3R6PA

Crystal structure of abscisic acid-bound pyl10
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
154
structure length
154
Chain Sequence
SQCSSTLVKHIKAPLHLVWSIVRRFDEPQKYKPFISRCVVQGKKLEVGSVREVDLKSGLPATKSTEVLEILDDNEHILGIRIVGGDHRLKNYSSTISLHSETIDGKTGTLAIESFVVDVPEGNTKEETCFFVEALIQCNLNSLADVTERLQAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Abscisic acid receptor PYL10
publication title Crystal structure of abscisic acid-bound PYL10
rcsb
source organism Arabidopsis thaliana
molecule tags Hormone receptor
total genus 43
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10604 Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 3r6pA00
3Q63A 2E3MA 5C9YA 2LF2A 2VQ5A 1XUVA 3RD6A 4C9CA 2LDKA 4N0GC 1EM2A 3NR4A 3NMTA 2LCGA 3ZVUA 1IFVA 3P9VA 2LIOA 4JHIA 2E3RA 2E3QA 4JHGA 3NMHA 3P0LA 1FSKA 2FLHA 1TXCA 1XN6A 3OQUA 1LN2A 4GY9A 5JO1A 2M47A 3NJ0A 2KF2A 4N3EA 1B6FA 3UQHA 2N4AA 4IHRA 2K5GA 2E3PA 4R7KA 2LPXA 4DSBA 3W9KA 2EJXA 4C94A 3KDIA 3UJLA 4B9RA 2NN5A 4MAPA 1LN3A 3NEFA 1H2OA 1LLTA 3PU2A 4M9BA 4RYVA 4IGXA 2N4BA 3NMPA 4A84A 4PSBA 5BRLA 2E3SA 2LUZA 3JRSA 4XRTA 1T17A 3NJOA 2REZA 4JDLA 1E09A 2LE1A 4REJA 3K90A 1XN5A 2GKDA 2LAKA 2A1LA 3R6PA 3K3KA 2D4RA 4LGAA 2BK0A 2IL5A 4DS8A 3H3QA 1ZXFA 3KDHA 2KCZA 2KTEA 3H3RA 4LGBA 2E3OA 3KLXA 3IE5A 3KDJA 3NMNA 4IH0A 4BKDA 3TFZA 4Q0KA 1X53A 2QIMA 4IGWA 4IGVA 1TW0A 1UW5A 5JO2A 4C9IA 5E4MA 4MNSA 1JSSA 3F08A 1ICXA 3KAYA 2L9PA 3NEGA 4BK7A 3ELIA 4A8GA 4A83A 1FM4A 4A88A 1XFSA 3KB0A 1LN1A 4REIA 2RESA 4A81A 3Q64A 2PSOA 1BV1A 3OJIA 4JDAA 3PUTA 5E46A 3RT2A 3WG8A 4A85A 4Z3LA 5I8FA 4XRWA 2VNEA 2LEQA 4BTZA 4A80A 5E4DA 2K7HA 3CNWA 4JHHA 1VJHA 4WVOA 4IH2A 3H3TA 2PCSA 3UIDA 3TVRA 2FFSA 4OICA 3GGNA 2KEWA 3NJ1A 5AMWA 3QSZA 1XDFA 3KAZA 2E3NA 4QIPA 2L65A 1KCMA 1T27A 2Z9YA 3Q6AA 3TL1A 3JRQB 3NMVA 2L8OA 4LA7A 1QMRA 2LGHA 4BKCA 2Q3QA 4REHA 3IJTA 3E85A 3KB3A 1BTVA 3OTLA 2QPVA 3P51A 1Z94A 2I9YA 5E4BA 4M9WA 3NS2A 4MA6A 2WQLA 3QN1A 3NI8A 4DSCA 2NS9A 4A8UA 4A86A 4FPWA 3W9RA 3FO5A 2RERA 3OH8A 4A87A 3RT0C 3TVQA 2R55A 4A8VA 5JNNA 3KL1A 3H3SA 2MOUA 5I9JA 3C0VA 4Y31A 4IGYA 4LG5A 2M89A 2Z9ZA 4BK6A
chains in the Genus database with same CATH superfamily
3Q63A 2E3MA 5C9YA 2LF2A 2VQ5A 1XUVA 4N47A 3RD6A 4C9CA 2LDKA 4N0GC 3TGOC 1EM2A 3NR4A 3DLBA 3NMTA 2LCGA 3ZVUA 1IFVA 3P9VA 2LIOA 4JHIA 2E3RA 2E3QA 4JHGA 3NMHA 3P0LA 4NCBA 3HM9A 1FSKA 2FLHA 1TXCA 1XN6A 3OQUA 1LN2A 4GY9A 5JO1A 2M47A 4N41A 3NJ0A 2KF2A 4N3EA 1B6FA 3UQHA 2N4AA 4IHRA 2K5GA 2E3PA 4R7KA 2LPXA 4QDFA 4DSBA 3W9KA 2EJXA 4C94A 3KDIA 3UJLA 4B9RA 2NN5A 4MAPA 1LN3A 3NEFA 1H2OA 1LLTA 3PU2A 4M9BA 4RYVA 4IGXA 2N4BA 3NMPA 4A84A 4PSBA 5BRLA 2E3SA 2LUZA 3JRSA 3DLHA 3GTSA 4XRTA 3GOBA 1T17A 3NJOA 3HXMA 2REZA 4JHYA 4JDLA 4QDDA 2LAFA 1E09A 2LE1A 4REJA 3K90A 1XN5A 4QDFB 2GKDA 2LAKA 2A1LA 3R6PA 3K3KA 2D4RA 2ZYLA 4LGAA 2BK0A 2IL5A 4DS8A 3H3QA 1ZXFA 3KDHA 3HJFA 2KCZA 2KTEA 3H3RA 4LGBA 2E3OA 3KLXA 3IE5A 3KDJA 3NMNA 4IH0A 4BKDA 3TFZA 4Q0KA 1X53A 2QIMA 4IGWA 4IGVA 1TW0A 1UW5A 5JO2A 4C9IA 5E4MA 4MNSA 1JSSA 3F08A 1ICXA 3KAYA 2L9PA 3NEGA 4BK7A 3ELIA 4A8GA 4A83A 1FM4A 4A88A 3GL2A 4KPYA 1XFSA 3KB0A 3HO1A 1LN1A 4REIA 2RESA 4A81A 3HVRA 3Q64A 2PSOA 1BV1A 3OJIA 4JDAA 3PUTA 5E46A 3RT2A 3WG8A 4A85A 4Z3LA 5I8FA 4XRWA 2VNEA 2LEQA 4BTZA 4A80A 5E4DA 2K7HA 3CNWA 4JHHA 1VJHA 4WVOA 4IH2A 3H3TA 2PCSA 3UIDA 3TVRA 2FFSA 4OICA 3GGNA 2KEWA 3NJ1A 5AMWA 2YH6A 3GB4A 3NQNA 4QCKA 3QSZA 1XDFA 3KAZA 2E3NA 4QIPA 3HK2A 2L65A 1KCMA 1T27A 2Z9YA 3GTEA 3Q6AA 3JRQB 3TL1A 3NMVA 2L8OA 4LA7A 1QMRA 3F73A 2LGHA 4BKCA 4E6FA 2Q3QA 4REHA 3IJTA 3E85A 3KB3A 1BTVA 3OTLA 2QPVA 3P51A 1Z94A 2I9YA 5E4BA 4M9WA 3NS2A 5EKQC 4MA6A 2WQLA 3QN1A 3NI8A 4QDCA 4DSCA 2NS9A 4A8UA 4A86A 3GKEA 4FPWA 3W9RA 3FO5A 2RERA 3OH8A 4A87A 3RT0C 4N76A 3TVQA 2R55A 4A8VA 5JNNA 3KL1A 4NCAA 3H3SA 2MOUA 5I9JA 3C0VA 4Y31A 4IGYA 4LG5A 3GL0A 2M89A 2Z9ZA 4BK6A
chains in the Genus database with same CATH topology
3Q63A 2E3MA 5C9YA 2LF2A 2VQ5A 1XUVA 4N47A 3RD6A 4C9CA 2LDKA 4N0GC 3TGOC 1EM2A 3NR4A 3DLBA 3NMTA 2LCGA 3ZVUA 1IFVA 3P9VA 2LIOA 4JHIA 2E3RA 2E3QA 4JHGA 3NMHA 3P0LA 4NCBA 3HM9A 1FSKA 2FLHA 1TXCA 1XN6A 3OQUA 1LN2A 4GY9A 5JO1A 2M47A 4N41A 3NJ0A 2KF2A 4N3EA 1B6FA 3UQHA 2N4AA 4IHRA 2K5GA 2E3PA 4R7KA 2LPXA 4QDFA 4DSBA 3W9KA 2EJXA 4C94A 3KDIA 3UJLA 4B9RA 2NN5A 4MAPA 1LN3A 3NEFA 1H2OA 1LLTA 3PU2A 4M9BA 4RYVA 4IGXA 2N4BA 3NMPA 4A84A 4PSBA 5BRLA 2E3SA 2LUZA 3JRSA 3DLHA 3GTSA 4XRTA 3GOBA 1T17A 3NJOA 3HXMA 2REZA 4JHYA 4JDLA 4QDDA 2LAFA 1E09A 2LE1A 4REJA 3K90A 1XN5A 4QDFB 2GKDA 2LAKA 2A1LA 3R6PA 3K3KA 2D4RA 2ZYLA 4LGAA 2BK0A 2IL5A 4DS8A 3H3QA 1ZXFA 3KDHA 3HJFA 2KCZA 2KTEA 3H3RA 4LGBA 2E3OA 3KLXA 3IE5A 3KDJA 3NMNA 4IH0A 4BKDA 3TFZA 4Q0KA 1X53A 2QIMA 4IGWA 4IGVA 1TW0A 1UW5A 5JO2A 4C9IA 5E4MA 4MNSA 1JSSA 3F08A 1ICXA 3KAYA 2L9PA 3NEGA 4BK7A 3ELIA 4A8GA 4A83A 1FM4A 4A88A 3GL2A 4KPYA 1XFSA 3KB0A 3HO1A 1LN1A 4REIA 2RESA 4A81A 3HVRA 3Q64A 2PSOA 1BV1A 3OJIA 4JDAA 3PUTA 5E46A 3RT2A 3WG8A 4A85A 4Z3LA 5I8FA 4XRWA 2VNEA 2LEQA 4BTZA 4A80A 5E4DA 2K7HA 3CNWA 4JHHA 1VJHA 4WVOA 4IH2A 3H3TA 2PCSA 3UIDA 3TVRA 2FFSA 4OICA 3GGNA 2KEWA 3NJ1A 5AMWA 2YH6A 3GB4A 3NQNA 4QCKA 3QSZA 1XDFA 3KAZA 2E3NA 4QIPA 3HK2A 2L65A 1KCMA 1T27A 2Z9YA 3GTEA 3Q6AA 3JRQB 3TL1A 3NMVA 2L8OA 4LA7A 1QMRA 3F73A 2LGHA 4BKCA 4E6FA 2Q3QA 4REHA 3IJTA 3E85A 3KB3A 1BTVA 3OTLA 2QPVA 3P51A 1Z94A 2I9YA 5E4BA 4M9WA 3NS2A 5EKQC 4MA6A 2WQLA 3QN1A 3NI8A 4QDCA 4DSCA 2NS9A 4A8UA 4A86A 3GKEA 4FPWA 3W9RA 3FO5A 2RERA 3OH8A 4A87A 3RT0C 4N76A 3TVQA 2R55A 4A8VA 5JNNA 3KL1A 4NCAA 3H3SA 2MOUA 5I9JA 3C0VA 4Y31A 4IGYA 4LG5A 3GL0A 2M89A 2Z9ZA 4BK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q63 A;  2E3M A;  5C9Y A;  2LF2 A;  2VQ5 A;  1XUV A;  3RD6 A;  4C9C A;  2LDK A;  4N0G C;  1EM2 A;  3NR4 A;  3NMT A;  2LCG A;  3ZVU A;  1IFV A;  3P9V A;  2LIO A;  4JHI A;  2E3R A;  2E3Q A;  4JHG A;  3NMH A;  3P0L A;  1FSK A;  2FLH A;  1TXC A;  1XN6 A;  3OQU A;  1LN2 A;  4GY9 A;  5JO1 A;  2M47 A;  3NJ0 A;  2KF2 A;  4N3E A;  1B6F A;  3UQH A;  2N4A A;  4IHR A;  2K5G A;  2E3P A;  4R7K A;  2LPX A;  4DSB A;  3W9K A;  2EJX A;  4C94 A;  3KDI A;  3UJL A;  4B9R A;  2NN5 A;  4MAP A;  1LN3 A;  3NEF A;  1H2O A;  1LLT A;  3PU2 A;  4M9B A;  4RYV A;  4IGX A;  2N4B A;  3NMP A;  4A84 A;  4PSB A;  5BRL A;  2E3S A;  2LUZ A;  3JRS A;  4XRT A;  1T17 A;  3NJO A;  2REZ A;  4JDL A;  1E09 A;  2LE1 A;  4REJ A;  3K90 A;  1XN5 A;  2GKD A;  2LAK A;  2A1L A;  3R6P A;  3K3K A;  2D4R A;  4LGA A;  2BK0 A;  2IL5 A;  4DS8 A;  3H3Q A;  1ZXF A;  3KDH A;  2KCZ A;  2KTE A;  3H3R A;  4LGB A;  2E3O A;  3KLX A;  3IE5 A;  3KDJ A;  3NMN A;  4IH0 A;  4BKD A;  3TFZ A;  4Q0K A;  1X53 A;  2QIM A;  4IGW A;  4IGV A;  1TW0 A;  1UW5 A;  5JO2 A;  4C9I A;  5E4M A;  4MNS A;  1JSS A;  3F08 A;  1ICX A;  3KAY A;  2L9P A;  3NEG A;  4BK7 A;  3ELI A;  4A8G A;  4A83 A;  1FM4 A;  4A88 A;  1XFS A;  3KB0 A;  1LN1 A;  4REI A;  2RES A;  4A81 A;  3Q64 A;  2PSO A;  1BV1 A;  3OJI A;  4JDA A;  3PUT A;  5E46 A;  3RT2 A;  3WG8 A;  4A85 A;  4Z3L A;  5I8F A;  4XRW A;  2VNE A;  2LEQ A;  4BTZ A;  4A80 A;  5E4D A;  2K7H A;  3CNW A;  4JHH A;  1VJH A;  4WVO A;  4IH2 A;  3H3T A;  2PCS A;  3UID A;  3TVR A;  2FFS A;  4OIC A;  3GGN A;  2KEW A;  3NJ1 A;  5AMW A;  3QSZ A;  1XDF A;  3KAZ A;  2E3N A;  4QIP A;  2L65 A;  1KCM A;  1T27 A;  2Z9Y A;  3Q6A A;  3TL1 A;  3JRQ B;  3NMV A;  2L8O A;  4LA7 A;  1QMR A;  2LGH A;  4BKC A;  2Q3Q A;  4REH A;  3IJT A;  3E85 A;  3KB3 A;  1BTV A;  3OTL A;  2QPV A;  3P51 A;  1Z94 A;  2I9Y A;  5E4B A;  4M9W A;  3NS2 A;  4MA6 A;  2WQL A;  3QN1 A;  3NI8 A;  4DSC A;  2NS9 A;  4A8U A;  4A86 A;  4FPW A;  3W9R A;  3FO5 A;  2RER A;  3OH8 A;  4A87 A;  3RT0 C;  3TVQ A;  2R55 A;  4A8V A;  5JNN A;  3KL1 A;  3H3S A;  2MOU A;  5I9J A;  3C0V A;  4Y31 A;  4IGY A;  4LG5 A;  2M89 A;  2Z9Z A;  4BK6 A; 
#chains in the Genus database with same CATH topology
 3Q63 A;  2E3M A;  5C9Y A;  2LF2 A;  2VQ5 A;  1XUV A;  4N47 A;  3RD6 A;  4C9C A;  2LDK A;  4N0G C;  3TGO C;  1EM2 A;  3NR4 A;  3DLB A;  3NMT A;  2LCG A;  3ZVU A;  1IFV A;  3P9V A;  2LIO A;  4JHI A;  2E3R A;  2E3Q A;  4JHG A;  3NMH A;  3P0L A;  4NCB A;  3HM9 A;  1FSK A;  2FLH A;  1TXC A;  1XN6 A;  3OQU A;  1LN2 A;  4GY9 A;  5JO1 A;  2M47 A;  4N41 A;  3NJ0 A;  2KF2 A;  4N3E A;  1B6F A;  3UQH A;  2N4A A;  4IHR A;  2K5G A;  2E3P A;  4R7K A;  2LPX A;  4QDF A;  4DSB A;  3W9K A;  2EJX A;  4C94 A;  3KDI A;  3UJL A;  4B9R A;  2NN5 A;  4MAP A;  1LN3 A;  3NEF A;  1H2O A;  1LLT A;  3PU2 A;  4M9B A;  4RYV A;  4IGX A;  2N4B A;  3NMP A;  4A84 A;  4PSB A;  5BRL A;  2E3S A;  2LUZ A;  3JRS A;  3DLH A;  3GTS A;  4XRT A;  3GOB A;  1T17 A;  3NJO A;  3HXM A;  2REZ A;  4JHY A;  4JDL A;  4QDD A;  2LAF A;  1E09 A;  2LE1 A;  4REJ A;  3K90 A;  1XN5 A;  4QDF B;  2GKD A;  2LAK A;  2A1L A;  3R6P A;  3K3K A;  2D4R A;  2ZYL A;  4LGA A;  2BK0 A;  2IL5 A;  4DS8 A;  3H3Q A;  1ZXF A;  3KDH A;  3HJF A;  2KCZ A;  2KTE A;  3H3R A;  4LGB A;  2E3O A;  3KLX A;  3IE5 A;  3KDJ A;  3NMN A;  4IH0 A;  4BKD A;  3TFZ A;  4Q0K A;  1X53 A;  2QIM A;  4IGW A;  4IGV A;  1TW0 A;  1UW5 A;  5JO2 A;  4C9I A;  5E4M A;  4MNS A;  1JSS A;  3F08 A;  1ICX A;  3KAY A;  2L9P A;  3NEG A;  4BK7 A;  3ELI A;  4A8G A;  4A83 A;  1FM4 A;  4A88 A;  3GL2 A;  4KPY A;  1XFS A;  3KB0 A;  3HO1 A;  1LN1 A;  4REI A;  2RES A;  4A81 A;  3HVR A;  3Q64 A;  2PSO A;  1BV1 A;  3OJI A;  4JDA A;  3PUT A;  5E46 A;  3RT2 A;  3WG8 A;  4A85 A;  4Z3L A;  5I8F A;  4XRW A;  2VNE A;  2LEQ A;  4BTZ A;  4A80 A;  5E4D A;  2K7H A;  3CNW A;  4JHH A;  1VJH A;  4WVO A;  4IH2 A;  3H3T A;  2PCS A;  3UID A;  3TVR A;  2FFS A;  4OIC A;  3GGN A;  2KEW A;  3NJ1 A;  5AMW A;  2YH6 A;  3GB4 A;  3NQN A;  4QCK A;  3QSZ A;  1XDF A;  3KAZ A;  2E3N A;  4QIP A;  3HK2 A;  2L65 A;  1KCM A;  1T27 A;  2Z9Y A;  3GTE A;  3Q6A A;  3JRQ B;  3TL1 A;  3NMV A;  2L8O A;  4LA7 A;  1QMR A;  3F73 A;  2LGH A;  4BKC A;  4E6F A;  2Q3Q A;  4REH A;  3IJT A;  3E85 A;  3KB3 A;  1BTV A;  3OTL A;  2QPV A;  3P51 A;  1Z94 A;  2I9Y A;  5E4B A;  4M9W A;  3NS2 A;  5EKQ C;  4MA6 A;  2WQL A;  3QN1 A;  3NI8 A;  4QDC A;  4DSC A;  2NS9 A;  4A8U A;  4A86 A;  3GKE A;  4FPW A;  3W9R A;  3FO5 A;  2RER A;  3OH8 A;  4A87 A;  3RT0 C;  4N76 A;  3TVQ A;  2R55 A;  4A8V A;  5JNN A;  3KL1 A;  4NCA A;  3H3S A;  2MOU A;  5I9J A;  3C0V A;  4Y31 A;  4IGY A;  4LG5 A;  3GL0 A;  2M89 A;  2Z9Z A;  4BK6 A; 
#chains in the Genus database with same CATH homology
 3Q63 A;  2E3M A;  5C9Y A;  2LF2 A;  2VQ5 A;  1XUV A;  4N47 A;  3RD6 A;  4C9C A;  2LDK A;  4N0G C;  3TGO C;  1EM2 A;  3NR4 A;  3DLB A;  3NMT A;  2LCG A;  3ZVU A;  1IFV A;  3P9V A;  2LIO A;  4JHI A;  2E3R A;  2E3Q A;  4JHG A;  3NMH A;  3P0L A;  4NCB A;  3HM9 A;  1FSK A;  2FLH A;  1TXC A;  1XN6 A;  3OQU A;  1LN2 A;  4GY9 A;  5JO1 A;  2M47 A;  4N41 A;  3NJ0 A;  2KF2 A;  4N3E A;  1B6F A;  3UQH A;  2N4A A;  4IHR A;  2K5G A;  2E3P A;  4R7K A;  2LPX A;  4QDF A;  4DSB A;  3W9K A;  2EJX A;  4C94 A;  3KDI A;  3UJL A;  4B9R A;  2NN5 A;  4MAP A;  1LN3 A;  3NEF A;  1H2O A;  1LLT A;  3PU2 A;  4M9B A;  4RYV A;  4IGX A;  2N4B A;  3NMP A;  4A84 A;  4PSB A;  5BRL A;  2E3S A;  2LUZ A;  3JRS A;  3DLH A;  3GTS A;  4XRT A;  3GOB A;  1T17 A;  3NJO A;  3HXM A;  2REZ A;  4JHY A;  4JDL A;  4QDD A;  2LAF A;  1E09 A;  2LE1 A;  4REJ A;  3K90 A;  1XN5 A;  4QDF B;  2GKD A;  2LAK A;  2A1L A;  3R6P A;  3K3K A;  2D4R A;  2ZYL A;  4LGA A;  2BK0 A;  2IL5 A;  4DS8 A;  3H3Q A;  1ZXF A;  3KDH A;  3HJF A;  2KCZ A;  2KTE A;  3H3R A;  4LGB A;  2E3O A;  3KLX A;  3IE5 A;  3KDJ A;  3NMN A;  4IH0 A;  4BKD A;  3TFZ A;  4Q0K A;  1X53 A;  2QIM A;  4IGW A;  4IGV A;  1TW0 A;  1UW5 A;  5JO2 A;  4C9I A;  5E4M A;  4MNS A;  1JSS A;  3F08 A;  1ICX A;  3KAY A;  2L9P A;  3NEG A;  4BK7 A;  3ELI A;  4A8G A;  4A83 A;  1FM4 A;  4A88 A;  3GL2 A;  4KPY A;  1XFS A;  3KB0 A;  3HO1 A;  1LN1 A;  4REI A;  2RES A;  4A81 A;  3HVR A;  3Q64 A;  2PSO A;  1BV1 A;  3OJI A;  4JDA A;  3PUT A;  5E46 A;  3RT2 A;  3WG8 A;  4A85 A;  4Z3L A;  5I8F A;  4XRW A;  2VNE A;  2LEQ A;  4BTZ A;  4A80 A;  5E4D A;  2K7H A;  3CNW A;  4JHH A;  1VJH A;  4WVO A;  4IH2 A;  3H3T A;  2PCS A;  3UID A;  3TVR A;  2FFS A;  4OIC A;  3GGN A;  2KEW A;  3NJ1 A;  5AMW A;  2YH6 A;  3GB4 A;  3NQN A;  4QCK A;  3QSZ A;  1XDF A;  3KAZ A;  2E3N A;  4QIP A;  3HK2 A;  2L65 A;  1KCM A;  1T27 A;  2Z9Y A;  3GTE A;  3Q6A A;  3JRQ B;  3TL1 A;  3NMV A;  2L8O A;  4LA7 A;  1QMR A;  3F73 A;  2LGH A;  4BKC A;  4E6F A;  2Q3Q A;  4REH A;  3IJT A;  3E85 A;  3KB3 A;  1BTV A;  3OTL A;  2QPV A;  3P51 A;  1Z94 A;  2I9Y A;  5E4B A;  4M9W A;  3NS2 A;  5EKQ C;  4MA6 A;  2WQL A;  3QN1 A;  3NI8 A;  4QDC A;  4DSC A;  2NS9 A;  4A8U A;  4A86 A;  3GKE A;  4FPW A;  3W9R A;  3FO5 A;  2RER A;  3OH8 A;  4A87 A;  3RT0 C;  4N76 A;  3TVQ A;  2R55 A;  4A8V A;  5JNN A;  3KL1 A;  4NCA A;  3H3S A;  2MOU A;  5I9J A;  3C0V A;  4Y31 A;  4IGY A;  4LG5 A;  3GL0 A;  2M89 A;  2Z9Z A;  4BK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...