3R6HA

Crystal structure of an enoyl-coa hydratase (echa3) from mycobacterium marinum
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
228
structure length
225
Chain Sequence
b'GPVTYTHDDAIGVIRMDDGKVNVLGPTMQQALNEAIDAADRDNVGALVIAGNHRVFSGGFDLKVLTAKPAIDMLRGGFELSYRLLSYPKPVVIACTGHAIAMGAFLLCSGDHRVAAHAYNVQANEVAIGMTIPYAAMEVLKLRLTPSAYQQAAGLAKTFFGETALAAGFIDEISLPEVVLSRAEEAAREFAGLNQQAHNATKLRARAEALKAIRAGIDGIEAEFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-CoA hydratase, EchA3
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium marinum m
molecule tags Lyase
total genus 84
structure length 225
sequence length 228
ec nomenclature
pdb deposition date 2011-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3r6hA00
2VSUC 2VX2A 3H0QA 2F6IA 3H81A 5DTPA 1XO6A 1DUBA 3IBBA 2HW5A 1K39A 5CTBA 3KTHA 4KNPA 3SLLA 2BZRA 4QIJA 5G1SA 2EJ5A 3BEZA 1UYSA 2W3PA 3GF3A 1YG6A 3GMAA 3U9RB 3H02A 2A7KA 3PE8A 3Q0JA 4JOTA 3SWXA 3KTIA 5KJPA 3ZWCA 3ZWAA 1UYVA 4JFCA 2F9IA 4EMMA 3ZW9A 2CBYA 4JSBA 3G64A 4I4ZA 1RJNA 1WZ8A 2PPYA 3FDUA 3TVWA 2NP9A 5DKPA 4GHNA 2Q35A 4EMPA 1FC9A 5INGA 4FZWC 4U0GA 5DU8A 3T89A 3T88A 1XNVA 1FCFA 3TT7A 4WZ8B 1HZDA 1SG4A 4IZCA 1PJHA 4NEKA 4MOUA 4NNQA 1Y7OA 2FZSA 1XNWA 3KTKA 5KDRA 2Q2XA 2X24A 4I42A 4JYLA 2J5SA 3R6HA 4I52A 1TYFA 3R9SA 2A7SA 2QQ3A 1WDMA 3LAOA 2F9YA 2VSSF 4ZU2A 3DORA 4LK5A 2UZFA 2A81A 2DUBA 3RRVA 2IEXA 3IAVA 1Q52A 3R9TA 3KTJA 5FUSA 4ZDEA 1J7XA 3R0OA 4YLHA 2VSSE 1XNYA 2VSSA 4GM2A 4L8KA 2J5IB 3T8AA 5DTWA 2GTRA 4G2RA 5DL1A 2FBMA 3ST9A 3HINA 4B3JA 3ISAA 5IKLB 4U18A 4Z0MA 5DZKA 3STAA 3T8BA 3M6NA 3Q0GA 5JBXA 3QXZA 3U9TB 3QMJA 3R9QA 2ZL2A 4FN7A 1FC7A 4IZBA 3NJBA 4ZDDA 4ZDFA 3NJDA 5CTCA 5C90A 2CE3A 3KQFA 3HLN1 3PEAA 3PGQA 1Q51A 1XX4A 4WCZA 3QXIA 4FB8A 2PG8A 4FJWD 3K50A 4U1AA 2D3TA 5DZKH 3P2LA 3QYRA 3OT6A 4F47A 1RJMA 2C8TA 4KD6A 1N6DA 4L6WA 4HC8A 1HNUA 1SZOA 3Q1TA 3V5EA 4RYFH 3QREA 2X58A 1WDKA 5DUFA 4U19A 3HP0A 2J5II 1WDLA 1O8UA 3TRRA 1K32A 3T3WA 3MOYA 5G1QA 1NZYA 4OLQA 1ON9A 3OMEA 4EMLA 1MJ3A 5DU4A 1W2XA 4JYJA 4FN8A 3PZKA 2ZQRA 3MYBA 3H0UA 1UYRA 2F9IB 2F6QA 3IB9A 1DCIA 5JBWA 3GLMA 3JU1A 1PIXA 2VREA 4FNDA 2J5GD 1N6FA 4JJTA 3HRXA 3QKAA 4Q0GA 3MT6A 3U9SB 2J5GA 3TVUA 3Q7HA 2ZL4A 5C9GA 3BPPA 3QWDA 4KWBA 3V5IA 3ZWBA 4B3IA 4ELWA 4JCRA 3P85A 4JVTA 4MXIA 3FF6A 5E0SH 4KPKA 3RSIA 4JWVA 4RYFA 3TV5A 3I47A 3H0JA 3ZW8A 4IZDA 3GF7A 4U0HA 2VSUF 3L3SA 5DUCA 5KDRB 1EY3A 3N6RB 3RSTA 5INIA 4QFEA 3TLFA 2J5IA 2VSUE 2ZL3A 2VSUA 3BF0A 1UIYA 2F9YB 1EF9A 4ELSA 1NZYB 1VRGA 5E0NX 4Q1IA 4DI1A 3KTGA 1OD4A 4K3WA 4OG1A 4ZDCA 1JXZA 3K8XA 4JCSA 2ZQQA 3P5MA 4K29A 3TT6A 2WTBA 5INFA 3LKEA 4ASIA 1TG6A 2ZL0A 3DJAA 4HNKA 1ON3A 4OMRA 4JCTA 1YG8A 3TZ3A 3VIVA 4K2NA 1HNOA 5MGBA 4QIIA 1EF8A 4FNBA 1FC6A 2Q34A 5G1RA 3GKBA 3WG5A 5E0SA 1X0UA 3M6MA 4WYOB 4ELXA 3MFMA 2DEOA 1N6EA 3TDCA 4MI2A 3OC7A 3HE2A 4ZDBA 4B3HA 5FIFA 5DU6A 2PBPA 1OD2A 4RCNA 4JCQA 4FZWA 3QK8A 3H0SA 1UYTA 2FW2A 4U0GH
chains in the Genus database with same CATH superfamily
2VSUC 2YJGA 2VX2A 3H0QA 2F6IA 3H81A 5DTPA 1XO6A 1DUBA 3IBBA 2HW5A 1K39A 5CTBA 3KTHA 4KNPA 3SLLA 2BZRA 4QIJA 5G1SA 2EJ5A 3BEZA 4J2UA 1UYSA 2W3PA 3GF3A 1YG6A 3GMAA 3U9RB 3H02A 2A7KA 3PE8A 3Q0JA 4JOTA 3SWXA 3KTIA 5KJPA 3ZWCA 3ZWAA 1UYVA 4JFCA 2F9IA 4EMMA 3ZW9A 2CBYA 4JSBA 3G64A 4I4ZA 1RJNA 1WZ8A 2PPYA 3FDUA 3TVWA 2NP9A 5DKPA 4GHNA 2Q35A 4EMPA 1FC9A 5INGA 4FZWC 4U0GA 5DU8A 3T89A 3T88A 1XNVA 1FCFA 3TT7A 4WZ8B 1HZDA 1SG4A 4IZCA 1PJHA 4NEKA 4MOUA 4NNQA 1Y7OA 2FZSA 1XNWA 3KTKA 5KDRA 2Q2XA 2X24A 4I42A 4JYLA 2J5SA 3R6HA 4I52A 1TYFA 3R9SA 2A7SA 2QQ3A 1WDMA 3LAOA 2F9YA 2VSSF 4ZU2A 3DORA 4LK5A 2UZFA 2A81A 2DUBA 3RRVA 2IEXA 3IAVA 1Q52A 3R9TA 3KTJA 5FUSA 4ZDEA 1J7XA 3R0OA 4YLHA 2VSSE 1XNYA 2VSSA 4GM2A 4L8KA 2J5IB 3T8AA 5DTWA 2GTRA 4G2RA 5DL1A 5HUQA 2FBMA 3ST9A 3HINA 4B3JA 3ISAA 5IKLB 4U18A 4Z0MA 5DZKA 3STAA 3T8BA 3M6NA 3Q0GA 5JBXA 3QXZA 3U9TB 4NARA 3QMJA 3R9QA 2ZL2A 4FN7A 1FC7A 4IZBA 3NJBA 4ZDDA 4ZDFA 3NJDA 5CTCA 5C90A 2CE3A 3KQFA 3HLN1 3PEAA 3PGQA 1Q51A 1XX4A 4WCZA 3QXIA 3BPTA 4FB8A 2PG8A 4FJWD 3K50A 4U1AA 2D3TA 5DZKH 3P2LA 3QYRA 3OT6A 4F47A 1RJMA 2C8TA 4KD6A 1N6DA 4L6WA 4HC8A 1HNUA 1SZOA 3Q1TA 3V5EA 4RYFH 3QREA 2X58A 1WDKA 5DUFA 4U19A 3HP0A 2J5II 1WDLA 1O8UA 3TRRA 1K32A 3T3WA 3MOYA 5G1QA 1NZYA 4OLQA 1ON9A 3OMEA 4EMLA 1MJ3A 5DU4A 1W2XA 4HDTA 4JYJA 4FN8A 3PZKA 2ZQRA 3MYBA 3H0UA 1UYRA 2F9IB 2F6QA 3IB9A 1DCIA 5JBWA 3GLMA 3JU1A 1PIXA 2VREA 4FNDA 2J5GD 1N6FA 4JJTA 3HRXA 3QKAA 4Q0GA 3MT6A 3U9SB 2J5GA 3TVUA 3Q7HA 2ZL4A 5C9GA 3BPPA 3QWDA 4KWBA 3V5IA 3ZWBA 4B3IA 4ELWA 4JCRA 3P85A 4JVTA 4MXIA 3FF6A 5E0SH 4KPKA 3RSIA 4JWVA 4RYFA 3TV5A 3I47A 3H0JA 3ZW8A 4IZDA 3GF7A 4U0HA 2VSUF 3L3SA 5DUCA 5KDRB 1EY3A 3N6RB 3RSTA 5INIA 4QFEA 3TLFA 2J5IA 2VSUE 2ZL3A 2VSUA 3BF0A 1UIYA 2F9YB 1EF9A 4ELSA 1NZYB 1VRGA 5E0NX 4Q1IA 4DI1A 3KTGA 1OD4A 4K3WA 4OG1A 4ZDCA 1JXZA 3K8XA 4JCSA 2ZQQA 3P5MA 4K29A 3TT6A 2WTBA 5INFA 3LKEA 4ASIA 1TG6A 2ZL0A 3DJAA 4HNKA 1ON3A 4OMRA 4JCTA 1YG8A 3TZ3A 3VIVA 4K2NA 1HNOA 5MGBA 4QIIA 1EF8A 4FNBA 1FC6A 2Q34A 5G1RA 3GKBA 3WG5A 5E0SA 1X0UA 3M6MA 4WYOB 4ELXA 3MFMA 2DEOA 1N6EA 3TDCA 4MI2A 3OC7A 3HE2A 4ZDBA 4B3HA 5FIFA 5DU6A 2PBPA 1OD2A 4RCNA 4JCQA 4FZWA 3QK8A 3H0SA 1UYTA 2FW2A 4U0GH
chains in the Genus database with same CATH topology
2VSUC 2YJGA 2VX2A 3H0QA 2F6IA 3H81A 5DTPA 1XO6A 1DUBA 3IBBA 2HW5A 1K39A 5CTBA 3KTHA 4KNPA 3SLLA 2BZRA 4QIJA 5G1SA 2EJ5A 3BEZA 4J2UA 1UYSA 2W3PA 3GF3A 1YG6A 3GMAA 3U9RB 3H02A 2A7KA 3PE8A 3Q0JA 4JOTA 3SWXA 3KTIA 5KJPA 3ZWCA 3ZWAA 1UYVA 4JFCA 2F9IA 4EMMA 3ZW9A 2CBYA 4JSBA 3G64A 4I4ZA 1RJNA 1WZ8A 2PPYA 3FDUA 3TVWA 2NP9A 5DKPA 4GHNA 2Q35A 4EMPA 1FC9A 5INGA 4FZWC 4U0GA 5DU8A 3T89A 3T88A 1XNVA 1FCFA 3TT7A 4WZ8B 1HZDA 1SG4A 4IZCA 1PJHA 4NEKA 4MOUA 4NNQA 1Y7OA 2FZSA 1XNWA 3KTKA 5KDRA 2Q2XA 2X24A 4I42A 4JYLA 2J5SA 3R6HA 4I52A 1TYFA 3R9SA 2A7SA 2QQ3A 1WDMA 3LAOA 2F9YA 2VSSF 4ZU2A 3DORA 4LK5A 2UZFA 2A81A 2DUBA 3RRVA 2IEXA 3IAVA 1Q52A 3R9TA 3KTJA 5FUSA 4ZDEA 1J7XA 3R0OA 4YLHA 2VSSE 1XNYA 2VSSA 4GM2A 4L8KA 2J5IB 3T8AA 5DTWA 2GTRA 4G2RA 5DL1A 5HUQA 2FBMA 3ST9A 3HINA 4B3JA 3ISAA 5IKLB 4U18A 4Z0MA 5DZKA 3STAA 3T8BA 3M6NA 3Q0GA 5JBXA 3QXZA 3U9TB 4NARA 3QMJA 3R9QA 2ZL2A 4FN7A 1FC7A 4IZBA 3NJBA 4ZDDA 4ZDFA 3NJDA 5CTCA 5C90A 2CE3A 3KQFA 3HLN1 3PEAA 3PGQA 1Q51A 1XX4A 4WCZA 3QXIA 3BPTA 4FB8A 2PG8A 4FJWD 3K50A 4U1AA 2D3TA 5DZKH 3P2LA 3QYRA 3OT6A 4F47A 1RJMA 2C8TA 4KD6A 1N6DA 4L6WA 4HC8A 1HNUA 1SZOA 3Q1TA 3V5EA 4RYFH 3QREA 2X58A 1WDKA 5DUFA 4U19A 3HP0A 2J5II 1WDLA 1O8UA 3TRRA 1K32A 3T3WA 3MOYA 5G1QA 1NZYA 4OLQA 1ON9A 3OMEA 4EMLA 1MJ3A 5DU4A 1W2XA 4HDTA 4JYJA 4FN8A 3PZKA 2ZQRA 3MYBA 3H0UA 1UYRA 2F9IB 2F6QA 3IB9A 1DCIA 5JBWA 3GLMA 3JU1A 1PIXA 2VREA 4FNDA 2J5GD 1N6FA 4JJTA 3HRXA 3QKAA 4Q0GA 3MT6A 3U9SB 2J5GA 3TVUA 3Q7HA 2ZL4A 5C9GA 3BPPA 3QWDA 4KWBA 3V5IA 3ZWBA 4B3IA 4ELWA 4JCRA 3P85A 4JVTA 4MXIA 3FF6A 5E0SH 4KPKA 3RSIA 4JWVA 4RYFA 3TV5A 3I47A 3H0JA 3ZW8A 4IZDA 3GF7A 4U0HA 2VSUF 3L3SA 5DUCA 5KDRB 1EY3A 3N6RB 3RSTA 5INIA 4QFEA 3TLFA 2J5IA 2VSUE 2ZL3A 2VSUA 3BF0A 1UIYA 2F9YB 1EF9A 4ELSA 1NZYB 1VRGA 5E0NX 4Q1IA 4DI1A 3KTGA 1OD4A 4K3WA 4OG1A 4ZDCA 1JXZA 3K8XA 4JCSA 2ZQQA 3P5MA 4K29A 3TT6A 2WTBA 5INFA 3LKEA 4ASIA 1TG6A 2ZL0A 3DJAA 4HNKA 1ON3A 4OMRA 4JCTA 1YG8A 3TZ3A 3VIVA 4K2NA 1HNOA 5MGBA 4QIIA 1EF8A 4FNBA 1FC6A 2Q34A 5G1RA 3GKBA 3WG5A 5E0SA 1X0UA 3M6MA 4WYOB 4ELXA 3MFMA 2DEOA 1N6EA 3TDCA 4MI2A 3OC7A 3HE2A 4ZDBA 4B3HA 5FIFA 5DU6A 2PBPA 1OD2A 4RCNA 4JCQA 4FZWA 3QK8A 3H0SA 1UYTA 2FW2A 4U0GH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSU C;  2VX2 A;  3H0Q A;  2F6I A;  3H81 A;  5DTP A;  1XO6 A;  1DUB A;  3IBB A;  2HW5 A;  1K39 A;  5CTB A;  3KTH A;  4KNP A;  3SLL A;  2BZR A;  4QIJ A;  5G1S A;  2EJ5 A;  3BEZ A;  1UYS A;  2W3P A;  3GF3 A;  1YG6 A;  3GMA A;  3U9R B;  3H02 A;  2A7K A;  3PE8 A;  3Q0J A;  4JOT A;  3SWX A;  3KTI A;  5KJP A;  3ZWC A;  3ZWA A;  1UYV A;  4JFC A;  2F9I A;  4EMM A;  3ZW9 A;  2CBY A;  4JSB A;  3G64 A;  4I4Z A;  1RJN A;  1WZ8 A;  2PPY A;  3FDU A;  3TVW A;  2NP9 A;  5DKP A;  4GHN A;  2Q35 A;  4EMP A;  1FC9 A;  5ING A;  4FZW C;  4U0G A;  5DU8 A;  3T89 A;  3T88 A;  1XNV A;  1FCF A;  3TT7 A;  4WZ8 B;  1HZD A;  1SG4 A;  4IZC A;  1PJH A;  4NEK A;  4MOU A;  4NNQ A;  1Y7O A;  2FZS A;  1XNW A;  3KTK A;  5KDR A;  2Q2X A;  2X24 A;  4I42 A;  4JYL A;  2J5S A;  3R6H A;  4I52 A;  1TYF A;  3R9S A;  2A7S A;  2QQ3 A;  1WDM A;  3LAO A;  2F9Y A;  2VSS F;  4ZU2 A;  3DOR A;  4LK5 A;  2UZF A;  2A81 A;  2DUB A;  3RRV A;  2IEX A;  3IAV A;  1Q52 A;  3R9T A;  3KTJ A;  5FUS A;  4ZDE A;  1J7X A;  3R0O A;  4YLH A;  2VSS E;  1XNY A;  2VSS A;  4GM2 A;  4L8K A;  2J5I B;  3T8A A;  5DTW A;  2GTR A;  4G2R A;  5DL1 A;  2FBM A;  3ST9 A;  3HIN A;  4B3J A;  3ISA A;  5IKL B;  4U18 A;  4Z0M A;  5DZK A;  3STA A;  3T8B A;  3M6N A;  3Q0G A;  5JBX A;  3QXZ A;  3U9T B;  3QMJ A;  3R9Q A;  2ZL2 A;  4FN7 A;  1FC7 A;  4IZB A;  3NJB A;  4ZDD A;  4ZDF A;  3NJD A;  5CTC A;  5C90 A;  2CE3 A;  3KQF A;  3HLN 1;  3PEA A;  3PGQ A;  1Q51 A;  1XX4 A;  4WCZ A;  3QXI A;  4FB8 A;  2PG8 A;  4FJW D;  3K50 A;  4U1A A;  2D3T A;  5DZK H;  3P2L A;  3QYR A;  3OT6 A;  4F47 A;  1RJM A;  2C8T A;  4KD6 A;  1N6D A;  4L6W A;  4HC8 A;  1HNU A;  1SZO A;  3Q1T A;  3V5E A;  4RYF H;  3QRE A;  2X58 A;  1WDK A;  5DUF A;  4U19 A;  3HP0 A;  2J5I I;  1WDL A;  1O8U A;  3TRR A;  1K32 A;  3T3W A;  3MOY A;  5G1Q A;  1NZY A;  4OLQ A;  1ON9 A;  3OME A;  4EML A;  1MJ3 A;  5DU4 A;  1W2X A;  4JYJ A;  4FN8 A;  3PZK A;  2ZQR A;  3MYB A;  3H0U A;  1UYR A;  2F9I B;  2F6Q A;  3IB9 A;  1DCI A;  5JBW A;  3GLM A;  3JU1 A;  1PIX A;  2VRE A;  4FND A;  2J5G D;  1N6F A;  4JJT A;  3HRX A;  3QKA A;  4Q0G A;  3MT6 A;  3U9S B;  2J5G A;  3TVU A;  3Q7H A;  2ZL4 A;  5C9G A;  3BPP A;  3QWD A;  4KWB A;  3V5I A;  3ZWB A;  4B3I A;  4ELW A;  4JCR A;  3P85 A;  4JVT A;  4MXI A;  3FF6 A;  5E0S H;  4KPK A;  3RSI A;  4JWV A;  4RYF A;  3TV5 A;  3I47 A;  3H0J A;  3ZW8 A;  4IZD A;  3GF7 A;  4U0H A;  2VSU F;  3L3S A;  5DUC A;  5KDR B;  1EY3 A;  3N6R B;  3RST A;  5INI A;  4QFE A;  3TLF A;  2J5I A;  2VSU E;  2ZL3 A;  2VSU A;  3BF0 A;  1UIY A;  2F9Y B;  1EF9 A;  4ELS A;  1NZY B;  1VRG A;  5E0N X;  4Q1I A;  4DI1 A;  3KTG A;  1OD4 A;  4K3W A;  4OG1 A;  4ZDC A;  1JXZ A;  3K8X A;  4JCS A;  2ZQQ A;  3P5M A;  4K29 A;  3TT6 A;  2WTB A;  5INF A;  3LKE A;  4ASI A;  1TG6 A;  2ZL0 A;  3DJA A;  4HNK A;  1ON3 A;  4OMR A;  4JCT A;  1YG8 A;  3TZ3 A;  3VIV A;  4K2N A;  1HNO A;  5MGB A;  4QII A;  1EF8 A;  4FNB A;  1FC6 A;  2Q34 A;  5G1R A;  3GKB A;  3WG5 A;  5E0S A;  1X0U A;  3M6M A;  4WYO B;  4ELX A;  3MFM A;  2DEO A;  1N6E A;  3TDC A;  4MI2 A;  3OC7 A;  3HE2 A;  4ZDB A;  4B3H A;  5FIF A;  5DU6 A;  2PBP A;  1OD2 A;  4RCN A;  4JCQ A;  4FZW A;  3QK8 A;  3H0S A;  1UYT A;  2FW2 A;  4U0G H; 
#chains in the Genus database with same CATH topology
 2VSU C;  2YJG A;  2VX2 A;  3H0Q A;  2F6I A;  3H81 A;  5DTP A;  1XO6 A;  1DUB A;  3IBB A;  2HW5 A;  1K39 A;  5CTB A;  3KTH A;  4KNP A;  3SLL A;  2BZR A;  4QIJ A;  5G1S A;  2EJ5 A;  3BEZ A;  4J2U A;  1UYS A;  2W3P A;  3GF3 A;  1YG6 A;  3GMA A;  3U9R B;  3H02 A;  2A7K A;  3PE8 A;  3Q0J A;  4JOT A;  3SWX A;  3KTI A;  5KJP A;  3ZWC A;  3ZWA A;  1UYV A;  4JFC A;  2F9I A;  4EMM A;  3ZW9 A;  2CBY A;  4JSB A;  3G64 A;  4I4Z A;  1RJN A;  1WZ8 A;  2PPY A;  3FDU A;  3TVW A;  2NP9 A;  5DKP A;  4GHN A;  2Q35 A;  4EMP A;  1FC9 A;  5ING A;  4FZW C;  4U0G A;  5DU8 A;  3T89 A;  3T88 A;  1XNV A;  1FCF A;  3TT7 A;  4WZ8 B;  1HZD A;  1SG4 A;  4IZC A;  1PJH A;  4NEK A;  4MOU A;  4NNQ A;  1Y7O A;  2FZS A;  1XNW A;  3KTK A;  5KDR A;  2Q2X A;  2X24 A;  4I42 A;  4JYL A;  2J5S A;  3R6H A;  4I52 A;  1TYF A;  3R9S A;  2A7S A;  2QQ3 A;  1WDM A;  3LAO A;  2F9Y A;  2VSS F;  4ZU2 A;  3DOR A;  4LK5 A;  2UZF A;  2A81 A;  2DUB A;  3RRV A;  2IEX A;  3IAV A;  1Q52 A;  3R9T A;  3KTJ A;  5FUS A;  4ZDE A;  1J7X A;  3R0O A;  4YLH A;  2VSS E;  1XNY A;  2VSS A;  4GM2 A;  4L8K A;  2J5I B;  3T8A A;  5DTW A;  2GTR A;  4G2R A;  5DL1 A;  5HUQ A;  2FBM A;  3ST9 A;  3HIN A;  4B3J A;  3ISA A;  5IKL B;  4U18 A;  4Z0M A;  5DZK A;  3STA A;  3T8B A;  3M6N A;  3Q0G A;  5JBX A;  3QXZ A;  3U9T B;  4NAR A;  3QMJ A;  3R9Q A;  2ZL2 A;  4FN7 A;  1FC7 A;  4IZB A;  3NJB A;  4ZDD A;  4ZDF A;  3NJD A;  5CTC A;  5C90 A;  2CE3 A;  3KQF A;  3HLN 1;  3PEA A;  3PGQ A;  1Q51 A;  1XX4 A;  4WCZ A;  3QXI A;  3BPT A;  4FB8 A;  2PG8 A;  4FJW D;  3K50 A;  4U1A A;  2D3T A;  5DZK H;  3P2L A;  3QYR A;  3OT6 A;  4F47 A;  1RJM A;  2C8T A;  4KD6 A;  1N6D A;  4L6W A;  4HC8 A;  1HNU A;  1SZO A;  3Q1T A;  3V5E A;  4RYF H;  3QRE A;  2X58 A;  1WDK A;  5DUF A;  4U19 A;  3HP0 A;  2J5I I;  1WDL A;  1O8U A;  3TRR A;  1K32 A;  3T3W A;  3MOY A;  5G1Q A;  1NZY A;  4OLQ A;  1ON9 A;  3OME A;  4EML A;  1MJ3 A;  5DU4 A;  1W2X A;  4HDT A;  4JYJ A;  4FN8 A;  3PZK A;  2ZQR A;  3MYB A;  3H0U A;  1UYR A;  2F9I B;  2F6Q A;  3IB9 A;  1DCI A;  5JBW A;  3GLM A;  3JU1 A;  1PIX A;  2VRE A;  4FND A;  2J5G D;  1N6F A;  4JJT A;  3HRX A;  3QKA A;  4Q0G A;  3MT6 A;  3U9S B;  2J5G A;  3TVU A;  3Q7H A;  2ZL4 A;  5C9G A;  3BPP A;  3QWD A;  4KWB A;  3V5I A;  3ZWB A;  4B3I A;  4ELW A;  4JCR A;  3P85 A;  4JVT A;  4MXI A;  3FF6 A;  5E0S H;  4KPK A;  3RSI A;  4JWV A;  4RYF A;  3TV5 A;  3I47 A;  3H0J A;  3ZW8 A;  4IZD A;  3GF7 A;  4U0H A;  2VSU F;  3L3S A;  5DUC A;  5KDR B;  1EY3 A;  3N6R B;  3RST A;  5INI A;  4QFE A;  3TLF A;  2J5I A;  2VSU E;  2ZL3 A;  2VSU A;  3BF0 A;  1UIY A;  2F9Y B;  1EF9 A;  4ELS A;  1NZY B;  1VRG A;  5E0N X;  4Q1I A;  4DI1 A;  3KTG A;  1OD4 A;  4K3W A;  4OG1 A;  4ZDC A;  1JXZ A;  3K8X A;  4JCS A;  2ZQQ A;  3P5M A;  4K29 A;  3TT6 A;  2WTB A;  5INF A;  3LKE A;  4ASI A;  1TG6 A;  2ZL0 A;  3DJA A;  4HNK A;  1ON3 A;  4OMR A;  4JCT A;  1YG8 A;  3TZ3 A;  3VIV A;  4K2N A;  1HNO A;  5MGB A;  4QII A;  1EF8 A;  4FNB A;  1FC6 A;  2Q34 A;  5G1R A;  3GKB A;  3WG5 A;  5E0S A;  1X0U A;  3M6M A;  4WYO B;  4ELX A;  3MFM A;  2DEO A;  1N6E A;  3TDC A;  4MI2 A;  3OC7 A;  3HE2 A;  4ZDB A;  4B3H A;  5FIF A;  5DU6 A;  2PBP A;  1OD2 A;  4RCN A;  4JCQ A;  4FZW A;  3QK8 A;  3H0S A;  1UYT A;  2FW2 A;  4U0G H; 
#chains in the Genus database with same CATH homology
 2VSU C;  2YJG A;  2VX2 A;  3H0Q A;  2F6I A;  3H81 A;  5DTP A;  1XO6 A;  1DUB A;  3IBB A;  2HW5 A;  1K39 A;  5CTB A;  3KTH A;  4KNP A;  3SLL A;  2BZR A;  4QIJ A;  5G1S A;  2EJ5 A;  3BEZ A;  4J2U A;  1UYS A;  2W3P A;  3GF3 A;  1YG6 A;  3GMA A;  3U9R B;  3H02 A;  2A7K A;  3PE8 A;  3Q0J A;  4JOT A;  3SWX A;  3KTI A;  5KJP A;  3ZWC A;  3ZWA A;  1UYV A;  4JFC A;  2F9I A;  4EMM A;  3ZW9 A;  2CBY A;  4JSB A;  3G64 A;  4I4Z A;  1RJN A;  1WZ8 A;  2PPY A;  3FDU A;  3TVW A;  2NP9 A;  5DKP A;  4GHN A;  2Q35 A;  4EMP A;  1FC9 A;  5ING A;  4FZW C;  4U0G A;  5DU8 A;  3T89 A;  3T88 A;  1XNV A;  1FCF A;  3TT7 A;  4WZ8 B;  1HZD A;  1SG4 A;  4IZC A;  1PJH A;  4NEK A;  4MOU A;  4NNQ A;  1Y7O A;  2FZS A;  1XNW A;  3KTK A;  5KDR A;  2Q2X A;  2X24 A;  4I42 A;  4JYL A;  2J5S A;  3R6H A;  4I52 A;  1TYF A;  3R9S A;  2A7S A;  2QQ3 A;  1WDM A;  3LAO A;  2F9Y A;  2VSS F;  4ZU2 A;  3DOR A;  4LK5 A;  2UZF A;  2A81 A;  2DUB A;  3RRV A;  2IEX A;  3IAV A;  1Q52 A;  3R9T A;  3KTJ A;  5FUS A;  4ZDE A;  1J7X A;  3R0O A;  4YLH A;  2VSS E;  1XNY A;  2VSS A;  4GM2 A;  4L8K A;  2J5I B;  3T8A A;  5DTW A;  2GTR A;  4G2R A;  5DL1 A;  5HUQ A;  2FBM A;  3ST9 A;  3HIN A;  4B3J A;  3ISA A;  5IKL B;  4U18 A;  4Z0M A;  5DZK A;  3STA A;  3T8B A;  3M6N A;  3Q0G A;  5JBX A;  3QXZ A;  3U9T B;  4NAR A;  3QMJ A;  3R9Q A;  2ZL2 A;  4FN7 A;  1FC7 A;  4IZB A;  3NJB A;  4ZDD A;  4ZDF A;  3NJD A;  5CTC A;  5C90 A;  2CE3 A;  3KQF A;  3HLN 1;  3PEA A;  3PGQ A;  1Q51 A;  1XX4 A;  4WCZ A;  3QXI A;  3BPT A;  4FB8 A;  2PG8 A;  4FJW D;  3K50 A;  4U1A A;  2D3T A;  5DZK H;  3P2L A;  3QYR A;  3OT6 A;  4F47 A;  1RJM A;  2C8T A;  4KD6 A;  1N6D A;  4L6W A;  4HC8 A;  1HNU A;  1SZO A;  3Q1T A;  3V5E A;  4RYF H;  3QRE A;  2X58 A;  1WDK A;  5DUF A;  4U19 A;  3HP0 A;  2J5I I;  1WDL A;  1O8U A;  3TRR A;  1K32 A;  3T3W A;  3MOY A;  5G1Q A;  1NZY A;  4OLQ A;  1ON9 A;  3OME A;  4EML A;  1MJ3 A;  5DU4 A;  1W2X A;  4HDT A;  4JYJ A;  4FN8 A;  3PZK A;  2ZQR A;  3MYB A;  3H0U A;  1UYR A;  2F9I B;  2F6Q A;  3IB9 A;  1DCI A;  5JBW A;  3GLM A;  3JU1 A;  1PIX A;  2VRE A;  4FND A;  2J5G D;  1N6F A;  4JJT A;  3HRX A;  3QKA A;  4Q0G A;  3MT6 A;  3U9S B;  2J5G A;  3TVU A;  3Q7H A;  2ZL4 A;  5C9G A;  3BPP A;  3QWD A;  4KWB A;  3V5I A;  3ZWB A;  4B3I A;  4ELW A;  4JCR A;  3P85 A;  4JVT A;  4MXI A;  3FF6 A;  5E0S H;  4KPK A;  3RSI A;  4JWV A;  4RYF A;  3TV5 A;  3I47 A;  3H0J A;  3ZW8 A;  4IZD A;  3GF7 A;  4U0H A;  2VSU F;  3L3S A;  5DUC A;  5KDR B;  1EY3 A;  3N6R B;  3RST A;  5INI A;  4QFE A;  3TLF A;  2J5I A;  2VSU E;  2ZL3 A;  2VSU A;  3BF0 A;  1UIY A;  2F9Y B;  1EF9 A;  4ELS A;  1NZY B;  1VRG A;  5E0N X;  4Q1I A;  4DI1 A;  3KTG A;  1OD4 A;  4K3W A;  4OG1 A;  4ZDC A;  1JXZ A;  3K8X A;  4JCS A;  2ZQQ A;  3P5M A;  4K29 A;  3TT6 A;  2WTB A;  5INF A;  3LKE A;  4ASI A;  1TG6 A;  2ZL0 A;  3DJA A;  4HNK A;  1ON3 A;  4OMR A;  4JCT A;  1YG8 A;  3TZ3 A;  3VIV A;  4K2N A;  1HNO A;  5MGB A;  4QII A;  1EF8 A;  4FNB A;  1FC6 A;  2Q34 A;  5G1R A;  3GKB A;  3WG5 A;  5E0S A;  1X0U A;  3M6M A;  4WYO B;  4ELX A;  3MFM A;  2DEO A;  1N6E A;  3TDC A;  4MI2 A;  3OC7 A;  3HE2 A;  4ZDB A;  4B3H A;  5FIF A;  5DU6 A;  2PBP A;  1OD2 A;  4RCN A;  4JCQ A;  4FZW A;  3QK8 A;  3H0S A;  1UYT A;  2FW2 A;  4U0G H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...