X86A 3DR5A 2C88A 2FQYA 4KXWA 2G9VA 4PYKA 3ESYA 3DL0A 3JQCA 13PKA 1YRQA 2RMKA 3CONA 1CUHA 3KBOA 5C5DA 1TAGA 3KJGA 4JSTA 4QT0A 3FRHA 4QNNA 2G5PA 2XWPA 4RK6A 3O0DA 2IWHA 1DG1G 1T2EA 1F1BA 1P74A 1CUDA 2B8JA 1EFCA 3MGGA 3MS4A 4F85A 2CNNA 4Q7KA 1N25A 3ZJTA 3V7UA 4C01A 4K46A 2JAUA 4E0BA 3OEEA 2BFFB 1UDBA 4YCAA 2HH9A 1XRMA 4OQDA 2P9ZA 4MUYA 5B3JA 5CHEA 4C06A 3NDPA 4EL5A 3Q1LA 4PHTA 3BH0A 4XVUA 5IKXA 5BNTA 4YCLA 3T5DA 4CMIB 2B4YA 2SECE 2HJSA 2QWXA 4Z3DA 1L5FA 4Q4HA 5LR6A 3GLRA 4KVZA 1CV2A 2CCGA 5B1IA 4Z0TA 2RCNA 2HSJA 1Z6ZA 4PYQA 5LU9A 1J9ZA 4AFNA 2V55B 4X1KB 4NYJQ 3LYHA 2JZOA 1FFXA 1YKSA 5DRYA 1KQNA 2WAAA 4LDRA 1HTBA 3D2AA 3OU7A 5CIQA 4D0RA 3WGLA 4QAQA 1WZCA 4XFKA 2AIRA 1BG6A 2ZI6A 3HKBB 2EP8A 4RMIA 4GX5A 4KWCA 4E6EA 1I10A 5DBIA 4EB6A 2HNAA 4ZYVA 4QOJA 1F0NA 3TM5A 1ZSNA 1FCJA 3TVDA 1Z0UA 1C2TA 3QBJA 1Z6YA 2GJKA 1EKXA 2WJ3A 3VQTA 3JTEA 4FINA 1TVCA 3MWEA 4P0TA 5AP9A 3F7MA 2Q2QA 3AHCA 1Q12A 3QWAA 1KYTA 2A9RA 4I0WB 1KZHA 4IS2A 3TDNA 3VRHA 1K8QA 3IVGA 4RSHA 4N47A 4ETWA 1OH8A 4P4GA 3IVMA 1FQJA 1QVWA 2C2MA 1L4KA 1EUDB 2F9MA 1U8AA 2HIAA 1ZD5A 2PZAA 1XJWA 2AMYA 1D2RA 2RAUA 4FSDA 5FH9A 1JAXA 4CQNA 2RHGB 1IULA 3JR7A 2Z8XA 3GJRA 4QPCA 1ADCA 1KK2A 2LUOA 2OLEA 2VLIA 1EI9A 3S3TA 4TVSA 3M5DA 3IQZA 1VJ5A 3FFBA 3DHEA 4V0OA 3ZU3A 4D9IA 4BZXA 5DX0A 1NPDA 4B3XA 2JHGA 4XCVA 1MQ9A 4NBNA 4XQGA 3GMTA 4M1KA 4B84A 2XE4A 1H4VB 3JASA 1PL6A 5JH7A 2JAOA 4RF5A 3MWFA 1XVTA 1DJQA 3AR5A 3R4CA 3CX8A 3FMFA 3IC5A 5AO9A 3ZV4A 4E3ZA 3P9QA 4D02A 1TYEB 3STVA 1P3JA 4B6EA 5JAIA 1PU2A 3GJZA 1DDGA 1OLUA 2ZSKA 4LNUA 4UMVA 1DO0A 1PL0A 2VWPA 1TC2A 3SC6A 4OYYA 3WFJA 4DUPA 3DGFC 2C98A 3A6HA 3ICVA 4PC6A 2YV5A 4NOKA 1TM2A 1Z0FA 4JBWA 4E5KA 1JH9A 2XE6A 1WW8A 1YL6A 3A11A 4LK2A 4RL6A 4ZODA 3RBXA 1BHQ1 1X2BA 1JAZA 4KXUA 3DDHA 1YVUA 9GPBA 5IDXA 3PYXA 5LP6C 4WOJA 3M49A 1BWPA 3P27A 4MVJI 5EKXA 3IBTA 2QX8A 3T4XA 4AW9A 3M1AA 2VEDA 1M1XB 3NORA 1JQ5A 2B35A 2G06A 5GZ1A 1EVQA 2OCGA 4LW8A 1I14A 1SOUA 1PG2A 1EGMB 1XYGA 3CLUC 1HDRA 3NONA 5EESA 5FLKA 4RDXA 5F3RA 1F3LA 4KIFA 1XPRA 4TLDA 2GA9A 5CBKA 4R3NA 2G9RA 3CUEF 3O90A 1UP4A 2REQA 1QFYA 2JGIA 5BQ5A 1M74A 3W6PA 3WLOA 3UK1A 4Q3BA 3C1AA 4NJOA 5E9JA 4HQFA 3QM1A 1PQWA 8MHTA 1PS0A 3NXKA 1STOA 3LL7A 1L4MA 3TB4A 1FQWA 3GGDA 1XVLA 2IIVA 2ZVPX 4TTSA 3RU3A 1AZWA 1SIBE 2NUAA 2WTEA 5K3FA 2Z6QA 5LQSA 2XD9A 2NO4A 5L95A 4ZTZB 1LX7A 1E3LA 1YS1X 2O0HA 2QU8A 4L6AA 2FUG1 5GONB 5HKBA 1U0JA 3GCDA 2HA7A 1Q77A 3BFVA 2W2MA 5TMBA 1CP2A 3D8RA 1BEZA 5FR2A 2JK1A 2I2FA 5BQOA 4B81A 2IELA 2H4XA 2GB4A 3G2OA 1TYAE 3BKXA 1OREA 3P4YA 3V4FA 1TE2A 2WP8J 3NATA 2RHOA 3UXYA 2OAQ1 1RQGA 1IBCA 4HMOA 1SIUA 4GPBA 4IF4A 3I1IA 2W2KB 3MJVA 5CVCA 4GM1A 1T0IA 2QQ5A 4ZVVA 3ZS8A 4Y9DA 2V3WA 2J3LA 2QX9A 3P9ZA 1A9TA 2I76A 2PH7A 1DL5A 1U3FA 1QFSA 1GZDA 5BSRA 3QPVA 4FHEA 3W6UA 5FOQA 1Z0JA 1SC4A 1WD7A 3CLTC 1D6SA 2V7QD 3NTUA 4FZ5A 4MV4A 4TVBA 5DHTA 2NZVG 3H1BA 4Y3UA 3UMJA 2QT9A 2YOHA 3JVUA 4YBZA 1SZJG 4H0NA 4N8SA 4OGGA 2CV0A 4FFOA 2MIIA 2R6R1 2VHVA 3JQGA 4G1EB 1FX1A 4ENUA 3U6KA 4BNTA 3AVPA 1QO0D 4G5QA 4Q3EA 1SKYB 1F8XA 1TJ5A 1BC5A 4RJJA 4F71A 2BHRA 5JARA 2IHNA 2CEKA 4MW1A 1YU6A 5TMEA 3HYTA 2I1QA 4EW1A 1I24A 4DQUA 5FOUA 4OQLA 3JYNA 4M6WB 4TYMA 2IYOA 3JARB 4XLTA 3RC3A 5JY1A 4CPDA 5DTJA 2ZIGA 2D0IA 3UPTA 4F8JA 1SCQA 2F3SA 1CPYA 3FGNA 5A0FA 3AVVA 1YDHA 4Q4AB 5IS2A 5IKOA 5IJXA 1OAAA 1HUQA 1P1IA 3WLJA 5DBEX 5G40A 3L8EA 1Y3DE 3QLUA 2B25A 3M1YA 4HTAA 1U2DA 2H2DA 4DBZA 3PL1A 4KW7A 1V3VA 2VCHA 4G5OA 2ZUBA 3LFUA 1GRNA 1TM1E 1Y6RA 1HE8B 1N6NA 2RH4A 1DCMA 4LYJA 4Y7CA 4BVKA 1GFZA 1VJ0A 1XZFA 2UYOA 2WV7A 2B34A 1LEHA 3IRVA 1OA1A 1PYDA 4PFJA 4Y2HA 5E6SA 4JNKA 3ITKA 3MT0A 3TLMA 5CH5A 2B8TA 1T4CB 3JQ8A 1CQJA 4WXYB 1SC1A 4BE7B 4G0WA 1K66A 1QUFA 4DQDA 2NU6B 1E2GA 5TNXA 2E21A 4PG5A 4H7KA 5LXTF 1NLFA 1RI1A 3KP1A 1PO7A 2OMEA 4PAQA 5JNWA 3UAZA 3WKAA 3H04A 2RAFA 2JI8A 2VP9A 1Y8RA 1WCIB 2RH5A 2XE8A 3TQIA 4GZ6A 1KJWA 5D1NA 3DHWC 3NWEA 3P94A 4FE3A 1N2OA 4F1WA 3OJCA 1OIXA 1W52X 3P9RA 2XUFA 4M83A 2E4ZA 4MP6A 3ICOA 1OFIA 3PEUA 5AM1A 4AU1A 2AQHA 4DBLC 5BR1A 4TMWA 2IBSA 3A0UA 3INNA 3ESRA 3M9WA 2XCSB 4A73A 4DLNA 1KIFA 1U8ZA 1GADO 2DY0A 5IAGA 5E7JA 4LISA 1A50B 1PT6A 4RHUA 5AVOA 2PNJA 2ZYRA 1GAWA 2UVQA 3D2CA 1C9JA 3DOHA 3PGVA 3FROA 1SCKA 2V7EA 4XPZA 3C3YA 1KJQA 2RHDA 1MNAA 2ORYA 4DCGA 1D2MA 1VCNA 3H3FA 1FZQA 5K2OA 4GX0A 5KB3A 1OZ0A 4EECA 5EJFA 5KS2A 2WJZB 3E58A 4UBJA 2AVNA 1E63A 1DDIA 2ZRAA 3NWJA 4XSVA 3R77A 1NAHA 1G3IA 2AB0A 2I6FA 5EPUA 3D8TA 3I30X 2F4VB 5CLIA 2JLQA 2MOKA 3PSAA 3VVLA 4ECAA 1SEPA 4Y2GA 4CFYA 2CZQA 3CV3A 4XCXA 3VR4D 1TOAA 4WQMA 4WDRA 1U0LA 2ZBFA 1R6TA 4DLUA 2P4EA 5LQDA 4DSUA 2OWEA 2C9DA 2PXCA 1KBQA 3S99A 4IIJB 1G6KA 2ZPAA 3VOTA 4D82A 5IC4A 3H17A 4N12A 2PT7A 1RC8A 1E96A 1UT5A 1VCIA 1YK0A 2H52A 1OZHA 2BTQB 2NYUA 4HGZA 2RKBA 3ENKA 3SZLA 4DA9A 5I48A 3RYHA 2IODA 3ROTA 1K3FA 1LD3A 3HYSA 4G1MB 4XQ9A 3R5TA 1J5EB 3SYLA 1FL9A 1XA3A 3CH4B 2R85A 4PGFA 4DW8A 2CW5A 4H1WA 5A4FS 3CPSA 3RM3A 5KOJA 5AUOB 3PDHA 3W0LB 5KSYA 5TF4A 4CIXA 1E5LA 1FXWA 3T3IA 9LDTA 4ZWNA 4PQYA 2AMFA 4D4GA 4W5RA 1T0UA 3DUFA 3B78A 1Y3HA 2ZTHA 2CXQA 3ZJYA 1JVNA 5C8YF 3RVBA 1YRYE 4U9IS 2CKDA 2VTVA 2Y3IA 3OZFA 2O50A 3T99A 2YMLA 4WCFB 1TUIA 3UG6A 4LDZA 1BRMA 3TMYA 5EE3A 3VI3B 3WNDA 2W6NA 1PEAA 2EL9A 1AF4A 4B9AA 4JR1A 4BBPA 4Y6LA 3D4LA 4Y1FA 3WTCA 3KZCA 2BC9A 4LJAA 1JEDA 1DAFA 3PHLA 4JBIA 2ZS7A 3THWB 3P71T 3IQXA 5CXQA 4UM5A 4YR7A 4L0QA 1H2HA 5C35A 3L40A 1BKSB 4KR7A 1Q7RA 3B3JA 1F8GA 2YOFA 1INLA 3EBPA 1E3SA 4CLOA 1TYCA 2VRCD 2Y6VA 2YZMA 3I58A 4X1YB 1U2QA 5CA1B 3UNXA 4KWHA 5JSQA 2P1DA 1QV7A 1NFFA 4MQ6A 4UEOA 5T4BA 2Z98A 3QNMA 4WCDA 5J5VA 1FX0B 1KQPA 2C99A 2VYQA 3AB7A 2BCJQ 4LZZA 3CCBA 1QHGA 1IHPA 4C7KA 3L4EA 1S2DA 5DHAA 1EUDA 3KDAA 4EW6A 3F74A 4O1MA 3KCNA 3B3GA 3GH3A 4YAJA 1IVNA 4GI5A 2BFEB 4N3CA 4NCJA 4AS1A 4ZU1X 5AM4A 3C3CA 1K9VF 1EFVA 1XCJA 2B1QA 1L3BA 4KE6A 4KITB 5DYYA 4G5GA 1NTOA 3H65A 3LHDA 3PITA 4L5AA 4WL0A 5JISA 2HLDD 4QDJA 7ABPA 1R0YA 4NX2A 4BZWA 4MA5A 3RLIA 1XA0A 3K71B 5TJ9A 4OGWA 3E9RA 2IYUA 1N2JA 1WTAA 1M2FA 3RVMA 4AS3A 2ISSD 4URXR 3QU5A 4DR2B 1BMFD 3HA5A 2FSPA 3LSTA 3L7NA 1FSGA 4B7XA 2P68A 1ZSYA 4JH0A 5KTTA 2AOXA 3FJOA 5T4EA 1FFWA 1OZAA 4G63A 2Y4OA 3A1UA 1KPGA 5LQMA 2I2XB 4R98A 3ANMA 4LA4A 2W0MA 5HIMA 3EOAI 4P5DA 4B4VA 1KSFX 2RARA 1YASA 1U2EA 4PO3X 2X9GA 5FUQA 1Y7TA 3UMFA 4JGGA 5CYPA 3C1UA 1I33A 4YS6A 5JBQA 1ESCA 4HAZA 1HT0A 2JPDA 4OAOA 1QHNA 1LCIA 4M0EA 1JEOA 1IN7A 2AUTA 4N6OA 1UC9A 1H4QA 1D1PA 1ZA1A 4DDTA 5DTQA 4Z9FA 3OZWA 1LVHA 1I2CA 3EYAA 3LRTA 1AO0A 2QRJA 3LPNA 4HN2A 3A2LA 1JZSA 3EFHA 2W2OA 3ZUGA 4BMOB 1M8FA 2GDZA 3NLLA 1Y7IA 4RMGA 1Y3BE 4EJFA 5LMZA 4RPLA 1OXXK 2G1UA 5F78A 2C00A 4Q1EA 3UV3A 3P9SA 2I6QA 3PXCX 1JT2A 4U2FA 5KYXA 5EA2A 2YZGA 1Z68A 4QYIA 3IA2A 1V95A 3H8VA 2BGGA 1PZGA 3A1NA 2YINC 4Z3KA 1N5RA 4MROA 4DC1A 4XUCA 1Q3HA 1PZXA 2C61A 4H0FA 3AFIA 4JLWA 5AI9A 3EA0A 3DTVB 3A6KA 1ADFA 4ZO8A 5ESWA 1IAVA 1ESEA 4CIVA 2NU8A 4BO9A 3NV7A 1DC5A 4S0XA 1RVV1 2ES4A 3AHIA 5DCYA 3MT9A 5DI9A 4HJXA 5CM8B 1DRUA 3V3KA 1V1RA 2NUPA 2PXXA 4CHTA 5KYGA 1KBOA 4PHCA 3UB3A 1WMEA 1M1ZA 2LPMA 1ZD1A 3L0ZA 5K3EA 1OKKD 2GN6A 1EH5A 2R6AA 1C0EA 1X7XB 2DTDA 1PNQA 3B7WA 3EGDA 3IAS1 3IH5A 3K1TA 3NI2A 2R6ZA 1JQJC 1PLLA 1EFTA 3RVRA 3WZLA 5LDHA 5CA1A 3DBIA 1Y9JA 1Z08A 2PSDA 2H1SA 1LPSA 4MRVA 5KCMA 4MV7A 5F73A 3IUJA 3NAGA 4KXVA 2DKOA 2I78A 2FCAA 5D84A 3TI9A 2IS6A 2QN6A 3PUKA 4PYIA 1VMKA 1H42A 2VNIA 5EKUA 4O2RA 1X9HA 1VE9A 1YXMA 2DRIA 1JPVA 1XTQA 1W4AA 3O1JC 4J16C 4K6KA 4TGLA 3RVPA 4I50F 3LBAA 1O95C 4FFBA 1ZC3A 4UCWA 1MVNA 2FXIA 1DOAA 2VAWA 1SD1A 5FT9A 3AEQA 2AHRA 1YFJA 1SXPA 4B3MB 2NXCA 2VRWA 1AZSC 2CUTA 4BUZA 3ZX4A 4EHAA 2ACVA 4Q4AA 4FJ2A 1XQWA 1YOVA 1XKQA 4D74A 3DW1X 3EEBA 4AJNA 1DIAA 1JHMA 4PYRA 3C3KA 2YHIB 4QDXA 2BGNA 2ST1A 5DO9A 1FY2A 3IE1A 1V2HE 3TZEA 4J1NA 1U7PA 2QXTA 4LRQA 3DWFA 4M46A 1KQGA 2ZDGA 3ZWPA 2CMGA 2DGDA 3M6VA 3OLCX 3KOYA 2CB0A 1ABFA 4HB0A 4XQCA 2YICA 2WTMA 1CUXA 1P7ZA 1V35A 4YJ3F 3QBDA 4HH3C 2YS7A 2FTKE 2PUJA 4K9SA 4EVIA 5ADUS 1A8IA 3MRXA 4A7PA 1A4XA 1E4EA 1NUAA 2OBXA 1AG9A 3L4BC 1GTG1 4FE7A 5LJLA 3HH8A 2UZ1B 5CJPA 1ZITA 5TV2A 2VNJA 3FOCA 2AOTA 4ETIA 3C14C 2E3JA 5JS6A 5LZ4A 1W44A 1YDWA 3O21A 3H5IA 3Q7SA 1C9MA 1M1NA 4QX6A 1GPJA 2H1LA 3IIMA 4GI2A 2R00C 4MRPA 4QYWA 2QR2A 5ICFA 4IMPA 4OFWA 1B6GA 1R88A 1L4BA 4IO0A 4D44A 3NVDA 3IKVA 1LTQA 3PHJA 3UWMA 3A9TA 3V8EA 1N5JA 4HRAA 1JXOA 1R9NA 2CWWA 5AK4A 3I3OA 4YUWA 1Q91A 2ZJ8A 3E5RA 1VPDA 2PGJA 5CURA 5HRUA 4H1TA 3O73A 4GRIA 2IEZA 3RANA 1N9GA 4L50A 4HUJA 4ZI7A 4U2EA 4HUQA 2HZBA 3CUVA 2QYSA 3FPJA 2Q5OA 1NWHA 4ENPA 3OZCA 5K0CA 3QHQA 4OLHA 1KZ1A 4ZREA 2EQBA 4E46A 4RYLA 2WW8A 3VBEA 3LUPA 4B3TB 5I9IA 3MM4A 3OY2A 5AW7A 2C1ZA 3HCCA 1ABEA 4MI6A 2NYRA 5LP6A 3V34A 2Z9CA 4LE0A 1JFLA 2I3ZA 3EZYA 3PEEA 4O0MA 5FUWA 3WAKA 2WWTA 5H3LA 4B75A 4D0NA 4CIAA 1TU4A 2OHXA 4A3SA 2YZKA 4NG5A 3EAFA 4CRWB 4YAGA 4X8LA 3R23A 1IY2A 1ORWA 1T2NA 2WK1A 4P34A 5DCUA 3L1JA 1FFAA 1WEHA 2CUZA 2I9PA 3KNZA 2TRSB 3JTMA 3PYLA 4RGBA 1BEUB 2Q2OA 2XOXA 3IQFA 3RTEA 2DB3A 2AEJA 2JEZA 3K9LA 2O2SA 4MYCA 4OQYA 3RYTC 4FB5A 2IS2A 3DLBA 2DAPA 5IH3A 4CQMD 3UW3A 5JAPA 2K4MA 4B48A 3OF5A 2JH9A 3IE2A 3P0FA 1V6AA 1YCGA 2JFZA 5DW3A 3TQSA 1RC0A 1OYWA 2GPYA 2X9LA 1TVKA 4KDEA 5DT9A 1DS6A 3PI6A 4JXZA 3L7JA 1WM1A 4AT1A 1QVAA 3SR4A 2GGSA 5AVSA 3GRRA 3BT7A 4B7CA 4BOYA 5HG0A 2XBUA 1WD5A 1JYEA 1E94E 3RS9A 4P0PB 1N2IA 1XMQB 4BGDA 1Q17A 5FWYA 1JLHA 3UPDA 2OV8A 1I6WA 1E7MA 2JFYA 3E82A 3G79A 3NP7A 3K0SA 3G0CA 3CTMA 3GAZA 2XVYA 4ZJPA 4FWTA 2FUKA 5ALXA 1U04A 1ZK2A 3KL4A 1C1YA 1C0KA 2EX4A 1UJ4A 3ACBA 3KPWA 3PU6A 4H7JA 4UCFA 5DPMA 2FE1A 4E6PA 1ZNWA 4LWQA 1C80A 2BH9A 3BD7A 3CG0A 1U8UA 3LRPA 1ADJA 3PC8C 3QX7A 3T5MA 2XTZA 3DLAA 3VYTB 3FBGA 3ZVRA 4AAYA 1K3UB 3DMHA 3PRJA 4NL4H 2A94A 1E3JA 1UKBA 2XWQA 2CDBA 2YHBA 4O5OA 1YR1A 2L82A 2K5UA 3EXEA 1XD2A 1EQ2A 4QYTA 4ZOBA 5CCBA 2Z1MA 4ENSA 3FUCA 1DBPA 4P5EA 1H1DA 1SCIA 1SK9A 2E4YA 3W3ZB 3T52A 1L5OA 2ECKA 1R9MA 3PRKE 4QXAA 1TLLA 4K6FA 1DC3A 1P2FA 5JBNA 1EE9A 3L1HA 4CU2A 1VKZA 2IU6A 3K9QO 1ILWA 1Z4PX 2P62A 3KOWA 3UJ6A 2HB6A 5HIKA 3STYA 2VJQA 4BNZA 4KG7A 1JUDA 2FW6A 4DJFC 3HA7A 4MVJG 4JGIA 2W2LA 1R7RA 2ZSAA 4HAOA 3PR3A 1QXSA 4C21A 4XTCS 1R6XA 3NC1C 1W36D 2AZ4A 3JALB 1FU4A 1GZ7A 3FNFA 4NHOA 3UOAB 4OREX 4BNHA 1EZZA 3LIIA 3REOA 1O54A 1PX0A 3UTDA 1PQUA 2EWMA 1KARA 4BZZA 4EHNA 3LKVA 4WBSA 5FQNA 3IUNA 3F9CA 2WT9A 2N47A 3PK0A 4KWTA 2QN2A 3GLHB 1XZHA 3ESAA 3E8SA 4CKCA 5DNDA 3T1HB 4P93A 4YYEA 1B43A 1K5HA 1ZM2A 2H4WA 4ND8A 2H6EA 3AGQA 3EJ6A 4L4SA 1WHTA 3QWIA 3ZHCA 1ECJA 5CVUA 1F2DA 4FZRA 1XPJA 1J00A 2A0XA 1HFJA 2HRBA 2J31A 3L43A 3F96A 3PPYA 3Q2OA 4U9UA 2YRXA 5DASA 3TW6A 4TKUA 5IZCC 2A57A 5CLJA 3PWKA 3ZLTA 4DLSA 2DFVA 2O5VA 3LA6A 4PG6A 1LUAA 1N6IA 4QGBA 1CCWA 1U2PA 3C7TA 4KDFA 1IZ0A 1CULC 2YZNA 3OJWA 4YTEA 2I1LA 2WU4A 2EWWA 5H80A 4HDOB 4W9NA 5LOVF 1KK1A 4TS1A 3BICA 1IE3A 1VECA 4E2FA 2Q99A 4EYKA 4OSPA 2OYSA 3LP8A 4QAJA 4RW0A 3RQSA 4D92A 4AKGA 3IO3A 2ZQ5A 4JP3A 4M88A 5HS4A 4BNGA 1Z0KA 1WUKS 3C5EA 3SIWA 3MTIA 4KMSA 2WUDA 1CZHA 4N01A 4TROA 4DWOA 4LY6A 5BWLA 1MDBA 3K31A 1EA5A 1KFJB 1ZWKA 4BVLA 3QX8A 3CM0A 5HSGA 3SS9X 1A88A 5FJJA 1BA2A 2OM6A 5EUBA 3V8QA 4L75A 3KWJA 4YREA 3NM6B 4F60A 4Q6WA 1P0QA 3HDGA 2C9MA 3LIPA 4FT4A 5ENZA 1QTRA 3X43A 4DLYA 1N0VC 2WJYA 2QSYA 4QRHA 3SOPA 4C4PA 2NP7A 2R6DA 3WWYA 1V4VA 2CNWA 2JAWA 5ER9A 3PQEA 3LC1O 3WHIA 4D42A 4WFJA 2GJ9A 4JCOA 3PDIA 3CRVA 2W83A 4M86A 4LF8B 1RAIA 5EJAA 1HZJA 2VBCA 3A31A 1CZLA 2P9YA 2CMFA 2NUTA 2DSNA 1HY3A 1CNMA 1SOMA 2AFIE 1KEEA 2HEIA 2DPHA 3WLSA 1Q0HA 4WPGA 1N0HA 1XZDA 5JPCA 4U7JA 1E1KA 1VKOA 3I4FA 5EGSA 4FNMA 5T41A 1O96A 3W7VA 1BDMA 5JALA 2GXQA 4GI3A 4OX9B 1KDTA 1KEWA 3MZ0A 3ND7A 1P62B 5I5GA 3ZWXA 2B0CA 2QUZA 1J99A 2JGLA 3EWNA 2QSZA 4OATA 5EP3A 1FNBA 3QEMA 3DAFA 5EVJA 3RYHB 2EHDA 2Z8ZA 2E48A 3TZ6A 5B7NA 1DUSA 5M7EA 2FUNB 1I6LA 3O92A 3WB9A 5JNTA 3AB3A 5ENVA 4B8YA 3ZIAA 4NJEA 3SDBA 2NT4A 3MGBA 5HQ3B 2V7VA 2EX0A 1UWKA 5EIAA 4IJUA 4ZANA 1MOQA 3H8JA 4DLXA 2I54A 3V7WA 2OV2A 5E38A 2IYWA 5INTA 1QFJA 1X80B 5IMSA 1WLSA 4FEEA 3L9WA 2VPYA 5JNRA 2IIBA 4IDOA 5KTOA 4PU0A 4YCBA 5JXJA 4BFCA 1ZGBA 4NE9A 5FA6A 4TUYB 4RS3A 5TS3A 3ZKWA 5BW5A 1AKYA 3ZU6A 1T13A 3R3ZA 1N4AA 2O7NA 3ZLUA 1KMIY 2MYPA 5BWBA 2GHRA 3MRVA 1GDTA 2BGTA 2FDXA 1TMKA 2TYSB 4AJPA 3WISA 2ZIUB 3ZJVA 4P58A 3QRWA 3OQPA 3L82B 3BXZA 3ABIA 1UOEA 2J59A 4WESB 4DNFA 3OFKA 1XX6A 5J9FA 2X22A 3N2NA 4AF7A 1GXSB 1I32A 4XGKA 5H4HA 3JAKA 4IDAA 1TAQA 1CBUA 2V74B 4FN4A 3PXXA 2DQKA 1JX6A 1XLTA 1X92A 2P0AA 3DD5A 4EZBA 3HMKA 3DKVA 4I4LA 5ESRA 4Q4DA 1KDVA 3KTAA 1L4GA 3O3NB 3VU0A 5ICGA 3NHLA 4LZWA 5AW0A 7REQA 1AIPA 3CCFA 4BVJA 1ZIDA 4HYEA 2ZSEA 4W82A 4DWVA 5BWMA 1PTJA 5A3VA 3CCCA 1V3QE 5D5PA 1GZHB 2YIMA 1M6VA 3KKMA 1QIHA 1L8XA 2YVLA 4M8KA 4R1NA 2NQ2C 4V24A 1J22A 3DE1X 4IDEA 1B16A 4QM6A 4Z2YA 2JL1A 1WNTA 2XMGA 4OYLA 3ZPXA 5A6SB 3RJZA 3TNYA 4BU1A 4FFLA 1SXJD 3HMQA 4MHTA 2QLTA 4KX3A 4XWTA 1LJLA 2FE4A 2NTNA 1E66A 5ED0A 4YXWA 5JQWA 4LF5B 4GI1A 4CTNA 3KUXA 3YASA 4HDKB 4IOLA 4O2BF 4Z51A 4FS3A 3SSOA 1ZVMA 2FMUA 2BDTA 1M5TA 3AUUA 4Q05A 3IOMA 1P3Y1 2YJ3A 2Z04A 4PPYA 5F1KA 3VOAA 3H11B 4ARBA 3PUWA 3QW2A 3LX5A 4EG7A 2AFHE 1VSQA 2GEUA 3DEHA 3K6JA 5MHTA 1W5EA 4GOLD 4HUQB 1QIKA 1JKFA 2FW9A 1F6BA 1YR7A 1Z18A 2G72A 4L95C 2XHZA 4Q1CA 3RO7A 3W9UA 4EX7A 2AKEA 1XYYA 1Z12A 1JHRA 2YUTA 4INOA 4KGVA 2X0EA 4E7OA 1RQ7A 3L0DA 2GAIA 4QJ4A 5EP2A 3C39A 3TQOA 2FGKA 3DHVA 1QGUA 3PC2A 5A04A 4JI4B 2QTRA 2D3TA 4KFRA 2GZAA 2FKAA 2OV4A 2VQ6A 4MR8B 3FOEC 2LKCA 5BSEA 1T3HA 4YRQA 1U2TA 1Z6PA 4HEJA 2O06A 3I04M 3DOFA 1NQUA 1FJHA 3CW8X 1QKKA 2FPKA 4DMKA 4ZYXA 3QELA 1NE7A 5G4KB 3T3PB 4Q19A 5IRCD 1JB9A 1SXJB 3HB9A 2CF5A 4QECA 4Y2VA 4YJ3A 2RKOA 4XFDA 5J4LA 2CZGA 3D1VA 2BMEA 3QYPA 4ZA2A 4BKPA 1QCZA 1BMDA 4ZVSA 1UWCA 3SE7A 4KLCA 2AOUA 2B9VA 5JCJD 1DRKA 1B8VA 3QXJA 1JDNA 4MB0A 4NULA 2RK4A 1TB4A 5EPOA 4DCNA 5IABA 3SBXA 4FSXA 1V6CA 5A1TA 1MPTA 2GBPA 2KHZA 4HDRA 4MITA 3FCOA 2WD7A 3KYDA 4RDCA 5D3MA 5ERGB 4KR3A 1HL7A 5A7GA 4QDTA 3D5QA 5EQFA 3ER8A 1PNOA 1W35A 3RWMB 1SVWA 3AP3A 3D0RA 1RRGA 5C8XA 3IAEA 1G8PA 3JY6A 2F3PA 2YWRA 3FYDA 3RS2A 1L1QA 1RD4A 5K4GA 4PHFA 3G0GA 3ZEAA 4EG8A 1NA5A 4YN3A 3IJPA 4Z99A 1P9WA 4X1KA 4Q00A 3WYNA 4DGSA 2JIBA 4IHJA 2P90A 4KXQA 2YXPX 4I9UA 2FPWA 3QUSA 4ZOCA 5FL7D 5FNVF 4RY2A 3NOOA 4CMHA 1Z0ZA 2BHLA 4RY8A 3KUUA 4KAAA 2C2KA 1DXQA 5KQSA 4RKRA 1Z37A 1L7AA 1V1RB 1N8SA 4WERA 2GNAA 3UH1A 3ONFA 3FUUA 3RSHA 3PD7A 4P08A 7REQB 1GLVA 3WQQA 2XZPA 2Y76A 4NFLA 1P45A 2XEDA 3FMVA 4IXWA 3BMCB 4M1WA 3NPAA 1E2JA 3SDZA 2Q0SA 4BB6A 1DDOA 5L6MB 1NRXA 2IQIA 4U0KA 1R18A 1E2NA 5KYWB 2WG1A 4RDHA 3BJEA 3KEOA 1MIHA 1NW5A 3PQ4A 1B0UA 4JVLA 2OMKA 1ZNYA 3HEMA 4X90A 3KE9A 3H1PA 4BN4A 2K87A 4CLXA 4EMUA 4YJKA 4GDFA 3D9QX 1O9GA 2RGGA 1AKNA 1BROA 4CEJB 4MLDA 5FOVA 1C9YA 1C14A 1XAHA 3NEPX 4KLAA 4QBTA 5D85A 1I0IA 4L8WB 2VYCA 4EENA 5JMTA 3W3AD 4C0LA 4IFBA 3CZCA 1G3MA 4RZ2A 1PZFA 1UBRS 4RHEA 5EMKA 2HMSA 4F2DA 4AM8A 5I3ZA 4M54A 1Z0SA 5F23A 3EN0A 2AWOA 3AHJA 4O4HF 1C3VA 2C8VA 2DQYA 5DDIP 3IEIA 2H7VA 2WM8A 5BORA 2HC9A 4ESHA 1RBYA 3IMCA 3ZVKA 1QGYA 2EERA 4G41A 4IGFA 3CGGA 4F6RA 1UEXC 3B7GA 3UT6A 1Z56C 3GF4A 1VG1A 4CKCB 3HJBA 3VU3A 1TYBE 1OILA 3NYIA 2Z58A 4JELA 4QO8A 1M2HA 5DWDA 5HIJA 1KORA 2CLSA 4QRDA 3M6XA 4DCPA 2P5UA 2VRNA 1MVLA 1JQEA 3BB4A 4HGQA 1F3OA 1JDPA 1V5EA 3CTPA 2ZYDA 1E99A 4GPEA 4TYQA 4RTNA 4W7HA 3R9IA 1RYZA 4IZIA 3I9V6 2IDMA 3HDQA 1SXJA 1V96A 4I9HA 5BPHA 2HYIC 2GTIA 2ZWIA 2I0FA 2ZDQA 1A8UA 3AK4A 4CM3A 3GBVA 3J7TA 5CYFA 3EDRA 3KZKA 3QE4A 4UEKA 4IUYA 3U39A 3LZ6A 1M2KA 3KC2A 1KMQA 4G56A 5G0SA 4RTLA 5L6LB 2A7QA 4DBLE 1X2EA 1ZUNB 4HZUB 1SUCA 3Q85A 2Z5GA 4ZU6X 2DLDA 3OO0A 5LYJB 1HX7A 1BQEA 3EY4A 5CVDA 1UKYA 4TMFA 2J6BA 3H2GA 4KQIA 4AMGA 2HMAA 2VTBA 1HE3A 1LS1A 3KZVA 1B4DA 4L0CA 3CX4A 4TT3D 4YMTA 2FMKA 1AZLA 5G1OA 2R1TA 3CPHA 1GRQA 5H82A 4V0NA 2C03A 4QJ5A 3F6RA 4RHXA 3SSAA 1XC7A 1V6SA 4X91A 2Y1KA 4BRWA 3HLYA 3NOVA 3CNBA 3D4OA 1I7QB 3GLKA 2ESRA 1BS9A 4F12A 1DBIA 1SD2A 4HWPA 2D1YA 2ID4A 1B14A 3AF5A 4PLPA 1JEYB 2XEXA 2BE9A 2PLNA 4ZVQA 1A7JA 1PZNA 2IZ7A 3OEED 4YQYA 5FBWB 1V0JA 4K87A 1EQUA 1HGXA 1N32B 4KRFA 1A9ZA 1ZGGA 1R2QA 3H13A 1S2LA 4QASA 3TZHA 4BB9A 1WR8A 4L4YA 4FZVA 4X1OA 2CXTA 2J3IA 3C15C 3OZDA 4AWXA 5MFZA 3FDZA 3WLTA 1VB5A 1BCSA 3QVGA 1IJFA 3QMPA 3M3PA 3MJTA 1VLVA 1OT3A 1CY4A 2QQGA 5YASA 3L7LA 3PFHA 1OB2A 2I7DA 5CFRA 1Y6JA 3EJWA 3IVAA 4IM7A 3X3HA 4XD7A 2C9BA 3FHOA 5K0JA 3V48A 3VX3A 2P5YA 3WYBA 2O6LA 5AUPB 1ZX1A 1NW9B 3GLUA 4A8JA 1DT3A 1AMNA 3H9QA 5JVDA 3I1YA 1U4OA 4CTJA 3A3OA 3SYNA 4R1PA 3TK1A 4ZARA 3OZEA 3N74A 1ZOPA 3T41A 3NIWA 4MVJD 3JARA 4BDSA 3R3YA 4INAA 3K73O 1NMZA 1DIRA 2WZQA 1UIMA 3HGQA 4M89A 3RFXA 1NSYA 1SBHA 2LXNA 4KH1A 4UFPA 3OAAD 2YRWA 2RIRA 3P8ZA 4FYVA 2ILTA 4TVKA 5A0VA 3NCHA 1E6UA 2X8AA 2ZIXB 3T4PA 3FYTA 3CVXA 3IMGA 1LTKA 2VDMB 3O8LA 4E3WA 2PEZA 4ODIA 3PCTA 2VSOA 2AYXA 5COBA 1JRLA 3EB9A 1XCPA 2J30A 4MUFA 5SICE 4MJLA 2J08A 1VLLA 2DSTA 3CISA 2R7MA 3HI4A 3T3MB 1E0JA 2ZRGA 3VDNB 1GR0A 3OEYA 3K70D 4U2DA 5G3YA 5AM5A 4D6PA 4KSCA 3VI4B 4XKJA 1R6UA 2IV2X 2GSDA 1GLNA 1Y34E 1YB7A 1WOMA 5DF1A 1P17A 1GL9B 2YJ6A 4PZDA 2IV3A 1H93A 1T9BA 5FLEX 4WLNA 3VJLA 3I8OA 1D0IA 4QICA 1GG2A 3MJFA 5DM60 4XRGA 2FR1A 3BGWA 3KWMA 3EW9A 5L7TA 3K09A 4Q0MA 3JQBC 4F2WA 3DMYA 2EFGA 5L3ZA 2ODQA 5HGJA 1Z88A 4DS3A 3DDWA 1NVUQ 2OQRA 1K2WA 2VPZA 3O38A 421PA 1EWRA 3L7YA 3F9RA 4M1TA 1S02A 4YFVA 3L0PA 5AI8A 3I5AA 5J4YA 1EUQA 5CM9C 2A92A 1RP7A 3WB1A 4A2WA 1HLDA 4DTIA 2C4KA 1E62A 4ZHQF 3WICA 2X4IA 3QPCA 1HKHA 3TNLA 5A9RA 2HA6A 1E5XA 1UKAA 1XB2A 2HT1A 1BXZA 4XZ3A 3GIWA 4AYXA 1C1DA 2V9CA 4LX0A 1HO3A 3LP5A 1EZ1A 1JB1A 4ZEWA 1Q20A 3GPDG 3TI7A 2V4ZA 2AG5A 2VF4X 4KN9S 2WFAA 3ANNA 3OX4A 1AZTA 4NV0A 2VRCA 1X1CA 2JHAA 1JW9B 2UUOA 4JYMA 2G88A 4N8DA 4D5EA 4OL0A 1R6DA 4X97A 4XIFA 2FW8A 5AKHA 4XUDA 5IXSA 4UUOA 5DIZA 2J8ZA 4BFUA 5M29A 2FPXA 2J87A 2PUHA 3O8CA 5T3YA 1UBGA 4D8VA 2Y8EA 1J8YF 3OLVA 1KZ9A 4J9VA 4BZQA 2HRZA 2OCIA 3WDMA 2XKAA 4G81A 2R6FA 3NBXX 3GP5A 2XYQA 2ZJ6A 4L5JA 3WA6A 4GFDA 3ZI0A 1DWOA 3ICCA 4FX5A 2ZE7A 1XQVA 3ZHQA 1OAKA 3IDQA 3IHTA 1GU1A 3NDJA 4N9QA 3P2EA 3IUBA 4HGPA 2IH5A 4FC7A 3VR6D 5JHHB 1O94D 3JWIA 2OK8A 3CZ5A 2PCLA 4JYAB 2PS1A 4DA4A 4F92B 2HFJA 3HO8A 2ZLBA 3HSKA 3QUQA 4L3WA 4PV7A 4ARZA 2A7XA 6LDHA 1KI6B 3EVDA 4LI3X 4Y0AA 3U5TA 2I87A 1BKYA 2NV0A 5FPQA 1A8PA 4O1IA 2BI7A 3DMDA 2GZ1A 3VZDA 2QD3A 5AHOA 3TGLA 3DZJA 2ODPA 5I9BA 1B0PA 1RS0A 3E9YA 4P4TA 4MCAA 2YWXA 4UHHA 4B71A 1G66A 4RADA 1G8KA 5GP1A 3PBKA 4LMAA 4Q9AA 5LM3A 3LT2A 1HT1E 3CVWA 3VC1A 1LPBB 3H84A 2XLBA 1U7XA 1YUNA 4H7DA 1A3CA 4S1NA 4ALIA 4JLPA 4PQRA 1T9AA 3ORRA 4KR9A 5EIFA 5KYNA 3I5YA 2B9EA 4XYMA 3ZV7A 4UOQA 4MEBA 4GLFA 2AFIA 3OIVA 1BWSA 2WIBA 4GP9A 3CE6A 1CQXA 3A9CA 4Y6SA 1G5HA 5L45A 1U8CB 2F1IA 4RZIA 1O96B 2IE8A 3CZAA 2EIHA 3TX6A 4TOIA 3B2EA 3MINB 5DM1A 2PUGA 3UF0A 3WL4A 3ZY3A 2C77A 5CYOA 1C1XB 4ZMSA 2HK6A 1I6KA 3Q3EA 3GLIB 1DAHA 1U0NA 3BDAA 3VSAA 1M6WA 1XTKA 3ER9A 2VDJA 4IFIA 3BMNA 3ELYA 2WJAA 1V4NA 2ZROA 1JIXA 1FDOA 5FD8A 5TS2A 1SUWA 1O8CA 2DTEA 4U1RA 5F35A 4M8NE 5DYTA 2PE5A 5K4AA 3G1TA 3E3MA 3KAQA 3HNPA 4Z2AA 1LI5A 1AUXA 2HBQA 3HO1A 5J1SB 1QS0A 3F7TA 1OH7A 1Y8AA 1BDHA 4ZVPA 5KHLB 2BFEA 3LVFO 1E8NA 1RPAA 2JJMA 5COQA 4N5DA 1G8JA 2IHUA 3IMKA 3LUHA 1YQDA 2D0PB 2V7GA 3EUEA 3WNCA 1IXZA 1E6WA 1NXOA 4OHBA 3I9V1 5D86A 1NMXA 4D4JA 4E13A 4EHIA 1CB7A 4LZPA 4D8UA 4JXXA 3KQSA 3BZBA 1TCVA 1BMTA 3EEQA 2VTKA 2X77A 4HG2A 5J63A 5B6IA 3WRWA 3VMMA 5CD1A 3KWFA 3AESA 5L40A 3LY9A 4TRNA 2FEAA 1ZUWA 3LP6A 4PXAA 1K8ZB 5IBPA 2OXFA 1WF6A 2P3LA 5IN5A 3GK3A 5GJVC 5BYKA 1VGVA 3VHRA 4EF6A 4M1ZA 4I6JA 5FDFA 5JZBA 4UQLA 3DVQX 1NJFA 1TLFA 4ACAA 3HCDA 4XVQA 2C0CA 2VPQA 3H2YA 2Y9MB 3WHKA 5E2IA 5J43A 4MUHA 1WV1A 4PAOA 4FHFA 4D9NA 1HZZA 2ATXA 1GYPA 1OFVA 1R8YA 3AZPA 3HRHA 3QEKA 4GP6A 1GTVA 2MR5A 4J3NA 2GEFA 3VU1A 5CFQA 1Z47A 1E3MA 3JXEA 3RYIB 1CR6A 4GPAA 2XRMA 5FBZA 3KV3O 2JIRA 2FSSA 3K0EA 3K05A 3O83A 4P54A 3UWKA 4D2IA 5T57A 1M6VB 1UJ5A 3IBGA 2CL7X 1SXQA 2FF7A 3CPJB 1IN5A 3FKQA 3HGMA 4WZAA 4GVXA 3HKEB 4GWGA 4RTQA 4B17A 1MT3A 5I7UA 2ONZA 2GI4A 4WN9A 5I8PA 4G8DA 4AECA 5JC8A 1VIAA 2Y0CA 3WYAA 1II8A 1OSNA 3TPFA 5JUWA 4CVNA 3UUWA 4F04A 4BUJA 1V48A 1EGHA 3EEYA 1N7JA 1NL3A 6Q21A 1KQ3A 3C4VA 4ITRC 2V96A 3FI0A 3RSSA 3WIOA 1GQFA 2HJWA 4QOFA 1ODCA 2BR5A 2WLTA 2XSZD 3IQGX 2EFYA 3VHLB 3OE5A 2CUKA 1L5MA 5FR1A 3EEOA 2X1VA 1Q0SA 3A6ZA 4BAUA 4C20A 4N1AA 1H2XA 1QC5A 2ATEA 1X38A 4G0OA 4RIGA 4L4ZA 3ZNNA 2BF4A 1MQAA 2AFIB 2YJ4A 4ENRA 2J7PD 1ZU5A 4DMFA 1QRAA 1K7XB 3DOEA 2DTXA 3OOEA 1M1UA 1DAPA 1GU0A 1QPGA 2GK3A 2I3BA 3GRKA 4JUCA 1KI8A 4WAUA 4GWKA 1GM5A 1KYWA 3NT4A 2ZB2A 1GPWB 4ZQEA 2C2XA 5DK6A 1P7VA 2ZVQX 4S05A 1PAUA 3H87A 4V2IA 3ZWWA 2CLEB 3EGDB 3FPCA 3AI7A 1H6AA 4Y6QA 1Z2PX 2WYWA 2AXQA 1GV0A 2ZIZA 4G86A 4HTFA 3RE1A 2N1MA 3BK2A 2O14A 2GTHA 4CYMA 1RHJA 3MD9A 1RVDA 1JP7A 3AP2A 1JDBB 3O3CA 1GAXA 1HYQA 3EVBA 2YYAA 1VMAA 4QOGA 3RIGA 5GPBA 1RWXA 1XWIA 3I45A 3RNLA 3E70C 3D6HA 4HWKA 3I8SA 1Z29A 4J2OA 5DSXA 5JWHA 5ER6A 2IYSA 3SKXA 4BGVA 4HQLA 1SUPA 1Z0IA 2WIFA 3WLAA 2A5JA 3QKIA 3IO5A 4WTOA 4QUIA 1SG9A 4A23A 2GAAA 16PKA 2JI6A 5EIBC 4Z1OA 5B36A 1ZPDA 1U2SA 1XCBA 2OLKA 3P1JA 4MWZA 1SCNE 1NBWB 3RFCA 3WGTA 1YOVB 3VO9A 1EZ4A 2XXAA 1ADYA 2KS6A 2Q8PA 1SO8A 4D9FA 3RH0A 3FFWA 4XWYA 1KNXA 2DQ4A 2PGXA 2FR8C 3B6KA 3GVXA 4ZDJA 2B0JA 4NWIA 4PZEA 1RDFA 2OUKA 4OVKA 1EWTA 3P9KA 2XJ4A 1NNUA 3D59A 2W2KA 1S4MA 4NPHA 5LB2A 1M2VA 3WKEA 2J0SA 4ZQHA 3JATB 3PL5A 1AC5A 3DAOA 3RW9A 3V4SA 1HQCA 1TZMA 3RI3A 1H9CA 2JAHA 4Q3KA 4W8OA 3DCYA 5ALZA 1I4WA 1WXFA 1QAQA 4WZ6A 1O0SA 2P6UA 2ZXEA 2GETA 3CX3A 1V16B 3HJTA 3QFFA 4G36A 4ZKEA 2PMBA 2RAPA 4FN5A 1SBYA 1Z2NX 2LP4Y 2Z08A 3JZMA 4P3XA 4UJ3A 4AG6A 4B0PA 3GEEA 4YAOA 4QHSA 1GQYA 4D3DA 2O8EA 3KO8A 1L5YA 2JFPA 3RGGA 3HSYA 1XXHB 1CUIA 2PGNA 4G26A 2R4UA 3T12A 5FUXA 3V33A 2F67A 3HDYA 4IRUB 1RZ3A 4BB0A 1UBJS 3IE0A 1DRWA 1P5HA 1ZL2A 2VDUE 2Q6TA 4O4JB 1K4KA 1GRCA 2JDID 5FYDA 3KLMX 3RYFB 2W6ID 3AIMA 3VDMA 4WK2B 1N3IA 5IHXA 1BOFA 1H5UA 2HRQA 3OIFA 3RC8A 1L5QA 1GQ2A 1QVZA 2HQOA 3TUJC 2NTVA 4WK0B 1Z5GA 3E9ZA 4GF5A 4MCIA 1AURA 4RSMA 1QK3A 3KLPX 1MX1A 4GH5A 3BQNB 1W73A 4MPTA 3GP8A 3TVYA 4FHDA 1TM4E 1NVBA 3IXMA 2V98A 4KZKA 1GNQA 1H66A 1VE5A 4K88A 3E4DA 1GTZA 3GN2A 2HK7A 1T36A 1MABB 2FZWA 2UVPB 4BQQA 1I7LA 5KQGA 2PVPA 4TL9A 5E2BA 4Q7MB 2OK7A 1E92A 1CS0B 2JD2A 2H1FA 2HRCA 1C1HA 2PWAA 4FEYA 4HCJA 5K45A 2Q1XA 2GESA 3M2PA 1QHFA 4YGYA 1W4RA 5FXMA 3U4HA 2JAXA 2XBLA 4LXQA 4XASA 2ZUEA 4RA9A 4EUSA 3LXXA 2X40A 2V6FA 2OPBA 2WDZA 3B2QA 1U98A 2I4RA 2N1BA 3RVSA 4YAIA 1PP4A 1F60A 3LCVB 3SHWA 4B5KA 1JPJA 3B9RA 3DG9A 3FGOA 2GD6A 1ZUNA 4HZUA 1XTBA 2I22A 5IVIA 1O6CA 1P3DA 2DXIA 2PX3A 4AY4A 2YKGA 1MRNA 3EWAA 4U8GA 2ZKLA 3L6UA 3LQYA 5KYYA 3ILHA 1NN0A 1P2BA 1TVKB 1JG6A 3FJYA 4UM9D 1URPA 1V41E 1XRLA 4AZTA 2FOLA 4LYEA 1VYHA 3DOIA 1PUJA 1CQPA 2GUGA 3DMPA 3FNHA 3QMMA 4QUEA 5BUZA 3K5IA 1P18A 3OCVA 4D9JA 1CIJA 1LV8A 3QMVA 2XNSA 2ASVA 2OO3A 4WOKA 4EA6A 5BO5A 4O4JF 2C4TA 1J0XO 1JIIA 1Z22A 3G9ZA 5FOTA 4WEOA 4YMUA 3TOZA 1U0TA 3MJSA 4CT0A 5I8ZA 3E9QA 1UKVY 5BN5A 5BSVA 3ROFA 3MOSA 3TIGA 3UANA 3IAM6 1DHRA 3N5CA 2JARA 3NH6A 3ENVA 3BFPA 3MWKA 1OT5A 4MLZA 4OUKX 1M2VB 5BRAA 1SHUX 1W2GA 2IEIA 3E3NA 4AO7A 3P0HA 1JBKA 3MAGA 5LWHA 4BO5A 3DXFA 4E5SA 3LJKA 5C1BA 2DWUA 3EZFA 4K9PA 5EHNA 3V55A 5DNUA 3KPYA 4Q9KA 4ZQGA 5J47A 4UXJA 1T8YA 1I9GA 2GPSA 2J9XB 2C2OA 4KE9A 3DBVO 1QTIA 1UDRA 4P86A 4KX5A 5ECGC 3R7DA 4F56A 1KEPA 1UXOA 2N75A 1I36A 3IILA 4FUTA 3O03A 3QQPA 5KYUA 5ABPA 3COYA 2E37A 4BMDA 1T8UA 4IGIA 3LWNA 3DLCA 4LDQA 3MBOA 5ICSA 1XTRA 1F1JA 4WNAB 2YNMC 1ONBA 2QTVA 3LMKA 3FGZA 1ZA2A 4NH4A 5IUKC 3U48A 2D62A 4YRAA 4K3VA 4LAFA 4CEIB 4MQUA 3VVBA 4XUEA 4KB5A 2IZOA 3MUOA 4OF4A 3CZ9A 3S5UA 1IEXA 4LJLA 3OZIA 1DTEA 3AP1A 4IKPA 2PMKA 1IAQA 3QSYA 2GPTA 1RMTA 2GZ3A 2OR3A 3GZTB 1DMRA 5GMOA 3FYCA 1IHOA 1E7WA 2VZLA 5JYBA 5KCZA 5FUMA 4A8PA 3JYOA 4MW0A 3DDNA 5JD3A 2A59A 2C31A 2OV6A 4FR2A 1G2OA 3FPAA 2XCOA 3UKOA 3G7SA 2F1OA 3FPGA 2DM6A 5D5QA 3SQOA 3L8YA 3S5JA 4CUKA 1Q1GA 4MI3A 1AQIA 1J9GA 3U81A 2CYCA 4XSGA 3Q3JB 1ZH6A 4RNDB 3SEAA 5JQGB 1YDGA 2D6FA 4OUDA 2NSHA 3E9MA 2OORA 3MTJA 1I7SB 1ZW6A 4DIBA 3QFHA 1E1CB 1C7IA 1MT0A 5DNWA 4C1BA 3ZQJA 3SXUA 3I0MA 4X1YA 3GYBA 3W90A 3AL3A 1AB5A 4PS0A 2Q21A 3PA8A 4HXEB 3LW8A 5FNZA 2BJHA 3TQTA 2UXDB 1HQYE 4Q1DA 3BXOA 4MYSA 4GT1A 1JQBA 1Y37A 3ZE2B 3MOGA 3DDUA 2Q5HA 1NUQA 2HNBA 5JSHA 3C6ZA 2VH1A 1FBTA 2BE7A 1QQ5A 1RXEA 2BR3A 2Z4SA 3CH6A 3GUCA 3KT6A 3OLYA 2LBPA 1JECA 4IJMA 4OGFA 4RJTA 1AJEA 1ORIA 1N6KA 4LXHA 5AH0A 3RR2A 1NQOA 1XVIA 2I1WA 2PO7A 3N8HA 4Q82A 4QBIA 3ROZA 1CLEA 4YT8A 2ZXFA 1TQ8A 4JEHA 2HSEA 3QVJA 4M76B 4FYMA 4B4DA 1NNI1 3WY9A 2HMUA 3G8BA 3S1AB 2H48A 5ICMA 4EF4A 1U7HA 2Z57A 2L0XA 2DQZA 3CVOA 1ZN2A 4H3SA 3EG5A 4RABA 3Q9NA 2OFWA 5CH3A 4MKHA 5DE3A 2OHGA 3RFVA 5IF9A 4TKLA 1IY0A 1UC4B 2QUJA 4QATA 5FFFA 1X6VA 4FGJA 4QUDA 3HUFA 1Z2OX 3E22B 3M3HA 1SU8A 3NV9A 3R7WA 2BHTA 3RRBA 3RWBA 2H59A 1D2AA 2Y93A 3MTAA 3WWEA 4A2PA 3DP9A 3R7LA 3QF4B 3BWMA 3WADA 4Q16A 5AW5A 5TMDA 3ABRB 4OP1A 1DXOA 1XNHA 2KPOA 2NUBA 5J2UA 4KOAA 1JWLA 1QM5A 5HGXA 1UMDA 1BHJA 2B30A 3DV2A 2D1TA 3N6XA 3W06A 4G0MA 5K8UA 3A6FA 2QF7A 1OASA 4QHYA 4JJZA 3ZN2A 1FX0A 3CVUA 3C4QA 1G60A 3QI7A 4J1TA 3FMPB 1R37A 2KI5A 3H9BA 2CT8A 2H1RA 5K0ZA 1XJ0A 4JYCA 3W1EA 5ETJA 4ED9A 2ACKA 1NUSA 2O4UX 4E7PA 3FHTA 1GNTA 1E9VA 3AIIA 4M87A 1ULAA 4RFSA 1E1MA 1OBHA 1WSWA 1ZM3A 2IP4A 2WUGA 1CRQA 4HQKA 4RS4A 5DHQA 1TUBA 1PF7E 3OFSA 5EZSA 1I2AA 1GPNA 3UC9A 3KOUA 3T5PA 4OQFA 1RBMA 2JLUA 1WXEA 3G1UA 2QXUA 2PJUA 1T6BY 2Y68A 2YWFA 3PUHA 2QTTA 2W00A 3A06A 4N0PA 3IT2A 3PPIA 4NYMR 3W8RA 1L5SA 3L41A 4EHKA 3S8MA 2JZCA 2Q5FA 4J0FA 3GELA 1O94C 4OPMA 1KNQA 2OWDA 1DKNA 4Y2UA 4HN9A 3EC2A 9LDBA 2G76A 4X3CA 3ZEIA 4PZAA 3OM1A 3T1NA 2GLTA 3SHTA 4QDOA 4HF7A