3R6PA

Crystal structure of abscisic acid-bound pyl10
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
154
structure length
154
Chain Sequence
SQCSSTLVKHIKAPLHLVWSIVRRFDEPQKYKPFISRCVVQGKKLEVGSVREVDLKSGLPATKSTEVLEILDDNEHILGIRIVGGDHRLKNYSSTISLHSETIDGKTGTLAIESFVVDVPEGNTKEETCFFVEALIQCNLNSLADVTERLQAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of abscisic acid-bound PYL10
rcsb
source organism Arabidopsis thaliana
molecule tags Hormone receptor
molecule keywords Abscisic acid receptor PYL10
total genus 43
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10604 Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 3r6pA00
5E4DA 1TXCA 4OICA 1T27A 4N0GC 4A80A 1BTVA 3TL1A 1XFSA 3W9RA 4JHGA 1QMRA 4DS8A 3KLXA 3P51A 1XDFA 3F08A 4M9WA 4B9RA 4GY9A 1B6FA 2QPVA 4IGWA 4MAPA 2WQLA 4JHHA 2E3PA 2E3OA 3KAYA 4XRTA 2FLHA 3PU2A 2IL5A 4JDLA 2RERA 1LN3A 1H2OA 2N4AA 3TFZA 1JSSA 4IGYA 2EJXA 2LGHA 5E46A 3NMNA 5BRLA 1XUVA 2BK0A 4BK7A 2LE1A 3JRQB 3KDIA 4LA7A 2L8OA 4RYVA 1Z94A 2RESA 3KDJA 3OH8A 3H3TA 3TVRA 4REJA 4FPWA 3E85A 5I8FA 2LPXA 3OJIA 1ICXA 3UQHA 1KCMA 2E3MA 2KTEA 4DSCA 1XN5A 2LF2A 2L65A 1LLTA 3NMVA 4MA6A 3CNWA 3NJOA 4WVOA 3K3KA 2M47A 2GKDA 3NI8A 4LG5A 4REHA 2D4RA 2K7HA 2Z9ZA 3QSZA 3OTLA 3NMPA 4IHRA 2PCSA 5JNNA 3NEFA 2A1LA 3Q64A 1LN2A 4JHIA 2LDKA 4A8GA 5E4BA 2Q3QA 3W9KA 2NN5A 2MOUA 1FM4A 2R55A 3NEGA 2KF2A 3ELIA 1EM2A 4N3EA 4A84A 5JO2A 2KEWA 1T17A 2E3SA 3NMHA 4IGVA 1TW0A 4Q0KA 4A85A 2REZA 1VJHA 3H3RA 4IH2A 4DSBA 3NJ1A 4BKDA 2LAKA 3PUTA 2N4BA 5JO1A 1XN6A 2VNEA 4PSBA 2VQ5A 3Q6AA 2I9YA 3JRSA 2E3RA 4XRWA 1X53A 4A8VA 2Z9YA 1E09A 3R6PA 4Z3LA 4IGXA 1ZXFA 2FFSA 2PSOA 5I9JA 4BK6A 3UJLA 4IH0A 2E3NA 4C94A 4C9IA 4R7KA 3Q63A 3NMTA 4A83A 2M89A 3ZVUA 3QN1A 1IFVA 3KB3A 2LUZA 4BTZA 3IE5A 3KAZA 3KL1A 3IJTA 4QIPA 1BV1A 2QIMA 4A81A 3H3SA 3NR4A 5AMWA 3OQUA 4A86A 3P9VA 3RT2A 3C0VA 2K5GA 4C9CA 4A87A 4REIA 1LN1A 4M9BA 1UW5A 3NS2A 4JDAA 2L9PA 3H3QA 2LIOA 4LGBA 3NJ0A 3RD6A 3UIDA 2NS9A 3KB0A 3TVQA 4A8UA 4LGAA 3P0LA 3K90A 4Y31A 1FSKA 3KDHA 4BKCA 2E3QA 2LCGA 2KCZA 3RT0C 4A88A 3WG8A 4MNSA 2LEQA 3FO5A 5C9YA 5E4MA 3GGNA
chains in the Genus database with same CATH superfamily
5E4DA 1TXCA 4OICA 1T27A 4N47A 4N0GC 4A80A 1BTVA 3TL1A 1XFSA 3W9RA 4JHGA 1QMRA 4DS8A 3KLXA 3P51A 4QDDA 1XDFA 3F08A 3GTEA 4M9WA 4NCBA 4B9RA 4GY9A 4NCAA 1B6FA 2QPVA 4IGWA 4MAPA 2WQLA 4JHHA 2E3PA 2E3OA 3KAYA 4QDCA 2FLHA 3PU2A 4XRTA 2IL5A 4JDLA 2RERA 1LN3A 1H2OA 2N4AA 3TFZA 1JSSA 4IGYA 2EJXA 2LGHA 5E46A 3NMNA 5BRLA 3F73A 1XUVA 2BK0A 3GTSA 4BK7A 2LE1A 3JRQB 3KDIA 4LA7A 2L8OA 4RYVA 1Z94A 2RESA 3KDJA 3OH8A 3H3TA 3TVRA 4REJA 3DLHA 4FPWA 3E85A 5I8FA 2LPXA 3OJIA 1ICXA 3UQHA 1KCMA 2E3MA 5EKQC 2KTEA 4DSCA 1XN5A 2LF2A 2L65A 1LLTA 3NMVA 4MA6A 3CNWA 3NJOA 4WVOA 3K3KA 2M47A 4QDFA 3NI8A 4LG5A 2GKDA 4REHA 2D4RA 2K7HA 2Z9ZA 3QSZA 3OTLA 3NMPA 4IHRA 2PCSA 3GOBA 5JNNA 3NEFA 4KPYA 2A1LA 3Q64A 1LN2A 4JHIA 2LDKA 4E6FA 4A8GA 5E4BA 2Q3QA 3W9KA 2NN5A 2MOUA 1FM4A 2R55A 3NEGA 2KF2A 3ELIA 1EM2A 4N3EA 4A84A 3TGOC 2KEWA 2LAFA 5JO2A 1T17A 2E3SA 3GL2A 3NMHA 4IGVA 3DLBA 1TW0A 4Q0KA 4A85A 2REZA 1VJHA 3H3RA 4IH2A 4DSBA 3NJ1A 4QDFB 4BKDA 3HO1A 2LAKA 3PUTA 2N4BA 5JO1A 1XN6A 2VNEA 4PSBA 3GKEA 2VQ5A 3Q6AA 2I9YA 3JRSA 3HVRA 2E3RA 4XRWA 1X53A 4A8VA 2Z9YA 1E09A 3R6PA 4Z3LA 4IGXA 3HXMA 1ZXFA 2FFSA 2PSOA 5I9JA 3GB4A 4BK6A 3UJLA 2YH6A 4IH0A 2E3NA 4C94A 4C9IA 4R7KA 3Q63A 3NMTA 3HK2A 4A83A 2M89A 3ZVUA 3QN1A 1IFVA 3KB3A 2LUZA 4BTZA 3IE5A 3KAZA 3KL1A 3IJTA 4QIPA 1BV1A 2QIMA 4A81A 3H3SA 3NR4A 3NQNA 3OQUA 5AMWA 4A86A 3GL0A 3P9VA 4QCKA 3RT2A 3C0VA 2K5GA 4C9CA 4A87A 4REIA 1LN1A 4M9BA 1UW5A 3NS2A 4JDAA 2L9PA 3H3QA 2LIOA 4LGBA 3NJ0A 3RD6A 3UIDA 2NS9A 3KB0A 3HM9A 3TVQA 2ZYLA 4A8UA 4JHYA 4LGAA 3P0LA 3K90A 4Y31A 3HJFA 4N76A 1FSKA 3KDHA 4BKCA 2E3QA 4N41A 2LCGA 2KCZA 3RT0C 4A88A 3WG8A 4MNSA 2LEQA 3FO5A 5C9YA 5E4MA 3GGNA
chains in the Genus database with same CATH topology
5E4DA 1TXCA 4OICA 1T27A 4N47A 4N0GC 4A80A 1BTVA 3TL1A 1XFSA 3W9RA 4JHGA 1QMRA 4DS8A 3KLXA 3P51A 4QDDA 1XDFA 3F08A 3GTEA 4M9WA 4NCBA 4B9RA 4GY9A 4NCAA 1B6FA 2QPVA 4IGWA 4MAPA 2WQLA 4JHHA 2E3PA 2E3OA 3KAYA 4QDCA 2FLHA 3PU2A 4XRTA 2IL5A 4JDLA 2RERA 1LN3A 1H2OA 2N4AA 3TFZA 1JSSA 4IGYA 2EJXA 2LGHA 5E46A 3NMNA 5BRLA 3F73A 1XUVA 2BK0A 3GTSA 4BK7A 2LE1A 3JRQB 3KDIA 4LA7A 2L8OA 4RYVA 1Z94A 2RESA 3KDJA 3OH8A 3H3TA 3TVRA 4REJA 3DLHA 4FPWA 3E85A 5I8FA 2LPXA 3OJIA 1ICXA 3UQHA 1KCMA 2E3MA 5EKQC 2KTEA 4DSCA 1XN5A 2LF2A 2L65A 1LLTA 3NMVA 4MA6A 3CNWA 3NJOA 4WVOA 3K3KA 2M47A 4QDFA 3NI8A 4LG5A 2GKDA 4REHA 2D4RA 2K7HA 2Z9ZA 3QSZA 3OTLA 3NMPA 4IHRA 2PCSA 3GOBA 5JNNA 3NEFA 4KPYA 2A1LA 3Q64A 1LN2A 4JHIA 2LDKA 4E6FA 4A8GA 5E4BA 2Q3QA 3W9KA 2NN5A 2MOUA 1FM4A 2R55A 3NEGA 2KF2A 3ELIA 1EM2A 4N3EA 4A84A 3TGOC 2KEWA 2LAFA 5JO2A 1T17A 2E3SA 3GL2A 3NMHA 4IGVA 3DLBA 1TW0A 4Q0KA 4A85A 2REZA 1VJHA 3H3RA 4IH2A 4DSBA 3NJ1A 4QDFB 4BKDA 3HO1A 2LAKA 3PUTA 2N4BA 5JO1A 1XN6A 2VNEA 4PSBA 3GKEA 2VQ5A 3Q6AA 2I9YA 3JRSA 3HVRA 2E3RA 4XRWA 1X53A 4A8VA 2Z9YA 1E09A 3R6PA 4Z3LA 4IGXA 3HXMA 1ZXFA 2FFSA 2PSOA 5I9JA 3GB4A 4BK6A 3UJLA 2YH6A 4IH0A 2E3NA 4C94A 4C9IA 4R7KA 3Q63A 3NMTA 3HK2A 4A83A 2M89A 3ZVUA 3QN1A 1IFVA 3KB3A 2LUZA 4BTZA 3IE5A 3KAZA 3KL1A 3IJTA 4QIPA 1BV1A 2QIMA 4A81A 3H3SA 3NR4A 3NQNA 3OQUA 5AMWA 4A86A 3GL0A 3P9VA 4QCKA 3RT2A 3C0VA 2K5GA 4C9CA 4A87A 4REIA 1LN1A 4M9BA 1UW5A 3NS2A 4JDAA 2L9PA 3H3QA 2LIOA 4LGBA 3NJ0A 3RD6A 3UIDA 2NS9A 3KB0A 3HM9A 3TVQA 2ZYLA 4A8UA 4JHYA 4LGAA 3P0LA 3K90A 4Y31A 3HJFA 4N76A 1FSKA 3KDHA 4BKCA 2E3QA 4N41A 2LCGA 2KCZA 3RT0C 4A88A 3WG8A 4MNSA 2LEQA 3FO5A 5C9YA 5E4MA 3GGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E4D A;  1TXC A;  4OIC A;  1T27 A;  4N0G C;  4A80 A;  1BTV A;  3TL1 A;  1XFS A;  3W9R A;  4JHG A;  1QMR A;  4DS8 A;  3KLX A;  3P51 A;  1XDF A;  3F08 A;  4M9W A;  4B9R A;  4GY9 A;  1B6F A;  2QPV A;  4IGW A;  4MAP A;  2WQL A;  4JHH A;  2E3P A;  2E3O A;  3KAY A;  4XRT A;  2FLH A;  3PU2 A;  2IL5 A;  4JDL A;  2RER A;  1LN3 A;  1H2O A;  2N4A A;  3TFZ A;  1JSS A;  4IGY A;  2EJX A;  2LGH A;  5E46 A;  3NMN A;  5BRL A;  1XUV A;  2BK0 A;  4BK7 A;  2LE1 A;  3JRQ B;  3KDI A;  4LA7 A;  2L8O A;  4RYV A;  1Z94 A;  2RES A;  3KDJ A;  3OH8 A;  3H3T A;  3TVR A;  4REJ A;  4FPW A;  3E85 A;  5I8F A;  2LPX A;  3OJI A;  1ICX A;  3UQH A;  1KCM A;  2E3M A;  2KTE A;  4DSC A;  1XN5 A;  2LF2 A;  2L65 A;  1LLT A;  3NMV A;  4MA6 A;  3CNW A;  3NJO A;  4WVO A;  3K3K A;  2M47 A;  2GKD A;  3NI8 A;  4LG5 A;  4REH A;  2D4R A;  2K7H A;  2Z9Z A;  3QSZ A;  3OTL A;  3NMP A;  4IHR A;  2PCS A;  5JNN A;  3NEF A;  2A1L A;  3Q64 A;  1LN2 A;  4JHI A;  2LDK A;  4A8G A;  5E4B A;  2Q3Q A;  3W9K A;  2NN5 A;  2MOU A;  1FM4 A;  2R55 A;  3NEG A;  2KF2 A;  3ELI A;  1EM2 A;  4N3E A;  4A84 A;  5JO2 A;  2KEW A;  1T17 A;  2E3S A;  3NMH A;  4IGV A;  1TW0 A;  4Q0K A;  4A85 A;  2REZ A;  1VJH A;  3H3R A;  4IH2 A;  4DSB A;  3NJ1 A;  4BKD A;  2LAK A;  3PUT A;  2N4B A;  5JO1 A;  1XN6 A;  2VNE A;  4PSB A;  2VQ5 A;  3Q6A A;  2I9Y A;  3JRS A;  2E3R A;  4XRW A;  1X53 A;  4A8V A;  2Z9Y A;  1E09 A;  3R6P A;  4Z3L A;  4IGX A;  1ZXF A;  2FFS A;  2PSO A;  5I9J A;  4BK6 A;  3UJL A;  4IH0 A;  2E3N A;  4C94 A;  4C9I A;  4R7K A;  3Q63 A;  3NMT A;  4A83 A;  2M89 A;  3ZVU A;  3QN1 A;  1IFV A;  3KB3 A;  2LUZ A;  4BTZ A;  3IE5 A;  3KAZ A;  3KL1 A;  3IJT A;  4QIP A;  1BV1 A;  2QIM A;  4A81 A;  3H3S A;  3NR4 A;  5AMW A;  3OQU A;  4A86 A;  3P9V A;  3RT2 A;  3C0V A;  2K5G A;  4C9C A;  4A87 A;  4REI A;  1LN1 A;  4M9B A;  1UW5 A;  3NS2 A;  4JDA A;  2L9P A;  3H3Q A;  2LIO A;  4LGB A;  3NJ0 A;  3RD6 A;  3UID A;  2NS9 A;  3KB0 A;  3TVQ A;  4A8U A;  4LGA A;  3P0L A;  3K90 A;  4Y31 A;  1FSK A;  3KDH A;  4BKC A;  2E3Q A;  2LCG A;  2KCZ A;  3RT0 C;  4A88 A;  3WG8 A;  4MNS A;  2LEQ A;  3FO5 A;  5C9Y A;  5E4M A;  3GGN A; 
#chains in the Genus database with same CATH topology
 5E4D A;  1TXC A;  4OIC A;  1T27 A;  4N47 A;  4N0G C;  4A80 A;  1BTV A;  3TL1 A;  1XFS A;  3W9R A;  4JHG A;  1QMR A;  4DS8 A;  3KLX A;  3P51 A;  4QDD A;  1XDF A;  3F08 A;  3GTE A;  4M9W A;  4NCB A;  4B9R A;  4GY9 A;  4NCA A;  1B6F A;  2QPV A;  4IGW A;  4MAP A;  2WQL A;  4JHH A;  2E3P A;  2E3O A;  3KAY A;  4QDC A;  2FLH A;  3PU2 A;  4XRT A;  2IL5 A;  4JDL A;  2RER A;  1LN3 A;  1H2O A;  2N4A A;  3TFZ A;  1JSS A;  4IGY A;  2EJX A;  2LGH A;  5E46 A;  3NMN A;  5BRL A;  3F73 A;  1XUV A;  2BK0 A;  3GTS A;  4BK7 A;  2LE1 A;  3JRQ B;  3KDI A;  4LA7 A;  2L8O A;  4RYV A;  1Z94 A;  2RES A;  3KDJ A;  3OH8 A;  3H3T A;  3TVR A;  4REJ A;  3DLH A;  4FPW A;  3E85 A;  5I8F A;  2LPX A;  3OJI A;  1ICX A;  3UQH A;  1KCM A;  2E3M A;  5EKQ C;  2KTE A;  4DSC A;  1XN5 A;  2LF2 A;  2L65 A;  1LLT A;  3NMV A;  4MA6 A;  3CNW A;  3NJO A;  4WVO A;  3K3K A;  2M47 A;  4QDF A;  3NI8 A;  4LG5 A;  2GKD A;  4REH A;  2D4R A;  2K7H A;  2Z9Z A;  3QSZ A;  3OTL A;  3NMP A;  4IHR A;  2PCS A;  3GOB A;  5JNN A;  3NEF A;  4KPY A;  2A1L A;  3Q64 A;  1LN2 A;  4JHI A;  2LDK A;  4E6F A;  4A8G A;  5E4B A;  2Q3Q A;  3W9K A;  2NN5 A;  2MOU A;  1FM4 A;  2R55 A;  3NEG A;  2KF2 A;  3ELI A;  1EM2 A;  4N3E A;  4A84 A;  3TGO C;  2KEW A;  2LAF A;  5JO2 A;  1T17 A;  2E3S A;  3GL2 A;  3NMH A;  4IGV A;  3DLB A;  1TW0 A;  4Q0K A;  4A85 A;  2REZ A;  1VJH A;  3H3R A;  4IH2 A;  4DSB A;  3NJ1 A;  4QDF B;  4BKD A;  3HO1 A;  2LAK A;  3PUT A;  2N4B A;  5JO1 A;  1XN6 A;  2VNE A;  4PSB A;  3GKE A;  2VQ5 A;  3Q6A A;  2I9Y A;  3JRS A;  3HVR A;  2E3R A;  4XRW A;  1X53 A;  4A8V A;  2Z9Y A;  1E09 A;  3R6P A;  4Z3L A;  4IGX A;  3HXM A;  1ZXF A;  2FFS A;  2PSO A;  5I9J A;  3GB4 A;  4BK6 A;  3UJL A;  2YH6 A;  4IH0 A;  2E3N A;  4C94 A;  4C9I A;  4R7K A;  3Q63 A;  3NMT A;  3HK2 A;  4A83 A;  2M89 A;  3ZVU A;  3QN1 A;  1IFV A;  3KB3 A;  2LUZ A;  4BTZ A;  3IE5 A;  3KAZ A;  3KL1 A;  3IJT A;  4QIP A;  1BV1 A;  2QIM A;  4A81 A;  3H3S A;  3NR4 A;  3NQN A;  3OQU A;  5AMW A;  4A86 A;  3GL0 A;  3P9V A;  4QCK A;  3RT2 A;  3C0V A;  2K5G A;  4C9C A;  4A87 A;  4REI A;  1LN1 A;  4M9B A;  1UW5 A;  3NS2 A;  4JDA A;  2L9P A;  3H3Q A;  2LIO A;  4LGB A;  3NJ0 A;  3RD6 A;  3UID A;  2NS9 A;  3KB0 A;  3HM9 A;  3TVQ A;  2ZYL A;  4A8U A;  4JHY A;  4LGA A;  3P0L A;  3K90 A;  4Y31 A;  3HJF A;  4N76 A;  1FSK A;  3KDH A;  4BKC A;  2E3Q A;  4N41 A;  2LCG A;  2KCZ A;  3RT0 C;  4A88 A;  3WG8 A;  4MNS A;  2LEQ A;  3FO5 A;  5C9Y A;  5E4M A;  3GGN A; 
#chains in the Genus database with same CATH homology
 5E4D A;  1TXC A;  4OIC A;  1T27 A;  4N47 A;  4N0G C;  4A80 A;  1BTV A;  3TL1 A;  1XFS A;  3W9R A;  4JHG A;  1QMR A;  4DS8 A;  3KLX A;  3P51 A;  4QDD A;  1XDF A;  3F08 A;  3GTE A;  4M9W A;  4NCB A;  4B9R A;  4GY9 A;  4NCA A;  1B6F A;  2QPV A;  4IGW A;  4MAP A;  2WQL A;  4JHH A;  2E3P A;  2E3O A;  3KAY A;  4QDC A;  2FLH A;  3PU2 A;  4XRT A;  2IL5 A;  4JDL A;  2RER A;  1LN3 A;  1H2O A;  2N4A A;  3TFZ A;  1JSS A;  4IGY A;  2EJX A;  2LGH A;  5E46 A;  3NMN A;  5BRL A;  3F73 A;  1XUV A;  2BK0 A;  3GTS A;  4BK7 A;  2LE1 A;  3JRQ B;  3KDI A;  4LA7 A;  2L8O A;  4RYV A;  1Z94 A;  2RES A;  3KDJ A;  3OH8 A;  3H3T A;  3TVR A;  4REJ A;  3DLH A;  4FPW A;  3E85 A;  5I8F A;  2LPX A;  3OJI A;  1ICX A;  3UQH A;  1KCM A;  2E3M A;  5EKQ C;  2KTE A;  4DSC A;  1XN5 A;  2LF2 A;  2L65 A;  1LLT A;  3NMV A;  4MA6 A;  3CNW A;  3NJO A;  4WVO A;  3K3K A;  2M47 A;  4QDF A;  3NI8 A;  4LG5 A;  2GKD A;  4REH A;  2D4R A;  2K7H A;  2Z9Z A;  3QSZ A;  3OTL A;  3NMP A;  4IHR A;  2PCS A;  3GOB A;  5JNN A;  3NEF A;  4KPY A;  2A1L A;  3Q64 A;  1LN2 A;  4JHI A;  2LDK A;  4E6F A;  4A8G A;  5E4B A;  2Q3Q A;  3W9K A;  2NN5 A;  2MOU A;  1FM4 A;  2R55 A;  3NEG A;  2KF2 A;  3ELI A;  1EM2 A;  4N3E A;  4A84 A;  3TGO C;  2KEW A;  2LAF A;  5JO2 A;  1T17 A;  2E3S A;  3GL2 A;  3NMH A;  4IGV A;  3DLB A;  1TW0 A;  4Q0K A;  4A85 A;  2REZ A;  1VJH A;  3H3R A;  4IH2 A;  4DSB A;  3NJ1 A;  4QDF B;  4BKD A;  3HO1 A;  2LAK A;  3PUT A;  2N4B A;  5JO1 A;  1XN6 A;  2VNE A;  4PSB A;  3GKE A;  2VQ5 A;  3Q6A A;  2I9Y A;  3JRS A;  3HVR A;  2E3R A;  4XRW A;  1X53 A;  4A8V A;  2Z9Y A;  1E09 A;  3R6P A;  4Z3L A;  4IGX A;  3HXM A;  1ZXF A;  2FFS A;  2PSO A;  5I9J A;  3GB4 A;  4BK6 A;  3UJL A;  2YH6 A;  4IH0 A;  2E3N A;  4C94 A;  4C9I A;  4R7K A;  3Q63 A;  3NMT A;  3HK2 A;  4A83 A;  2M89 A;  3ZVU A;  3QN1 A;  1IFV A;  3KB3 A;  2LUZ A;  4BTZ A;  3IE5 A;  3KAZ A;  3KL1 A;  3IJT A;  4QIP A;  1BV1 A;  2QIM A;  4A81 A;  3H3S A;  3NR4 A;  3NQN A;  3OQU A;  5AMW A;  4A86 A;  3GL0 A;  3P9V A;  4QCK A;  3RT2 A;  3C0V A;  2K5G A;  4C9C A;  4A87 A;  4REI A;  1LN1 A;  4M9B A;  1UW5 A;  3NS2 A;  4JDA A;  2L9P A;  3H3Q A;  2LIO A;  4LGB A;  3NJ0 A;  3RD6 A;  3UID A;  2NS9 A;  3KB0 A;  3HM9 A;  3TVQ A;  2ZYL A;  4A8U A;  4JHY A;  4LGA A;  3P0L A;  3K90 A;  4Y31 A;  3HJF A;  4N76 A;  1FSK A;  3KDH A;  4BKC A;  2E3Q A;  4N41 A;  2LCG A;  2KCZ A;  3RT0 C;  4A88 A;  3WG8 A;  4MNS A;  2LEQ A;  3FO5 A;  5C9Y A;  5E4M A;  3GGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...