3R7MA

Akr1c3 complex with sulindac
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
316
structure length
303
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Crystal structures of three classes of non-steroidal anti-inflammatory drugs in complex with aldo-keto reductase 1C3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 117
structure length 303
sequence length 316
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3r7mA00
1XF0A 3UZZA 4XAPA 2NVDA 3KRBA 2PDIA 3UWEA 3DOPA 4H8NA 1LQAA 4YVVA 1XGDA 3WBXA 3Q67A 2PDKA 3R43A 1GVEA 3GUGA 2HDJA 1FRBA 4XZIA 1Z9AA 4JIRA 3R7MA 3V35A 5JH2A 2VDGA 1X98A 3V0SA 1AH3A 2NVCA 2PDUA 2PDPA 3ONCA 2IPWA 2PEVA 2DUXA 4F40A 4XZNX 1MRQA 1T41A 4L1WA 4QR6A 3V0TA 2A79A 1QWKA 4GQ0A 1A80A 1JEZA 2ACSA 3U2CA 3BURA 1EL3A 4LB4A 3WBYA 4GQGA 4XK2A 2ALRA 1C9WA 4XO6A 2PD5A 4QX4A 3G1RA 1YE4A 4JQ1A 3R6IA 3R8GA 2PDYA 1S2AA 5DANA 4Q7BA 2INEA 4LB3A 2PDXA 3B3DA 1VP5A 3UZXA 4PRTA 2FZDA 2PDJA 3WBWA 3WCZA 3WG6A 1RALA 2F38A 3BCJA 2PD9A 1ZUAX 1S1RA 3GHTA 4JQ3A 4LAUA 1UR3M 4IGSA 2I16A 4JTRA 3N2TA 1US0A 2FZ8A 4GIEA 4G5DA 4PUUA 5AZ0A 1PWMA 3UFYA 5LIXX 3GHSA 2I17A 4LBRA 1Q13A 4L1XA 2PDBA 1ZQ5A 2P5NA 4JQ2A 2IPFA 3C3UA 1HQTA 1XJBA 2PDLA 2PDCA 5HNUA 4JIIX 1AZ2A 2HVNA 3EAUA 3LN3A 3P2VA 4WRHA 2IQDA 3S3GA 3R8HA 3ERPA 5HA7A 1IEIA 4JTQA 1RY8A 3EB3A 1PWLA 3LZ3A 4DBUA 5AZ1A 1Z89A 4WEVX 4HBKA 3UP8A 3O0KA 4GACA 1LWIA 1YE6A 3MC5A 2R9RA 3M0IA 3H4GA 1R38A 3QKZA 1OG6A 2C91A 3RX2A 3CAVA 2ISFA 4JTDA 3UZWA 1EF3A 2QXWA 2BGSA 1EXBA 3CAQA 4ICCX 4XZHA 4EXAA 1Q5MA 2PF8A 2IQ0A 3N6QA 4HMNA 4XO7A 2WZMA 1AZ1A 1YNQA 4DBSA 4PR4A 5M2FX 4IJCA 2PDGA 5HNTA 1S1PA 5LIYX 1X96A 4EXBA 4QBXA 3BV7A 4GA8A 2PDMA 1AH4A 4GABA 3UYIA 4FA3A 1ADSA 4IJRA 3FJNA 3O3RA 4YVXA 3F7JA 3M64A 2PZNA 4JQAA 2FVLA 2F2KA 1S2CA 4JIHA 3LENA 4DZ5A 4PRRA 1YNPA 2CLPA 1AFSA 1MI3A 2HEJA 4OTKA 2IS7A 2FZ9A 2PFHA 4RPQA 3UZYA 3LUTA 4FZIA 3GHRA 3R94A 4JTAA 4WDWA 3H7UA 1PYFA 4YS1A 1X97A 4LAZA 4PMJA 2PDFA 4LBSA 3EB4A 3Q65A 1Z3NA 1VBJA 2IKJA 2FZBA 2IKGA 2PDQA 2WZTA 4WDTA 5LIUX 5LIWX 1MZRA 3G5EA 3UGRA 4WGHA 2PDNA 3D3FA 4PUWA 1EKOA 1RY0A 2INZA 3UG8A 1ZGDA 4FALA 1HW6A 4YVPA 1QRQA 2ACRA 2HVOA 2IPJA 3LQGA 2ACUA 4FAMA 3NTYA 2R24A 4H7CA 2PDHA 4XZMX 3T42A 3BUVA 1AH0A 3LNMA 4ASTA 3CMFA 4GCAA 3ONBA 3DN5A 1SM9A 4MHBA 4R9OA 1Z8AA 1K8CA 3M4HA 2HE8A 5JH1A 3V0UA 2DUZA 2PDWA 2ACQA 2AGTA 3V36A 1T40A 1IHIA 4XZLX 5C7HA 3LD5A 3RX3A 1M9HA 2DV0A 4DBWA 2BP1A 1J96A 2IKIA 3LQLA 4JQ4A 1ZSXA 1PZ1A 2HV5A 3GHUA 3LBOA 2HE5A 2IPGA 2IKHA 3R58A 4YU1A 4XVDA 4XVEA 2BGQA 4JTCA 5KETA 2FGBA 3CV6A 3LEPA 3LZ5A 3FX4A 4NKCA 4I5XA 3MB9A 4AUBA 1PZ0A 4WDUA 3VXGA 4ZFCA 5LIKX 2J8TA 4Q3MA 4WDXA 3RX4A 3CV7A 3CASA 3H7RA 4QXIA 3COTA
chains in the Genus database with same CATH superfamily
3GVWA 3EOUA 1V6WA 3WH5A 3LTYA 3LHUA 5AFDA 2DVUA 2HISA 1JCYA 1TVLA 2NV1A 2ZFAA 3AFBA 3QHMA 3VD5A 1AJ0A 1TWZA 4GH3A 2DZVA 4ENLA 4A8LA 5D8WA 4LC8A 3ZSTA 5BRBA 5CAHA 1CGVA 3GUGA 1BAGA 4REQB 3TYZA 4QNWA 3LSCA 3U57A 1GVSA 2W4XA 4U4MA 1GZ1A 4DJDA 1TFVA 3QR1A 2QKFA 3EYPA 1VPYA 4BI6A 1JCTA 4GJIA 1WNOA 2DUXA 3TOPA 2ZUMA 3V0TA 2XPKA 4MKSA 3BMVA 4IX0A 2VC5A 4QG6A 2WC7A 1D3CA 1JPDX 2YDRA 3Q4DA 3NDOA 1JG9A 1LRQA 3MKVA 2NQZA 4AWTA 3WBYA 4IMFA 1BYBA 1XLFA 1YLVA 1TTJA 5C0QA 3TN6A 1PTAA 4Q7BA 3TR2A 2GJLA 1WOAA 3IRSA 4LB3A 1UA7A 2BVDA 4MIMA 1WBHA 5M03A 3CAKA 2ZX6A 5FEXA 1YXCA 2PD9A 1V3HA 3SB0A 5LNRA 4BCEA 2ODOA 2WNQA 3CO4A 3B9AA 3CLMA 4JKMA 1UR3M 1KLYA 1K70A 1DJGA 4C65A 3ARZA 1SZEA 3NG3A 6REQB 4PE8A 1PUDA 3NOYA 4D72A 2OQLA 4AD4A 4K8EA 4Q6JA 4WVXA 2Z2UA 5I23A 5K4XA 1FBAA 4M7SA 2RJHA 4LCSA 3SUWA 4Q22A 5C7VA 2D3LA 3MUY1 3LXCA 4KRTA 1GPFA 4PMDA 1CIUA 2IPFA 3S47A 4DAIA 1UC4A 2PDCA 1XDJA 4P2VA 5KTLA 1E55A 1FH9A 3AALA 1H51A 1KFKA 3TMQA 1QWGA 3BLEA 1B3WA 2W27A 1TJ1A 2WZHA 3GG0A 2QPUA 4AWSA 1UPPA 3GC5A 4R34A 3QSTA 5FJRA 4XQ6A 1Z48A 2O7SA 3VIFA 3NVDA 1W5NA 4NRSA 1KWKA 3GFYA 4KPLA 5BMXA 1SW3A 4ZO9A 4O50A 5CC7A 4CNSA 1JZ2A 5AVHA 2XTKA 3LV6A 3KTSA 3UZWA 2DP3A 1DIDA 4QAIA 4F0HA 4EXAA 4N42A 3ITOA 2EBNA 4OVXA 3ARQA 2A5HA 1AZ1A 3A3XA 1E0WA 3IACA 3S2MA 3UU0A 3SFWA 3CMJA 3CIVA 5DMMA 4GI8A 1AL7A 3VIKA 2GVYA 4LS0A 1F6YA 4GYPC 1HGYA 1ZBWA 4BFAA 4M80A 1OF6A 4MM1A 5C54A 9RUBA 1WP6A 4GA8A 4UTJA 3WIJA 1CBGA 5C9ZA 1YADA 4D8ZA 4NZ1A 1TA3A 2QCHA 4AD0A 4L6OA 1FWIC 3SGZA 4DZ5A 5E70A 2XYLA 3ZVIA 2WCAA 2CIPA 2CLPA 3WX7A 4K36A 4PMYA 5CZSA 3AC0A 1DJIA 3RJYA 1CT5A 1Z69A 3GHRA 4F2BA 4RNHA 2HRWA 3SW6A 2GVLA 4C6BA 5I02A 1BGAA 1LLWA 3M0KA 2ISDA 1XYMA 2FMOA 2VTFA 3TEVA 3MP5A 3OVGA 3W28A 3W76A 4DZHA 1JPHA 1KC7A 2NXHA 3AAMA 5JU6A 3S8HA 2J62A 3PUDA 4B5WA 2VNCA 3DKJA 4WGHA 1XYBA 3O05A 5FF4A 1V6XA 4OHQA 3QFEA 1DJWA 2BODX 4PMRA 3EMQA 4WJ8A 4AF0B 2HS6A 1E4NA 3L0GA 3UWYA 4N6EA 2ACUA 2FVMA 3NTYA 3E74A 3VU2A 3W1AA 3SGGA 3HPSA 3EOSA 2Z7GA 1JGMA 3AQUA 2XZ7A 4RW3A 4MB1A 3MHUA 1C92A 3E2SA 2J77A 4R9OA 5KEZA 4ZB2A 3APTA 1BQCA 3AOFA 1QI4A 2QW5A 4WX2A 3SI9A 1E5NA 1FXQA 5D30A 3QV6A 5LXXA 1EIXA 1QK0A 5DQPA 4UTWC 5AHMA 4ZOEA 4F0RA 1PJ9A 1UZDA 2GDQA 1N2VA 4M0XA 3TW6A 4QAWA 4LUIA 4F8XA 4PA8A 1W3IA 4PUKA 3T0DA 4NAEB 1W91A 1XBYA 4C6NA 1B4KA 1Y8BA 3CGTA 1XQLA 4I5XA 4EF8A 3VYLA 1A5UA 4GXPA 4PMQA 5E0FA 3FA5A 1ZENA 5EMKA 4Z2KA 4V27A 2QCDA 1UIPA 2V8ZA 2V69A 1U1JA 3DDMA 1M65A 1XV8A 3HFTA 2RDTA 3RN6A 4R7WA 4JPGA 2OU4A 4DO4A 1RJQA 3T1GA 3PZMA 1XICA 2XSBA 5H8MA 4PUEA 3MW7A 1ZAHA 3NYZA 1SO5A 2FPTA 3AS3A 1BF6A 3W1XA 1I60A 3S1XA 5A1AA 5HPCA 2G5WA 3DG6A 1FCBA 4GIYA 3DECA 5D33A 4ADSA 3F5LA 3D3AA 4B15A 4Y9PA 3G6MA 4RCXA 2XWDA 4S3EA 2XFFA 1S5NA 3LI0A 1X98A 1MXGA 4F66A 2YL9A 4A2RA 1GYNA 3RYSA 1SFSA 2V38A 3BWWA 4PMXA 4P61A 3DEQA 4IQEA 4JX5A 4UIOA 4XZNX 4RNFA 4L1WA 1R85A 3PFMA 4IG2B 4IICA 4KCVA 5A8PA 5TBOA 4ORIA 3F4WA 4GQ0A 3PPGA 3AUOA 3NPWA 5ENLA 3W6MA 3RGTA 1KCZA 2ABAA 1JCJA 4GUGA 5HK4A 4MGGA 2J74A 3H2MA 2ALRA 2RDXA 1H7OA 1C9WA 4DVOA 2FDMA 2PUZA 3WDPP 4Q33A 3CS2A 3NO3A 2RAGA 4JOMA 1S5MA 3YPIA 3R6IA 2X1TA 1YDYA 4ZODA 1TV5A 9XIMA 3XINA 1OFRA 4P7QA 1EBGA 4CNUA 1OEPA 3T40A 4O13A 4XAYA 3DI1A 2VVNA 2GSHA 3NQBA 5TF0A 4GQRA 3EX3A 4AWUA 1DJYA 5I03A 4KCUA 2J7GA 2RGLA 4C6KA 2G3NA 3S4TA 1Q8JA 3HPXA 3WEMA 2Z1KA 1TRIA 2FZ8A 3WLSA 3SIMA 1ZJAA 3UFYA 1EUNA 3ZYZA 2BWGA 2OPJA 5DO8A 1JF5A 1JYWA 3TV8A 4AG0A 1YPFA 2WPBA 3VCNA 1VYRA 1A4MA 2V2CA 4KERA 2YA1A 1OWQA 1F8IA 5D9NA 4AIOA 1BVNP 5DBTA 4H01A 1AQMA 2XVGA 3UR8A 2YYTA 3DG3A 3M44A 3LGEA 3DFYA 3QM3A 3I6TA 3R8RA 4Z2IA 3H53A 4UOJA 4G7EA 4HP5A 4XZWA 1K7XA 4ZOBA 2DZBA 2E68A 4S2CA 3BARA 1GQJA 4HCDA 1V4YA 4IIBA 1SZFA 1V6TA 4B9YA 3T0AA 1VC4A 1C7TA 5DCBA 1EPVA 4OJYA 3K8KA 4X2RA 3SDOA 2R9RA 1WE5A 1TX2A 3AXKA 5HAOA 3VGHA 3WLHA 3AMGA 2J9ZA 4S3BA 4XZHA 1Q45A 2ZTJA 1FWSA 4V33A 5AHNA 3OGVA 4XTDA 3LERA 4BQ2A 3QJAA 3EWXA 4PFMA 1E51A 4CD7A 3ZWTA 1QPKA 2J8FA 4N02A 2DQWA 5BNKA 1G4SA 2FJKA 1JAKA 4QCEA 5HATA 4IUOA 1M53A 1TPEA 2BY1A 3QH2A 3SJ3A 3BV7A 3M6DA 1VF8A 3UGVA 1F8MA 3G24A 3PANA 1ADSA 3IJIA 4QDWA 1SW7A 4DN1A 3E2QA 3PWGA 1XS2A 2W91A 1KCLA 1T7LA 1H63A 3AXIA 4RNJA 1EP3A 2OXNA 3UWUA 2E6YA 3G22A 1XQKA 4EPBC 2X1UA 1QO2A 2Q71A 3N3MA 1SR0A 4HNTA 4L9ZA 1GG1A 1GHSA 1TWWA 4RPQA 1WDQA 3M07A 3W7DA 2WMIB 2ZIDA 4NYUA 1GVFA 2WWCA 3H2AA 1THFD 4EOUA 2WHMA 4PMJA 1Y7VA 3P7YA 2A1YA 2GK1A 1CGUA 3TC6A 3FJLA 1YHTA 4OUIA 4EK7A 2HS8A 2VKZG 5K4ZA 1BRLB 3B8UA 1GGOA 1ISWA 4LC6A 3LMYA 4UB9A 3I6EA 2AL1A 3OTRA 3UG8A 1ZGDA 3KCOA 5CPMA 1J11A 5H8PA 3PS7A 1KKOA 4GVFA 5M17A 4RE2A 3CNYA 4IJBA 1HP5A 5I3GA 3WQVA 3ENLA 1CTNA 2CNCA 4ZB0A 5BWAA 4TXEA 1PCKA 4ASTA 2WXDM 1Y5XA 3ONBA 3DN5A 1XINA 3R13A 4FHAA 3OGSA 1TE1A 3WNLA 4J2PA 1XLBA 3PBYA 4TOQA 2ZZ6A 5E0CA 1E6SM 3A64A 3UR2A 1RVGA 1IT0A 4FLSA 3RR1A 2QYGA 1DWFM 1OIMA 1TTPA 5IDZA 4TVUA 2E4TA 5TQLA 5E09A 3LQLA 1X1OA 1W1B1 3TJXA 4OECA 1SFTA 3W38A 2BVWA 1V3JA 2Z2AA 1EEPA 1X8FA 1B0IA 3RJXA 4G7FA 2FPVA 2FB3A 3LM7A 4WY0F 3CL7A 3O63A 1WZKA 5F7UA 1OCBA 3GAYA 3K8LA 4W9TA 1KRCC 1J0HA 1IT7A 3UJEA 1H62A 1Z44A 3QR3A 5FL0A 1ZAJA 5D04C 1NOUA 3C0LA 3AJ7A 3PJTA 3QTPA 3V5OA 5JUVA 2PBGA 3FHAA 4TR9A 4YTQA 4QM1A 2Y24A 1BG9A 3GG1A 2OQHA 3IJLA 1OX4B 4MY8A 3STCA 4KRZA 4NNAA 4HTBA 3E38A 2ZA1A 2V3EA 2UBPC 3U4AA 3V1HA 5HANA 1UWAA 2P88A 4UQAA 2GDUA 2QGYA 2VZOA 3FKKA 5C5YA 4JY9A 3PZOA 4DUWA 7ODCA 1H1NA 3JR2A 2Z1WA 2RDUA 1QVBA 3PY2A 3PN8A 2VDGA 1TR9A 1KFJA 5HULA 4HNLA 3DFTA 4DF2A 1XRVA 3CZLA 2PWFA 3EX4A 1GEQA 3LCFA 3M41A 4ZBCA 3VTRA 2DSWA 2DJLA 4W5ZA 4P8XA 1JZ5A 2ACSA 1BKHA 3PC0A 4M6QA 3U2CA 1TPB1 3BURA 1W3KA 2Y0FA 2OVLA 1FDZA 5REQB 3DKLA 1X8CA 3G1RA 1KM0A 1PKYA 2YXXA 1U22A 3HPFA 4DXKA 3CTTA 1AMKA 3TQ0A 1TV2A 1E0UA 3W72A 4N4QA 3VFLA 3CV2A 1CGXA 5EMUA 4R27A 1NWSA 4S38A 4HPJA 3QC3A 1DWAM 4JX6A 1UG6A 2WMGA 1HO4A 1OG0A 3W1LA 2G3FA 2VMFA 4FIQA 3AHXA 3W1UA 3E12A 3F2CA 4NHVA 2B7NA 4Q7NA 1A5NC 1GJUA 2FHCA 4M8UA 3GXTA 5I77A 2FJUB 2CXEA 2CZDA 3HQPA 4JTSA 5D9OA 1E6ZA 3CB8A 1R7AA 3W1PA 4JTEA 3O6YX 3WD2A 3NZRA 5I00A 2VURA 3OZOA 3EOOA 4QLKA 1KM5A 4WRHA 1VLIA 3NQ8A 4UR8A 4IIDA 5BCAA 5EA9A 1QNSA 3WJWA 4WF7A 1GVOA 3E5BA 3N11A 3VGBA 4EWND 1IZJA 2Q3OA 3O8AA 3EB3A 3PPFA 4PMOA 5M5DA 5C9WA 3WFAA 2DSUA 1VENA 1VFTA 4A4AA 4DLMA 3GM8A 4YJ5A 4GOAA 4AD3A 2WQPA 1T8XA 3O0KA 4PCFA 5I79A 3WLNA 1VS1A 4NX0A 3FIGA 2E0PA 5IFPA 4HA0A 1BYAA 5C8BB 1VPQA 4OKDA 3G0UA 1JUEA 2DVXA 2SFPA 5BXTA 4ICCX 1G0CA 1BVZA 3SUSA 3VIGA 4B5VA 3HF3A 1KCKA 2YDAA 1QOXA 1CX9A 1DQUA 1JZ4A 3WEOA 4C6CA 3PUOA 1ZFJA 1SSGA 1V7YA 1YIXA 4KWVA 1ZU8A 3CHCA 2A7PA 1HKMA 1V6VA 1W1TA 1NEYA 4EXBA 2DIKA 3MI6A 3EX6A 3HGRA 2YX0A 3CHVA 1YDVA 1SZGA 2TSYA 5I3KA 3DGBA 3UR5A 3GKFA 5G1MA 1XIGA 1KFWA 1JYVA 2WOQA 3F7JA 3WO8A 1D2KA 4E8CA 1BGGA 4US5A 1VBRA 4P5UA 1SFJA 3E2VA 3M43A 3N9SA 3WLKX 1FWWA 4UTTA 2E28A 4JEQA 3D5HA 1PPIA 3WF3A 4HSOA 2ZUUA 4IQJA 4P8UA 2HVMA 3GR8A 3R5EA 1PKLA 1XYZA 1XKJA 2HEJA 2I56A 3PNUA 5DMNA 3BJTA 2J79A 3AIRA 3UW6A 4LUYA 4DF1A 4UNIA 1ICPA 1OD8A 2R1LA 4HIBA 5A6TC 2PGWA 3WH8A 3DXIA 3GX9A 1UB3A 2I14A 1UZHA 1WOBA 5CG7A 1HGWA 4F9DA 4M1BA 1ISZA 4ZA0A 5HPOA 2PDQA 2WZTA 3LOTA 3HGSA 2XM1A 5F4SA 3ANUA 4D6IA 1F76A 1NELA 2I9EA 1UMYA 2NSOA 1E3ZA 2W6RA 4J3TA 3NXFA 5EGRA 4LOCA 2Y7FA 2FH6A 3NQGA 3N1AA 4I9TA 3KBJA 3TROA 3OVQA 3ZQ9A 2F84A 3BUVA 3N3TA 3S42A 3DIPA 4GCAA 4XBSA 1VEOA 2XGIA 2YLLA 4ZQCA 3TQVA 4FOJA 2Y62A 3U6WA 1XUZA 5FL1A 3NM1A 4IXHA 5IHSA 1JCLA 2ZVRA 2G4JA 2Z1VA 5GNYA 1WZAA 4UMAA 1EH9A 1V8EA 3EOEA 3VAVA 1HJUA 2VXNA 2VX5A 5CPNA 2QPSA 2GVJA 1OFBA 1XXXA 6CGTA 3PZ9A 3W84A 4AYGA 2GQ3A 3R79A 5DCEA 2WCSA 6PTDA 1J0KA 4GZJA 1XI3A 1SJCA 2A4AA 3LHYA 3GTFA 3MJYA 1DBTA 4JTCA 3W9ZA 3Q2DA 3IARA 3NVTA 3IAPA 1L8NA 2FFCA 2G41A 3LEPA 3P80A 4F2UA 3HIJA 4K7VA 1M01A 4WDUA 5FAJA 5TD4A 1RCXB 3FDKA 3QZ6A 4H9XA 1UHVA 2QJIA 4AX6A 3NAVA 4D6FA 3L68A 2QCFA 3KL5A 3VIOA 1VFHA 3IV8A 2OO6A 4M7TA 4K39A 2DT1A 1J6OA 1YPXA 1F3XA 1H2JA 1UIOA 5AECA 3FSUA 2P8CA 2EO7A 2YCEA 3L4WA 7PTDA 3VDAA 2H8XA 2B0MA 4CQ8A 2O56A 4US6A 4GZEA 3BGJA 3WBXA 2OX1A 5IRPA 3CQIA 4JZ5A 3AXHA 5HWMA 3RCMA 2DZPA 3O06A 1MRAA 5JH2A 2GJXA 3CBWA 4UQ9A 4ERGA 1EGMA 1CWYA 3ITYA 2E6DA 1FWDC 4FNRA 3D46A 5A6BA 5I5RA 2HTMA 3W88A 5AHEA 5FJUA 3FA4A 4CN4A 3ONCA 3WLMA 2UY3A 2DUAA 3B9NA 1OFAA 4MJZA 3TOYA 4QR6A 4FXJA 3EWBX 3NWRA 3FDGA 4CD8A 5FI8A 3TLLA 3FAWA 1V5XA 3VNDA 4UBPC 3KOWA 2W61A 4B3ZA 3BGGA 1IV8A 1RJRA 4YYFA 3TE9A 5U7SA 1NIUA 1VQTA 2XIBA 1GVQA 1W31A 3M5VA 4LF1A 2NQ9A 2ZZ1A 1TB3A 2D1ZA 1HZYA 1REQB 3I3EA 2ZCGA 4CCDA 4ZMGA 3O0FA 1O7AA 3K4WA 3MSGA 3WCZA 5AHLA 4H4IA 4YTRA 4X0NA 2GGHA 5FCZA 4ZQNA 2FTWA 3GG7A 3I68A 3S5NA 3CHDA 3E0IA 1RD6A 2ALDA 3ARWA 1EGVA 2R82A 1QNVA 5C70A 2OKTA 2W92A 2WPGA 1SJAA 4U5KA 4GIEA 3FFSA 4OBSA 3ZJ8A 5DY2A 2ZADA 5D2VA 1IZCA 3GHSA 1OIFA 3IPWA 3H2CA 1UOZA 1FFRA 4L9YA 4KETA 4ZQOA 2VI0A 1XBZA 2X7WA 3KBNA 4O53A 1IT8A 3T2PA 3A6OA 1XYLA 4GFSA 4GY1A 1M7JA 3KCLA 1XJBA 2Y61A 4EKJA 4IIGA 1MXSA 4FNPA 4GVGA 3UNTA 4AX7A 3LCGA 4QS6A 4HOZA 3DFOA 3SURA 3BW4A 3M6YA 1S5WA 5HWJA 1MEWA 4AIEA 3K4DA 2HROA 1RP8A 3WELA 4CVUA 3WL0A 3GD6A 3IJQA 3RLHA 4J40A 2XVKA 2F7FA 5XINA 2QV5A 1C8XA 3WLOA 1K9TA 3CYJA 5CZ0A 4BWLC 4HNUA 4MNMA 3HU7A 1SPQA 2FMNA 1HVQA 1AD4A 4W7UA 5LHFA 3IGHX 3APYA 4F2TA 1R2RA 3WH7A 4RXGA 2TMDA 3HO8A 3UPBA 1DEDA 1NWRA 3I65A 4Z1BA 4E38A 3W82A 4JKKA 1NDZA 1QW7A 4GUIA 3TDFA 1QOQA 1R3VA 4GIAA 5ABTA 2Y8VA 1WV2A 4PUJA 3U8GA 3WL1A 3P0XA 4PR4A 4FEZA 4RK8A 2I5QA 4AD1A 2OT0A 4X3ZA 2ZRZA 1E56A 1YTDA 1JNDA 4AEEA 1IR2A 3GH4A 4LRSA 4UFKA 1JD7A 2PDMA 4KFOA 3TYBA 3H8AA 3RFAA 1V7AA 2YL5A 2RHGA 3FJNA 2NW0A 2PU0A 3TX9A 2GJPA 3FJ6A 1IIGA 4RDWA 1S2CA 4W86A 2F6UA 1K4HA 2QCGA 4A05A 3TK7A 3UBPC 4FF7A 2E3ZA 3EPMA 2A7RA 3ZXWA 5F4XA 3QGVA 3T0BA 1UQYA 1FWHC 1VRXA 2YCIX 2A3AA 2JIWA 2A3LA 3B8VA 4WIWA 1ICSA 2ZX8A 4AZCB 4RL3A 3WJZA 3FW6A 3Q65A 5HJXA 2GSJA 3KOZA 4PUNA 2J7DA 3VOIA 2AOSA 2F8QA 2QDHA 4O4VA 4OT7A 4QISA 1HKVA 2RGMA 2EF9A 3HV9A 3PJXA 1KM2A 4FXRA 4TQTA 1NVMA 1K9EA 3EEZA 3K5XA 4C5ZA 4JIEA 3E0VA 4EIVA 1I2OA 2EQDA 4FALA 4ZSTA 2J25A 3V75A 2ACRA 1F7BA 3UA4A 5K3VA 3MANA 4MSSA 4BI7A 5A8OA 4RKAA 3TN5A 4ILSA 2CETA 3TN4A 3UG3A 4HOWA 1X7FA 2OYLA 2WHJA 1UMLA 1B31A 7XIMA 2RH9A 4MUPA 1BLIA 5I24A 3EDDA 2NUXA 3ZR4A 4I7UA 3EMCA 3PPCA 1B30A 1PTGA 1V0KA 5FAGA 4H7ZA 2FLIA 1NQ6A 3RITA 2QUUA 4PSPA 1A5AA 3VO0A 4RZ6A 3WK1A 1BHGA 3B04A 1DXIA 4O1BA 3BV4A 4IX2A 4J7RA 1XPYA 1O5XA 3AMDA 4JQ4A 4MB3A 4K3ZA 3L4YA 5C55A 3BO9A 2E6AA 4YU1A 4KFNA 4MVAA 3W23A 4FX6M 1RA5A 4EPEC 2MNRA 3MV01 2EGZA 3NGFA 2A3BA 4JTIA 4L4OA 1AW2A 5CPOA 3TQKA 5A8MA 3BZJA 3EB2A 2ZRWA 3A9IA 4OOZA 1HO1A 1XSKA 1VAHA 2HK1A 3B0XA 2WSQA 5K9DA 4UQEA 2LLEA 5DBUA 4IL0A 3WQ4A 2ANUA 3T4CA 2ZXDA 4EANA 1TWIA 3NDZA 3OU8A 2EPHA 3SM0A 2YL8A 3L12A 3N13A 1AG1O 2OZ0A 1F4HA 4ATWA 3P62A 2OZTA 1VHNA 3DX5A 1EZ2A 2ZOXA 5DN1A 1ZY9A 3CUFA 5CC6A 1NH6A 2W5FA 1MDRA 1GOOA 1XGDA 2GUYA 3VNZA 1UQZA 1QPRA 5AN7A 3UNDA 4WY0B 4P7NA 1LWJA 4FR6A 4A3QA 2Q6ZA 1K6AA 3EPNA 1Q7ZA 2J8GA 1E4MM 3EXSA 3WLPA 3PBMA 3G1SA 1YDOA 2W0UA 4N9EA 1GG0A 4F48A 3VD4A 1M6JA 1M3UA 1PKMA 2YSWA 2ONEA 1XRSA 3OQEA 1TG7A 4TTUA 1TMLA 2QUMA 2CHRA 4Z1YA 4O1EA 4BQ3A 3W25A 2YYUA 3P84A 1HFBA 2ADAA 2XU2A 1JDFA 1IXPA 5D2WA 1W3HA 3C2VA 1E3XA 4JAWA 4LVBA 4MYAA 1QI2A 3T2QA 1S2AA 3M9YA 1E1CA 2CPUA 3HFYA 2PDXA 2PCQA 4A3UA 3UZXA 2XN0A 4PRTA 3WSUA 3O2LA 1NWTA 3OYZA 4TV5A 2FZDA 2PDJA 3SCNA 2WQDA 3ITXA 3AMKA 1B5TA 3BQ5A 4MWAD 4G6CA 4LS1A 5BROA 3RLUA 3BMXA 1JCNA 2VC9A 1PZ3A 3Q58A 3TNOA 4AZGA 1DWIM 1QPQA 4UMCA 5A3HA 3IGXA 4QRNA 4KIEA 4H00A 4AY7A 4JDYA 4RE4A 4MZYA 4GQQA 3EWUA 2WSYA 4LBRA 1W9DM 3QQWA 4HN8A 4LYKA 1SQ7A 4MWAB 2W66A 2PWHA 3A4XA 2V9DA 5CXPA 3CL6A 3B9EA 1XCWA 1Q7MA 5U4NA 1Q2RA 3F4DA 1AZ2A 3S6OA 1Z41A 4Q8MA 1P7TA 1LOQA 1ZCCA 4HCLA 2AKMA 3KOYA 3T4WA 4B5TA 1S3HA 5D4YA 3CUHA 1DWHM 4Y90A 1SO3A 1H09A 1YMYA 4TIMA 4DNMA 5K9XA 1PKNA 4LAOA 5CC5A 2VP8A 1LYXA 1XIBA 5HR7A 4U5IA 1Z32X 1LF1A 3VZXA 4JEJA 1EQPA 4DO6A 3CUGA 2QJNA 4HBKA 2VC6A 3T05A 3KZPA 4C7DA 5G4HC 5IM51 5AB3A 4XZ9A 3KP0A 4Q32A 1R38A 2VFIA 2VVSA 2MANA 3UXDA 2ZUWA 4H9YA 2HNEA 3VDCA 4MPKA 4JDBA 4ZEPA 2Q8LA 1N8IA 4TVDA 3UG4A 4LT9A 2A6NA 1HVXA 1OQFA 2H9AA 3A22A 4HK7A 1FDYA 2WZMA 5GJNA 4Y96A 4HYWA 3N25A 5CQ1A 3GXNA 5EFDA 1UD8A 4U33A 3IK4A 1T96A 1J18A 5AY7A 3GTXA 1UUQA 5AC6A 1KD0A 4PMNA 3ME3A 2WZEA 3GH5A 4UNLA 3WBEA 4RR4A 1BWVA 3B06A 3IGUA 2D2JA 5CSSA 3V5CA 2ZUSA 1Q6EA 3M0HA 4LU0A 3N29A 5CLWA 2FVLA 2OODA 2ESCA 4IPLA 1MW3A 5FEZA 3B9OA 1CXKA 1UCWA 1JD9A 1E1FA 4MAVA 1VFUA 2OCZA 3MUCA 3WJXA 1GTEA 4KT2A 2GOUA 3E0LA 1K3UA 6XIMA 3SUVA 1G9HA 1UH3A 3M0VA 5E5CA 3W6LA 1JFHA 4WOZA 3ID7A 4L80A 4U2ZA 2DSKA 2B7QA 2ZYFA 1I75A 2GVGA 1SO4A 3PF3A 3GVGA 4PZVA 1E71M 5HUOA 2PDNA 3GO2A 2W9MA 2XM2A 1GQIA 2O9OA 1OX5A 1TVPA 1IEVA 4JCLA 1DJHA 1WDRA 3QY8A 4ZFMA 1TUXA 3U7VA 2WBGA 3F4CA 2IPJA 3VX0A 4IFOA 1DYSA 3W1RA 1NTHA 1UP2A 4L7ZA 1KFBA 1YTEA 3MWAA 5T8GA 3WKZA 1KXQA 2PE4A 1TELA 1KRAC 2J6VA 2X40A 4D71A 3WFLA 1W5PA 1Z8AA 1TPFA 3M4HA 5FKYA 1XLLA 3DBNA 2XIIA 2EPNA 4GXMA 2JIEA 1FHDA 3A5VA 4MJ2A 1DHPA 3LG3A 4G1KA 1IEQA 1GEHA 5C9RA 3N04A 4LCQA 3BANA 1VJIA 5AC7A 1WXJA 3A5FA 4Y7EA 2VGIA 3NZQA 4A6GA 3L9CA 3AHYA 1UD4A 3NJ3A 1ZSXA 2O55A 4W7VA 4FPSA 2IPGA 3PUEA 3VINA 1VLWA 4UC5A 2G37A 3UCCA 2VT0A 2WK2A 3NZGA 2G4FA 2CZEA 3DAQA 4JKLA 3RM8A 4UTUA 1W54A 4L4LA 1C7SA 1GK8A 1UJQA 1ISXA 7REQB 5FEWA 2CLLA 2VR5A 4ZQPA 4YTUA 1QO5A 4Q8TA 1A5KC 4BS0A 2QV4A 2V3GA 2OT1A 3UWEA 4ROPA 3QXBA 3ALGA 3MU7A 3SN0A 3DOPA 1SVDA 3GDRA 3UVAA 3NPUA 3KWSA 5C9XA 1CXFA 4DUVA 3SQSA 5A6BD 5I7GA 4LYRA 1JQXA 3V16A 4TTGA 3NL5A 1LBFA 3Q67A 3R43A 2WVVB 3PSVA 3TYUA 4HN4A 1Q7QA 3CH0A 2VR2A 2X30A 5LKYA 4PMZA 2WHLA 5A5WA 3PJWA 3V0SA 1VCVA 1G5AA 2CWNA 1DE5A 3S83A 4FOKA 1EUAA 2PDUA 4FP1A 3GNDA 4ML4A 2CKRA 4GRSA 3W1TA 1EWDA 2Z24A 3LGDA 1J01A 4M5PA 2WNNA 4ZENA 3GBDA 3BAXA 3TAOA 3NA8A 1JEZA 2C1HA 2QVNA 5BOFA 3BK0A 5LZLA 1W3TA 4HYVA 1G94A 5GVJA 1P6WA 4I5UA 1KBKA 3IJ7A 1HTIA 4XK2A 4DJEC 3AYSA 4E4UA 4JQ1A 1OYBA 3POCA 3KVLA 5AYBA 3M0ZA 3LHWA 2FDSA 3LHVA 2W3ZA 2OLAA 4IXXA 3NQ2A 8XIMA 4LNCA 5PTDA 5HJLA 4Z42C 3AUJA 2WJEA 5GNXA 1GUVA 1TCDA 2TPSA 1R6WA 3ZJKA 3WMSA 3WG6A 4FNUA 1UW9A 3OQ8A 3F5KA 1RA0A 2YB4A 3QPEA 1CEOA 2C13A 3WQCA 1WCGA 3BLKA 4LAUA 4IGSA 4JS3A 3UG5A 2X7VA 2XFWA 3QPZA 2I16A 3S5SA 5MKGA 3M7SA 4I8YA 1I2NA 3NPVA 3BJFA 1WXZA 3W7HA 1ZP4A 2VRQA 1QW9A 1PHWA 1WZMA 4JL2A 3UZJA 4LUTB 1UPMB 3NDYA 2J4GA 3EWYA 1PO9A 2RUSA 1XGEA 3H4WA 3N34A 2VENA 3PAJA 1PVNA 3B0YA 1CXIA 5G5IA 3GR4A 5EY5A 2O4QA 2OOFA 1JNEA 3MS8A 2DSVA 4CD6A 3N2XA 4C6FA 3TFCA 3LN3A 4OIFA 3VPLA 4FX8A 4LVGA 3QY6A 3H22A 2WBKA 2V82A 3IIZA 1JDCA 3W87A 1TZZA 1SJBA 5I06A 3R8HA 1S2TA 3MSYA 3E96A 3P67A 4JTQA 4PTWA 3CQ0A 3MI2A 4PTDA 3NQDA 1MUCA 1Z89A 1GOQA 4Q4PA 5H1WA 1KV5A 2EXOA 3N18A 4KW2A 5HR6A 4H6RA 5KMYA 1YBQA 2J9XA 3QQ1A 4YCOA 3T44A 4DJFD 1U83A 3WD1A 1Y5VA 3PB2A 5K7JA 3IGSA 3THAA 3K13A 1O4UA 1EF3A 1ZCOA 2G3MA 3T2OA 3GNNA 4Q8WA 4RX0A 2P1FA 2WC3A 2F61A 1KBJA 3B8WA 3E2RA 3MCOA 2WCGA 3HG2A 1FWCC 3MP4A 4W87A 1MDLA 1FX6A 4HK5A 5M2FX 1UP3A 3MDUA 1Q6LA 2CLFA 5LIYX 1EA9C 3T08A 2FPYA 3KP1A 3MCMA 2QJMA 4N9BA 3DUGA 4Y6GA 1TV7A 3ZM8A 3O16A 4FXSA 2R6OA 1JDEA 1K7EA 2NT0A 2XSAA 4HMEA 1RK6A 3ARRA 3M64A 3S9ZA 2ZX9A 4QE1A 4FR1A 4E4PA 4PRRA 5D02A 1ITCA 4PTXA 4K1WA 1PX4A 3E49A 3N9KA 4GIRA 3QV8A 1LRNA 3DFSA 3KAOA 5E1QA 1XWYA 3VA8A 2OSXA 1J4EA 1U5VA 3IIPA 4AZHA 2Z25A 3EWCA 3GBEA 3LPGA 2XH4A 5SWUA 4GJJA 1UR8A 2Y70A 3SGUA 2BNJA 2PRHA 3W7NA 3GC4A 3UWWA 2BZNA 1Z3NA 2TODA 3B9DA 1XD1A 2VHLA 4GC3A 2ZKMX 4ADTA 3TSDA 1R3RA 4MPQA 2ZA3A 4XAFA 2XUCA 3CZ8A 1XH0A 2AQOA 1GOXA 3UGRA 3LYEA 1SR9A 2FB2A 4J28A 4XKYA 4MFDA 4BEUA 4NYYA 4C6DA 1C8QA 2CLIA 4EPDC 1T0OA 1UJPA 1OFQA 1R3TA 2XVPA 1HJQA 1E9ZB 2HVOA 3VDBA 4B5XA 3D0CA 3WD4A 1J6PA 4H41A 3CU2A 2NUYA 4L56A 3OHMB 2DSZA 3NQ6A 1H61A 1TPWA 4M56A 2A21A 2CC0A 2AMXA 2VX6A 5EL1A 4UTIA 2DUZA 3CQKA 3UESA 1P0EA 4CQAA 5GNZA 1N55A 4UZSA 1T40A 2OYKA 3FYPA 1I9CB 3HPAA 2RKXA 3F4VA 4BK9A 3BW3A 3MUZ1 4HNNA 2YCLB 4IGHA 3WQEA 3RCYA 5AYYA 1VHCA 5BXPA 4NU7A 4AVFA 3W22A 2DORA 2Z1BA 1WKEA 4ZSUA 4PODA 1NFGA 2E9BA 4PBFA 3A3WA 3RRAA 3WLIA 1EJRC 2VR4A 4ONVA 4D6CA 2G97A 2WM0A 2DH3A 3FX4A 1HIZA 2HBVA 1XFBA 4MDOA 1E9IA 1JFXA 4LUSA 3VXGA 3RF9A 2D0GA 1OC5A 4WQ6A 3CL8A 4J3XA 3CZEA 4AC7C 3LCWA 1QDSA 3MO7A 4C1NB 2J24A 1RSCA 5C2XA 4TO8A 8CGTA 1XCXA 5C71A 3BGAA 3WMLA 4O8AA 3HN3A 4KWOA 2D2OA 3Q37A 3PTQA 2J9YA 4EE9A 2OEMA 3IAQA 1J0YA 2WVUA 4DYEA 6TAAA 4ACZB 2OYMA 3N6JA 5CC3A 5DT5A 1ZLPA 4J5NA 1FRBA 3D6NA 4AY1A 1TYGA 2QCNA 4JIRA 2D3NA 3V35A 2J88A 1GTHA 4OGZA 4B2DD 4X22A 1LDCA 1EYEA 1EOKA 4WK9A 8A3HA 2ZUTA 4DJFC 1LRTA 3C4UA 2VJXA 4CQBA 3NL2A 5EKYA 5FF2A 4JTKA 1J9YA 2P3ZA 3AIQA 3R89A 1ALDA 5CZKA 4HPHA 3UJ2A 1IZKA 3MBDA 4I8DA 1QWKA 4LW7A 4YHGA 1K8ZA 3PZVA 1QATA 5DCDA 1PE1A 3UT0A 1WA3A 2Z2BA 1OJXA 3MYOA 3HM7A 5KINA 4HQVA 1RUSA 2D22A 2V30A 2Y2WA 2YCKX 1P43A 4JIPA 4CD4A 1L6YA 4JTLA 3NR0A 1TPDA 2QAPA 1FKXA 1QOPA 3VC6A 1LUCA 4EP8C 1XSIA 2X41A 4Z2HA 1HJVA 4B5UA 1XDMA 4K2SA 3A4AA 4DAFA 3AMCA 4UR7A 4JL1A 5CPSA 4X0VA 4IOTA 2R94A 4ZCWA 4O0KA 3ZZ1A 3LTSA 1MFUA 3P8IA 4IM4A 1LT7A 1W5OA 2GZXA 3S1WA 3P81A 1D8CA 3HQNA 2DGAA 2R1KA 1LQ0A 2OFJA 5H91A 2GWNA 1JZ8A 3C2OA 3HOJA 1OK4A 4IUGA 1UR0A 3AYRA 4X60A 4QS5A 3MSDA 3S6DA 3F5JA 2X1SA 3KX6A 3L2IA 1U1UA 2Z26A 3VGDA 2PDBA 1W0MA 5AC5A 2OJPA 4MJ4A 4MZ8A 2CW6A 3VNMA 4RE0A 4QJ5B 2DH2A 3C3UA 1HQTA 3MUXA 1N82A 3DH7A 3UETA 4CKQA 1VFFA 1H7XA 3GYCA 4ZO8A 3FEQA 4V28A 1V0LA 1XBXA 1BYCA 2GGJA 3BSHA 1J0IA 4ZQRA 3EGJA 1CB2A 1AQFA 5ABFA 4NJJA 4X61A 2AQWA 3W7MA 2R14A 2YR1A 3H21A 5HA7A 3JZEA 3MSRA 4XD3A 3QC0A 4XG1A 4NNBA 4E0CA 1FVPA 1YW1A 4R5EA 4XSLA 5BU9A 1DL3A 4EF9A 3CIWA 5ABEA 1YX1A 2JK2A 1LWIA 3M5YA 3MC5A 1IEWA 3NXLA 1GHRA 4F0KA 1IXNA 3OG3A 2DQXA 3H4GA 2OO0A 7ENLA 3RPTA 2Y7DA 1OZQA 4NI8A 3TXZA 3THCA 3VNKA 1DVJA 1M7OA 4AZ6A 4DWSA 1QNPA 1Q85A 4H9UA 1KTBA 4C7FA 4PYSA 1R9ZA 4DX3A 4AYSA 5I3JA 4NILA 3Q45A 2HBXA 3ITLA 5D09A 3DZ1A 1KA9F 2YXOA 3PK7A 3QHOA 2BV9A 4Y9AA 1RQBA 2GPTA 1ISYA 4KQNA 1NFPA 4PCSA 4GZ7A 4D6EA 3OGRA 3AU2A 2D73A 2ISVA 4F0LA 2JKEA 2BVTA 1DJQA 3B4YA 3LCHA 2D2GA 4HCHA 4I9AA 3TC7A 2P3EA 4QTGA 1AUSL 5G4EA 4NIRA 2Z00A 1BVWA 3CUJA 2WLZA 4JCMA 3T78A 1QPNA 3DFPA 1W3JA 3STEA 1KW1A 1LG2A 3A4JA 4P8VA 1W5QA 3UZYA 4HT3A 5FEPA 2A3EA 3FEMA 3VOCA 4NJIA 4C6EA 4TUFA 3I4EA 1JZ6A 4A3YA 2VM8A 1CXEA 1ADOA 4DBEA 4HMCA 5G2WA 2PDFA 4HU3A 5DRCA 3BLPX 3SCPA 4BI5A 1WDWA 2W79A 3GTHA 3UZ5A 2PCEA 6ENLA 4WKHA 5DELA 3CUZA 1P5BA 5LA1A 3TFXA 1XYFA 1JZ3A 2PTWA 3QKEA 3GVVA 4K38A 4B4HA 1GKRA 2OZ8A 2INZA 4LPCA 1FH7A 1N8FA 1QRQA 4NXKA 1JCXA 3WK3A 3SCWA 1FXPA 4R88A 4A35A 1C91A 5A6MA 4Q4QA 2Y1HA 1SU5A 5D03A 4IFKA 3LLFA 4FAMA 3C8NA 3MI3A 3ZMRA 3BDKA 4IPJA 4XZMX 3AYTA 4IH3A 3SRKA 3ABQA 4Y9MA 2FZNA 3P6LA 4O1FA 3TQPA 3BLLA 1O66A 3L66A 1VEMA 2ZE3A 3NZ1A 4DZAA 3SCRA 3QMTA 1XUUA 4JHZA 1E4LA 4MTVA 3G0SA 3WLRA 2CYGA 3TYAA 2QPXA 3KL0A 2XWEA 2EG7A 1FHUA 3REQB 3ZVHB 2CZFA 1PBGA 4F0MA 3POHA 2XH7A 4LXFA 4LV9A 1US3A 1W1VA 3ELFA 4IHCA 2DFAA 2FGBA 1X6LA 1W9PA 3AIVA 3LZ5A 4AZIA 3I7SA 3T6CA 4AMAA 1SSDA 5D9MA 1PZ0A 3RR4A 3CHEA 4Y2WA 2I5GA 1MZHA 1FWFC 5HNRA 4M29A 1P48A 4GGBA 3P0WA 3IJ6A 2QDGA 4DQWA 1FWAC 4NZ4A 1BTMA 1UD3A 2QJHA 3J7HA 3AWNA 4PL1A 3KWXA 3HURA 5AHIA 4N7QA 4LEFA 3KXQA 2JQXA 3AU6A 3P8JA 3O6CA 4UOZA 3W53A 4QEEA 4CGTA 1PV8A 1F74A 2POTA 1F5ZA 4UCGA 4DYJA 1JDDA 3CAWA 1BXNA 3SADA 1JDAA 3DI0A 3W7RA 1SW0A 5IHRA 1SZNA 3IUHA 1E6QM 3LV5A 4KIRA 5FJIA 2GUUA 1QHPA 3B8IA 2OLHA 4TX9A 3SUTA 5F2GA 1EXPA 4HMDA 4OUEA 3C2EA 3KOXA 4YYCA 2JALA 1KXVA 3LI1A 2O7QA 1WO2A 2GQ8A 2CITA 3BAYA 1I6NA 4CEXC 1P0BA 1JQVA 3OO2A 1XLKA 1H50A 3TJ4A 3UXKA 3VE9A 3L5LA 3LLXA 5A6LA 1CXLA 2NQHA 3VFCA 5HXMA 4BF9A 2ZRVA 1E9LA 1ZJHA 3BL3A 2PODA 4C91A 4EPKA 4S3DA 4NT0A 2DJXA 4MLRA 4R33A 2AL2B 4CVWA 1FHVA 3R8GA 2QF8A 2FVKA 1L2QA 4EACA 2INEA 3CPUA 3TA9A 3WQPA 4NZCA 5EYWA 4UQCA 5BU6A 4H8UA 3UY8A 1MFVA 3HG3A 1YDNA 4JTUA 4MMWA 5E0KA 4J3UA 1KBLA 1Z7AA 4PL2A 3PTMA 1J2BA 3TSMA 3UVIA 4GKLA 3WFZA 4GYPA 3HGJA 4LV4A 2R8WA 3TA6A 1K7FA 3E02A 2QLYA 4XBJA 4WLCA 3RNDA 1D3HA 4PH6A 1TJRA 1B3XA 3GQYA 4JTTA 3EA3A 1PWMA 1NM9A 1MVYA 4WJXA 4UQDA 2I17A 2P0IA 3MP3A 1ME7A 3HQ1A 4A21A 2JEPA 4JY8A 4L1XA 3C8FA 4AFYA 2VEGA 1M03A 3M0JA 5BW6A 5HNUA 3HG5A 3SQMA 4REQA 2XDFA 3ARPA 2BLEA 1K6WA 4WOQA 1A3XA 4WSHA 1R2TA 3N4EA 5HDRA 3P5YA 4J27A 4J35A 3FGCB 4RNIA 1TUFA 1IYXA 3K30A 5A6AA 3GVRA 3CIXA 5IXEA 1M7PA 2H8ZA 3IVTA 1LG1A 1XLDA 1XIHA 1F6KA 4DBUA 4NAFB 4GBUA 4PULA 4QFUA 1ADDA 1FQ0A 3ITGA 2CLMA 2R1PA 2VX4A 3R1ZA 4GACA 3IV3A 4LWWA 4FS9A 1P6BA 2Q8ZA 3TAKA 1L6GA 1TTQA 1S3TC 1MQRA 1K1DA 3NFUA 5BOEA 1OG6A 3ARTA 1D9EA 3GXDA 4L61A 1RLCL 4W85A 2BGSA 1PB0A 3VD7A 1LOLA 4OE7A 1Q5MA 1YTKA 4PB3A 4V1YA 3IJDA 3PZTA 3N6QA 4DZIA 3GC2A 3MT1A 3R0UA 5IBXC 1GOKA 3PR2A 5FOOA 1X96A 1RH9A 3MVIA 3MV11 3W7LA 3EZ4A 4D6HA 1DHKA 5CCZA 5IBXA 4GYFA 2QF7A 4GY7A 4I9JA 1E6PA 1AH4A 2G50A 1C93A 6REQA 1WKYA 4UTWA 4Z0SA 5M3WA 3SN1A 3EX2A 1JPMA 3GE7A 4YVXA 2VUNA 1BYDA 1F61A 3L4UA 3WH6A 1XIDA 4GUJA 4JIHA 4HA4A 3BAIA 1O6IA 1C8VA 3DFQA 1RBOB 1QT1A 1OGGA 4H7VA 1L8PA 4DI9A 4E2DA 1HG3A 2PTZA 4V15A 4OTKA 4W8AA 3LUTA 3CO8A 1QHOA 4GBDA 1L6SA 4FI4A 4HGXA 1EYWA 1I0DA 2PGEA 3R0KA 1NOFA 3PNZA 4L5ZA 1CW2A 4K1GA 4MDPA 3SSJA 4LBSA 4MY9A 1KM6A 1KTNA 4QIUA 2HXUA 1T8QA 2E1DA 4RPPA 2R1MA 5LXEA 3VKBA 1VIZA 3PBGA 5G1YA 1A5BA 1K8YA 5LNWA 4Z2JA 3TLQA 3R2GA 2NVAA 4DXVA 1JL8A 4HZ6A 1RXOB 3JW7A 2CLOA 1K77A 3G3DA 1DWJM 3LXBA 3SN4A 2PDHA 3L67A 4L1GA 4W89A 3QMSA 1F05A 1JR1A 1R30A 4WD0A 1R8LA 1OZMA 2C15A 1S39A 3RU6A 4CQCA 2AGTA 4LEQA 1LCOA 3MHGA 3BG5A 1VFOA 4Z1AA 3VNIA 2VRKA 5I6SA 1X1ZA 4W8LA 4ZXOA 4PCNA 2EJAA 1H4PA 2IKIA 2D24A 1FWTA 5MF5A 2HK0A 4PN2A 3QBUA 4GQBA 1TJ2A 3R58A 3NYDA 3WN6A 4GISA 1I2QA 4GH1A 3ITTA 2X0YA 1CB7B 4IP5A 4B16A 4DUXA 1WPCA 4LANA 4NKCA 3B0UX 2ZUNA 4DO5A 4TV6A 1EJTC 3LBCA 3WMBA 3JUGA 4AUBA 1Q6FA 4AD2A 1NY1A 3T55A 2QMKA 3KZSA 1KFLA 1F07A 4XKMA 4TVCA 4GUFA 3W24A 2WJFA 3WF0A 3WQOA 1Z6KA 3EDFA 3URQA 3SFKA 3COTA 3N4FA 4GYJA 5AYXA 3KDOA 3EDJA 1AQ0A 2AAMA 2KX9A 3GTNA 3BPWA 1OFEA 5CAKA 2QHAA 5FJJA 2CESA 3ABOA 4AF0A 4LTSA 3W07A 2ZRUA 2TRSA 2WV8A 3E5PA 2OKOA 3QOMA 1H7RA 2HDJA 5CJ5A 2QUVA 3P61A 3OZMA 3DERA 4FLQA 2UY2A 2DDXA 1CPUA 4NX5A 4QE4A 1G01A 4GI6A 3JZUA 3LCXA 3S2CA 1L9WA 2IXVA 3LBMA 4QDPA 1H0GA 4JN7A 4J3WA 1T41A 3S2NA 1WDPA 1ZZMA 2GYIA 3W3OA 3WNPA 5RUBA 1DJZA 1PL9A 5D2YA 4PSRA 4UTHA 3W4RA 2ZC8A 4XSMA 1DKWA 3B0PA 1MSSA 4HNVA 3BG3A 4GQGA 1U5HA 2EG6A 1GORA 1VJSA 3HMJG 1KO0A 4NAEA 1UBPC 4HNOA 1BG4A 3G1HA 2PDYA 4O52A 3KTXA 1YXDA 3SEPA 1R3SA 1FCVA 4KWSA 1C90A 3GNXA 4JFVA 3THDA 3I10A 1R0MA 4TU1A 4ZGYA 2UY4A 4IWWA 3L23A 4GJ1A 4NJHA 7A3HA 1ZB5A 2BDQA 1QCWA 1J10A 5LNUA 8TIMA 1GONA 2WANA 5CGTA 1HJSA 3AYVA 4AVOA 4ZZ9A 4JQ3A 1U2YA 4WXZA 2WB5A 4QGCA 2PMQA 3D47A 3WYZA 2JGYA 1US0A 4CCCA 1TCMA 1QNRA 5F2LA 1KR0A 3PSWA 3LCIA 3SY5A 5J04A 1B3YA 4OBRA 2D0HA 1XCFA 1OB0A 3PP7A 3EX1A 4JQ2A 4OBTA 2WVSA 3AZRA 3S1VA 1D3GA 2XG9A 3RUBL 2X8RA 1LBMA 1IIHA 1DIEA 3AWOA 3A24A 1QW8A 2DW7A 3GIYA 1SUXA 1H41A 4WHBA 3T8QA 4LCRA 4J3VA 2HXTA 1P0KA 8XIAA 3SZ8A 4ZOCA 1O5KA 2E5DA 4FMVA 1NF0A 3ARYA 4IG2A 1JPKA 1J5SA 4YPJA 2PLCA 4DWSD 3UP8A 3EDKA 2B31A 1MNSA 2GOKA 3GFXA 3SCOA 1A5MC 3OOQA 2YCJA 4GINA 2PF0A 2O4MA 4LRTA 2DZUA 3T8LA 2C0AA 1XC4A 5CJNA 2DPEA 3IK2A 4IF2A 4GK8A 1KGWA 3CZGA 3B97A 1H60A 1FCUA 3R11A 1W37A 2CFFA 2EKCA 1UR9A 2XH2A 3EPOA 3SJNA 4UR9A 4WKAA 4KS0A 3KTCA 5F1UA 3IVSA 3B03A 1XC6A 1OGBA 3M0XA 3OLIA 1VR6A 5AOUA 4U28A 5JVLA 4GABA 2E5BA 1NQKA 3FXGA 4Q4MA 1RJPA 2YB1A 3MTWA 3GH7A 3WDQA 2A6LA 4JQAA 2F2KA 1CCWB 2P76A 3CJPA 4CUCA 1LLZA 4B91A 2QUTA 4O15A 2BOGX 4E2VA 3W37A 4O1CA 1ZS2A 4C6IA 2FZ9A 2PFHA 1CECA 3FOKA 4WDWA 4LQ1A 3TJIA 3A9BA 3H7UA 2O92A 1X97A 1Y65A 1UWTA 1VFLA 4BY3A 1TV4A 5H8UA 3QV7A 3VGEA 5FJOA 2X16A 5K2ZA 1WQ5A 5LHEA 5C6MA 1XLGA 2KZHA 4K6AA 1L6WA 2W62A 4KGJA 3BCDA 1MZRA 4KCWA 2JFEX 4U2YA 2VFHA 3WZ0E 2C3ZA 4DJDD 2UZ9A 3H2NA 3NOEA 4QJ3B 1TV8A 3AIWA 3VZYA 1I1XA 4BQ4A 2OSWA 2WAGA 1VYSX 1WKDA 5JXQA 1EF2A 3ANVA 4QSHA 2VZSA 4A3RA 4G9PA 2UV8G 3W7OA 1GVYA 2ZE0A 1S2VA 3L7RA 4ATDA 2YBVA 4BF7A 3WNOA 1AW5A 4NUWA 3W7IA 2QQ6A 1ZTVA 4QSFA 3UJRA 1IGSA 3VMPA 3WJYA 2D2HA 1VKFA 2A2IA 3QQ0A 1Q6CA 4Z08A 1ONEA 3NEVA 3L5AA 2VEFA 3S1GA 4DM2A 1QI3A 2QUNA 1V3MA 1J96A 1CGYA 5CEWA 1MUMA 2XGBA 3GHUA 4S3AA 1V0NA 2BX7A 2F9RA 1K02A 2ZXBA 4HU0A 1B57A 4A3HA 3GDKA 3CV6A 1AA1B 3ZS4A 3DENA 1M1BA 1RZMA 2O9TA 5EMLA 3G6LA 1XLAA 2WJZA 1TQJA 2WMIA 1H7WA 1KBIA 2C19A 3A21A 4URIA 3JS3A 1RVKA 2Z28A 5E9AA 4ZFCA 2YOCA 2J13A 4M81A 1RHCA 3K2GA 1SZRA 4FB7A 1WX0A 1UZ4A 2PWVA 2WMKA 1KCXA 4LSBA 4WZHA 2JKPA 3DCPA 2ZBTA 4J3ZA 2CBJA 4UTLA 4DBDA 4IQDA 1BRLA 3MUIA 3OLGA 4WSKA 3TYDA 4U3CA 4GLEA 1XF0A 1J79A 3OYXA 1SMDA 1XIEA 1D8WA 4A22A 2XH0A 4J9JA 3QW4B 3OODA 3VE7A 4DIAA 2DZXA 4MNKA 2XVLA 3G77A 3VNLA 3S0CA 4XBKA 3K46A 4K8HA 3U48A 1ICQA 2O0TA 3M5XA 1HKKA 3ZR5A 3AROA 1BD0A 4QROA 1J8VA 4PMVA 3TTEA 3H4XA 2C6QA 3KRZA 7TAAA 2OGYA 2WVTA 1AH3A 3HA1A 3QRHA 1IWPA 3SO7A 3UJSA 3EMZA 3H2OA 3VM7A 2DT3A 2IPWA 1WXYA 1P4CA 4MADA 4CNTA 1WBJA 3VD9A 2A79A 1OF8A 5CBBA 1OCJA 1CGTA 2NV9A 3GR7A 3WD0A 2TAAA 1F73A 1W1ZA 3VIPA 4MJMA 1A0CA 3HB9A 4B90A 3AXMA 1YE4A 1E70M 3PZGA 1XG4A 1NJJA 2X09A 3QYQA 2XFRA 3URAA 1VJZA 4RZ4A 3MMWA 1DP0A 4D9PA 4AXKA 4INFA 2YIHA 3TH6A 1R86A 2JKAA 2PTXA 2Z6JA 4ERAA 1EEXA 5GJPA 3BCJA 3W83A 1IWAA 4MB4A 1A50A 3BC9A 1E6NA 4NJGA 3W02A 4YXGA 4O17A 4E2BA 3I7QA 3RRXA 3AS2A 4O19A 3N2TA 3BLDA 2YW4A 3H70A 1LL7A 1R46A 2XN1A 3RAOA 1TA3B 4XZBA 3H2FA 4FNSA 1OX4A 1R5YA 2VFEA 3TR9A 4QLLA 1J93A 4NVTA 2FGLA 1NF7A 4IPIA 2D20A 1EP2A 3RLVA 3MZ2A 4G8TA 4M3PA 4R53A 3F2DA 1FWJC 1A53A 3SRFA 3TSBA 4TX8A 4DJDC 4ZTYA 3ES7A 5HMFA 1I2RA 4FXFA 5DY3A 3K1GA 3PG8A 3P2VA 4J3SA 1DJXA 3PUGA 2WMJA 5KZEA 3S3GA 1O60A 4XUYA 3QTGA 3U3HA 1KM1A 4ZQMA 2GDVA 1FP9A 3EA1A 1R87A 4LGXA 1ITQA 4GX9A 1X6UA 4AVNA 4CEUC 4UOQA 4WXYA 3WUEA 1RLDA 2AAAA 2BY0A 4O54A 3VGGA 1QR7A 3W26A 5KZMA 2PLKA 4NRRA 4E2OA 5REQA 1YE6A 3R12A 1O5RA 1XFCA 3QR0A 3G1AA 3AS0A 4M24A 1S46A 1KXHA 4O10A 2A3HA 3KHJA 1QBAA 1P0DA 1B54A 4P7LA 3MHFA 2ZC1A 2HNHA 1E0TA 1FDJA 4DBSA 1VFSA 1M68A 1RQHA 3VKAA 4U3AA 3OZPA 2ZICA 1BSLA 1NP2A 1L2UA 1E72M 4Q4KA 5XIAA 2CLHA 2FH8A 1IEXA 2Y7GA 3BLFA 5DEZA 4D1JA 4S3GA 4PUDA 2XVNA 3WQDA 4QNEA 3W86A 2BXYA 1BQGA 4U10A 2DU2A 3ABXA 1GJPA 5HBFA 3C2FA 3U5YA 4KRUA 1JAEA 1Q4WA 3N2OA 4UWMA 2WLYA 2ISSA 2A3CA 3WUBA 1MW1A 3SBFA 1CZ1A 4LBUA 2IS7A 4HHHA 4HVXA 1JI2A 4GUHA 4JGDA 1GQKA 3VIIA 1TIWA 1HKIA 1MEHA 3CB3A 1H1YA 1KGXA 4YWIA 1OK6A 3QSRA 2QCDB 1XX1A 5XIMA 3G1YA 4P8WA 4ZXLA 4KH2A 5I2UA 1QPOA 4KF1A 5BXSA 1HXJA 1GQLA 1VIWA 2JEQA 4X9YA 4Z17A 1EX5A 5TNVA 4C6LA 2XN2A 1DTUA 5AC4A 5AVNA 2BB0A 1HN1A 1ML1A 3G2GA 6A3HA 4G56A 3WQFA 1J12A 2PLJA 1SGJA 4A8NA 3W1QA 5BXRA 2ISWA 5EMYA 3N9RA 3PZIA 4JX4A 3GDTA 1UR1A 3MWCA 5M1TA 1WKFA 2Q8XA 1ODZA 2P8BA 5BZAA 4J4KA 5CPLA 5A6SA 2XIMA 1KRMA 4HHLA 3V0UA 2PDWA 5JIPA 4R7OA 4M19A 1XRTA 4FLOA 5IOBA 3L0KA 3BSMA 1VRDA 2BS9A 2E8YA 4KWWA 3V1PA 4S39A 3URNA 3WQGA 1IE7C 1J2WA 1TQXA 3T07A 2VGBA 3WQ5A 2V2DA 4AZ7A 1XL9A 1B3ZA 2OWXA 1MYRA 4AU0A 2YBUA 4MWAE 1ZAIA 1UH4A 3IIXA 2L5HA 5D2XA 2YL6A 3ALFA 4O4WA 3B8TA 2BGQA 1U5JA 1Q66A 3L4ZA 3GNOA 4K37A 3AZSA 3ZT5A 4XISA 1S2UA 2AKZA 4AHQA 2ZZ4A 3GTIA 4XD4A 4Q8PA 3ECQA 3IEBA 1NDWA 3W0KA 2QJJA 3G0XA 4Q4OA 3ZLHA 3LS9A 3W00A 1OX6A 2CWXA 1LWHA 4I6VA 3CASA 2ZVIA 3GW0A 1SJDA 2WSRA 1V6YA 2ZUVA 4PB4A 1TVNA 1UC5A 2Y5JA 4R3UA 3HV8A 3P5ZA 1G7UA 3C86A 1EDQA 4OV4A 4AZBA 1QI0A 1NSJA 3DHDA 3LPFA 5CZJA 3ZJ7A 1W9VA 2R91A 2V5KA 2R1NA 3MQTA 3OLEA 3O1NA 3RIKA 3AXXA 2VC7A 4CU8A 4UFHA 3S1UA 4IL2A 1MW2A 1R7OA 2PDPA 2EPOA 4G7EB 2GVEA 1MRQA 1VBHA 2W67A 2I7GA 3S46A 1E5JA 1CENA 4Q8OA 4NZ5A 3WF4A 1DV7A 4BWLA 1B2YA 3U7BA 4D6GA 1YQ2A 3EBVA 1KR1A 1ECQA 3LMZA 3U0HA 4HKPA 5E9XA 3AI0A 3BQ6A 1HX0A 3K8MA 4ZVJA 1RBAA 4ORMA 2V68A 1XBVA 2UWFA 3OA3A 4O57A 3CH9A 3R4IA 4L4PA 1H0IA 3T0CA 2B7PA 1GNXA 1MUWA 3KE0A 4E5TA 4UTMA 3SSZA 3S5ZA 3N73A 4H8HA 3HGOA 3M0LA 3OHIA 3GXFA 2ATSA 1TZ7A 4JYFA 4H2HA 1BPLB 3TIMA 4ZE4A 2Z1SA 2MUCA 2D69A 4HPNA 1UKSA 2E9MA 3RLGA 5A8QA 3L4VA 4KKXA 3WH9A 3F4NA 3CUIA 1VFMA 3CTLA 3OVPA 3V18A 4G1NA 4QE5A 1V6UA 2WM1A 1A47A 3KLKA 1GVRA 1OD0A 1Q13A 5DLCA 1NU5A 2GWGA 3AIUA 2C18A 3DG7A 4AQLA 1CYGA 4OFCA 4KFPA 2Q3RA 3WJSA 2DIJA 3E1F1 3VI2A 1UH2A 1VYPX 4RDVA 1M7XA 2WHKA 4X9SA 3INPA 2PS2A 4AD5A 5D05A 1JJKA 4JTGA 2HPMA 5CGMA 2Y85A 2BY3A 2DW6A 3CZKA 4C90A 3CXOA 4GCXA 5EPDA 5FF3A 3TN3A 3VVGA 1W8GA 2GK1B 3ERPA 3G1XA 4H8VA 3VNJA 3VM5A 3LM3A 3SCTA 4MUZA 2YFNA 5AZ1A 3E0FA 4TMBA 5DXYA 4C7GA 3NCOA 4GMEA 4FO4A 3K4AA 1F3WA 5A2AA 1N7KA 4AY8A 3TTYA 1P6CA 1Q4NX 5BRQA 4K68A 4JR5A 4JNYA 2CZVA 4JFUA 3S2LA 3LU2A 1UOKA 3SCVA 3ZJ6A 3I3DA 4QP0A 1EXBA 1C8YA 2FTPA 3MMDA 1L6FA 4BHYA 1AD1A 2PF8A 1HF6A 1S38A 2Q01A 3MKCA 3LPPA 3WDIA 4XAGA 2NWRA 1Q3NA 1JYXA 5B7ZA 1REQA 1YNQA 3B4UA 1WAWA 3QZAA 3N2CA 5I3DA 3GDBA 1GJWA 3W81A 2D0FA 1KWGA 3UPMA 3GLCA 4AAJA 1MXDA 1EO7A 4QITA 2B4GA 3UYIA 4FA3A 4MB5A 1V79A 1W5MA 1B4EA 3O3RA 1OHLA 3IUDA 1EOMA 3UF9A 4DHGA 3HJZA 3KS6A 3W71A 2W63A 3QZEA 1W6TA 2VUYA 4X63A 2OX4A 1MI3A 2BY2A 4X2PA 1H7NA 5D8ZA 1ZJBA 2C1IA 4RDZA 5I3HA 4BQ5A 2FYMA 3GU2A 2ZXAA 3OPSA 2I5IA 2NQLA 1E9YB 1IF2A 3FVMA 2OEJA 4ZOAA 3M0MA 1EJ7L 3KLLA 4OWGA 4TMCA 5LIWX 2PTDA 4MAZA 3KVMA 3G5EA 3WBAA 4NXSA 2WMHA 2JGQA 3LRKA 1E40A 3GK0A 4IPNB 3BOXA 3QMRA 4IPPA 1MO0A 3VOFA 1TRDA 3W70A 2E6FA 2WO5A 5EMMA 3S9YA 1G69A 9XIAA 4S3JA 3DHPA 3TWBA 2CLKA 3RO8A 3BZGA 4WJEA 2VEIA 5T9CE 1MMFA 1Q63A 2CBIA 2VOMA 1VCGA 1OGSA 4HU8A 4JFTA 4QQUA 1DE6A 2ZZ2A 3O7UA 3NEHA 4H2CA 1A5OC 1ITUA 3UCDA 1WUFA 2VD8A 3TXVA 2Y6ZA 3ICJA 5LYRA 5LGXA 1W1A1 5JBEA 5JH1A 3VUPA 1F3EA 1AVAA 2PA6A 2GGEA 4IQLA 4UNKA 5C7HA 2BVYA 4LF2A 2ZWZA 2Z4GA 1MQQA 2QULA 1XHGA 4H83A 2P0OA 2CBUA 4O18A 2Z6IA 1GQNA 2YA0A 1ONRA 3G1FA 2VDHA 1KB3A 3GZAA 1NWUA 2IKHA 1J5TA 1LQ2A 1VEPA 4IIHA 3WEZA 1PIFA 4MLJA 1KFEA 1GOIA 3IUIA 1RP9A 4MFEA 3GZ3A 2XZ9A 2J27A 3MB9A 1CNVA 2NLYA 4UMBA 3ORWA 2VCCA 2E77A 1KV8A 1PDYA 2EKGA 5A69A 1QU4A 4AZCA 3LCLA 1VH7A 4D8AA 1F4AA 3JU2A 3LRMA 4V1XA 1JUBA 1AODA 4E6MA 2Z7KA 3CZJA 4QXIA 1DIKA 4MNLA 1F9CA 5B7YA 2NVDA 3GUWA 2QVHA 2V81A 4UCFA 3W7CA 4HSHA 2BOFX 3VNYA 1CLXA 1VBUA 3TW9A 4CU7A 3W7JA 4ZTXA 5HJYA 2FQIA 1EGZA 1AK5A 4H3DA 3ARVA 3VIHA 7TIMA 2PRLA 3NQEA 4PCTA 4IGMA 2OWWA 3P14A 3QGAC 4UUIA 3OBKA 5CBJA 3RG6A 4I90A 3PG9A 2PWEA 4RJEA 3PHAA 2ZDRA 1PXGA 5FACA 3QFWA 1XISA 1XYAA 2CERA 3IVUA 2H6RA 4R7JA 1GYMA 2QDDA 3AHVA 5AYZA 1A80A 4AZ5A 4PMUA 2ATMA 4DELA 3GG8A 1VPXA 4C6QA 4S3CA 5AKQA 4Y8EA 3NUKA 4RDYA 3QPYA 3TW7A 3GXMA 1DIOA 5JBDA 4YWSA 1JRBA 3GU9A 3B8DA 2E09A 3EKZA 1TJ0A 4US5D 3WLTA 3A23A 1ITXA 2NSXA 3P74A 4HJFA 2CLEA 3LY0A 3PFRA 5HOSA 1FTXA 1XSJA 4N0RA 1ZUAX 2B7OA 5CJMA 1S1RA 3GHTA 4LVAA 3QF0A 3ARSA 4RV8A 1FOBA 1XP3A 2ZWYA 4LALA 4KEUA 1W32A 2PWGA 4S2BA 4Z1CA 4PUUA 1QAPA 5AZ0A 1KKRA 4OU1A 1L0PA 3ABZA 5D2TA 1ZQ5A 1DORA 5LSMA 1IWBA 3Q94A 1P1MA 4GY0A 1PX8A 4WY0A 3C0JA 4NJKA 2HVNA 3LGGA 2OGJA 1R47A 4FLRA 1RPXA 4AIUA 3C0SA 4IP7A 3W7PA 3LB0A 1WUEA 5J5DA 2X2GA 2FKPA 2CHNA 4O0QA 1UUMA 2BHUA 1EA0A 1IEIA 1RY8A 4IIFA 3TC3A 2PZ0A 5EU9A 3WDJA 4DPPA 3EWDA 3TMLA 4H9TA 3PM6A 1XDLA 3U9IA 3G8EA 1EQCA 3O9NA 4JFWA 2BSLA 2QCEA 3ZLFA 1NARA 4D6JA 1SMAA 5FD0A 1XR2A 1US2A 4BZYA 1W17A 1UKOA 1OABA 5FJPA 1I4NA 5AC8A 4EAMA 3UXIA 3PZQA 2WW5A 1EP1A 1XLHA 1MW0A 4JHOA 2IQ0A 3CMGA 3P82A 1A0EA 1G1YA 1JULA 3OP2A 1YKWA 4M6UA 3SAZA 1BF2A 3USBA 2V3DA 3KBVA 3W2UA 2X1IA 5CSRA 1S1PA 3AICA 3TKFA 4WUIA 2DY3A 2QR6A 2OOGA 2JF7A 3AHZA 2PB1A 3UXLA 2QMJA 3BLOA 3EEGA 1Y0EA 3MYPA 4MWAC 1HL9A 2J66A 1AJZA 5TIMA 1G67A 3W1MA 5KITA 1E0VA 2NX3A 4JXCA 1OVDA 2G0WA 4GC4A 4C6MA 2ZQ0A 1EJSC 3LENA 1KXTA 3PWAA 4MWAA 1W3LA 2PPGA 3UA3A 3PBUA 2VFFA 1V3KA 4DXXA 3I4KA 2J7BA 4J2MA 5CZTA 4HJWA 1XKYA 1ODUA 2EG8A 3AHTA 3W7GA 4QG9A 2BHYA 5A95A 2QCMA 4L65A 2OEKA 3TTQA 3FHQA 1W2PA 3GAKA 1DTNA 3ATYA 4E3TA 2VL4A 2GQAA 4DI8A 1JVNA 5HMEA 3WQ6A 2Z0IA 3KCJA 4GD0A 3G1VA 2ZZ3A 1EKOA 4HB7A 4HZ8A 3VOJA 3NQAA 4YVPA 4CCEA 4EXQA 3OVRA 2HCVA 5EBUA 2BG5A 3LNPA 1LZOA 3STFA 2PP0A 2PC4A 1V51A 1EJXC 4ZE5A 3C2RA 5FIPA 1R9XA 3RDKA 3TUUA 2GJXB 4LVDA 3OJGA 2TYSA 1CI1A 2HE8A 5CPQA 4AB4A 4HD5A 4FOUA 1B90A 1E15A 2V3FA 1Z42A 1IHIA 3W27A 2Y5EA 4JTHA 4NP7A 1EJWC 2DEPA 5BMWA 1X7IA 4NF7A 1UR2A 4L6HA 1TIMA 3UYCA 1XLMA 2X2YA 1XG3A 5LNSA 2VFGA 4UTTC 3VKDA 1GPWA 2HV5A 1B9BA 3LBOA 4DJEA 2GSEA 4JD4A 4PEKA 2AQVA 4XVEA 1BWKA 4OOUA 3B8SA 3HZ3A 2VX7A 4JBRA 4H1ZA 3WF1A 1TR1A 4BJHA 1K9FA 3R10A 4WKFA 4ML9A 5LIKX 4IMEA 1RCQA 1I45A 2AMGA 3PPHA 3WK0A 3RX4A 1M41A 3NQCA 3LX9A 1UKPA 1UUOA 1XIIA 1V03A 5D38A 3W2NA 1X1NA 3AISA 4V2XA 3N12A 3UZZA 1H1ZA 1E6XM 3M0YA 2NQ5A 5BOOA 5G2HA 1G6CA 5LA0A 4O14A 1ZPTA 3EWZA 3GKAA 4C6JA 3A12A 3K1DA 3MO4A 1M5WA 4DYKA 3U2EA 1XPGA 1OFOA 4CLMA 2C8NA 1WZLA 4QHRA 4XX6A 4XZIA 6ALDA 2WWDA 3PZUA 1YNYA 1QUMA 1OC6A 4B5SA 5CG0A 3LDVA 3ITCA 4H6QA 2QS8A 3SRHA 3L2MA 3KM8A 4F40A 2I57A 3M47A 2VEMA 2OB3A 1LORA 1AL8A 4JN8A 3FAXA 3VZZA 4A29A 1JZ7A 1ZNNA 1V93A 1XIJA 2G96A 3NL6A 4WGXA 4XIAA 3SUUA 3KVKA 2NT1A 2Q09A 3ES8A 1Q6DA 1W9BM 4Z0JA 3QN3A 3HG4A 2OWCA 3FK4A 1VP5A 3B05A 1BSIA 4NG3A 3GY1A 1PIGA 3QGKC 2YZ5A 3RHGA 4A8IA 2NXGA 1T5AA 4RLIA 1KM3A 9CGTA 1LLOA 4IP4A 4CQ9A 5F2IA 2YXGA 3C2YA 4IMCA 3KEHA 4POCA 7REQA 5H6HA 1EFZA 1PHQA 1V02E 2EHHA 3UEQA 3WDRA 1TSIA 1JXKA 3U4FA 3KL3A 3CPGA 2YLAA 5AYIA 4JTRA 2XJ7A 2X1RA 2Z27A 1EPXA 4G5DA 4UZUA 3NQFA 2DZSA 1IGWA 1W3NA 2FIQA 2O9PA 1K03A 1FWNA 4NSBA 3S5OA 1XLEA 4W93A 2REQB 5KZDA 5IDIA 1HKJA 3KOFA 4ADUA 4AMCA 2PDLA 2DZWA 4ACYA 5FESA 2WVVA 4O11A 3G3MA 4D2JA 1A3WA 1G4PA 2HQAA 3GXPA 1S5TA 1D7KA 4LS2A 3PBWA 3E0WA 3BAWA 3BAKA 3FY1A 5KZ6A 2EAWA 5E93A 3C56A 1PWLA 3BTNA 3DYOA 3EXRA 4GX8A 1RV8A 3IIOA 1DPMA 1X39A 3W1NA 4FF5A 2HPIA 3UXAA 1XLCA 1VZWA 4KEMA 5EMJA 3M0IA 2XIQA 4HHMA 2WSPA 1Q8AA 1OY0A 1LP6A 3NSXA 2V5JA 3CAQA 4G2DA 1WYIA 1UKQA 3WUGA 5E6YA 4C5YA 6TIMA 2X0HA 3EKGA 3C52A 3IWPA 5JBFA 4XO7A 1GOWA 2CZ5A 1EC7A 5DRIA 3IJ9A 3AS1A 2VFDA 2GL5A 1V08A 4Q4SA 4HK6A 5A2BA 3PBVA 3OB8A 1WB0A 1QFEA 1Y5WA 3DFNA 3GB6A 4O8RA 3VK5A 1HP4A 3QY7A 1UP0A 3E9AA 4LUTA 3S9IA 3HBLA 3DYPA 3O07A 2J47A 1MNZA 3QLLA 4D6DA 1B9ZA 5HNNA 1FP8A 1YNPA 1LTDA 3P3BA 3GRIA 3ARUA 1AFSA 4QQ3A 4O16A 3WLJA 1QXLA 1RK5A 1OCQA 4AC1X 3AIBA 3ATZA 5HMDA 3VIJA 2DT2A 1BFNA 4PCPA 4YN5A 4PBEA 1A3HA 4C6PA 3HMCA 2VCAA 2Y8UA 5ECVA 5A6JA 4LAZA 3L5MA 4RV3A 1R3YA 2NX1A 1JXJA 3IIVA 5JQ9A 1C9DA 2CU0A 4QEHA 4IMAA 3GSMA 1QMLA 3W2MA 3FYOA 5LIUX 2G3IA 5F2MA 5CKSA 1CDGA 1YPIA 2X0SA 1RY0A 5L6UA 1JPIA 4H6KA 2PGRA 1NDYA 3FYYA 1F6PA 2HSAA 3TZNA 1TZ9A 1EJUC 3OZYA 3CM4A 2PP3A 1TPVA 3T42A 1AH0A 3KUMA 3LNMA 3CMFA 4S3KA 1VGAA 2J7CA 2PSNA 2PURA 4DJFA 1K8CA 3MUAA 5DT7A 1H3GA 2P53A 3WNNA 3LRLA 1DJNA 1U33A 3L2LA 2GLKA 1GZGA 8RUCA 1FY6A 4BA0A 1GZJA 2FGZA 2NUWA 2A85A 1O1ZA 3NPXA 4NY2A 1TTIA 3GDLA 2VZUA 1WDDA 2DV0A 3RM9A 4ZR8A 4DBWA 2BFGA 1FH8A 2BP1A 1AMYA 1LOSA 3CK5A 3U5UA 1OC7A 3UR7A 4GE8A 4HSNA 3VKKA 1ONWA 2JBMA 4A2SA 1BXCA 3PJUA 4IMDA 4PRWA 5D37A 2CHOA 3TWAA 3RILA 1DXFA 4GKTA 3OA5A 4L4MA 1CLKA 1E1CB 3KRUA 4XWUA 2DZAA 2REQA 4GYKA 4M82A 1W2VA 4EX4A 4PGLA 2OG9A 5A94A 2ZTKA 3H2EA 1UWSA 2WNWA 4W88A 4F4RA 2KAUC 3GIQA 3WQ8A 4Q8NA 3RPDA 3TTOA 2Y89A 3ZIZA 4B5NA 1XLIA 3A3HA 4K7YA 1R3QA 2C71A 3BOLA 4S3FA 3EOLA 4S23A 4O1AA 4YTTA 2DT0A 5HQLA 3KRBA 5ABHA 1XIMA 1G4TA 3M5ZA 3OLDA 1LQAA 4RZ5A 5AHFA 5CBIA 1F3TA 3T81A 4ZO7A 4AWEA 2H3BA 2PDKA 4ICNA 1AJ2A 1P7TB 4PUMA 3PWIA 5I3IA 4TX6A 4Q8QA 2B81A 2VEKA 4N6FA 1OT1A 4CNPA 4F3HA 5BRPA 1POKA 2XISA 4UQBA 3RCNA 3LK6A 1IXOA 3DESA 3GDMA 4QG8A 4Q8VA 2YCLA 4XAZA 1BEUA 1KLZA 3NSNA 4HA3A 2NZLA 4LB4A 4JN6A 1QI5A 1E4IA 1JCMP 3W75A 2PD5A 4QX4A 3SY1A 4LUJA 4ERIA 4IGNA 4FSAA 4JHMA 2POZA 4KGLA 3T0TA 5J5RA 4AISA 3B3DA 3I6RA 4B9ZA 3ZWSA 2HJPA 1CGWA 2H9AB 4GHRA 2WC4A 4DUOA 1UKTA 3BE7A 3N17A 3WBWA 3VOHA 4JYDA 1HL2A 1RALA 3QV9A 4JNZA 1O1HA 2ZZ7A 3MDWA 3GS6A 2ZRXA 4NZ3A 5B80A 1QBBA 3WD3A 2VD9A 4UFIA 1KQYA 2Z1XA 2OELA 4C1NA 3C61A 3SCSA 1V3IA 4UFMA 3ARXA 2PBOA 4W8BA 3TJLA 5LIXX 3SIZA 3VKCA 3N19B 1ISVA 3NO5A 3PAOA 3ZOAA 2Z29A 2X05A 1KQZA 3VC5A 2IMRA 3MMTA 4EAYA 2YBTA 1TPH1 4HU4A 4RE3A 3L4XA 1A4LA 2E9LA 1MEIA 4ACZA 1KRBC 4F0SA 3DYMA 3CPRA 2NXIA 3CYVA 3EAUA 3RMEA 4GI9A 5CPTA 4IMGA 5A8GA 5C9UA 1E43A 4H19A 2J7HA 4CN1A 4LVFA 3O6AA 2PRMA 2YKKA 1PSCA 5HQMA 3UWVA 4MYXA 4QLJA 1AW1A 3XISA 1ME8A 3FSTA 4Y9OA 1Q6GA 2QCLA 3LZ3A 4I7WA 3VOGA 5TAOA 5CLTA 3NNTA 1GOMA 4FNTA 4B2DA 4GG9A 5CSYA 1W56A 4KEVA 1V0MA 3FS2A 1KNWA 1TPUA 4JTFA 1FWBC 1P1XA 3DHUA 3UD6A 1DXEA 1QHZA 5FA5A 1TPC1 3ZLGA 3PTDA 5ECUA 1LT8A 1JF6A 2BTMA 1XIFA 2VRJA 4E8DA 2BXZA 3IRDA 4HMNA 4CNNA 3PVFA 3HTWA 3H7VA 1ECEA 4M6PA 3H12A 4LY8A 1XW8A 2XFYA 2V5BA 2ASHA 1PZ2A 2AGKA 1ZL1A 4N9CA 1RBLA 4HZMA 1R2SA 5T91A 1EBHA 3R25A 1D7FA 3M16A 3WK2A 3BMWA 3W7EA 3CEUA 1S2WA 2CKSA 1TREA 4LYPA 1J0ZA 4W7WA 1UBSA 4C1LA 3W74A 4XB3A 1VD6A 3BLIA 4PTNA 1ZBVA 3LA4A 1FA2A 1VBGA 2D23A 4DY1A 2BBFA 4WR3A 1JUKA 1UWRA 2VEPA 1RD5A 4YS1A 1QNOA 2FTYA 1SFLA 3W01A 4JNMA 4UTKA 5CSUA 3URBA 1TWSA 3RPMA 1VBJA 3UERA 2XIJA 5I07A 1OFPA 4WDTA 1HKWA 3MCNA 1XH1A 2E5CA 3UY7A 3PZNA 3KVJA 1AQHA 4QDMA 4PUWA 1HNYA 3T09A 1F2JA 4LAKA 1P0NA 1N8WA 4L6DA 1HW6A 2OQYA 3W6YA 4LFYA 2JE8A 2V2HA 2RFGA 1O5QA 1U30A 2WSKA 5GQBA 1CLVA 1OSEA 2XHYA 1YEYA 2R24A 1BXBA 4NZJA 1SM9A 3CC1A 4YCPA 1UWQA 3SCUA 3V5FA 1KTCA 3WY1A 1B3OA 2BGNE 2GJNA 4DPQA 1FCQA 4HYRA 3TYEA 1EJVC 1FFQA 1I1WA 4PBGA 4N9DA 1GW9A 4DJED 2J6XA 3KBWA 1NP0A 3B0VC 2E8ZA 2QZRA 4R9XA 3RX3A 1PCWA 1M9HA 2NX9A 2V63A 1UR4A 4M6VA 2P50A 3ITVA 1A5LC 4N4PA 3SCQA 3AO0A 3MMUA 1DQWA 3AIEA 2JF6A 4YL2A 3TZFA 4GNJA 1JGIA 3W29A 4A8RA 5DF0A 1I8JA 1EHNA 3P60A 5EFFA 2Y8KA 3DFHA 2XINA 3BG9A 2IQTA 4W4QA 1LJYA 4HTYA 1ONXA 5FJTA 2NWSA 1RAKA 3N15A 3VKJA 3H6OA 2WJDA 2NV2A 3MY9A 2J8TA 3UQNA 1X38A 1XLJA 4Q3MA 3QHNA 3H7RA 1OADA 1V02A 2V6AA 4ECLA 5MKGB 3DHFA 3VD3A 2PGFA 3MBFA 4I5RA 1T6MA 2PDIA 1UA3A 5J8LA 1UD2A 3M1ZA 1T99A 4ZB5A 4DRSA 1HUVA 1UYQA 4UFLA 5LNVA 3CV1A 1GKQA 2V5CA 3KS5A 5HWNA 3UWQA 4Y9NA 4LX4A 2WKLA 4O0ZA 1JYNA 5KSWA 1GVEA 3KFTA 1ZBKA 3ISIX 1Z9AA 5C2CA 3W85A 1YRRA 1O95A 3B40A 4M1RA 1EWEA 2O9RA 4DO7A 2VQTA 1FWRA 3S2JA 2CBVA 2PEVA 1OINA 2J78A 2DZTA 1E1EA 3TP4A 2CXGA 2XGZA 3CEPA 3RK8A 1EIBA