3R6PA

Crystal structure of abscisic acid-bound pyl10
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
154
structure length
154
Chain Sequence
b'SQCSSTLVKHIKAPLHLVWSIVRRFDEPQKYKPFISRCVVQGKKLEVGSVREVDLKSGLPATKSTEVLEILDDNEHILGIRIVGGDHRLKNYSSTISLHSETIDGKTGTLAIESFVVDVPEGNTKEETCFFVEALIQCNLNSLADVTERLQAES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Abscisic acid receptor PYL10
publication title Crystal structure of abscisic acid-bound PYL10
rcsb
source organism Arabidopsis thaliana
molecule tags Hormone receptor
total genus 43
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10604 Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 3r6pA00
2IL5A 3H3RA 1ICXA 3ZVUA 4A88A 3KB3A 3W9KA 1LN2A 3TVRA 1TW0A 3K3KA 4Y31A 4REJA 5BRLA 5JO2A 1BTVA 4A8GA 2QIMA 1X53A 4XRTA 2RERA 4N3EA 4DSCA 2FFSA 3K90A 3GGNA 5JO1A 3Q63A 2KTEA 3WG8A 2D4RA 4A85A 2E3NA 4IH2A 4A8UA 4Q0KA 3KAYA 5I8FA 3KB0A 2LUZA 4MNSA 2L65A 4LGBA 2M47A 1LLTA 4REHA 3E85A 3KAZA 3NEGA 4IGXA 2LEQA 3KDIA 4A84A 2A1LA 1LN1A 4IGYA 3NMTA 5I9JA 3NR4A 2N4BA 3NMPA 2KEWA 2K5GA 4A83A 4BK6A 1Z94A 3UQHA 3H3TA 1TXCA 3P0LA 1KCMA 2FLHA 2NN5A 3H3SA 2I9YA 3P9VA 4GY9A 4JHIA 4RYVA 5E46A 3RT2A 3TFZA 2VNEA 3NJ1A 2E3RA 2M89A 5C9YA 4DSBA 4REIA 4A87A 1XN6A 1IFVA 2E3MA 1EM2A 4JHHA 5E4MA 4BKCA 2LF2A 3IJTA 1XN5A 3UJLA 4N0GC 2VQ5A 3NEFA 3OJIA 4LA7A 4A81A 2GKDA 1B6FA 4C9CA 1JSSA 2QPVA 5AMWA 4OICA 3CNWA 4Z3LA 4BK7A 4QIPA 3KDJA 2E3QA 3R6PA 2BK0A 3NI8A 3QN1A 1VJHA 4FPWA 3NJOA 2KF2A 2LE1A 1XFSA 2NS9A 3PUTA 4JDLA 1XUVA 4JHGA 3RT0C 2L9PA 3Q64A 4C94A 4XRWA 4M9BA 4PSBA 4WVOA 2Z9YA 3UIDA 1FSKA 3NMHA 4BTZA 3KDHA 1LN3A 1ZXFA 3NMNA 3Q6AA 4JDAA 4R7KA 1BV1A 2L8OA 3P51A 2E3SA 4IGWA 3OQUA 2EJXA 2Q3QA 2REZA 1H2OA 4IGVA 2KCZA 2PSOA 3PU2A 2MOUA 2N4AA 3NMVA 5E4BA 2R55A 1T27A 3RD6A 2K7HA 1FM4A 2WQLA 3ELIA 4BKDA 3OH8A 3C0VA 4IH0A 2E3OA 5E4DA 3TL1A 3KLXA 3TVQA 5JNNA 2Z9ZA 2LAKA 3W9RA 3H3QA 3JRSA 3NJ0A 4M9WA 2E3PA 2LIOA 4A8VA 2RESA 4IHRA 4B9RA 4A86A 3JRQB 4A80A 1XDFA 4MA6A 4MAPA 2LDKA 2LCGA 1QMRA 4LGAA 2PCSA 2LPXA 1T17A 3FO5A 3IE5A 3NS2A 4LG5A 3OTLA 4C9IA 3QSZA 4DS8A 1E09A 3KL1A 1UW5A 3F08A 2LGHA
chains in the Genus database with same CATH superfamily
2IL5A 3H3RA 4N47A 1ICXA 3HM9A 3ZVUA 4JHYA 4A88A 3KB3A 3W9KA 1LN2A 3TVRA 1TW0A 3K3KA 4Y31A 4REJA 5BRLA 5JO2A 3HJFA 4A8GA 3HXMA 1BTVA 2QIMA 4QDCA 1X53A 4XRTA 2RERA 4N3EA 3HK2A 4DSCA 2FFSA 3K90A 3GGNA 5JO1A 3Q63A 2KTEA 3WG8A 2D4RA 4A85A 2E3NA 4IH2A 4A8UA 4Q0KA 3KAYA 5I8FA 3KB0A 2LUZA 4MNSA 2L65A 4LGBA 3F73A 4QDFA 2M47A 1LLTA 4REHA 3E85A 3KAZA 3NEGA 4IGXA 2LEQA 3KDIA 4A84A 2A1LA 1LN1A 4IGYA 3GTEA 3NMTA 3NR4A 2N4BA 5I9JA 3NMPA 2KEWA 2K5GA 4A83A 4BK6A 1Z94A 3UQHA 4NCBA 3H3TA 1TXCA 3TGOC 4N76A 3P0LA 3GTSA 1KCMA 2FLHA 2NN5A 3H3SA 2I9YA 3P9VA 4GY9A 4JHIA 4RYVA 5E46A 3RT2A 3TFZA 4NCAA 2ZYLA 2VNEA 3NJ1A 2E3RA 2M89A 5C9YA 4DSBA 4REIA 4A87A 3GL0A 1XN6A 1IFVA 2E3MA 1EM2A 4JHHA 5E4MA 4BKCA 2LF2A 3GOBA 1XN5A 3IJTA 3UJLA 4N0GC 2VQ5A 3NEFA 3OJIA 4LA7A 4A81A 2GKDA 1B6FA 4C9CA 1JSSA 2QPVA 5AMWA 3GB4A 4OICA 3GL2A 3CNWA 5EKQC 3GKEA 4Z3LA 4BK7A 4QIPA 3KDJA 2E3QA 3R6PA 2BK0A 3NI8A 3QN1A 1VJHA 4FPWA 3NJOA 2KF2A 2LE1A 1XFSA 2NS9A 3PUTA 4JDLA 1XUVA 4JHGA 3RT0C 2L9PA 3Q64A 4C94A 4KPYA 4XRWA 4M9BA 4PSBA 4WVOA 2Z9YA 3UIDA 1FSKA 3NMHA 4BTZA 3KDHA 1LN3A 1ZXFA 3HVRA 3NMNA 3Q6AA 4JDAA 4R7KA 1BV1A 3DLBA 2LAFA 2L8OA 3P51A 2E3SA 4IGWA 3OQUA 3NQNA 2EJXA 2Q3QA 2REZA 1H2OA 4N41A 4IGVA 2KCZA 2PSOA 3PU2A 3DLHA 2MOUA 4E6FA 2N4AA 3NMVA 5E4BA 2R55A 1T27A 4QDDA 2YH6A 3RD6A 2K7HA 1FM4A 2WQLA 3ELIA 3HO1A 4BKDA 3OH8A 3C0VA 4IH0A 2E3OA 5E4DA 3TL1A 3KLXA 3TVQA 5JNNA 2Z9ZA 2LAKA 3W9RA 3H3QA 3JRSA 3NJ0A 4M9WA 2E3PA 2LIOA 4A8VA 2RESA 4IHRA 4B9RA 4A86A 3JRQB 4A80A 1XDFA 4MA6A 4MAPA 2LDKA 2LCGA 1QMRA 4LGAA 2PCSA 2LPXA 1T17A 3FO5A 3IE5A 3NS2A 4LG5A 3OTLA 4QDFB 3QSZA 4C9IA 4DS8A 1E09A 4QCKA 3KL1A 1UW5A 3F08A 2LGHA
chains in the Genus database with same CATH topology
2IL5A 3H3RA 4N47A 1ICXA 3HM9A 3ZVUA 4JHYA 4A88A 3KB3A 3W9KA 1LN2A 3TVRA 1TW0A 3K3KA 4Y31A 4REJA 5BRLA 5JO2A 3HJFA 4A8GA 3HXMA 1BTVA 2QIMA 4QDCA 1X53A 4XRTA 2RERA 4N3EA 3HK2A 4DSCA 2FFSA 3K90A 3GGNA 5JO1A 3Q63A 2KTEA 3WG8A 2D4RA 4A85A 2E3NA 4IH2A 4A8UA 4Q0KA 3KAYA 5I8FA 3KB0A 2LUZA 4MNSA 2L65A 4LGBA 3F73A 4QDFA 2M47A 1LLTA 4REHA 3E85A 3KAZA 3NEGA 4IGXA 2LEQA 3KDIA 4A84A 2A1LA 1LN1A 4IGYA 3GTEA 3NMTA 3NR4A 2N4BA 5I9JA 3NMPA 2KEWA 2K5GA 4A83A 4BK6A 1Z94A 3UQHA 4NCBA 3H3TA 1TXCA 3TGOC 4N76A 3P0LA 3GTSA 1KCMA 2FLHA 2NN5A 3H3SA 2I9YA 3P9VA 4GY9A 4JHIA 4RYVA 5E46A 3RT2A 3TFZA 4NCAA 2ZYLA 2VNEA 3NJ1A 2E3RA 2M89A 5C9YA 4DSBA 4REIA 4A87A 3GL0A 1XN6A 1IFVA 2E3MA 1EM2A 4JHHA 5E4MA 4BKCA 2LF2A 3GOBA 1XN5A 3IJTA 3UJLA 4N0GC 2VQ5A 3NEFA 3OJIA 4LA7A 4A81A 2GKDA 1B6FA 4C9CA 1JSSA 2QPVA 5AMWA 3GB4A 4OICA 3GL2A 3CNWA 5EKQC 3GKEA 4Z3LA 4BK7A 4QIPA 3KDJA 2E3QA 3R6PA 2BK0A 3NI8A 3QN1A 1VJHA 4FPWA 3NJOA 2KF2A 2LE1A 1XFSA 2NS9A 3PUTA 4JDLA 1XUVA 4JHGA 3RT0C 2L9PA 3Q64A 4C94A 4KPYA 4XRWA 4M9BA 4PSBA 4WVOA 2Z9YA 3UIDA 1FSKA 3NMHA 4BTZA 3KDHA 1LN3A 1ZXFA 3HVRA 3NMNA 3Q6AA 4JDAA 4R7KA 1BV1A 3DLBA 2LAFA 2L8OA 3P51A 2E3SA 4IGWA 3OQUA 3NQNA 2EJXA 2Q3QA 2REZA 1H2OA 4N41A 4IGVA 2KCZA 2PSOA 3PU2A 3DLHA 2MOUA 4E6FA 2N4AA 3NMVA 5E4BA 2R55A 1T27A 4QDDA 2YH6A 3RD6A 2K7HA 1FM4A 2WQLA 3ELIA 3HO1A 4BKDA 3OH8A 3C0VA 4IH0A 2E3OA 5E4DA 3TL1A 3KLXA 3TVQA 5JNNA 2Z9ZA 2LAKA 3W9RA 3H3QA 3JRSA 3NJ0A 4M9WA 2E3PA 2LIOA 4A8VA 2RESA 4IHRA 4B9RA 4A86A 3JRQB 4A80A 1XDFA 4MA6A 4MAPA 2LDKA 2LCGA 1QMRA 4LGAA 2PCSA 2LPXA 1T17A 3FO5A 3IE5A 3NS2A 4LG5A 3OTLA 4QDFB 3QSZA 4C9IA 4DS8A 1E09A 4QCKA 3KL1A 1UW5A 3F08A 2LGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IL5 A;  3H3R A;  1ICX A;  3ZVU A;  4A88 A;  3KB3 A;  3W9K A;  1LN2 A;  3TVR A;  1TW0 A;  3K3K A;  4Y31 A;  4REJ A;  5BRL A;  5JO2 A;  1BTV A;  4A8G A;  2QIM A;  1X53 A;  4XRT A;  2RER A;  4N3E A;  4DSC A;  2FFS A;  3K90 A;  3GGN A;  5JO1 A;  3Q63 A;  2KTE A;  3WG8 A;  2D4R A;  4A85 A;  2E3N A;  4IH2 A;  4A8U A;  4Q0K A;  3KAY A;  5I8F A;  3KB0 A;  2LUZ A;  4MNS A;  2L65 A;  4LGB A;  2M47 A;  1LLT A;  4REH A;  3E85 A;  3KAZ A;  3NEG A;  4IGX A;  2LEQ A;  3KDI A;  4A84 A;  2A1L A;  1LN1 A;  4IGY A;  3NMT A;  5I9J A;  3NR4 A;  2N4B A;  3NMP A;  2KEW A;  2K5G A;  4A83 A;  4BK6 A;  1Z94 A;  3UQH A;  3H3T A;  1TXC A;  3P0L A;  1KCM A;  2FLH A;  2NN5 A;  3H3S A;  2I9Y A;  3P9V A;  4GY9 A;  4JHI A;  4RYV A;  5E46 A;  3RT2 A;  3TFZ A;  2VNE A;  3NJ1 A;  2E3R A;  2M89 A;  5C9Y A;  4DSB A;  4REI A;  4A87 A;  1XN6 A;  1IFV A;  2E3M A;  1EM2 A;  4JHH A;  5E4M A;  4BKC A;  2LF2 A;  3IJT A;  1XN5 A;  3UJL A;  4N0G C;  2VQ5 A;  3NEF A;  3OJI A;  4LA7 A;  4A81 A;  2GKD A;  1B6F A;  4C9C A;  1JSS A;  2QPV A;  5AMW A;  4OIC A;  3CNW A;  4Z3L A;  4BK7 A;  4QIP A;  3KDJ A;  2E3Q A;  3R6P A;  2BK0 A;  3NI8 A;  3QN1 A;  1VJH A;  4FPW A;  3NJO A;  2KF2 A;  2LE1 A;  1XFS A;  2NS9 A;  3PUT A;  4JDL A;  1XUV A;  4JHG A;  3RT0 C;  2L9P A;  3Q64 A;  4C94 A;  4XRW A;  4M9B A;  4PSB A;  4WVO A;  2Z9Y A;  3UID A;  1FSK A;  3NMH A;  4BTZ A;  3KDH A;  1LN3 A;  1ZXF A;  3NMN A;  3Q6A A;  4JDA A;  4R7K A;  1BV1 A;  2L8O A;  3P51 A;  2E3S A;  4IGW A;  3OQU A;  2EJX A;  2Q3Q A;  2REZ A;  1H2O A;  4IGV A;  2KCZ A;  2PSO A;  3PU2 A;  2MOU A;  2N4A A;  3NMV A;  5E4B A;  2R55 A;  1T27 A;  3RD6 A;  2K7H A;  1FM4 A;  2WQL A;  3ELI A;  4BKD A;  3OH8 A;  3C0V A;  4IH0 A;  2E3O A;  5E4D A;  3TL1 A;  3KLX A;  3TVQ A;  5JNN A;  2Z9Z A;  2LAK A;  3W9R A;  3H3Q A;  3JRS A;  3NJ0 A;  4M9W A;  2E3P A;  2LIO A;  4A8V A;  2RES A;  4IHR A;  4B9R A;  4A86 A;  3JRQ B;  4A80 A;  1XDF A;  4MA6 A;  4MAP A;  2LDK A;  2LCG A;  1QMR A;  4LGA A;  2PCS A;  2LPX A;  1T17 A;  3FO5 A;  3IE5 A;  3NS2 A;  4LG5 A;  3OTL A;  4C9I A;  3QSZ A;  4DS8 A;  1E09 A;  3KL1 A;  1UW5 A;  3F08 A;  2LGH A; 
#chains in the Genus database with same CATH topology
 2IL5 A;  3H3R A;  4N47 A;  1ICX A;  3HM9 A;  3ZVU A;  4JHY A;  4A88 A;  3KB3 A;  3W9K A;  1LN2 A;  3TVR A;  1TW0 A;  3K3K A;  4Y31 A;  4REJ A;  5BRL A;  5JO2 A;  3HJF A;  4A8G A;  3HXM A;  1BTV A;  2QIM A;  4QDC A;  1X53 A;  4XRT A;  2RER A;  4N3E A;  3HK2 A;  4DSC A;  2FFS A;  3K90 A;  3GGN A;  5JO1 A;  3Q63 A;  2KTE A;  3WG8 A;  2D4R A;  4A85 A;  2E3N A;  4IH2 A;  4A8U A;  4Q0K A;  3KAY A;  5I8F A;  3KB0 A;  2LUZ A;  4MNS A;  2L65 A;  4LGB A;  3F73 A;  4QDF A;  2M47 A;  1LLT A;  4REH A;  3E85 A;  3KAZ A;  3NEG A;  4IGX A;  2LEQ A;  3KDI A;  4A84 A;  2A1L A;  1LN1 A;  4IGY A;  3GTE A;  3NMT A;  3NR4 A;  2N4B A;  5I9J A;  3NMP A;  2KEW A;  2K5G A;  4A83 A;  4BK6 A;  1Z94 A;  3UQH A;  4NCB A;  3H3T A;  1TXC A;  3TGO C;  4N76 A;  3P0L A;  3GTS A;  1KCM A;  2FLH A;  2NN5 A;  3H3S A;  2I9Y A;  3P9V A;  4GY9 A;  4JHI A;  4RYV A;  5E46 A;  3RT2 A;  3TFZ A;  4NCA A;  2ZYL A;  2VNE A;  3NJ1 A;  2E3R A;  2M89 A;  5C9Y A;  4DSB A;  4REI A;  4A87 A;  3GL0 A;  1XN6 A;  1IFV A;  2E3M A;  1EM2 A;  4JHH A;  5E4M A;  4BKC A;  2LF2 A;  3GOB A;  1XN5 A;  3IJT A;  3UJL A;  4N0G C;  2VQ5 A;  3NEF A;  3OJI A;  4LA7 A;  4A81 A;  2GKD A;  1B6F A;  4C9C A;  1JSS A;  2QPV A;  5AMW A;  3GB4 A;  4OIC A;  3GL2 A;  3CNW A;  5EKQ C;  3GKE A;  4Z3L A;  4BK7 A;  4QIP A;  3KDJ A;  2E3Q A;  3R6P A;  2BK0 A;  3NI8 A;  3QN1 A;  1VJH A;  4FPW A;  3NJO A;  2KF2 A;  2LE1 A;  1XFS A;  2NS9 A;  3PUT A;  4JDL A;  1XUV A;  4JHG A;  3RT0 C;  2L9P A;  3Q64 A;  4C94 A;  4KPY A;  4XRW A;  4M9B A;  4PSB A;  4WVO A;  2Z9Y A;  3UID A;  1FSK A;  3NMH A;  4BTZ A;  3KDH A;  1LN3 A;  1ZXF A;  3HVR A;  3NMN A;  3Q6A A;  4JDA A;  4R7K A;  1BV1 A;  3DLB A;  2LAF A;  2L8O A;  3P51 A;  2E3S A;  4IGW A;  3OQU A;  3NQN A;  2EJX A;  2Q3Q A;  2REZ A;  1H2O A;  4N41 A;  4IGV A;  2KCZ A;  2PSO A;  3PU2 A;  3DLH A;  2MOU A;  4E6F A;  2N4A A;  3NMV A;  5E4B A;  2R55 A;  1T27 A;  4QDD A;  2YH6 A;  3RD6 A;  2K7H A;  1FM4 A;  2WQL A;  3ELI A;  3HO1 A;  4BKD A;  3OH8 A;  3C0V A;  4IH0 A;  2E3O A;  5E4D A;  3TL1 A;  3KLX A;  3TVQ A;  5JNN A;  2Z9Z A;  2LAK A;  3W9R A;  3H3Q A;  3JRS A;  3NJ0 A;  4M9W A;  2E3P A;  2LIO A;  4A8V A;  2RES A;  4IHR A;  4B9R A;  4A86 A;  3JRQ B;  4A80 A;  1XDF A;  4MA6 A;  4MAP A;  2LDK A;  2LCG A;  1QMR A;  4LGA A;  2PCS A;  2LPX A;  1T17 A;  3FO5 A;  3IE5 A;  3NS2 A;  4LG5 A;  3OTL A;  4QDF B;  3QSZ A;  4C9I A;  4DS8 A;  1E09 A;  4QCK A;  3KL1 A;  1UW5 A;  3F08 A;  2LGH A; 
#chains in the Genus database with same CATH homology
 2IL5 A;  3H3R A;  4N47 A;  1ICX A;  3HM9 A;  3ZVU A;  4JHY A;  4A88 A;  3KB3 A;  3W9K A;  1LN2 A;  3TVR A;  1TW0 A;  3K3K A;  4Y31 A;  4REJ A;  5BRL A;  5JO2 A;  3HJF A;  4A8G A;  3HXM A;  1BTV A;  2QIM A;  4QDC A;  1X53 A;  4XRT A;  2RER A;  4N3E A;  3HK2 A;  4DSC A;  2FFS A;  3K90 A;  3GGN A;  5JO1 A;  3Q63 A;  2KTE A;  3WG8 A;  2D4R A;  4A85 A;  2E3N A;  4IH2 A;  4A8U A;  4Q0K A;  3KAY A;  5I8F A;  3KB0 A;  2LUZ A;  4MNS A;  2L65 A;  4LGB A;  3F73 A;  4QDF A;  2M47 A;  1LLT A;  4REH A;  3E85 A;  3KAZ A;  3NEG A;  4IGX A;  2LEQ A;  3KDI A;  4A84 A;  2A1L A;  1LN1 A;  4IGY A;  3GTE A;  3NMT A;  3NR4 A;  2N4B A;  5I9J A;  3NMP A;  2KEW A;  2K5G A;  4A83 A;  4BK6 A;  1Z94 A;  3UQH A;  4NCB A;  3H3T A;  1TXC A;  3TGO C;  4N76 A;  3P0L A;  3GTS A;  1KCM A;  2FLH A;  2NN5 A;  3H3S A;  2I9Y A;  3P9V A;  4GY9 A;  4JHI A;  4RYV A;  5E46 A;  3RT2 A;  3TFZ A;  4NCA A;  2ZYL A;  2VNE A;  3NJ1 A;  2E3R A;  2M89 A;  5C9Y A;  4DSB A;  4REI A;  4A87 A;  3GL0 A;  1XN6 A;  1IFV A;  2E3M A;  1EM2 A;  4JHH A;  5E4M A;  4BKC A;  2LF2 A;  3GOB A;  1XN5 A;  3IJT A;  3UJL A;  4N0G C;  2VQ5 A;  3NEF A;  3OJI A;  4LA7 A;  4A81 A;  2GKD A;  1B6F A;  4C9C A;  1JSS A;  2QPV A;  5AMW A;  3GB4 A;  4OIC A;  3GL2 A;  3CNW A;  5EKQ C;  3GKE A;  4Z3L A;  4BK7 A;  4QIP A;  3KDJ A;  2E3Q A;  3R6P A;  2BK0 A;  3NI8 A;  3QN1 A;  1VJH A;  4FPW A;  3NJO A;  2KF2 A;  2LE1 A;  1XFS A;  2NS9 A;  3PUT A;  4JDL A;  1XUV A;  4JHG A;  3RT0 C;  2L9P A;  3Q64 A;  4C94 A;  4KPY A;  4XRW A;  4M9B A;  4PSB A;  4WVO A;  2Z9Y A;  3UID A;  1FSK A;  3NMH A;  4BTZ A;  3KDH A;  1LN3 A;  1ZXF A;  3HVR A;  3NMN A;  3Q6A A;  4JDA A;  4R7K A;  1BV1 A;  3DLB A;  2LAF A;  2L8O A;  3P51 A;  2E3S A;  4IGW A;  3OQU A;  3NQN A;  2EJX A;  2Q3Q A;  2REZ A;  1H2O A;  4N41 A;  4IGV A;  2KCZ A;  2PSO A;  3PU2 A;  3DLH A;  2MOU A;  4E6F A;  2N4A A;  3NMV A;  5E4B A;  2R55 A;  1T27 A;  4QDD A;  2YH6 A;  3RD6 A;  2K7H A;  1FM4 A;  2WQL A;  3ELI A;  3HO1 A;  4BKD A;  3OH8 A;  3C0V A;  4IH0 A;  2E3O A;  5E4D A;  3TL1 A;  3KLX A;  3TVQ A;  5JNN A;  2Z9Z A;  2LAK A;  3W9R A;  3H3Q A;  3JRS A;  3NJ0 A;  4M9W A;  2E3P A;  2LIO A;  4A8V A;  2RES A;  4IHR A;  4B9R A;  4A86 A;  3JRQ B;  4A80 A;  1XDF A;  4MA6 A;  4MAP A;  2LDK A;  2LCG A;  1QMR A;  4LGA A;  2PCS A;  2LPX A;  1T17 A;  3FO5 A;  3IE5 A;  3NS2 A;  4LG5 A;  3OTL A;  4QDF B;  3QSZ A;  4C9I A;  4DS8 A;  1E09 A;  4QCK A;  3KL1 A;  1UW5 A;  3F08 A;  2LGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...