3R7MA

Akr1c3 complex with sulindac
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
316
structure length
303
Chain Sequence
b'QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Crystal structures of three classes of non-steroidal anti-inflammatory drugs in complex with aldo-keto reductase 1C3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 117
structure length 303
sequence length 316
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3r7mA00
5HNTA 4ZFCA 2I17A 1PZ1A 3N2TA 4GACA 2PFHA 2IPFA 1AH3A 1ZSXA 1PWMA 4YVPA 1XGDA 5DANA 2HE8A 2PDBA 3P2VA 1T40A 3NTYA 4WDXA 3FX4A 3D3FA 5LIKX 3UFYA 3G5EA 3O0KA 3H7UA 2ACRA 2DUXA 4LBRA 4FZIA 3FJNA 5LIYX 1RY0A 2PDLA 3V36A 4WDUA 3RX4A 3WBYA 3UZZA 2R24A 2I16A 5LIXX 4EXAA 5AZ0A 1RALA 3MB9A 2ACSA 1MI3A 3Q65A 3R58A 4DZ5A 4XK2A 3M4HA 4L1XA 2ISFA 2AGTA 2HE5A 1AZ1A 4XZHA 1EL3A 4PRRA 1Z3NA 3CV7A 4WGHA 2VDGA 2PDIA 1S2CA 4MHBA 1A80A 3COTA 1VBJA 2IPWA 2J8TA 4XVDA 3M64A 3DOPA 3CASA 4G5DA 3BUVA 1HQTA 4YU1A 3R8GA 2FZDA 1Z89A 4QX4A 1JEZA 4EXBA 2INZA 4JQAA 3GHSA 3ONCA 4L1WA 3DN5A 1ZUAX 3GHUA 4NKCA 3G1RA 3KRBA 1LWIA 3V0SA 3BURA 1PWLA 2FVLA 3UGRA 3LZ5A 2PDJA 3GHTA 2P5NA 3H7RA 4F40A 4JIRA 3UWEA 1M9HA 3N6QA 1QRQA 2DUZA 2HV5A 2C91A 1PZ0A 4GQGA 2NVDA 4PMJA 4XZNX 2PDWA 1IEIA 1AH0A 4JTRA 1EKOA 2WZTA 1PYFA 3EB3A 2IKIA 3CMFA 2PDCA 1QWKA 2R9RA 3ERPA 2IKGA 1S2AA 2BP1A 5HA7A 4RPQA 4PR4A 3UP8A 3V0TA 1OG6A 3RX2A 1S1PA 3ONBA 4XVEA 3H4GA 1Q5MA 1FRBA 3R7MA 3LD5A 3GUGA 1X98A 2PDFA 2PDGA 1Q13A 1C9WA 2PEVA 4WEVX 3GHRA 4IJCA 3CV6A 1X97A 4FALA 2PDMA 4XAPA 4FAMA 2IPJA 1AFSA 2INEA 4JTQA 2ACUA 4H7CA 4DBWA 3LENA 3BV7A 4HBKA 2HEJA 3UZWA 4JQ1A 1RY8A 3R6IA 2FZBA 1ZQ5A 4YS1A 3B3DA 4JTCA 4WDTA 3RX3A 4XO6A 2IKJA 2PDXA 4OTKA 2PF8A 4PUUA 2WZMA 1YNQA 1K8CA 4LB4A 2PD5A 1EXBA 1YE4A 3LZ3A 1R38A 2IS7A 2ACQA 3M0IA 3UZYA 4Q7BA 3LUTA 4XZMX 3R8HA 4GCAA 4WDWA 1YNPA 2F38A 2CLPA 3V35A 4JQ2A 3CAVA 4JTDA 4LBSA 4LAZA 3WG6A 3EAUA 2FZ9A 2HDJA 2IKHA 1US0A 1J96A 4AUBA 4QR6A 4ASTA 1AH4A 2PDUA 4JIIX 4HMNA 4JQ4A 4R9OA 2PDYA 1XJBA 3MC5A 2NVCA 1MRQA 2PDKA 2PD9A 3U2CA 1Z9AA 4ICCX 3R94A 4GA8A 2A79A 4PRTA 2FZ8A 4DBSA 2PDNA 4IGSA 3S3GA 1LQAA 1HW6A 3C3UA 3BCJA 5M2FX 4XO7A 3LNMA 3LQGA 4YVVA 4IJRA 2DV0A 2QXWA 4I5XA 3UG8A 1Z8AA 3Q67A 2BGSA 2F2KA 2HVNA 3QKZA 1SM9A 5C7HA 4DBUA 3O3RA 1IHIA 4PUWA 3WBXA 3LN3A 4LB3A 1UR3M 1YE6A 3V0UA 4WRHA 5LIUX 5JH1A 3LEPA 3F7JA 3VXGA 4QBXA 5JH2A 2PDPA 4XZLX 3CAQA 4GIEA 5AZ1A 1GVEA 1EF3A 4Q3MA 5KETA 1AZ2A 4GABA 3WCZA 5LIWX 2ALRA 2HVOA 2BGQA 3EB4A 3LQLA 1VP5A 3UYIA 1S1RA 1MZRA 2IQ0A 1ZGDA 3T42A 4JQ3A 4H8NA 4FA3A 4QXIA 1XF0A 4XZIA 2PDQA 4LAUA 2FGBA 4JTAA 1ADSA 2PDHA 3R43A 2PZNA 2IQDA 1X96A 3WBWA 4YVXA 1T41A 4GQ0A 3UZXA 2IPGA 4JIHA 5HNUA 3LBOA
chains in the Genus database with same CATH superfamily
1WB0A 4NL1A 3UA3A 4KCWA 4FMVA 4HNUA 1GVIA 4YN5A 3VCCA 4UFLA 4R33A 4J1OA 4JKKA 2C14A 3SN1A 4F66A 1NIUA 3E1F1 1E0UA 3EX6A 2G50A 2OFJA 3QMTA 4YCPA 3K1DA 2QW5A 2O4QA 3M44A 3FX4A 4XZ9A 4IQJA 1JAKA 3D3FA 3R89A 3MJYA 1KQZA 2PGEA 2WNQA 1E51A 1DWJM 4HB7A 4CGTA 3GYEA 2VKZG 4KWSA 2WWDA 1RAKA 4NYYA 1IXPA 1XUUA 1E6XM 3T09A 3UZZA 1O6IA 2R24A 3N29A 3KP0A 5IBXC 3NPXA 3STEA 1AJ0A 4I7WA 4LS1A 2BG5A 4PTVA 1EOMA 4LC6A 3UXAA 4QFUA 2V2DA 1K9FA 3TXVA 1OYAA 4NAEA 3RM8A 3PB0A 3TTEA 1TZ9A 3RK8A 1EIXA 1Y7VA 3BZJA 4TMBA 1WXZA 4O18A 3COTA 1K9EA 1HF6A 4N6EA 1ZU8A 1VBJA 2UBPC 5D2XA 3BJTA 3VIGA 1YADA 3CAWA 4O54A 3T55A 2EJAA 4M6VA 3B0VC 4MB1A 3S1UA 1VJZA 3CYJA 3L5AA 3G8RA 1A49A 4I6KA 2W5FA 3ARZA 2OWWA 4W88A 4WKHA 5FJPA 1UBSA 3B97A 6REQB 2XGBA 2Y8UA 4AISA 1PIIA 3I6TA 2YYUA 3W7MA 4TVCA 1W1ZA 2FVLA 1KXHA 1RQEA 3P81A 3N4EA 2H8XA 3TEVA 5C2XA 1D2KA 1J0IA 2DW7A 1JI1A 3SFKA 1H41A 1MQRA 3QGKC 3V5CA 1XX1A 4B90A 2QKFA 1IGWA 1KC7A 3PZGA 1RQHA 4US6A 2Z6JA 2FMOA 3EB3A 2UV8G 3TC3A 4QM1A 1S5NA 1GVRA 2QF8A 3O07A 3GTFA 1XDLA 1TX0A 2Q3OA 3KL3A 4WHBA 9RUBA 2NT1A 4GXMA 3TQKA 1GYMA 3V0TA 2C7FA 4WOZA 3IAQA 1KO0A 4B5XA 3PAJA 5LXXA 4MWAC 2D22A 3R7MA 3E2RA 1JYWA 3VDHA 5D03A 4E2VA 5CC6A 4PULA 1KXQA 3MV11 6REQA 2PEVA 2OGYA 2WANA 1ODUA 2Z28A 3NQVA 1DJQA 5BXRA 3AXIA 2IPJA 4DM1A 5CH9A 2INEA 3JR2A 4B16A 3MUIA 1EC7A 4OGZA 4JIEA 3TYBA 3VNZA 1KBKA 3MHGA 4GI4A 3G6MA 1B0IA 3L12A 4M56A 2HROA 4DEFA 3MDUA 1QVBA 5BWAA 4CEUC 1E4MM 2WVTA 4EP8C 1IXQA 1JUKA 1TYGA 2V82A 3NDYA 4IIHA 5CZTA 3RX3A 3AHYA 4I8DA 2Z4GA 1IT7A 3JS3A 4NZJA 1SW3A 3VNMA 2VEPA 1TX2A 5GNXA 4GFSA 4DXVA 2YLAA 2JEQA 5I23A 2RJGA 4QG6A 5C2GA 2A5HA 4K8HA 3S9ZA 3Q37A 1DWHM 2CIPA 4ZE4A 5CG7A 1CPUA 1GK8A 4WDWA 1JF6A 3G2GA 5FJUA 1M7OA 2EPHA 4QHRA 2ZVRA 3FAXA 4LAZA 4JTFA 4OHQA 1QO2A 1XYBA 4E38A 1ME8A 1EIBA 2WSKA 1N55A 3CEPA 3MKCA 1BG4A 2AAAA 3ZVIA 2BSLA 3WH9A 4ASTA 4KF1A 3BXWA 3V4BA 4A8IA 4BK9A 4JIIX 3UETA 4US5D 4RUBA 4H7ZA 3W28A 5GJMA 1E1FA 4FP1A 1J5TA 2NVCA 3BOLA 2PD9A 1U5VA 2ZYFA 3DFPA 5I06A 2X1SA 4YWSA 3HQOA 1TRDA 3R79A 4UTIA 2VZSA 3LRMA 1QBBA 1JPMA 4I9TA 4MY1A 2QCNA 1YNYA 4H9TA 4NJHA 1X6UA 4ZQRA 3F2CA 2VXNA 1A50A 1TJ2A 3GYCA 4UFKA 1MFVA 3L4WA 2DV0A 2PB1A 2FQIA 3GDMA 2PZ0A 3UWVA 1OFQA 2PWDA 1GW9A 5A8MA 1MO0A 5I02A 5I5RA 3FYYA 3QV8A 2P0OA 5FSEC 3GU2A 2GJRA 1B57A 3W07A 4KIRA 1VAHA 1LBFA 3EKLA 1E6RA 4S38A 1W3JA 4CVUA 4JD4A 4L6HA 2VOMA 3ITCA 1FOBA 1IF2A 2DJXA 3CWHA 1E9LA 2PRHA 1WZAA 2PTZA 4AC1X 4YHGA 4AY8A 4AY1A 4C6NA 2VZOA 1UWAA 3O9NA 4RJEA 1TZ7A 2C8NA 5EBUA 1TE6A 5XIMA 3RILA 4GXWA 2CERA 2PBGA 3BQ5A 3GR4A 2PE4A 3W1QA 2PWVA 3FKRA 3BAYA 7ENLA 2PDQA 1HL2A 2FGBA 3BGAA 3MUCA 3PK7A 3MW7A 1EOKA 3I6EA 5CXPA 3QOMA 4G7EB 1M7XA 4WKFA 2WHMA 3WUEA 2E6DA 5BCAA 3AMLA 3PJXA 4X2RA 4RE2A 1HL8A 1O66A 1CXIA 5I79A 4GACA 1OCBA 4GINA 4L9ZA 1B4EA 2CWXA 2E6YA 3FY1A 1EQPA 1E9IA 1PWMA 3VOHA 2VDIA 3PG9A 3OW1A 1G69A 4FNRA 4BQ5A 3P2VA 1T40A 2DH2A 4US5A 4GQRA 3GTNA 4EF9A 1LL4A 3B9NA 2E6FA 3I3BA 3GRIA 1F6KA 2PRMA 1TPVA 3LDVA 2QUUA 3F1QA 3NA8A 4AZ5A 3BGGA 3GD6A 3WLSA 3M46A 3O8AA 4WVXA 1QXLA 1XIMA 3M0ZA 5HJLA 1IR1A 1KTCA 5I3IA 1BHGA 2GOUA 3AOFA 4HA3A 1E0VA 2ZUSA 2B0MA 3NCOA 5TAOA 3SGUA 2WQDA 1Z32X 3TE9A 3LM7A 4YTRA 2CFFA 1X7IA 1GOMA 3MMDA 3OJGA 4H6QA 1KWKA 4IX2A 1FY6A 5JXQA 3U4AA 1IEXA 5I07A 5C0QA 3GFXA 4MY8A 2CLIA 4KWVA 3FK4A 5AYZA 3RM9A 4MZ1A 2VDGA 2P0IA 4ZBCA 1FWJC 3GUWA 3IGSA 4RL3A 2ZXAA 5BZAA 2J8TA 5LNWA 1VJIA 2ZA1A 3CHCA 4B5NA 1PCWA 3JW7A 2CLMA 3B9OA 3L9CA 4WSJA 3KRUA 2NUWA 1TPFA 1MEWA 1MXGA 3EEGA 1A4LA 3V1HA 4EXBA 2XU2A 3UCCA 4AD4A 3GHSA 3T07A 1QUMA 4JYEA 4HU4A 2ZXDA 1ZUAX 5EYWA 1X7FA 3W38A 1WBJA 1R3VA 1Q6RA 4IGHA 3WLTA 4R88A 1ZY9A 3CGTA 2E5DA 1PWLA 3TLQA 3I7RA 2FH6A 3UGRA 2V30A 2P53A 2D2HA 1QPKA 2W67A 1M9HA 3N6QA 1XFCA 1PE1A 2BB0A 3V5OA 5AVNA 5GQBA 3LHWA 3BLEA 4BS0A 4NYUA 4QJ4B 1H09A 3THDA 5HATA 3S1GA 1ICQA 3H55A 1H63A 2WZTA 2X40A 3DI1A 3KLLA 1EEXA 3CUHA 3OBKA 2WYSA 4X9YA 4A2SA 4GO8A 3BDKA 4CQDA 3WK1A 2XH2A 4PR4A 1NDVA 1D3GA 2ICSA 2JE8A 4DWSC 4JS3A 4FLQA 3W2LA 2PDGA 1WDRA 2REQB 4BWLC 3C86A 2RAGA 2WOQA 1I75A 4ZB0A 3QKEA 2RUSA 3LHYA 3NUKA 3SN4A 4FAMA 1OFPA 3GVRA 1V4YA 5BOEA 1P1MA 4CCDA 5FSDC 5DT7A 1R87A 3D0CA 3UZWA 5ABTA 3K5XA 4JTKA 2VO5A 3R6IA 3W53A 1JFHA 4CNUA 3VOFA 2JF7A 4HA0A 1LORA 1DIKA 2ZTJA 4KFPA 3OLIA 5BRQA 2BY1A 3GFZA 4FIQA 1JNDA 3CMJA 5FJRA 4IXXA 3WJWA 1UBPC 1C8XA 5JIWA 2JK2A 1UH4A 3LZ3A 1O5XA 4J5NA 4MJ4A 4J3TA 3EDJA 3UY8A 3U5YA 2J79A 4MWAE 3R8HA 1NDZA 4DAFA 2C71A 3AIVA 3ZWSA 2CLPA 4UOJA 4MYXA 3AJ7A 2EAWA 3C5QA 2DSZA 3N6HA 4GLEA 1OX6A 2FZ9A 4NUWA 2WM0A 1XQKA 2OLHA 4KWOA 1FCUA 1QATA 2ISSA 3AWOA 3VIJA 3NURA 1FWDC 3UYCA 3FEMA 4FNPA 4NX5A 4ZFMA 3A9IA 1SR9A 2CLHA 3A3HA 1H7OA 1ITUA 3PBWA 3VIMA 1P7TB 3SCOA 3CPRA 4EX4A 3T0AA 2Z1BA 2DT3A 4D71A 3CLMA 4GJIA 4W8BA 3UJSA 3MCNA 4AD1A 1UC5A 2YX0A 1PB0A 3OIXA 4Z08A 5AYIA 2XZ7A 5M2FX 3TQPA 1WP6A 3WQCA 2YDSA 3WN6A 1U5JA 1YW1A 4PMRA 3NQFA 3AQUA 3GQYA 1VPQA 3WLPA 1Z8AA 4DVOA 1WV2A 3SBFA 2OTDA 1HXJA 3BICA 2OWCA 1O60A 4UR8A 4BR1A 3WNKA 3WBXA 4LB3A 4CN4A 2GQ9A 4PCSA 2E8ZA 4N02A 5A6MA 2VQUA 4N7QA 3AIBA 5JH1A 4Y8EA 5EL1A 2EHHA 1K8XA 3M0XA 1K6AA 4XZLX 4D72A 4Q4OA 2D23A 5AZ1A 2VFDA 1WYIA 1YIXA 1H49A 1W9PA 3MO7A 1JGIA 2Z24A 4W7VA 4LFYA 3EWDA 4ZL1A 2GJNA 1XQLA 1T99A 4HD5A 4PUNA 5MHBA 4FOUA 3CZGA 4MUPA 3GKFA 1VP5A 1WXYA 3IAPA 3P8JA 5LSMA 1CGUA 2NUXA 4O17A 1Q7QA 1P7TA 5FJIA 5KMYA 4IFKB 5K9DA 3KP1A 3KWXA 1TB3A 5J5RA 5TQLA 3AS3A 1JDAA 5EMKA 3A23A 2PDHA 1YPFA 3S2LA 5HXMA 2IUZA 3MSGA 5CGMA 4IZGA 3MKVA 4DO5A 4LX4A 1EJSC 1DQXA 2HNEA 2DZTA 3W7RA 4M80A 4FXSA 1BXBA 4XAYA 1YLVA 3N3MA 4WY0B 3VD9A 4U2ZA 4GNJA 3CZ8A 2YCLB 3PJUA 2NQHA 2XH7A 1FXQA 3QM3A 4UCGA 3ABXA 1SW7A 3T1GA 3WJZA 3T2OA 1GZGA 3USZA 3BO9A 4QDPA 3JVAA 2L5HA 3WMCA 3TSDA 3CL6A 1H1NA 1BEUA 3W00A 4ZOEA 1V0MA 3GNXA 1CB2A 3AHXA 1TV5A 1NOFA 1JXJA 1O7AA 4XAFA 1PXGA 3NIYA 1MUCA 1I4NA 3HG2A 5C9WA 3DUGA 3U3HA 2CU0A 5EU9A 3FHQA 1EYWA 2ZQ0A 2I16A 4IFKA 1P5BA 3GB6A 4DAIA 4Z1YA 2G97A 2V69A 4J3WA 3PZMA 3WQDA 2GVJA 3VKBA 1R3RA 3NSMA 1V6UA 1Q7ZA 2VHLA 1KM3A 5C54A 4JY8A 1N7KA 1IXOA 2FHFA 2WLZA 4J3SA 2QYGA 4AX7A 4U5IA 3AI0A 3LY0A 4JTTA 4MHBA 1Q2SA 3E38A 4WY0A 1JCXA 1AQMA 2QUTA 3W73A 1XLDA 2YCLA 3WDIA 2A2IA 3LGDA 4AEEA 1JZ8A 4PB3A 3N2OA 4S2CA 4JN6A 4QX4A 3IJDA 1RVKA 3S6OA 4ZE5A 1QPRA 3AU6A 5K9CA 3B8IA 4PMUA 2ZE0A 3OZYA 1LYXA 3OB8A 4C7FA 3E74A 3GHUA 3G1YA 1L2UA 4R7JA 3C2VA 1QW9A 3FDGA 3BURA 3UNDA 2G8ZA 3LMZA 5A6KA 2V81A 2XH0A 4HPJA 2NT0A 1TA3B 3BZGA 3N11A 1OX4B 2C18A 1VENA 2XIIA 2Z1VA 1V3JA 2V3DA 1YBQA 5A6BA 2J27A 3AXHA 2FVKA 2GJXB 2WMFA 1QI3A 4CD4A 1OK4A 2BZNA 4FOJA 3SRHA 2EQDA 3VO0A 1FDJA 1EKOA 4CU7A 2V0TA 3Q45A 1SFLA 4HK7A 2R9RA 4FS9A 3ANVA 3T6CA 3KTCA 2CHOA 4KS0A 2GL5A 4WD0A 1VFSA 3VX1A 3T44A 4EKJA 5XIAA 4CLMA 1XC6A 3LPPA 5AB3A 3HJEA 2V3GA 6XIMA 1Q5MA 3FVDA 4MNKA 3BG3A 3UT0A 1RBAA 3LD5A 1AQHA 4NXSA 3C8FA 1DPMA 3G3DA 1L9WA 1N82A 1X98A 1FH7A 4HZ7A 1C9WA 4PCTA 4WCJA 3PPFA 1W3TA 1FWHC 2PDMA 3W7QA 2BGNE 3PBUA 4P8XA 2G3FA 2WBKA 3TSBA 4J3ZA 4HIBA 2QV5A 4MJ2A 1LT8A 1PCKA 2JBMA 3H2AA 1W5QA 4DI8A 1LWJA 5F7UA 1BTCA 1EDTA 1V3IA 4DF1A 2RDXA 4AZ7A 5DCEA 3TLLA 2NQ9A 2PF8A 3CQJA 3EXSA 2WZMA 2R1LA 2H90A 4DO7A 1ZHAA 4F79A 1NWRA 1F76A 3WJYA 3I6RA 3NWRA 2W92A 4LUSB 1YE4A 2D2OA 2ZX6A 2UY3A 4K3ZA 2OWXA 3WK2A 2XN0A 4HVXA 3WF3A 3PBMA 2Y8VA 3PB2A 3W2KA 3OLDA 3ME3A 4QG8A 6TIMA 3CC1A 3WDQA 1AVAA 1RV8A 3NNTA 1XUZA 4Y9MA 1I45A 3H54A 5JVLA 1RSCA 2DJLA 4MZYA 4UFHA 2ZX9A 3W7OA 5IRPA 4DZHA 3UJRA 4FXRA 1A47A 2PMQA 4UTTC 4PMDA 4H00A 1AW5A 1A5SA 1FWEC 1OFRA 3NQ2A 1AH4A 4B3ZA 4EWND 4PUMA 3MYOA 3GH5A 3MSDA 2X16A 2PDYA 1DQUA 4IGMA 3BLLA 3VE9A 3W22A 3P62A 4NRRA 1YXYA 1C90A 2QIIA 2OOGA 5CSUA 1JGMA 4YHEA 2FYMA 4AX6A 1XLFA 1KFWA 3G8EA 2FJKA 4M3PA 2QDGA 1UZ4A 3OU8A 5FCZA 3LQGA 3TXZA 5CZ0A 4ACZB 1DVJA 3GFYA 2BGSA 1CBGA 3GNDA 3U4FA 4IIEA 4QQ3A 5IBXA 1W5PA 1P6CA 1O4UA 3MDWA 5DT5A 1W3IA 1SO5A 2JKAA 1V6XA 1ZJAA 1TV3A 2NQZA 4GKTA 4NRSA 3WF0A 3SB0A 4MB5A 4M19A 2WMJA 3KCJA 5CJNA 1NDYA 2QDHA 3ZFHA 1CW2A 3G24A 1ISXA 4UTWC 4HJWA 2OB3A 3UWYA 2VC6A 2GUYA 5F4WA 1TMQA 3CAKA 1JPIA 4M6PA 2RDUA 5HNNA 2GJLA 4PUKA 3T42A 1R6WA 3ZO9A 4HYWA 1NQ6A 2JIEA 4ZGYA 4FA3A 3P0WA 1DJHA 1WXJA 3FHAA 4PBFA 2ZRYA 1FTXA 4UTJA 2VFEA 4GG9A 3QR0A 3W7EA 4FR6A 4D2JA 4H19A 3UQNA 3CMGA 3FYOA 2VENA 2OMAA 1HL9A 4HJFA 3W7NA 1GPWA 3ZR6A 3GLCA 3URNA 3EPMA 3RRXA 4Q33A 3B05A 4D6GA 1EZ2A 1VFFA 3K8KA 3RITA 4BI5A 2YA1A 2NVAA 1RK6A 5DO8A 1MW3A 2C0HA 3VDCA 1NARA 4U4MA 4AIEA 3THCA 2ABAA 4CD6A 5DCDA 4MYAA 2FB2A 2YDQA 3MU7A 2W0UA 1OT2A 3U7VA 5FD0A 4L4LA 3TNOA 1JXKA 2VWSA 1TFVA 3VOIA 3DC8A 1MEIA 3C2EA 4AIBA 2POTA 1LLZA 3DYPA 4D6HA 4V33A 4L6OA 3UXLA 4LXFA 4MWAA 2ACSA 4B4FA 4JR5A 5AHMA 2QCEA 3AUJA 3M4HA 1H51A 3FKKA 1OC6A 2AGTA 4Z42C 1DTNA 1SSGA 1VC4A 4TUFA 1W1TA 4ZEPA 3M0LA 3CV7A 2H8ZA 2XG9A 1FQ0A 1JRCA 2C19A 2VELA 1OWQA 3FDKA 1CLKA 1ZAJA 3PBGA 1K8YA 3LYEA 3ALFA 3TX9A 3TZFA 3BCDA 3DOPA 1K4HA 3FA5A 3PTDA 4FXFA 1DE5A 1JPKA 4W93A 4JX6A 1VB9A 4YU1A 3ZXWA 1KWGA 1HVXA 2WNWA 2GGHA 3CTLA 3LLFA 3SCQA 4V1XA 2G3MA 3E0IA 4A3YA 4M1RA 3S47A 3RCNA 1Z41A 1F3TA 4AZCA 1VEOA 2WLYA 3OBAA 3UD6A 3S5YA 4ZXLA 1LWIA 4O10A 2Q02A 2YIHA 3LTSA 2WBGA 5FJJA 3MBDA 3HB9A 1CENA 3GHTA 1ITXA 3VOCA 2VM8A 4M6QA 2E28A 1P0BA 2ZC1A 3T8LA 5I3DA 1Y8BA 5A6TC 1QR7A 4RW3A 3KS6A 1W3HA 4DF2A 1V0NA 3SIMA 3BANA 5G1TA 4EVZA 3ORWA 2V2HA 4RCXA 1BGGA 4JTRA 3SUTA 3ARSA 3WF4A 1IT8A 1GPFA 1UQYA 4NHVA 1UW9A 1HX0A 3VFLA 3THQA 1KFLA 4RE0A 1QWKA 3UEQA 4L64A 2D0FA 3G1VA 4J3XA 3TR9A 2OQLA 3UR8A 2Y62A 1VRDA 3WEMA 3NOEA 1PYMA 1OG6A 2NSOA 3OQ8A 1V3HA 3FSUA 4XUGA 1XYCA 5ABHA 3AALA 2BX7A 4IH3A 2AGKA 4CNNA 4UC5A 1M53A 4HOWA 2QNEA 4J40A 2Z26A 4WQ6A 2ZDSA 4JEJA 3MMTA 3F4NA 2NXGA 3TTQA 4FLSA 3ARQA 3P6LA 3LXAA 1YTKA 2DIEA 2YW4A 1XI3A 2HEJA 3DG7A 3QFEA 4LAMA 1XLBA 2W9MA 3BLIA 4IG2B 2O9PA 1TJRA 3RF9A 9XIAA 4U31A 1E4LA 1XIHA 2VX4A 3QPEA 4QIUA 5TD4A 3N9SA 4XAGA 4ZR8A 2ZADA 3WD1A 2FPTA 4LB4A 2VC5A 1VZWA 3PS7A 3R0UA 2C6QA 4XSMA 3S5OA 3K4AA 4ALDA 3BW4A 4U2YA 2XIJA 4CU8A 4CQ9A 3RLUA 1BWLA 1MW1A 2TMDA 1UZ1A 3MZNA 5I2UA 4GO9A 3R12A 1YHTA 1K7FA 3M0JA 5BXTA 3OODA 4FR1A 1WUFA 5GNZA 4F2UA 3A13A 1GOKA 4HCLA 3GXIA 4GD0A 4KEUA 2HDJA 4QRNA 1SFTA 1XRFA 2V6AA 2BY3A 1J96A 3DAQA 2OODA 2NLIA 4PFHA 4QSHA 1DHPA 2V67A 2Y8KA 5ECUA 3L4YA 4JNYA 4Y90A 1DQWA 2RH9A 3FW6A 3OVPA 4F0MA 3M0HA 4B5SA 4QLJA 1WAUA 3DX5A 1KLZA 1XBVA 2OO0A 5FEWA 4K6AA 4DBSA 1F8IA 2ZUUA 4C6CA 1IT0A 3QY6A 2VOTA 3DKJA 4WF7A 4MNJA 2QUNA 2CESA 5DFAA 3B9DA 4GYFA 3KBJA 1LL6A 3W81A 4XSLA 4Q8UA 3OTRA 4S3EA 5M17A 4Q6XA 2WPBA 3SQMA 4O1BA 1SM9A 1Q3NA 1QNPA 3C61A 4Z2JA 4XV0A 2IXUA 1R3WA 1IHIA 2J77A 3GSMA 3NGJA 4GNVA 2YGYA 4E8CA 2ZRXA 4HTBA 5LIUX 3WFAA 4QISA 1CI1A 4ML4A 3MTWA 3S2CA 3S9YA 1SYTA 3URQA 4XD5A 2A7NA 4X0VA 1F3EA 2Y4SA 4GC3A 4IPLA 1C8YA 1RUSA 2ZUWA 1J0HA 3ZJ6A 1BYCA 2PWHA 5T91A 4UQEA 3W7JA 3U8GA 1ZTVA 3LBCA 4J7RA 3LBMA 3OLGA 5A8QA 2ISVA 4AZBA 1HO1A 1V6VA 4KEZA 2E5CA 1Z6KA 2VC9A 5LNUA 5HUPA 3LM3A 2WPGA 1GZJA 4S2BA 3LQLA 5D2WA 1TUFA 4E6MA 2FIQA 4UMCA 3VU2A 4JQ3A 4ATWA 3MWAA 3QH2A 4GQQA 1KM5A 4WSKA 2GGGA 1XF0A 1NP0A 3GAKA 3F5JA 4L7ZA 3TSMA 4GPNA 2Y7FA 3MI6A 4YVXA 3A4WA 2A6LA 3HURA 4GQ0A 4JKLA 4S3BA 3S8HA 4HK6A 5H2ZA 4PRWA 2WNZA 4UNLA 3EX4A 4QLKA 1SQ7A 3GDBA 1HZYA 3DHUA 1IXNA 5HAOA 4W7WA 1VEPA 2FTPA 3DKLA 2W62A 3OBEA 1NQKA 1GVYA 1GWJA 1XICA 2RHGA 2YB1A 5DXXA 1M1BA 4S1FA 1W9BM 3O2LA 1K7EA 1KD0A 1ZSXA 3A5FA 3EYPA 1KR1A 1LWHA 1ZNNA 2J13A 3R25A 4Y9OA 2XIMA 2R82A 1XW8A 4LW7A 4LT9A 2R6OA 2X0YA 4C90A 1QW8A 2QPXA 5DMMA 4Y7EA 1KM1A 1AQFA 2ASHA 4I3GA 5E1QA 2VGGA 1I60A 4LBRA 3BH4A 3WLHA 4RV3A 2ZE3A 4A3RA 3EX1A 2Z0IA 1S3HA 2BBFA 4GVHA 1Y0EA 4Q4MA 1AMKA 3GVQA 3V36A 1Q2RA 1DOSA 1W1A1 3WBYA 3CK5A 1VHNA 4F8XA 2VX7A 7XIMA 1Q6DA 4BF5A 4DWSA 3TWAA 3FJ4A 9XIMA 2QCDB 3MB9A 2JALA 3Q65A 2PWFA 3LI0A 4DWDA 2ISFA 4Y6GA 2Z6IA 4QITA 3TJ4A 2UY5A 2OJPA 2WZIA 1SR0A 4N0RA 5JU6A 4F4RA 2GQ8A 2YPIA 3NL3A 4NI3A 3CT7A 2XDFA 1XLMA 2DP3A 2IPWA 3AMDA 4PTWA 2J88A 4HP5A 4PMYA 4IIBA 3MKKA 4EF8A 4FHAA 4PTNA 1GKQA 1YQ2A 3WK0A 4ERGA 3B4YA 4MJZA 4HA4A 3R8GA 2NV2A 4ES4A 2PP1A 1PEZA 3A12A 4IFOA 1XYAA 1JZ6A 1RJQA 2WQPA 3CQ0A 4NKCA 1LJYA 4YWIA 2I9UA 3NZPA 3FN9A 1UIPA 3BW3A 4H8VA 4DJDC 3ZJKA 3PF3A 4MUZA 2QCDA 1GUVA 5K4XA 4LWWA 3P3BA 4P7NA 1EZWA 3LHVA 1XYMA 4MM1A 3LSCA 3AS1A 4Y8FA 1VJSA 1T8XA 2PP3A 2VC7A 2VNCA 3BQ6A 1QJWA 3UF9A 2GFTA 3AXXA 4BQ2A 4PUEA 3EPNA 4XZBA 1BRLB 2BP1A 1ML1A 1GHRA 3GVWA 1VFOA 2J75A 4IICA 2VVNA 4OVXA 4O12A 2GWNA 4DPPA 1THFD 3EOSA 3T2PA 2J7HA 1W2PA 1W8GA 1K6WA 1P48A 1EPVA 3W2UA 3QPZA 2Y2WA 1VLIA 1BKHA 3M0VA 3A24A 4C6FA 3F4VA 1SVDA 1JDDA 2GQAA 4R7OA 4PB5A 3H70A 1KCXA 2RGLA 1FP9A 4L4OA 3W71A 3RJXA 2V63A 4ERAA 5FJOA 3RPMA 5JBFA 2W79A 3UA4A 1DKWA 1Q6GA 1H4PA 1ZJIA 2XFYA 1RY8A 1G4EA 3SSJA 1ZQ5A 4PZVA 1GJPA 3CZJA 3S6TA 4Z2HA 2F6UA 3CB3A 3UCQA 1K03A 2ZX8A 4CNTA 3P8IA 2PCQA 1E1CB 1GQLA 4O1CA 3LPGA 1R38A 4IQLA 4MB3A 3SFWA 5BMXA 1A53A 1IEVA 3M0IA 4S3KA 1VBGA 3N17A 4JHOA 3MV01 5CEWA 3VKDA 1E1EA 2VFFA 1YNPA 3MUZ1 4LVFA 4B91A 5ECVA 3VINA 4ZOAA 2ZXQA 3EB2A 1GJUA 2VWTA 4M6UA 4L9YA 4NNAA 1DWIM 3PFMA 3RIKA 3ZIZA 4XIAA 3GTXA 1UKTA 3B03A 1R3QA 3B0XA 4WX2A 7PTDA 2OR2A 3DBPA 3SURA 2XFFA 1H62A 5HANA 4HMNA 4RR4A 3A64A 3UJ2A 1BVWA 1M04A 4H04A 4AQLA 1H1YA 3W6MA 1Q6FA 4GZJA 4FX8A 3ZR5A 2FZ8A 4UNKA 1OD0A 2PBOA 1ZP3A 3BCJA 5KITA 3G77A 2EKCA 4PUDA 3W1PA 3G0SA 3U7BA 1W3LA 2JF6A 4YYFA 2WMGA 1E1CA 1OC7A 2ZCGA 3U2EA 4IX0A 3AZSA 1RQBA 5DXYA 3CL8A 5A1AA 4WXYA 1PUDA 1XLEA 3HG5A 4YXGA 2F2KA 1MZHA 4DF0A 2J7CA 4YPJA 1X8FA 3O3RA 3NOYA 1AODA 1OF8A 3KX6A 3DG3A 3TTOA 5DCBA 3GDLA 1BQCA 5TIMA 4I9JA 5FA5A 4GVIA 3A9BA 4JL2A 3BAIA 5EMLA 4RNIA 4F0RA 1EJWC 1EUAA 4PMXA 4UB9A 3UJFA 4ORIA 4R53A 3WIJA 2I9EA 3LLXA 4R7WA 4JTEA 1JPDX 1GQNA 3VGDA 2I5GA 2HVOA 4OT7A 3EMCA 4HU0A 4HHMA 4UQAA 3RR1A 3TYEA 4NY2A 2IQ0A 4L1GA 1VCVA 1Q8AA 5PTDA 4ZSTA 5KZEA 1AW1A 1E15A 1RCQA 1E0TA 4J2MA 3C8NA 4UOQA 4CVWA 5LGZA 1ZLPA 5LHFA 1B31A 4W86A 1ADSA 3VMNA 4JCLA 2IMRA 1W5NA 1YRRA 3UR5A 3VYLA 4PYSA 3WLIA 4PSRA 3G1HA 1K7XA 1IZJA 3GC5A 3SRDA 4MF4A 4F0KA 4XKYB 3TYDA 2QR6A 3ELFA 1OZQA 2QMKA 1SJDA 3W0KA 1E70M 1TV8A 1B54A 2HZGA 3PWIA 1WDWA 1RVGA 1F4HA 2Y5SA 4DUWA 3WQ6A 2E5BA 2WB5A 4AHQA 4U5KA 1S2VA 3B4UA 2QVHA 5CPOA 1LUCB 1I0BA 3L65A 3O0KA 2WWCA 4H4IA 1DIDA 2JQXA 2ACRA 1D3CA 4UZUA 3WLNA 1A5MC 1E72M 3RPTA 1ONEA 3QGAC 1VBHA 1QAPA 2ALDA 4PMVA 3KOFA 1Q66A 3CS2A 1W54A 3OVGA 3RX4A 3IPWA 3LS9A 2RFGA 4O8AA 1NSJA 1JAEA 4AD5A 1XPGA 3VNJA 4QTGA 3MANA 1IEWA 2NW0A 3B0UX 1JYVA 4Q8TA 2QJJA 4GY0A 3CUFA 1JG9A 2VEGA 5AYYA 4KRZA 3C0JA 3VIPA 4AH7A 1R3TA 1TREA 4X9SA 3CIWA 4GISA 4B9ZA 3IGXA 5CJMA 3OZOA 4X63A 1Z69A 3NYDA 3B04A 2HISA 4G5DA 1B3VA 3ZYZA 2ZUNA 4O13A 3DFHA 2VT0A 1RZMA 3CJPA 4V1YA 2GGEA 3N19B 3N6JA 2R1PA 3CHVA 3PPHA 4E5TA 1IZCA 8TIMA 4ZO8A 2WVSA 3NG3A 1Y5XA 3WZ0E 1Y5WA 3RXZA 2EO7A 5LA1A 1N8WA 5XINA 1A0DA 4WK9A 1VEMA 3HZ3A 3V0SA 3Q58A 3WF2A 4CCCA 1W0MA 5J8LA 1VH7A 4RZ4A 3N73A 3P67A 1P4CA 4MDOA 4F40A 3S4TA 3LTPA 3BK0A 3N2XA 1AUSL 3IGUA 1ISVA 3B8UA 5DRIA 2NV9A 3E2VA 3A22A 4AMAA 4H01A 2DPEA 4EPBC 1JCJA 1HJXA 2E0PA 4UR7A 2IKIA 4H1ZA 2DSVA 5C9RA 4D8ZA 2PWUA 4GZ7A 4CQ8A 4R3UA 2CLOA 4KESA 1H7RA 5HA7A 4XWUA 3VA8A 4JBRA 4YTTA 3TROA 1U1HA 3CZKA 3LA4A 3SM0A 2XVNA 2Z1WA 3WQFA 4Y9NA 2ZKMX 4GYPC 4XVEA 4M82A 4E2BA 3H4GA 4QAIA 1VFTA 2WW5A 2FTWA 1JPHA 4LS0A 3NVTA 3QW3A 4K8GA 4UFIA 4QGCA 3NZGA 1J4EA 1TJ0A 4HU3A 2EF9A 1MMFA 2YXOA 5K7JA 2KZHA 1L0PA 2WCAA 3LENA 3N25A 4P7QA 4O1FA 2J6XA 2DZAA 1QTWA 3B3DA 4IXHA 3BAKA 3WMBA 3M0YA 2X1IA 3PZNA 2ZZ2A 4EAMA 4L4PA 3NO1A 3PZQA 4C65A 4XISA 4LYPA 1I2OA 1R2RA 3LV6A 3OA3A 4Q7BA 1W1IE 3OGRA 2GQ3A 2DUAA 4Z2KA 2GUBA 1NWSA 2DIKA 2MUCA 2DZPA 3APTA 3W9ZA 2DEPA 3WSUA 2E1DA 3HJZA 1KFJA 4HYVA 5AKQA 4IPJA 2OELA 4LBSA 2NXIA 3E49A 5E0CA 2ZUMA 4Q6JA 1K8ZA 4GJ1A 3KOYA 1PJ9A 4JIQA 3H4WA 3M7WA 1C91A 4OIFA 3TN3A 4AUBA 3OHMB 1HKWA 4B4HA 4NU7A 1EYEA 1UA7A 1OYBA 3O6AA 1XISA 4IUOA 2V5KA 5BW6A 1SW0A 4KH2A 5G2IA 3IJ7A 1WPCA 3QYSA 3B8SA 5GNYA 3CPGA 3W76A 3C2OA 3KBSA 1DJWA 3EDKA 4ADSA 4DJED 5C71A 3JU2A 3R94A 3CH9A 5AVHA 2WO5A 3TU9A 1S39A 1TKKA 4OOUA 2PU1A 1XV8A 3ARYA 3VNLA 3T9PA 1R47A 4C5ZA 3NL5A 2WVVB 2ESCA 4YVVA 4K39A 4PBEA 1P1XA 1T0OA 4LCQA 2Z1SA 3W4RA 3AZTA 4J35A 4I9AA 1XL9A 3E02A 5HINA 2XVKA 1W8SA 3RRAA 4JL1A 3ANUA 2CYGA 8XIMA 1EF2A 3ZLFA 1CX9A 5AHNA 4ZQMA 3BLFA 2INFA 2HK0A 1NFGA 4IPNB 1PKMA 5HDRA 3S1VA 1DBTA 4OUIA 3LI1A 1GVEA 1E0WA 1AZ2A 1F05A 1ZRQA 5EFFA 2DZWA 4AMCA 1ADDA 1PX8A 3VM7A 3VCRA 3UVAA 3M47A 2O7QA 3GY1A 1JR1A 2TAAA 1UZHA 4NSBA 4B9YA 1VYPX 3MHFA 4XZIA 3RU8X 4Q4SA 3PY2A 1QPQA 3M1ZA 1MQPA 3TN6A 5TF0A 1TWIA 2IQDA 3HMCA 1X96A 3VGHA 3PBVA 1ZBVA 3ECQA 5B7ZA 1KR0A 1QPOA 3LHUA 4HNCA 4YCOA 4AVNA 1OD8A 1PZ2A 1FWNA 2Y0FA 1GJWA 4OECA 2ZZ3A 1VR6A 2Q09A 4NZ3A 5CPMA 2WC4A 3IIOA 2WZHA 3T05A 3AYRA 3F03K 5HBFA 1Q45A 4MKSA 1PTAA 4ATLA 2CKSA 5I3KA 2WHLA 4L61A 2XN1A 3RFAA 3ANYA 1GG0A 3TOYA 5D9PA 5EMYA 1ZJBA 1G01A 4KCUA 2HXUA 4QE4A 3FCPA 3LCHA 1TUXA 2Y88A 4DJEA 4JTSA 3DU0A 3G5EA 4Q8VA 3DG6A 3EOEA 1PTGA 3LRLA 4UXDA 3WLKX 1UR2A 4QSFA 2A3HA 2J74A 1PX4A 1VFLA 2BVDA 3GXTA 2Z2BA 1RLDA 3EBVA 2F84A 2PDLA 2G0WA 2Z27A 4AWSA 1EPXA 1KKRA 3PUDA 1WOBA 3W7DA 3HFYA 3UESA 2QJNA 1UR9A 3D6NA 2C16A 3FFSA 4HPXA 2PLMA 3FXGA 4PEEA 4WGHA 1VPYA 1UWTA 5H8UA 3EPOA 5BNKA 2VZTA 2A3LA 1EC8A 4UCFA 3IJ6A 5G4WA 4YTSA 3CH0A 3FS2A 3KFTA 1UCWA 1OZMA 5CBIA 2QMJA 3BE7A 1JZ2A 1P0EA 3HGOA 1M01A 3UCDA 2YCIX 5I7GA 1WE5A 3VTRA 4H2HA 1GQJA 1W3KA 2W61A 1C9DA 1FWIC 5G1YA 1XR2A 2JGYA 3M5XA 1D3HA 4P8UA 3N4FA 2PURA 2ZDRA 3TFCA 2F2HA 1K02A 4GVGA 1R30A 4JQAA 3A4JA 1KFKA 3ONCA 3DN5A 4RDVA 4B5UA 5BXPA 5BWFA 3MO4A 2QQ6A 2NX3A 1E55A 2YBUA 4KFOA 1XKYA 4KETA 3NQGA 5AHFA 4W9TA 3KRSA 1XBXA 3QJAA 2BY2A 3RMEA 3L66A 3G0XA 3WDPP 2O7SA 7A3HA 3IJ8A 1V3MA 4PCPA 5M1TA 1PZ0A 2EPMX 5D38A 5CGQA 1OC5A 2NVDA 3WLRA 4TR9A 2CLFA 1AK5A 3XISA 4DIAA 3TR2A 2HK1A 2AL2A 3GNNA 5FF2A 4PMQA 3W7KA 3TYAA 1V6WA 1CNVA 3I68A 1EP3A 4A21A 3ZT5A 4H9MA 3W7IA 1S2AA 3UWWA 2WSRA 2DT0A 5GVJA 1ESWA 3QLLA 4H2CA 3CIXA 4AEFA 4YJ5A 1YDVA 1XIBA 2POZA 4A4AA 1XYZA 3RX2A 3BTNA 1VS1A 1WZLA 4KGJA 3P80A 4IT1A 3AYVA 3WQ5A 4C6LA 4Q4RA 1YMYA 5B7YA 3NSXA 1Q65A 1L6SA 3V1PA 3V75A 7TAAA 3VKAA 1G7VA 1EWEA 4FALA 3AWNA 3MMUA 4U3CA 4HPNA 4LVAA 2D69A 2GSHA 4LEFA 3T0CA 1VYRA 4AAJA 2O0TA 4S3DA 1NOUA 2Q01A 3WEZA 1DYSA 3W1RA 1Q85A 1GVSA 3H2MA 2RDWA 3LRKA 4RDWA 3PULA 1S2TA 2AQOA 1ZJHA 1H7NA 2CHRA 3Q4DA 1WKEA 1IWBA 3ARXA 5RUBA 2ZXBA 2CNCA 1RCOB 2PD5A 4EANA 1PAMA 1LQ0A 4Z2IA 1FFQA 3UZYA 1JCMP 3CQKA 4O8RA 4K7VA 1Z42A 3IK4A 3N2MA 4XZMX 5G2WA 4GCAA 1LOSA 5DMLA 4PE8A 4L5ZA 3IWPA 1A5AA 1H5YA 2V38A 3DYMA 3WG6A 2YZRA 2E40A 2QCMA 3GM8A 1E6QM 4H8HA 2NUYA 3PM6A 4IMGA 2YBVA 1ZAIA 3QLDA 2YOCA 3I3DA 3GZ3A 2FH8A 1VCFA 2CXEA 3BGJA 3MPGA 4MLJA 5I3JA 3TTYA 3GDRA 3VIKA 3RCMA 3G1DA 3ITVA 4R9OA 2BDQA 8RUCA 1R0MA 2LLEA 4I5UA 1O5KA 1LOQA 1T8QA 4ZQOA 4KERA 1V8EA 5D4YA 4IJBA 1F9CA 3C2FA 3PANA 1H3GA 2H9AB 3QVQA 2YKKA 4WR3A 3SJNA 3OGVA 3IANA 3GKAA 1XFBA 4LCSA 5K2ZA 1WDPA 2CW6A 3WD2A 1OB0A 1GKPA 1QNOA 4DYJA 5HUOA 3L0NA 1XYLA 2QZRA 1MUMA 5DX7A 5JMUA 2WCGA 3R0DA 4W84A 4H3DA 3SDOA 3PC0A 1OJXA 1TPWA 5G4EA 3TZNA 5CZSA 1JDEA 2E9BA 2ZX5A 1MDRA 3QTPA 3IVUA 2P10A 4DUVA 3RGTA 3RO6A 4OV9A 3BVJA 4H8UA 5DMYA 1UMLA 1VBUA 3NQCA 5T26A 3VAVA 3DGRA 1MNZA 1K4GA 1S1RA 4QP0A 1KFCA 4M5PA 1MZRA 4NX0A 3DFNA 1RXOB 3QZAA 1KBIA 3FIGA 1FCBA 3TV8A 4LH8A 3DESA 4AZGA 2XINA 4AZIA 4H9UA 3C52A 4HYRA 1AD1A 1DE6A 3WX7A 4H83A 1TO3A 5JIPA 3EMZA 1H0GA 3AU2A 2D2JA 2H9AA 3CO4A 3W7PA 2A0NA 1FWFC 1GYNA 3OG2A 3SQSA 5CBBA 1NWTA 2WJDA 1UP2A 5CLWA 1OHLA 1MXSA 4K1WA 3WDJA 3MWCA 4YMZA 1BKSA 4ILSA 4HZ8A 2B7PA 3GIQA 2A3CA 1V77A 2IPFA 1KGWA 1W9DM 3P5YA 2DZSA 3I4EA 3MUAA 3OYZA 2PAJA 3G1XA 2Y7DA 3S9IA 4NI8A 2GGJA 3L4XA 2WKLA 3IACA 2RKXA 3ZS4A 3JZEA 4MGGA 3RNDA 1H7WA 1KA9F 3ES8A 4FZIA 4G56A 3GC4A 4LF2A 1IEQA 1A5KC 5IFPA 1RBLA 3EWBX 5I00A 4BY3A 1SFSA 3M6DA 3MZ2A 5LXEA 1QOQA 1FFRA 3LOTA 4MLRA 3V16A 4FX7A 4ZZ9A 3N15A 1UPMB 2AMGA 1RALA 1ZCOA 3WD0A 1MI3A 1Q7MA 2VTFA 3R58A 3OOQA 1OFOA 3BLDA 3FA4A 1LF1A 4XZHA 1EL3A 3PUOA 4PRRA 3H12A 2DFAA 2ZRZA 1TTQA 4NJJA 3OVQA 1S2CA 3O1NA 1GVQA 1M7JA 4JNMA 3MYPA 3WH5A 3HTWA 5CAKA 3BW2A 3CASA 4DYKA 1WX0A 4Q8MA 1W1YA 1F61A 1JI2A 4FSAA 4IMEA 4E4UA 1WOAA 1W2VA 3EWZA 1UKPA 2DSWA 4C6PA 3WDHA 1W6TA 1I1XA 3G1RA 4HMDA 3PP7A 3TJXA 2O4MA 3M5VA 2FHCA 3AMGA 4Z1AA 3NGFA 1B9BA 1QHZA 3OIHA 2JEPA 1MW2A 2XVLA 3R11A 2MANA 5CAHA 4H9VA 5FF3A 1OIMA 3H7RA 5G5IA 2FZNA 1GVOA 3ABZA 4GRSA 1QRQA 2DUZA 3WFZA 5J04A 1GT8A 2EJ1A 1A0EA 2YB4A 5FEZA 1K70A 3ABSA 3ZLHA 3NEVA 3MS8A 2G3IA 4UBPC 3N9KA 3PTKA 2GDUA 2Y70A 3CMFA 1G9HA 4GIYA 1CCWB 5KZDA 3NPWA 5CQ1A 1B3WA 4J3VA 5FAGA 3GDTA 1UMYA 2E68A 4KWUA 1RA0A 4LPCA 2EPOA 1KFEA 3HQNA 5EMUA 1S5TA 2XM2A 4G1NA 4D8AA 5D9NA 2XSBA 2AKMA 4OFCA 1DXFA 2YR1A 3WQPA 3UZJA 4LVGA 3WELA 3VUPA 3OO2A 3O05A 1A3HA 2PF0A 1NFPA 4YYCA 3ZSSA 5M03A 4YTQA 3ZR4A 1MDLA 1W9UA 4CN6A 3LV5A 1L6YA 2YL9A 2O9RA 4H7CA 4DBWA 3D47A 1N2VA 3GG7A 3BV7A 2ISWA 2Y7GA 2DW6A 4GQBA 3BSMA 1DHKA 4UTMA 2C3ZA 4GZEA 4JTIA 2PI6A 3BV4A 2CZVA 1PO9A 2DGAA 2WMIA 4J3UA 1A5BA 1EWDA 3K8MA 3SI9A 2VJXA 1OVDA 4W8LA 5IOBA 4QEEA 5U4NA 2GWGA 3QMSA 3PPGA 3VMOA 1GOOA 4TU1A 1DJXA 3ZMRA 3O6YX 4JQ2A 1WA3A 2BXYA 1TQJA 3MJMA 3E2QA 4I6VA 2V5BA 4UR9A 5G4HC 4LSBA 1E73M 3AIWA 4C1NA 2E25A 1O5RA 1OM0A 4M8UA 2PDUA 1AL8A 1SFJA 3VNYA 3K46A 3E0WA 4ADTA 2PUZA 5E5CA 4LF1A 4J27A 2XSAA 5E93A 2W4XA 1MRQA 2PDKA 4L65A 2VCCA 4QAWA 4K8EA 3S5NA 3IV8A 3HG4A 2ZVIA 3UXIA 3S3GA 2F7FA 2CEQA 3UWZA 3EWXA 3C3UA 4IFRA 3GNRA 5EB8A 4TMCA 4E3TA 1TQXA 3C2YA 1QT1A 4ZO6A 3VILA 1OSEA 3UG8A 1R3YA 1ME9A 1QWGA 3CT2A 3GBEA 5BMWA 3KTXA 5BYWA 3E9AA 1SJBA 3DFYA 1PV8A 1DJZA 2G3NA 5A2AA 2XTKA 3THUA 1CXEA 2DORA 4AFYA 1OABA 4MPQA 1QOPA 3O7UA 3EWUA 1KGXA 3NQDA 3EX3A 2V2CA 5G2HA 4UMBA 1EF3A 3WUBA 4Q3MA 1AMYA 5D33A 4D1IA 3GR8A 2VEMA 5DF0A 1FHUA 3NYZA 2YL6A 3OVRA 2FB3A 2VUNA 1DWAM 3AIEA 2PTDA 1NWUA 2Q6ZA 4ZA0A 3PVFA 2J7DA 5CKSA 8XIAA 1XSIA 4KIEA 5HJYA 1UA3A 3WQ4A 4ECLA 3R43A 4PMZA 4E0CA 3ES7A 4AYGA 4GHRA 1CIUA 3CO8A 4RNFA 4AVFA 1GOQA 3MCOA 4K1GA 1TE1A 1EHNA 3TQ0A 3OEXA 1W37A 1V5XA 2ABBA 2O56A 3EOOA 4CN1A 4HNOA 1JD9A 4XKMA 2E9LA 4IUGA 5A3HA 2F8QA 1KBJA 4M0XA 3VZZA 2NZLA 2XJ7A 2BV9A 2E77A 2R94A 1KXVA 1JUEA 4AY7A 1O1ZA 4FX6M 3E0FA 1K3UA 4WDXA 5LIKX 2QJIA 1J11A 2VQTA 5F4SA 1RH9A 1QASA 1XLJA 4DXXA 1HJSA 2NQ5A 5DEZA 5FL0A 3BWWA 4Z0SA 3W27A 1IIHA 2XZ9A 4H9ZA 4MSSA 1CGXA 2J62A 4GYPA 2OGJA 2WKGA 3STPA 4PUJA 3U0HA 4E8DA 4B5VA 3FXYA 5F1UA 1VBRA 4XK2A 1QI0A 5HWNA 1VKFA 4C6MA 3KWSA 4V15A 1BWVA 3KOXA 4BCEA 4G7FA 1H0IA 3KVKA 3TC6A 2PDIA 3EMQA 4QCEA 4R85A 5EPDA 5AC8A 1UC4A 3ITGA 2ZFAA 1WDDA 3VD3A 2NQJA 1NH6A 3ZSTA 1R7OA 2O92A 2HVMA 1JZ7A 3VDBA 2YZ5A 5I3FA 3D46A 3B06A 3ATZA 4NIRA 4JNZA 3W29A 1XSJA 1SU5A 1UP3A 1XH1A 2PGWA 3NDZA 2P3EA 3MA8A 5D9OA 4G9PA 2DT2A 1L6FA 1SZRA 3W02A 3ITXA 1NP2A 1TJPA 4EXQA 6ALDA 2RJHA 4BI6A 4KGLA 5H8MA 1PKNA 4E3VA 4CD8A 2J4GA 4LVDA 4LBUA 2UY4A 3UBPC 3GBDA 1WDQA 1DJYA 3BC9A 5AYBA 5EFDA 3ZOAA 3P74A 3QY7A 4LU0A 4LGXA 1ITCA 2EBNA 2FJUB 3GXPA 2OX4A 3PWGA 5D32A 4R27A 1AH0A 4GFIA 5DBUA 3TA6A 1PYFA 3JZUA 2G5WA 2PDCA 2Y89A 3KCOA 3EOUA 4S3CA 4LYQA 3GVVA 3QBUA 2YDAA 1J9YA 4JTJA 2BVTA 1C92A 1FUYA 1I2NA 1ME7A 3PHAA 5ABEA 4MFEA 2FLIA 3FSTA 1LRTA 4H7VA 4X61A 4OV4A 4IISA 1B9ZA 3II1A 1S1PA 3H2EA 3LCGA 1B3YA 1E0XA 2YBTA 3HPZA 2HQAA 5AN7A 3NO5A 1XINA 3NR0A 1TV4A 1FRBA 1SO4A 2Z2UA 4FNTA 4X22A 3A47A 3M6YA 4E8GA 3QV7A 4Q7NA 4ZVJA 1XCWA 3N9RA 3CV6A 3HV9A 3VC6A 4JCMA 2J7BA 1AFSA 1NF0A 3IIVA 3WYZA 4INFA 4P8WA 2DDXA 3HGRA 3FOKA 4DHGA 1DXIA 1JDCA 3LHZA 4AIOA 5C70A 1T7LA 4K2SA 4PFMA 1ISYA 1MNSA 1OCJA 4C6IA 5C9ZA 1E6PA 1PTDA 4JTCA 2P76A 1XGZA 4LY4A 4WDTA 3SUUA 1TPC1 1GW1A 4UFJA 4PUUA 1SZNA 1V0LA 1YNQA 3ICJA 3LNPA 5DRCA 3W1XA 2VEKA 2WC7A 1KKOA 2P8CA 1FWTA 4E2DA 4OBSA 1UWRA 5EKYA 2X42A 3WEOA 1JCTA 1JUBA 1AA1B 1BWKA 1GOWA 4LNYA 2ATMA 4CCEA 3AIQA 4MPKA 2CWNA 1YX1A 2VD8A 3DH7A 1VD6A 1PX3A 2PTXA 2QCCA 1TV7A 1GQIA 1RK5A 1EUNA 1KTNA 4C6DA 2IKHA 1TTIA 3O06A 3AXKA 2QHAA 3AROA 3QQWA 3TW9A 1HO4A 5A6BD 3M5YA 4GI9A 3IV3A 4Q32A 2OQHA 3NSNA 1ELSA 1XBZA 1PPIA 2VEFA 2Y63A 2EGZA 3GZAA 2VR5A 3VABA 4ICCX 4GA8A 1I8JA 4UFMA 1J18A 5C9UA 3WENA 5LGXA 1GVFA 1XM3A 4GKLA 5FL1A 2VUYA 2BFGA 4XO7A 1ZBCA 3KTSA 8CGTA 4O50A 3W70A 3P82A 1FH8A 4ZB5A 3NQBA 2R8WA 3Q67A 4U3AA 3L5LA 4D9PA 4JKMA 4XD4A 1AW2A 5D09A 3TN5A 3LN3A 1XRTA 3HFTA 2ZUTA 3EWWA 2ZZ7A 1YBQB 1PDYA 2V5LA 2PPGA 2ON3A 4L56A 1GCYA 3K1GA 1VLWA 3N2BA 5A6LA 1X1OA 1TPEA 6XIAA 2GYIA 3LCFA 3ZM8A 4OUEA 3HV8A 1ZS2A 4O4VA 3VKJA 1O95A 3WH7A 4B92A 2ALRA 4FPSA 4A22A 5GJPA 4EPKA 1WZKA 1JYNA 3I4KA 5AC6A 1AJ2A 3RG6A 4PTXA 4NT0A 4HSOA 3F5KA 3IJ9A 1KV5A 3J7HA 4DO6A 2DZBA 4JTAA 5ENLA 1SSDA 5HNRA 4H9XA 5CCZA 3SCWA 3XIMA 1Z7AA 3WBWA 1IIGA 1T41A 3CV1A 5CJ5A 4KCTA 2EXOA 4ZTYA 4S3FA 3INPA 2PA6A 3V5FA 2Q71A 3NAVA 1FWSA 3F2BA 1XS2A 5HPCA 4OZOA 2J47A 3WMLA 4Z2GA 4ZQCA 3A21A 2HBVA 2PWEA 4W7UA 1JZ4A 2E67A 4YVPA 4IMFA 1XGDA 2HE8A 4L80A 3WH6A 4Z0JA 3QPYA 2YXXA 1EJ7L 4UTUA 1BYBA 1JL8A 3KBWA 1W3NA 2PC4A 2TPSA 4S23A 5BRPA 1MW0A 4RNJA 3AISA 1A5CA 2X41A 3VPLA 5EMMA 1G94A 1PBGA 1A5UA 1NDWA 1I6NA 4K36A 2P50A 5LIYX 3UXDA 3GG0A 4GZIA 4HNVA 3TA9A 1UKOA 4HTYA 4IIFA 1ZBKA 4EXAA 5AZ0A 5E9XA 1XLAA 2OSWA 1J6OA 4N2YA 4P5UA 3SCSA 4QLLA 1FWBC 5BRBA 1Y5VA 4HN8A 2B31A 4FLOA 3TAOA 4ONVA 4DUOA 4LALA 1A5LC 1ZL1A 1SMAA 3PNZA 3CZLA 2DZVA 4RZ5A 3UWUA 4NZ5A 3U5UA 5A8PA 3SUVA 4NF7A 3GTIA 1CGYA 5FF0A 1LROA 1ZALA 3H2CA 3WBAA 1RD6A 2FZDA 3NQ8A 4JFUA 3AHTA 1KNWA 1KRCC 2NWRA 1JEZA 2ONEA 3HPXA 4MFDA 1A3XA 1XLCA 3ITYA 5KINA 5HULA 1LDCA 2DU2A 1KXTA 1R9ZA 1TPUA 4URIA 3VGFA 1VFUA 5HR6A 3HA1A 3MSYA 1NAL1 1ZBWA 2QVNA 4XAZA 2VL4A 4I9MA 4XTDA 3RHGA 3VOJA 2I5IA 2PDJA 2QDDA 4Q7IA 3UY7A 3JUGA 5H91A 1TR1A 3P0XA 2V68A 3H22A 3ZWTA 4JIRA 1SO3A 2CC0A 4HOZA 3C3NA 4AW7A 4RKAA 5CPSA 2WNNA 2Z1XA 4S3GA 4W8AA 2P1FA 4WUIA 1VFHA 1UWUA 1Z44A 3QC0A 3SY8A 1QNVA 3CUJA 4MVAA 1OY0A 1I1WA 4HMCA 4CNPA 3KCLA 3N2CA 2GVGA 4RPQA 5F2IA 3U48A 2X1TA 3G22A 2P8BA 3POCA 1RPXA 1J6PA 4L9XA 1GZ1A 3O15A 3M41A 4KRTA 4I5RA 3OQEA 1EDGA 1B1YA 6ENLA 2ZA2A 1XIDA 2ZX7A 1OINA 4G8TA 3NZRA 4MWAD 3L2IA 1S3TC 2J8FA 2ZRUA 2PWGA 5K3VA 5ABGA 4PTMA 2VGBA 2PTYA 3YPIA 3QV9A 1BYDA 4JQ1A 2JIWA 1XRVA 4LUYA 4QJ3B 4UMAA 4C6QA 5IDZA 4YS1A 1J0YA 5LNSA 3U57A 4GUJA 3CUZA 2PLKA 4WZHA 2CLLA 4GX9A 4AIUA 2PCEA 2VCAA 2QCGA 2ZIDA 1ADOA 3W7CA 3DCPA 2ACQA 4O28A 2OYKA 1B2YA 3SY1A 3NEHA 2PGRA 2BVYA 3LG3A 1UOZA 4JAWA 4MWAB 1TTPA 2YA0A 5HMSA 1EO5A 3G18A 3CQIA 4FO4A 3V35A 3AS2A 3ALGA 4KMQA 3SCRA 4AB4A 4JTDA 5H1WA 3V3WA 3H2FA 3C4UA 3T81A 3ABOA 2OKOA 1HIZA 2C1HA 5D8WA 1Q6QA 2G95A 5IXEA 2EG7A 4TV6A 5T9BG 1TSIA 4TO8A 3RUBL 3VNDA 4NG3A 2E4TA 4I8YA 4IQDA 1BVNP 2DH3A 2J24A 3NVDA 3NPVA 2A79A 2G37A 4IOTA 1JNEA 4OU1A 2OSXA 2ZOXA 4HK5A 3CBWA 2HPIA 1HW6A 4CU6A 4AZCB 1JVNA 2YW3A 3MI3A 4DX3A 5I0DA 1MXDA 1MYRA 4IHCA 8A3HA 3UPBA 3BLOA 1LRNA 2E8YA 1ITQA 3VOGA 1VPXA 5K9XA 3QY8A 3URBA 3W2JA 2AL1A 2BXZA 2J9XA 3OA5A 5EGRA 5CPQA 4XX6A 2FFIA 3WNOA 4V2XA 4G1KA 4N4QA 2DIJA 3ZZ1A 2D73A 2VDHA 4BJHA 5CPTA 3VXGA 5AHLA 4DELA 5I6SA 2OSYA 4RNHA 3ZVHB 4PL1A 1QHPA 4FB7A 4XD3A 5EBAA 3W2MA 1BSIA 2FHBA 1GEQA 2FPVA 1CLXA 2XWEA 2YL5A 2VRJA 2WXDM 5CC7A 1UD3A 2Y5JA 5IDIA 2ZZ5A 1DXEA 3M0MA 3W72A 4LOCA 4H8NA 2PRLA 3VD4A 4LAUA 3EA2A 4Z1CA 1UASA 3MVIA 3A4XA 3UERA 1FVPA 4AEOA 3S2JA 2VCBA 1DV7A 4IMDA 3C6CA 1U2YA 5D04C 1XIIA 3C0SA 2F9RA 5HNTA 5E9AA 4B5TA 4ZFCA 1LZOA 5C2CA 1OIFA 2BOGX 1U83A 2CETA 4UTKA 1OF6A 4D6EA 1RLCL 4CQAA 5E6ZA 5FEPA 2A3AA 3JRKA 4FNSA 3M0KA 3VKCA 1X39A 1YKWA 1KBLA 3ZVHA 2D2GA 4ERIA 3VVGA 1V08A 1J0JA 5AC7A 2B7NA 1W91A 3TDFA 1J0KA 3NQAA 4Q22A 4REQB 1BVZA 4GYKA 3QTGA 4JHMA 1D8CA 3TFXA 4JTUA 1O68A 3LU2A 1OBAA 4XD6A 4UQCA 2FDMA 1L6GA 1POJA 3GX9A 4ZCWA 4JYDA 2E3ZA 3L68A 4QDWA 3QRHA 4P8VA 5A2BA 2VZVA 3ARTA 1GHSA 3REQB 2WHJA 3MBFA 5SWUA 4PODA 2GOKA 4JGDA 5KZMA 2BODX 3VX0A 3V18A 1X8CA 1LCOA 4ZXOA 3OG3A 2QIWA 1FCQA 4RDZA 4MY9A 1TPH1 1V02E 2CLKA 3S46A 3GK0A 4DZIA 5CC3A 1V93A 4GNKB 1T6MA 2O9OA 4O0KA 5CG0A 4Y9AA 1QMLA 2QCFA 5IHRA 1W31A 3BL3A 3W26A 2B7OA 1KM0A 4L1WA 4CQCA 4HPHA 3EA3A 3STCA 2Z25A 4REQA 3O6CA 4X0NA 2YLLA 5BROA 4AU0A 3AJXA 4XBJA 3UR7A 4PBGA 1X38A 2PSNA 2CPUA 2AMXA 4IQEA 2HV5A 1KLYA 2C0AA 1QFEA 3KAOA 4KPLA 2OXNA 4O1AA 1FHVA 4IL0A 5TBOA 3CQHA 3T08A 1PKLA 3N13A 1MRAA 3QSTA 3REQA 1V3LA 1XIEA 1IYXA 5GJNA 5HQEA 1Z48A 3RM4A 1PIFA 1GONA 4GBDA 1LP6A 2NLYA 4H9YA 2R1MA 1P0KA 3HG3A 2Y85A 3L0KA 1UROA 3ERPA 3WK3A 4J4KA 1UP0A 5FF7A 1YTDA 4AXKA 3G6LA 3UP8A 1I2PA 4A35A 2OLAA 2O9TA 4GGHA 4M7TA 3KUMA 3N4AA 3WL1A 3HBLA 1X6NA 4ZB2A 4DJFC 3N04A 1EDQA 4DWSD 4G7EA 2GVYA 2TODA 1LG2A 1MEHA 4AC7C 2D3NA 4XAPA 1A4MA 1BQGA 3NPUA 5HMFA 4GOAA 1GTEA 1UD4A 1UWSA 3E6EA 1V7YA 5DY2A 3PNUA 4HNTA 1EBHA 1BXNA 3PUEA 3UG5A 1TVNA 1NOWA 5I24A 3ABRA 4BA0A 1F7BA 1ONWA 5LNVA 2V3FA 4M51A 3WUGA 2DY3A 5G1MA 3RMJA 4R34A 2E09A 3UZ5A 3FGCB 3VIFA 4JXCA 3TH6A 5C9XA 2DT1A 3MP5A 4DWSB 4BF9A 1ZPTA 4QCFA 3AC0A 4M24A 2F38A 3IIPA 1J01A 3KVMA 5I03A 3CHFA 1OT1A 1PDZA 4EWJA 1WO2A 1W1B1 3EKZA 1TRIA 3LPOA 2JKPA 3R10A 3DFOA 5FF4A 3BSHA 3TUUA 4IPPA 3QOKA 1H2JA 5A95A 4FI4A 3W37A 4EPEC 1EXPA 2OT0A 3CIVA 2ZWZA 1E9YB 3M7SA 2B81A 4HA1A 1Z9AA 1PKYA 3BCFA 1V0KA 2PDNA 3A6OA 4TTGA 2H3DA 5CZKA 2ZZ1A 3T40A 3WJSA 1S5MA 5C55A 2ZZ6A 3W86A 3FGCA 4LCRA 3U2OA 4HT3A 1CGTA 2VYOA 5CLTA 7REQB 4PEKA 3QKZA 1XDJA 5F2LA 4JTGA 4DBUA 2A1YA 3G1FA 2C13A 2J66A 4BWLA 4TXEA 3WDRA 1IWPA 1TJ1A 1F4AA 5K4ZA 4PH6A 3CU2A 2DVUA 3R4IA 4MADA 1JZ3A 1OFDA 1GGOA 4RW5A 3UG4A 3B0YA 3I65A 4WJXA 1FKXA 4C91A 4Q8OA 2E9MA 3WCZA 2P3ZA 2QAFA 4ORMA 5A8OA 3CZEA 2OZTA 2BGQA 3CWOX 1UYQA 4FK9A 1KTBA 2X0HA 4ROPA 1ZGDA 2J7EA 3P61A 2UWFA 3SN0A 3NQEA 2WCSA 4JFTA 4NJGA 1EA9C 3BAJA 1ECEA 1U33A 5A2CA 3GW3A 4ADUA 3L23A 5LYRA 4BEQA 2EPNA 1R46A 1QK2A 5CPLA 9CGTA 1TPB1 1J2BA 3UJEA 1Q6CA 2REQA 2G41A 2QT3A 5AC5A 3THAA 1XD1A 7REQA 3T4CA 4LAKA 1KRAC 3KXQA 3IK2A 2GK1B 3N2TA 1V7AA 3LERA 3SW6A 2E7FA 2X2GA 1AH3A 2Q8ZA 3HGSA 2OOFA 4HN4A 1NM9A 3EEZA 3WD4A 4XBSA 4S3AA 1I2QA 1XLGA 3O6DA 2YSWA 2PLJA 4HHLA 4JPGA 2XYLA 4O16A 4K37A 3L2LA 4RZ6A 4NQ1A 2DUXA 1ZAHA 2FGZA 2FGLA 1UJQA 3H23A 3ID7A 5DLCA 4PSPA 1ALDA 1TWWA 1PSCA 3KW3A 4PA8A 3SO7A 3O16A 4NJKA 4QNWA 2QPUA 2QV4A 5C6MA 4GYJA 2ATSA 3KVLA 5LIXX 1NVMA 3A3WA 4P7OA 4IIDA 4PGLA 3W1MA 3L4TA 1WKYA 3T8QA 4KT2A 4UTLA 1YDNA 3P84A 2FPYA 1R9YA 4X3ZA 3XINA 4GCXA 3SEPA 3W85A 3B0PA 2NWSA 4UTHA 2GUUA 1QBAA 2DVTA 2GK1A 1RJPA 3E5BA 5CSSA 1R9XA 5T9CE 1BF2A 4YIWA 4OOZA 1TELA 1CGVA 4ICNA 4LUTB 4AHPA 1REQB 5M5DA 2DSKA 1BG9A 4MKNA 3B9EA 1UUQA 3WJXA 1CB7B 2TRSA 1HFBA 1FXPA 1QI2A 4O52A 4KCVA 3W2NA 4XIMA 3TVAA 3DHFA 2INZA 5HQMA 1N8IA 4QS5A 2YCEA 1UKSA 3GS6A 5E0KA 3DYOA 3P60A 5I09A 3BOXA 1TMHA 4Q8PA 1OK6A 3LZ5A 4JYFA 4A8NA 1R85A 4RLIA 1RJRA 2P5NA 2WV8A 1V6YA 3EZ4A 1HKJA 3PJWA 4PC8A 1PHQA 1CECA 5D05A 3PZTA 4YNGA 1KM2A 4PMJA 3VK5A 3NL2A 4TX8A 2PDWA 1IEIA 3H2OA 5HWJA 3OZPA 4IIGA 1JYXA 4LYKA 3CNYA 3PG8A 4JY9A 3F2DA 5EMJA 4LS2A 3USBA 4MKVA 2BASA 2X7VA 2ZC8A 2IKGA 3BOFA 1J5SA 4OWGA 3LLDA 3IRDA 2CCRA 4LUTA 1REQA 3AIRA 3IVSA 3W87A 4N4PA 4AD2A 3KDNA 4DNHA 4NXKA 4AG0A 5D30A 3KBVA 3BLKA 1RR2A 1E43A 1QU4A 3GUGA 4HCDA 3ARWA 2QUMA 4WEVX 1K77A 2DZUA 1J8VA 3KDOA 3NZ1A 1UD2A 1VFMA 1T96A 4BKNA 4IGNA 1B3XA 3CPUA 3B9AA 2XUCA 3TIMA 1ZFJA 1OX5A 4NZCA 1E5JA 4KQNA 4TVDA 3N1AA 2FFCA 3DECA 2WZEA 4HBKA 4CKQA 2VEIA 1OG0A 3KBMA 1QI4A 3QZ6A 1T5AA 1PL9A 4XO6A 4K38A 1EX5A 4KEMA 2QJGA 3BSGA 3RYSA 3DENA 1FWAC 3SIZA 1ISZA 4ICMA 1D8WA 2F6XA 5CSRA 1EXBA 3WNPA 2BOEX 4L4MA 4A3UA 2YJQA 2X05A 4OBRA 1C8QA 2XN2A 2ZTKA 2VZUA 3TMLA 2GJPA 1LL7A 1WDSA 4IM4A 1POKA 1ISWA 2J9YA 1E6NA 1EGZA 4AZHA 3AIUA 3R2GA 4A3QA 4M1BA 3PUGA 2AQWA 1US0A 2F61A 3RLHA 3TP4A 3A5VA 1SMDA 3GU1A 3N3TA 3TMQA 3PFRA 1EGVA 2OZ3A 4ZQPA 2XPKA 2GGIA 3MP3A 4QJ5B 2J9ZA 3APGA 4ML9A 1XCFA 1S46A 4O14A 3GR7A 1DL3A 3U2CA 1CTNA 1X6LA 3MUY1 5AFDA 4HGXA 1V02A 4JIPA 3C2RA 2QEZA 4WOQA 4S3JA 5D8ZA 4BQ3A 4J28A 1US3A 4E4FA 1XLIA 3AMCA 3E12A 3AUOA 2MNRA 2GSEA 1W1VA 1FX6A 3LNMA 1M5WA 3W6YA 4GIAA 3DBNA 3HO8A 4HMEA 1JFXA 4WJ8A 4C1LA 4ZQNA 1VHCA 4Z1DA 1AD4A 4KFNA 3W7HA 1F5ZA 1UUMA 4PUWA 4A6GA 4XUYA 2YCKX 3NJ3A 5D37A 3SCUA 2BMBA 1TV2A 1TA3A 4GI6A 1OX4A 1O1HA 4NVTA 3PAOA 3W83A 3N18A 1OQFA 1NFBA 2V8ZA 4MZ8A 3LGGA 3VC5A 1VRXA 2CXGA 2GJXA 1EQCA 1YTEA 1JQVA 5LIWX 3MQTA 2X2YA 4O4WA 3F4DA 1UUOA 1U22A 2XIQA 1MUWA 4BQ4A 3NQ6A 2BY0A 1OEPA 4N9BA 4N9EA 1AJZA 1CXKA 4O11A 1JD7A 4QXIA 5D02A 4MJMA 2GZXA 3VM5A 1NY1A 4W5ZA 2PZNA 1A5NC 4MMWA 1Q4NX 2OT1A 4W4QA 1FDYA 3TONA 4UQ9A 2IPGA 5HNUA 1XSKA 2NQLA 1DJNA 1QNQA 2VGFA 2B4GA 2EG8A 5H8PA 1OGSA 3ZT6A 1EJVC 2CZFA 4LV9A 1E6ZA 1RCXB 1ZP4A 2C1GA 1M68A 3VDAA 3FAWA 3NDOA 3VD7A 4UTTA 5FEXA 5EA9A 3KOWA 3TCEA 4LNCA 1XIJA 3DDMA 4GBUA 4NILA 3TTSA 1HKMA 1G7UA 3KZPA 1KFBA 2BWGA 3H7UA 4FIRA 3VZYA 2Q3RA 3D3AA 3SZ8A 2EPKX 3W1AA 3DC0A 4YTUA 5M3WA 3VCNA 4LYRA 4F2TA 4LUSA 4XB3A 4UQDA 1BGAA 3OHIA 4A2RA 3DFSA 3N12A 3AMKA 5HQLA 1UR8A 1CLVA 3WBEA 4ROQA 3E96A 3AZRA 3QMRA 3CLWA 4M29A 4Z17A 5F2GA 1S5WA 2XFWA 1UWIA 1I2RA 1Z3NA 4Z1BA 3PR2A 1O12A 3CUXA 3VIHA 3STFA 1UH3A 3WNNA 2IQTA 1A80A 4MAVA 1UB3A 1GOIA 1E5NA 3QFWA 4A8RA 4EOUA 1U1UA 2XH4A 2DVXA 1LOLA 4F9DA 1S38A 1EFZA 1ECQA 4GH1A 4GVFA 4UQBA 3W7LA 3AS0A 4UTWA 3GE7A 1R2TA 1TCMA 1YEYA 2FVMA 2QULA 4OE7A 1FWWA 1CEOA 1CT5A 3RO8A 3TAKA 3BAXA 4B3LA 4D6JA 4J9JA 5AHEA 4GIRA 3ENLA 2D24A 1BD0A 1M03A 4KBXA 3HPFA 4ACZA 1RD5A 1FKWA 2A85A 3IIZA 1GOXA 3FJ6A 1XWYA 4C6JA 1NTHA 3C0LA 4HNNA 1XLHA 3EDDA 3G1AA 1M65A 5IHSA 1P6BA 3KE0A 5AOUA 4LV4A 1DIOA 1N8FA 3DFQA 4AWEA 1D7KA 1JULA 3WUFA 1SZEA 1G67A 4XZNX 2YCJA 3MCMA 1HGWA 1GQKA 3IVTA 2FMNA 3W6LA 4MG4A 4RDYA 4UNIA 4GI8A 1S5VA 5JBEA 3LCWA 4GXPA 3EWYA 4K7YA 4HSNA 1H1ZA 4QNEA 1W32A 2V9DA 2X7WA 5BU9A 1UOKA 1OGGA 4L6DA 1F74A 2WSYA 1ONXA 3PTQA 3M5ZA 4RZBA 4D6CA 4C6EA 1YPXA 3K8LA 3SUSA 2O55A 4DZAA 4KWWA 3ONBA 1R2SA 2DZXA 4O57A 1BXCA 3IJQA 4G6CA 2PDFA 3BG9A 2Y5EA 1TWSA 5C8BB 3H21A 3WKZA 5HMEA 3AHZA 3LHTA 3GHRA 1Q4WA 4U33A 3RN6A 3C0QA 1P0NA 2VR2A 3W1NA 3PSVA 3M43A 4C5YA 3H6OA 1EO7A 3STGA 5I77A 1KGUA 4LUJA 4N6FA 4O0QA 4YLWA 3MP4A 2CBJA 2GPTA 3DXIA 4QE5A 1IGSA 3T7VA 2OKTA 2EG6A 3OP2A 1VIZA 3BAWA 3A3XA 1PVNA 1W9XA 4JEQA 3SCTA 4CD7A 2HWGA 4XQ6A 4LANA 2A3BA 4X60A 3E0VA 1EH9A 1G0CA 3H53A 4JX5A 2ADAA 3CTTA 1KM4A 3KHDA 3H8AA 1B5TA 1R3SA 1A5OC 1RP8A 1V03A 3L0GA 3LCLA 4ZTXA 5REQB 4NZFA 4AHOA 1R5YA 5E09A 4PL2A 1XLLA 5U7SA 5JQ9A 2FKPA 1W1PA 1WAWA 4TX6A 1DP0A 1M3UA 2XIBA 2VRKA 3ATYA 4N9DA 2GDVA 1OCQA 4ACYA 3KS5A 2VVSA 1QCWA 3TWBA 3C56A 4DJEC 2SFPA 4JQ4A 1MVYA 5TNVA 1XJBA 1D9EA 2I56A 2UY2A 3SR7A 2NSXA 3AXMA 1V51A 4ZENA 3NFUA 2W66A 4LVBA 4QS6A 2HCVA 3KM8A 3GXDA 3OYXA 4NZ4A 1QO5A 3PZIA 1P0DA 5A8GA 1GORA 5HMDA 2QXWA 4JN8A 4GE8A 3VE7A 2E6AA 3GTHA 4F48A 1G5AA 1YXDA 3TNBA 4DJFD 3IUIA 1K1DA 3TW6A 4RX0A 3RR4A 3BG5A 4AVOA 1R86A 2BHZA 1W56A 4JICA 5REQA 4H41A 4JDYA 2Z2AA 4QBXA 4K68A 2ZRVA 3KVJA 1W5MA 6CGTA 2AL2B 4AWTA 5KETA 3E0LA 2NV1A 3T0TA 3VNKA 4O1DA 2OYLA 4I7UA 2R14A 2WJZA 6TAAA 5HOSA 1J10A 5MF5A 3ABQA 4Q8NA 3UYIA 1TR9A 4D6DA 2YXGA 5F2MA 4C7GA 4AWUA 2ZWYA 3HIJA 3LTYA 3F4WA 2HPMA 4DM2A 2OLSA 1ZZMA 3EA1A 5LNRA 5D2YA 3UWQA 2VD9A 3N34A 1R8LA 3VI2A 3DFTA 2QLYA 1EP1A 1HJVA 4QG9A 3MMWA 3LBOA 3R13A 2E1WA 5A69A 1OYCA 4DUXA 1WZMA 2TSYA 3SAZA 4WGXA 2I17A 4W5UA 3VNIA 2QCHA 3QYQA 3G3MA 1KV8A 3A4AA 3LSBA 3QR1A 2PDBA 1UIOA 2NX9A 3QEZA 4PN2A 3BPWA 3OGSA 1EA0A 4HCHA 1JZ5A 1QNSA 1TZZA 3DIPA 2W3ZA 1G4PA 1GKRA 2WMKA 4IG2A 5DMNA 4WSHA 5CGTA 4W87A 1UR1A 3FA3A 1UR4A 4TV5A 4QQUA 2F6KA 1EX1A 3GAYA 3L7RA 4WJEA 4DRSA 2BHYA 2Y61A 3CUGA 3F4CA 4Y2WA 3W82A 2NX1A 3TCSA 3GDKA 1XC4A 3FJNA 3EDEA 1O5QA 2WSPA 2WVUA 1JCYA 7ODCA 4FNQA 1SUXA 4JFWA 2BHUA 2WAGA 3WQVA 3SCNA 3EWCA 3HMJG 2FDSA 3PZVA 3S83A 4DZ5A 1FA2A 4DJFA 1AZ1A 5LHEA 4XG1A 5FI8A 3QHMA 4WY0F 4H6EA 2OCZA 1SPQA 3NM1A 3AHVA 2V5JA 4NNBA 2JKEA 4TQTA 2OEJA 4PMOA 1E9ZB 4XVDA 3SSZA 3WQEA 6A3HA 1BAGA 1EP2A 3BUVA 1JF5A 3GNPA 3D5HA 2HMCA 3FLUA 3LGEA 2WK2A 1PZ3A 7TIMA 3S42A 3FJLA 1H7XA 1RP9A 3WQOA 4R5EA 2BTMA 5BXSA 2B7QA 2X1RA 3QC3A 5T8GA 2W63A 4MIMA 3TN4A 3KOZA 2ZRWA 3ISIX 4MDPA 3ARVA 1BFNA 4GH3A 1CYGA 5L6UA 3VIIA 1UJPA 1ICSA 1TIWA 3TC7A 2X1UA 3VGEA 1JCLA 7CGTA 1F8MA 2C91A 4DJDD 2BLEA 3TYCA 2GDQA 1P6WA 3RDKA 3S5ZA 1XHGA 4GQGA 2GVLA 3T0BA 1YXCA 4XBKA 1HG3A 4J2PA 4O19A 1J12A 2XGIA 4KKXA 3UPMA 3P93A 1I0DA 1FP8A 4GWEA 1ZENA 2I5QA 3GNOA 4RV8A 2BNJA 1JCNA 2XISA 1UD8A 3G0UA 5LA2A 1SZFA 2OQYA 3GO2A 3VFCA 3W1UA 1QOXA 3URAA 2CBIA 4IMAA 3UR2A 3PZ9A 4BZYA 1Q13A 2OZ0A 3ZJ7A 5F4XA 1CGWA 2UZ9A 3AFBA 2V5DA 2OPJA 5A8NA 4PMNA 2YYTA 4R9XA 1GEHA 3NL6A 1CWYA 2ACUA 2GSJA 2JGQA 4F0SA 4LQ1A 4ZO7A 3HOJA 4DPQA 2QJMA 3QV6A 1C7TA 3IEBA 4B3KA 1L8PA 1P43A 3HN3A 3TYZA 5AC4A 4MTVA 1U30A 4IWWA 3APYA 1YPIA 1HVQA 4BEUA 1UG6A 2C1IA 1HGYA 1X1NA 2P88A 3SJ3A 1IZKA 4GY7A 3AAMA 1TVPA 1KW1A 3ITLA 4F0LA 2QDEA 2H3BA 3KL0A 3B8DA 4JHZA 3LUTA 5GPRA 2R91A 4DO4A 1TWZA 1JRBA 1SO6A 4OQVA 4OKDA 5LA0A 3G1SA 1EJTC 1XGEA 3CAVA 4LTSA 4H6RA 1TVLA 1NELA 4UWMA 2YA2A 4WXZA 4ZOBA 1BYAA 5FIPA 4DJDA 3DI0A 1HJUA 1D7FA 4RXFA 4F3HA 3EDFA 1KQYA 1LTDA 1XG3A 1YDOA 1AL7A 1V79A 4D6FA 1UWQA 3AYTA 5KSWA 1EJUC 3ZLGA 3LPFA 4XZWA 5JBDA 3E5PA 4ZMGA 3UNTA 2GVEA 2I14A 4QJ1A 1UPPA 4DLFA 4B5WA 3IARA 1EGMA 1B3OA 1A0CA 1KCLA 2V3EA 2CZ5A 3ARPA 3U2ZA 4Q8QA 5FESA 3HPAA 4PB4A 4C60A 5CPNA 2IW0A 2YFNA 4JFVA 1UD6A 3CHEA 1J79A 2XM1A 3FVMA 3KL5A 4I5XA 2WM1A 3LXBA 3ITOA 2AKZA 3S5SA 3QR3A 5FACA 3QHNA 5C7HA 2WJFA 4IP7A 4DBDA 4JTLA 4LEQA 1DWFM 3QQ0A 3ARUA 3V0UA 4DXKA 3UG3A 4S39A 3EX2A 1SGJA 5DN1A 1F3XA 3F7JA 5JH2A 2PDPA 1EB3A 1QHOA 1CXFA 4RE3A 3QQ1A 3OPSA 3U6WA 3RLVA 1QPNA 2G4FA 2WC3A 4RK8A 3WQ8A 1H60A 2WJEA 4GABA 5F1VA 1XD0A 5AHIA 3T4WA 4IF2A 5A6SA 3QGVA 2A6NA 2JFEX 1K9DA 1Q8JA 3VGBA 2CHNA 4IP5A 3W84A 3AYSA 3T2QA 2Y7EA 3KRZA 4U28A 5C5YA 3DGBA 1BRLA 3O0FA 1FH9A 2A4AA 4ZODA 4Z2LA 3S2MA 4OJYA 4I90A 1C7SA 3B8TA 3KBNA 3Q94A 5A6JA 4MNLA 3BMWA 1EJXC 5E6YA 1E56A 3CM4A 2D0GA 3H2NA 1WUEA 5FKYA 1KM6A 1PZ1A 5LKYA 3V7PA 4C7DA 3GH4A 4P61A 1XIGA 2HNHA 1W9VA 1HP5A 3WL0A 1U1JA 5AYXA 3GXMA 4P7LA 1G6CA 2DQXA 1GNXA 3RJYA 3QZEA 2W27A 2WMIB 2DQWA 3K2GA 2A7PA 3UFYA 5JUVA 3W1TA 3KZSA 4TX9A 1KB3A 3HM7A 2VR4A 3SGZA 3WNLA 1UH2A 3VZXA 3P14A