3R7NA

Caspase-2 bound with two copies of ac-dvad-cho
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
159
structure length
154
Chain Sequence
MQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFLEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and enzymatic insights into caspase-2 protein substrate recognition and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-2 subunit p18
total genus 54
structure length 154
sequence length 159
chains with identical sequence C
ec nomenclature ec 3.4.22.55: Caspase-2.
pdb deposition date 2011-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r7nA00
3PD1A 1PYOA 1CP3A 2CNKA 1M72A 4ZVTA 5LUBA 1PAUA 4EHLA 3SIRA 5IBCA 3IBFA 1I3OA 1KMCA 2CJYA 3GJSA 1I4OA 3KJFA 4JR1A 1NMEA 3D6HA 1BMQA 1QTNA 1IBCA 4QUGA 1CVRA 2HBRA 1RWNA 5LU8A 3H11B 4JJ8A 1RHUA 4EHFA 3K7EA 2CNLA 2XYPA 4NBKA 4QU9A 4JR2A 4N5DA 1RWWA 4QULA 4EHKA 2Y1LA 5IAEA 3R5JA 2K7ZA 4N7JA 1RWMA 3RJMA 5IBPA 2QL5A 2XZDA 3P4UA 5I9TA 1SC1A 3V4OA 2H5IA 4JJ7A 5JFTA 4ZVPA 3IBCA 4QUAA 3H13A 2J30A 1GFWA 5IARA 4I1PA 3V4LA 2FQQA 4JQZA 3EDQA 4QUBA 2FUNB 4ZVQA 1I51A 3PD0A 3V6LA 2AR9A 2J33A 2C2KA 1RWVA 2H5JA 2C2OA 4PS0A 1ICEA 2HBZA 1F9EA 2QLJA 2H4WA 2H48A 1NMQA 4D3ZA 1QX3A 3OD5A 3UOAB 1NW9B 3H1PA 4AWBA 4I1RA 4HVAA 2C2ZA 1SHLA 2QL7A 2H65A 2J32A 3V55A 1SHJA 1K86A 2H4YA 3D6MA 3H0EA 3DEHA 4M9RA 3R7SA 3QNWA 3PCXA 5LU9A 1JXQA 2C1EA 4FDLA 4N6NA 4QUDA 4QUJA 2CNNA 5IAJA 4ZVRA 3R7BA 2C2MA 2XYHA 4JJEA 3BIJA 2H54A 3EDRA 2CJXA 3DEJA 4QU0A 5IBRA 3S8EA 1SC4A 3DEKA 2XYGA 3GJQA 3KJQA 2CNOA 2HBQA 5IANA 2Y0BA 4D3XA 4LSZA 3R7NA 3NKFA 1RHKA 1K88A 1RE1A 4FGUA 4HQRA 3V3KA 4AW9A 4ZVUA 5IASA 5IAKA 1RHRA 4JB8A 4QUIA 5K20A 4QU8A 4JR0A 1I4EB 1QDUA 4EHAA 2H51A 5IC4A 5IC6A 4PRYA 1NMSA 4QTYA 1RHMA 4QU5A 4PRZA 4NOMA 1RWKA 2QL9A 3NS7A 4EJFA 3R6LA 2NN3C 4EHHA 1RWPA 3DEIA 2DKOA 4DCJA 3R6GA 4ZVSA 3NR2A 4EHNA 4NOKA 2FP3A 4IYRA 1RHJA 2QLBA 5I9BA 5IABA 4PS1A 1GQFA 4EHDA 4NBLA 2CDRA 2WDPA 3P45A 4HQ0A 4QUHA 5LUAA 4FEAA 4N6GA 1RHQA 3GJTA 4NOJA 4QUEA 2J31A 3SIPA 4JQYA 4NBNA 3S70A 4N7MA 4IEFB 2P2CA 4NOLA 3UO8B 3D6FA 1RWOA 5IAGA 3H11A 2XZTA 3V6MA 4AWAA 1RWXA 4DCOA 3GJRA 3ITNA 2HBYA 3E4CA 3KJNA 4FXOA 4ZVOA 4DCPA 4QTXA 1F1JA 4N6OA 5H0IA 4D3YA 1SC3A 2QLFA 3R5KA
chains in the Genus database with same CATH superfamily
3C6BA 3FCOA 4PAGA 4Y2JA 5EJIA 4OQFA 5T4EA 1R6BX 3UB3A 3VGPA 5SYNA 1KJ9A 2QKYA 2YX1A 3CXUA 4MLPA 5CHYA 2F8LA 2FFBA 1X3LA 1K63A 1Q0UA 3K8QA 3B9RA 3KZKA 5K0ZA 2V3VA 1J7JA 1OIWA 3KJFA 4RNCA 3UY4A 3WX0A 3PE6A 4C04A 4LECA 5AVQA 1R8YA 1SWVA 3IQXA 3AZPA 4LDAA 1TTQB 2Z5FA 2ZIXA 3N0VA 1LKZA 2AE2A 3C2QA 1PVOA 2OZEA 3F5SA 1CQIB 1T34A 3ABZA 3BFVA 2CSXA 1TJPB 1JR3D 2C92A 3AEUB 3MAJA 3MWJA 4JL6A 1EE9A 5E9JA 5KTYA 2JHFA 3H83A 1SR8A 1MABB 1SCJA 5CCBA 5AJHA 4BVGA 3I9NA 3HSKA 3R9KA 3WGYA 5LZ2A 3DKKA 5DM4A 3TUJC 5HXAA 4HDRB 3EMKA 3VH4A 3JQ7B 4KUEA 1CUDA 5B6PA 3KYIB 3Q12A 1IU9A 4G4IA 2O7SA 4P35A 4UXJA 1I51A 4D26A 4LV6A 3T94A 5LKRA 1ZUD1 4GEGA 5DWDA 3GQVA 1H42A 1YUNA 5JCJA 1M10A 1ES9A 1XCBA 2ZQYA 4PPQA 5CYGA 3IO5A 1U7WA 2BFFB 1YB1A 3Q1KA 4FCWA 4YGXB 3THRA 3EYAA 5JR3A 1FDOA 2I1QA 3OPXA 3CISA 3GP8A 3COZA 3UHOA 2JIOA 1N7IA 4NBSA 2HSGA 1LPMA 3LX6A 3COSA 4HDNB 1CUAA 1H22A 5GM2A 1P5FA 3A9VA 6GPBA 3EMVA 1MC8A 3DEHA 1CUWA 3F5QA 1QDLB 3G2OA 1TTHA 4UBLA 4WEOA 2GKOA 2Z2JA 3JW8A 4HHEA 3ZE2B 2FSGA 4O4LF 3QM1A 2ZIZA 1QRTA 3HEAA 2Z9CA 3R7WA 3T5GA 3ZIAD 3ETJA 2Y68A 3GBPA 4AZSA 3MCAA 3GRUA 4AY6A 3OM9A 4X20A 3QU9A 4F21A 5KNCH 3UJ9A 1C9MA 2AW5A 4RE5A 4RXTA 5D85A 2F1IA 4GAEA 3UAVA 3UHFA 5IU6A 2YJGA 4PG5A 1C1XA 2J9FA 3OAAA 2JVJA 4IRXA 2XAAA 3MVEA 4RKYA 2RONA 5AJTA 5HVNA 5J43A 4R5HA 1XTIA 1VECA 2VCEA 3FYUA 3I3SR 1GKLA 1UBCA 2DFTA 3CSDA 1L1RA 3NTRA 5BQFA 3PEYA 3ND8A 2XPCA 3A7DA 2ZJBA 4TTJA 4NE9A 1J1IA 1V16B 2VA8A 4I7EA 4B76A 2P65A 5B30A 1BQEA 4LRSB 2YRFA 2X7XA 4LJ7A 4OA5A 5CNJA 5JG7A 5K3CA 2WE7A 5MFZA 2ZCVA 4FNGA 4O5OA 1I0LA 2E21A 4X1KB 3THSA 5C8YA 1T2AA 4H3HB 4KWCA 2DBQA 3ZHQA 2LCFA 2VPYA 4KPGA 4Z0PA 4L4SA 1U99A 4RACA 4ZCLA 3KQLA 4X94A 1AN0A 1ZS9A 4WLUA 2IUSA 2F43A 4L9WA 3ICQB 2JAQA 3R77A 1D2EA 4X95A 2FZGA 4C0WA 4R31A 1PI3A 3U3OA 2B37A 4ACAA 1NQAO 3QMVA 4QXMA 4QO7A 4Q9HA 3F6BX 3JD0A 4EZEA 4XWYA 5LSAA 4A15A 3LMKA 4HTFB 4M6WA 1AMOA 3QFRA 3U7FB 2RE8A 4RLFA 3Q1LA 2KS6A 2WVAA 2Z1NA 1MJGA 4WKOA 4WXRA 4MDHA 1AKVA 1JR3E 1IAQA 3B2EA 1N3BA 1KYIA 2JASA 2PIAA 5AKKA 3L43A 3ENWA 9LDBA 1N4DA 1E0SA 2CHEA 2JBWA 4Q4AA 1E2HA 3NHPA 1MXFA 2JL1A 3EXEA 3ZVKA 3FUXA 3KLPX 4B2PA 3M1IA 4OKIA 3DT9A 3EA4A 2ZR8A 2GB4A 2DXIA 3AKZA 2ZRKA 4Y0VA 5EG5A 5IJZA 2DFPA 2XCOA 1YR2A 5U4QA 4EK9A 6NULA 1JAHA 2LDBA 3SU8A 2GD0A 5CVJA 1JHYA 1JSZA 3GU3A 4RUKA 2BJWA 4ZT7A 2NTYC 2QN7A 3RYIA 2ZXEA 3TG8A 4IHAA 1U2GC 3FIJA 5FBZA 3IAUA 1QE0A 1XF1A 5A6VA 2X23A 2PKQO 4EYEA 1I6KA 1KAGA 1YZYA 1TYZA 2FP4A 4ZEOA 1RADA 1JXMA 2VN8A 4L72A 3VI3B 1N3LA 3DOFA 4BMDA 3KQHA 3AEQA 2IHVA 2NZUG 1QAOA 3ND7A 3H2BA 1E9CA 2L18A 3VM6A 2C88A 3M9XA 3MS7A 5HKAA 2R62A 3I8OA 1C7EA 1H2FA 3N2GB 3NDRA 4XD7A 2P7IA 3WL6A 2VG8A 3DP9A 2IXAA 1MPTA 4OI1A 4OY3A 2C0CA 2P0EA 3FSGA 3I6IA 3LY9A 2WKQA 4TMVA 2AUNA 3D2LA 4O59O 2QR3A 2V5AA 4FS8A 1HNNA 1QK3A 2YYSA 3GFSA 4FPXA 3J7AC 3PPYA 2CMFA 4MB2A 1GPH1 3HDTA 3S4YA 3VSAA 2C9OA 2C8VA 1KBQA 3RF6A 4JVOA 1CW2B 4AWBA 5B4TA 4UNSA 1XCGB 3ZGOA 1JQAA 3FJOA 2AMFA 3PC8C 4LOLA 4MUXA 4UHHA 3SHVA 1XEXB 2BGMA 3E2PA 1O96B 1LNZA 4OL0A 1OLSB 1L8LA 2UUAB 2WSBA 4JA0A 5TE9A 3GJYA 3O4RA 1ZK2A 1FP1D 2IZ6A 3PFIA 3CF4A 3VV3A 1FRQA 5EGSA 1RI5A 4AF7A 5B12A 2J4DA 1FZTA 4US1R 3VC7A 1E6UA 1RU3A 2DQSA 2Z08A 2Z83A 4CPDA 4MJ3A 1XQ9A 3W4JA 3RFCA 2Q5FA 3GJQA 4XE5A 4E7OA 1QANA 3KT0A 1ZNQO 3AXTA 1DC7A 4UXHA 5BP7A 3W90A 3QFTA 4U5QA 4ZYLA 2P4EA 4P93A 4R1TA 5FPSA 3I6MA 3S55A 5KDOA 1E2BA 3GAZA 3EIUA 2PUJA 4JIGA 4CJXA 4BYMA 4DLRA 4D4GA 4GMDA 1MX5A 4ALMA 2SECE 2A0YA 4WA7A 1J20A 1GKUB 2VZLA 4TZ0A 1ZGHA 3R3UA 1NF3A 4DV7B 1XWWA 1VE6A 4KUGA 5E7JA 5C9ZA 4L16A 3MT7A 3TW6A 2B1QA 3W6NA 1NHGA 5KYNA 2VQEB 1CTQA 5JD5A 2Y71A 1VCOA 1I94B 3GFVA 2HLPA 1QC5B 4HVCA 1XZHA 4KQCA 1VGRA 4G8CA 4MVCA 1IZ0A 1YRHA 3W2FA 3BHMA 3WXMA 2J3EA 5AIBA 3DAHA 1XAJA 4XX0B 2F8SA 2OHOA 4LX8A 4PBSA 1ZHOA 4H7DA 4B8YA 1IDN1 1QIHA 1RJDA 4JP1A 3N8HA 1DAIA 4MIEA 1MHPA 4GP7A 1E7YA 5F2KA 4YRZA 1XHLA 3LBNA 2P4QA 3NCHA 1E0DA 1NFQA 2A92A 4KH0A 1N8KA 5A9SB 3NIDB 1N0WA 4G9EA 3D6FA 3VYRB 1RZRD 1HDGO 3RIEA 2XUGA 4RY2A 3K6SB 3A37A 2C5FA 2KBEA 5BSMA 4EYSA 5CA1A 2SCUB 1SC3A 4IKOA 3Q5GA 4B2LA 1N5DA 2G7ZA 2R7KA 4R8MA 2CNKA 1OFIA 1DKMA 4PG4A 4NMWA 2N46A 2QUAA 1E7QA 1Q19A 2Z30A 3PNLA 4UTZA 4YFYA 3T41A 4KE6A 3VO9A 1UEXC 2AW3A 1G1AA 2M6SA 2Q2NA 2WYUA 3GJSA 1KDYA 2RHGB 3HI4A 2NU8B 2C2HA 3H5VA 3K92A 3H9CA 4OGLA 1Q1ZA 2BDTA 2GD2A 1NBIA 3BQMB 1W52X 3MNFA 4QQNA 5LDGA 3F3KA 1COZA 4I5IA 3WYEA 5DHSA 3E3NA 1M1ZA 1H0RA 2A57A 1JEJA 2CNLA 2BY4A 3L7NA 3B78A 3RK0A 4F1WA 1TRKA 4IVQA 1IN4A 4GRDA 4EY8A 3C6KA 1WB6A 2YQZA 2YV5A 5K0EA 5IYZF 4IDQA 1Z4QA 3ZQJA 1POWA 3FPFA 4FWBA 4N0MA 3HXOA 1U9ZA 3NOXA 3B1KA 4YHBA 5AHXA 3HU1A 4B48A 3CY6A 1CUZA 2IUTA 1GNLA 5AKIA 3VH2A 4F56A 4E2WA 2WJVA 1VG0B 1YI1A 1P81A 2I4MA 3NEJA 1G0OA 4G4GA 3V8RA 2QMOA 1NLFA 3V6LA 2JLSA 4B3XA 5BOSA 5BOVA 5GONF 2QRJA 1T5HX 2PMCA 2YHIA 4HD8A 1T6XA 3PKIA 3JATA 1Z0AA 3K4HA 5TF0A 1B00A 1ECCA 1OROA 3UHJA 4G9GA 1KL7A 1VL5A 2FWMX 3J7TA 1ELOA 2LCIA 3EXFB 2EWMA 3KYJB 1JVBA 3PIIA 2GZSA 2VQ3A 5C37A 3HDVA 1LH0A 5JOQA 4D4IA 2GJ8A 1ECGA 4HSGA 4JT9A 5J2TB 3H6HA 3KVNA 4C2TA 1S2IA 2C1EA 1R0KA 3CSUA 3MQ4A 1P33A 4GX1A 5A05A 4AJLA 2B1JA 1C8BA 3JQDA 3GW8A 4G89A 221PA 1M2KA 2QJOA 3P71T 1S96A 2PQ2A 3PEUA 1EFKA 3WRWA 2WM2A 3EGDB 3JZMA 2AMYA 3JQCA 1QE5A 4ZMRA 3GGPA 3HYLA 3CIOA 4D92A 821PA 2FW7A 2OR3A 3MELA 1E1YA 5EJ6A 3GO4A 4B47A 2V03A 1Y8QB 3LUGA 1RQ2A 4MUHA 1S1CA 4QJ4A 3SYRA 3WRXA 3FG9A 3IODA 1GZUA 4MEBA 1N5OX 4U7TB 4L8GA 4HS4A 2HKIA 3VTZA 3ZIDA 4ZYTA 5G0SA 2ZAYA 3GLIB 4JHXA 1L8QA 2M2IA 4BNLA 5BQXA 4MCHA 1TL7C 1GSHA 2QL9A 4YIKA 1JR6A 1PT9A 2H16A 2HYIC 4L4XA 5DNVA 3V9PA 1EKXA 1JNXX 4XOIA 2QJTA 2ZUUA 3G82C 4IFIA 4JOSA 4D4MA 4MUMA 4EUKA 5BR1A 3OLXA 5AT1A 3UGQA 4I55B 2GD1O 1FSSA 3GZNA 1OXUA 4DLKA 1DQPA 4TLDA 5AKHA 3O8OB 1J56A 1GGEA 1GTZA 2AQHA 4NZOA 1WB5A 4QRIA 3OE4A 2V96A 4J03A 5FTLA 1YB4A 3CO0S 3OOJA 3OZRA 1XMXA 1GARA 2YWRA 2VAPA 2Z8ZA 3GNQA 3ZV3A 4EZBA 4F5DA 4REOA 3KOYA 2QAGA 4RZHA 4X0EA 4M1SA 3U7QB 3SYLA 1GR1A 2J4CA 1E3JA 2WMNB 2PR2A 3CRMA 5ELLA 1TLTA 4JA2A 3WQHA 2GFHA 1AGRA 4YDQA 4BXOB 2RGRA 4J1TA 3ASZA 3ZZTA 4LIPD 4PSCA 4I4TA 1G5QA 3BSSA 5CBPA 5CLFA 4TN1A 2IPOA 1REQB 2QRLA 1Z4KA 2DPLA 1JEOA 1V9LA 3GEIA 1NJ1A 3RBZA 4BE9A 3CLTD 2VZ8A 1QGUA 2Z04A 4BU0A 9LDTA 2H7CA 4ID9A 4KQMA 4I4TB 1WP9A 1PJBA 1BW9B 2FZEA 2ZSAA 3OWOA 3U3DA 3AHJA 1N2EA 2FMIA 1DCMA 5JLJA 4PLWA 1PJ3A 4BQEA 5I9IA 1FP6A 5DYGA 1NPDA 1E6WA 5IFLA 5BQOA 1WA5A 1ZSYA 1NDUA 4KV7A 4UTXA 4GWLA 4X91A 2Z58A 5CCDA 3DFIA 3U7QA 5I4KA 2R6CA 1NATA 4GM4A 3WLEA 1W36B 1NASA 5COBA 1MEOA 1ZJZA 3HP1A 3WAKA 3FYCA 2HHAA 1H4QA 2DH6A 3SZ3A 3RJ9A 2I6TA 3P8ZA 5KNLA 4YAEA 4JI0B 1E3QA 1TQDA 2TECE 3HCWA 1J0XO 5JSFA 1P45A 1M1YE 2BUAA 3BOSA 2CMKA 2X5KO 1RYBA 2P2DA 4C08A 1MVNA 5M3BA 3WLKX 2XKJE 4XWGA 1NU6A 3SVLA 3EW9A 2H5JA 4KQWA 4OYYA 4Q00A 2HM7A 2EYUA 4QYIA 3E23A 3A3NA 5KTPA 1I1HA 3BULA 3VRHA 3GLIA 2X77A 5L4LA 4I66A 2WJHA 1RWBA 1BGWA 1RQNA 3U1BA 1Y8QA 3LDFA 4RABA 3Q9SA 5BYKA 1TJ4A 4RF4A 4BDSA 1RPTA 2WOOA 2J4FA 2OD9A 4UBMA 4KBFA 1A1VA 1QHGA 1AF7A 3PJGA 3RFFA 3M2PA 4ZQGA 2BGWA 3OIFA 2GVZC 2PQMA 4D96A 1BX3A 2DTEA 2YXBA 9MHTA 3G9UA 5BUCA 2QRZA 1ZJWA 2R5NA 2VHYA 1IDOA 3OSZA 1NN3A 1SULA 5CVDA 5KNCA 1AMNA 4GM1A 1V3QE 4K05A 1EUZA 1L7OA 1PK7A 4HDQB 3OF5A 2VDKB 1K7EB 2AJDA 2JBHA 3PUHA 5IH7A 3F5FA 4LZZA 1Q20A 1JSRA 4XSHA 1A8UA 2D7DA 4PQYA 2V65A 3GCWA 3IOYA 3LG2A 5DBEX 4LK2A 3HFJA 5J4VA 2FDXA 2QR5A 4KMMA 3EXFA 4BMYA 5DJ5A 1O4WA 2BR4A 4UAGA 3MTAA 4FYXA 3EBPA 5CR9A 4CI9A 3RWBA 4YX9A 3D4LA 1EESA 4R8SA 5LBTA 4MCJA 1C3JA 4DHWA 1PJTA 3NHWA 3O47A 2W6JA 4KFRA 5IEBA 3BH0A 1V1RB 1E3TA 4EEZA 5CX4A 1BOFA 4CIAA 4A6EA 2OHVA 5JO9A 2OQVA 4DARA 2P79A 1NGSA 3S2IA 4WK0B 2WTEA 4N0QA 4HAXA 3PQCA 5KWSA 4RKEA 1XMPA 3H9EO 5E8JA 2JIRA 3IBSA 5GADl 1LLUA 2XUZA 3LUPA 1V2HE 3PC4A 4L78A 4B31A 4O2BF 5DEOA 4YAGA 4JC8A 1KAMA 2WD8A 4YDRA 4LMBA 4WY5A 1MO2A 1TU3A 1ANKA 1V4BA 2HSDA 4UM5A 1E63A 2IP4A 3C3PA 5E38A 2BKVA 2B1RA 1EWKA 1L5ZA 2ZTVA 5J4YA 1LK5A 4CR8A 5DYYA 1RJWA 3W3AH 3AETB 1P1RA 3GT3A 3GNLA 1XZNA 3OZAA 4CTKA 2Z2KA 3S27A 1NFFA 3HXLA 2WNHA 1XMSA 3DWGA 4IIJF 5H83A 1IY8A 1VRWA 4PLTA 4O29A 5INTA 4CLHA 1V8DA 2ZTLA 5ALLA 4IXWA 4JLWA 5MGBA 3W4IA 2B8JA 1YL5A 1EINA 5IJWA 1VYUA 5EFOA 4C76A 3DV2A 2P6PA 3AR5A 1QRUA 1CVIA 1GUYA 2GZAA 2H6EA 1I1NA 2VAMA 1CERA 4N82A 3RIXA 1Z34A 1QFMA 4LV8B 2VPQA 2JFWA 5LP6F 4OHUA 5E0OA 3CB2A 4RK6A 4HX5A 1CC1S 1SUBA 2POCA 4JJAA 3P9RA 3AQ4A 4QXRA 3I09A 3T9DA 3BWDD 3HI6A 5ECWA 5JMWA 4ODIA 2AOUB 4FEEA 4BB6A 4URZR 1AN9A 2JAXA 4M88A 4PWYA 4J2OA 4FGSA 1XRMA 2DY0A 5C5IA 1E2LA 2AOTA 2FH5B 4R3WA 4A2CA 5AKGA 4Z86A 3UUGA 1W4AA 2O8FA 3HA5A 4OK5A 2IS1A 3GWZA 1Z7YA 4GPZA 3GAMA 1UPUA 5FXMA 4ZAXA 1G63A 1VLVA 4UNPA 5DP2A 4TMFA 1X1CA 3UJBA 3ZCPA 4X84A 3OCZA 3FI9A 2HMTA 3HM2A 5H82A 2IY9A 1P9OA 3B3JA 2NPFA 2X9VA 3NM5A 4WFKA 5EKXA 5E95A 2OC9A 3T0FA 1JAYA 1CULC 1M6HA 1PG2A 3F1KA 4DV2B 2RGBA 3EW7A 4C0SA 4EB0A 4ABTA 1YRYE 1G20B 1W8IA 4R7TA 1CR0A 2J3KA 4Q3BA 4QNNA 1F2UA 2PUEA 1E5QA 3KIPA 3QVOA 3TE7A 4A27A 3RTDA 3WLLA 2J5XA 5ALDA 3SOZA 4B3IA 5ED0A 1A9OA 1V6SA 4OXQA 1Q12A 3HABA 4WK4B 3RM3A 3F0TA 4R2MA 2W2QA 2PUWA 2HXGA 3JSXA 1NBMA 3OQ6A 5IRCD 4MIKA 3VZDA 4DG8A 3RK1A 2OCXA 2X5NA 1FJGB 1ORHA 4IZHA 1NQ5A 2IY8A 2CY0A 4QUIA 1J8QA 3W5HA 1ENOA 2Q5CA 1JB9A 1GCIA 3ABQB 5JQGA 3NUZA 4ZV4A 1L5HA 2HK8A 2VKQA 1H6BA 1U94A 1TJ5A 3ICCA 1BVYF 3AU9A 4HLQB 1KETA 1LJUA 2YHUA 4MUJA 3CNNA 1SOMA 5ALOA 4ZVLA 4F04A 5KOYA 1WB9A 2UYYA 3O8QA 5ESXA 1S3IA 2DH5A 3R24A 3BERA 2ILTA 4AUEA 3U6BA 3HVKA 4LS3A 521PA 3HY4A 2QVCA 2NUTB 2RBEA 3MJHA 2UKDA 3WNVA 2J6HA 4JUAA 4RGYA 4HX9A 1L4MA 2AEFA 2C8KA 2LBPA 3BXZA 3AJEA 4P2GA 1A7UA 1DG9A 2AWNA 2HHLA 3H5OA 1GKIA 2WJZB 4HEQA 2ES4A 5D7BA 5KKAA 2BIFA 2NU6B 1ZRHA 5HS6A 5B1EA 3ZW7A 2WJAA 4EOGA 2Z2ZA 1RPNA 3G8AA 1YKSA 3D3WB 3D7MA 4Z99A 1CD5A 4LWQA 4G5RA 1GFSA 3IPRA 2ZBUA 1RCUA 2HNKA 5CLGA 4A0QA 2D2XA 4KPUB 4REQA 4DNPA 4HRVA 2B3TA 4QOEA 1EWRA 2AUTA 2ACEA 4A3SA 1EPUA 4K6OA 3VTFA 1U2DC 1PHPA 2P9BA 1Z4OA 5EP1A 5DFAA 5HGJA 4RPCA 1WP4A 4UBOA 3UEOA 2Z9BA 1GPNA 3V1YA 1Q16A 1RVV1 4JLKA 2BN4A 4WN9B 2AZTA 3BB4A 5EQJB 4F1KA 1JIVA 2O0LA 3IYLW 3V1TC 3W8DA 1XCPA 5A4MS 2EWWA 1GCOA 1N9GB 2HPAA 2I7VA 4DZZA 4Z4IA 2WM9B 4M6WB 1G16A 2WF9A 3RBAA 3C3BA 1L4GA 1K08A 3QXXA 3R5JA 4KPYA 3HXTA 3IV7A 4OUKX 4XCVA 2O59A 3FWNA 4F97A 1YBAA 5JMTA 3HUDA 2AJTA 5FH9A 1ZVJA 2LGJA 4CMCA 4R83A 2VZ9A 3P2EA 4ALLA 2XT9A 2OAP1 3VPXA 2ZSJA 1NXTA 3IMGA 4CMGA 2F55A 3HL4A 1VLZA 2XIJA 5JQWA 2XQGA 2FZLA 1VGVA 3KO8A 1RC1A 4J2HA 3FGPA 3OEWA 4E30A 2GYVA 4M1YA 3HJHA 3RVMA 1FP2A 1NMQA 3WBKA 2JGMA 5BVGA 4LGMA 4RORA 5EA2A 3F78A 1BVRA 3FD8A 2F1JA 3DBLA 4BO1A 3CZMA 1ZC3A 4E4YA 1Z6GA 3B3FA 4PEVA 2AJBA 4RXMA 3T7RA 3JR7A 1F60A 1OLXB 2C9BA 3UJDA 1P0PA 3F7NA 4LKRA 3ZE0B 4AICA 2AFHB 4E31A 3EZYA 2HT1A 1HORA 4Z4FA 4RTQA 2NSYA 2YZKA 2H9YA 1XKQA 3E9NA 3TLZA 1K3TA 2XE8A 5CLHA 1ISRA 3T9CA 4UD2A 1DRJA 4Q4DA 2QVYX 2HBQA 2MSDB 4UMFA 4C2BA 4EZIA 5A2GA 4XJTA 4CV3A 3A6GA 3TEMA 2FN9A 3EC2A 3H4IA 4IH9A 2Q99A 4YXWA 2VDPB 4PSVA 4HDNA 4UBKA 3B5JA 1GUFA 5TARA 4N0DA 4ZYYA 4H16A 1BX0A 2GHQA 4MUYA 1NRWA 1Q91A 3IUQA 4X97A 2XMZA 4G37A 2PXHA 2ZETA 1IOVA 4QELA 2C4VA 4F8YA 4JUFA 4V0RA 4IF4A 4IJWA 1TQ8A 2HA7A 3L8MA 4M7WA 3PT9A 1A9YA 1XPJA 2C0PA 3EQZA 3JAKB 3SYMA 3CR3C 4U9IS 2Z8YA 1OX5A 4FJ1A 1ZEMA 2Q49A 3ABSB 5JZOA 2OHJA 3QLUC 1A8SA 4AMYA 1MB3A 2ECOA 1D8AA 5BMVB 1DBIA 3O92A 3KHUA 5DI3B 3WJ1A 1VHDA 3JAWB 3FFBA 3KHTA 2NVUA 2PZEA 4IG9A 4BWFB 1U8FO 4PLFA 3EIQA 1GIAA 5E4JA 1X87A 3W8RA 1JIIA 5KHOC 1SCAA 1CQIA 2I2DA 2HQBA 3AJ9A 1U7PA 1VSTA 4FGWA 2YZMA 3KKEA 3LCMA 3PJDA 4GXRA 4Q1DA 1T29A 2MINA 4PFJA 3GD5A 2IOQA 1JHVA 1SXIA 3FWYA 4LK3A 5D3KA 5TMDA 3RSFA 3TQQA 2WYIA 3EODA 3PHLA 3WL8A 4XA8A 2FDCA 4K9PA 1FRNA 1Q7CA 2IOYA 2ZG6A 4IW3B 2O2YA 2UZ4A 2ZI4A 2EV9A 3KALA 3ZPXA 3NBZC 4OQPA 5LQMA 3BDAA 1E60A 2BAGA 2EW8A 1I2DA 2RH4A 4PC6A 3GFOA 3NHRA 4BRWA 2JANA 2A7QA 5CW1A 2CFIA 4DBLE 1QVWA 4UJ5A 1ZA1A 1W4LA 1AUPA 2FPOA 3KFLA 4HO1X 1RWNA 1SG9A 4OAOA 2I8AA 2UVQA 2QQGA 1LBIA 4RANA 1GNVA 2XT6A 4CM5A 2EWVA 3BBPA 3ZVMA 4I1UA 1Z8FA 4MUNA 1VA4A 1GUZA 2VR1A 3H9BA 4IHJF 2GHIA 4W99A 1QIIA 3R5HA 2WWXA 1PLKA 1L5MA 3WGIA 3LGAA 3G2MA 2XDWA 1KBZA 3IE2A 2QVZX 1MOZA 1XRQA 1KI9A 5A3JA 5IM4F 4C06A 2HJHA 2OMEA 4Q7KA 1WHSB 4HBGA 1KPHA 5TY0A 2BPOA 3UWOA 4Q05A 2VUTA 3RREA 3S2FA 2OCDA 4DDKA 4OMUA 4OBWA 4D9MA 1WBBA 5G3YA 2YVAA 1VZ3A 3FGZA 4W5TA 3KQOA 4B6GA 4ARBA 4YRQA 3LA6A 3QLJA 4EATA 1CUFA 1JN0A 2XCUA 4FK8A 4CMEA 1HO3A 1AGXA 1E4EB 1OCEA 5H3HA 4S04A 1HEIA 2EEPA 1MW8X 2I9PA 3NX4A 1XTTA 3A4MA 4G26A 3HJNA 3JAKA 1KJJA 2PD4A 3L8ZA 2H17A 3FNQA 5A7GA 2QRMA 1F17A 4XSGA 1H2BA 1RXYA 3MOGA 4EYQA 2YFYA 1YR9A 1THZA 1SZPA 1DOAA 3FYUC 3AUTA 3H65A 3K0BA 4PO3X 5IK2A 1TX4B 5JCOA 4D3XA 2RIPA 4YJFA 1GT91 3OE7A 5SZHB 3B1ZA 3PNYA 4X9XA 1BMDA 3PE4A 2BFPA 4EECA 5DNCA 5GONB 2P6RA 1SU4A 3T7IA 4GZLA 2YVQA 1C30A 4C7KA 4QGFA 4RTMA 1SWWA 2I4RA 2ZSDA 1RXEA 3H04A 3I32A 5BSTA 5ELXA 2ZRCA 1L4EA 5DNDA 4NY1A 4H3SA 3U5TA 4Y6GB 5FHRA 3LCRA 2WF7A 4QZVA 4CQJA 5CM8B 1R18A 3IPXA 1KC3A 3CE6A 3HDHA 2FFAA 4LYHA 1AF4A 1UDAA 1CY8A 5CGQB 2C00A 2WQZA 4Q1VA 5FORA 1DS6A 1Y6RA 2O8BB 1EUQA 4Y6OA 4DV4B 1GITA 1J49A 2NADA 1T3LA 2OHIA 3WQQA 3CEAA 3OPMA 2O6LA 4CETA 1HWYA 1WDLA 4YUVA 3RTGA 2L42A 2JI7A 5M2QA 3G49A 4AMGA 4K6MA 4MZXA 2YN2A 5E7MA 4D79A 2QY6A 3IAFA 2J31A 4Z9AA 1JT2A 4J0CA 1WEKA 2FPWA 1LI4A 4AG6A 5IXSA 1CJVC 1K8YB 5K45A 2WP0A 4DLUA 6REQB 1KFKB 3SSOA 4JT4A 4PHCA 1RWXA 4UUMA 4X1IB 2XGGA 2OORA 1Z4NA 4N47A 4O2LA 3RBXA 4MIOA 3QUAA 3VR5D 3FZEA 4EHKA 3NRBA 2J0UB 1DAKA 3NC0C 4RS4A 4DA6A 2Q41A 1C4OA 3KT8A 3OMWA 4UC0A 1EWYA 5FTNA 4F5YA 3LQ4A 2H1SA 2YJ3A 1KR5A 2OG1A 3UGTA 2Q7XA 2BMDA 3EQ6A 3OPVA 4W5QA 1CZNA 4NMMA 1WRBA 3CGWA 3PD7A 1I5OA 1OIXA 1TUBA 3FTPA 2OT3B 3RRBA 1PDOA 3QBEA 3D0RA 1QTIA 2GO7A 1UKVY 2HBRA 1H0KA 2QWXA 4GRAA 2AS0A 5FRDA 3PDJA 4JBLA 1SELA 2I3GA 4TLEA 4B3MB 1BU5A 2Y1LA 4OJTA 1A3CA 3OJCA 5AVZA 3G13A 1W4RA 3L77A 3G2PA 4J49A 5J23A 4BX3A 3RRJA 2BW0A 4FSXA 3BKWA 1FIUA 2FI1A 1CUXA 4C6HA 1DJPA 4NZZA 2IGBA 4JB3A 3RNLA 4RA6B 2J5KA 1EU1A 3CBQA 1HQDA 2X8LA 4DN6A 3H8JA 1ID8A 3INTA 1AUOA 3F4KA 3KTFA 1UZAA 2OZKA 3LPAA 3D3WA 4PPNA 4WKNA 3SJ7A 3KK0A 4TKVA 4V24A 4OV6B 2C54A 4CT5A 5JSZA 2XDAA 4JAVC 2IYFA 2PKXA 2XGSA 3BREA 1YBMA 2YW9A 3ZXYA 1DSSG 4G1UC 3UOAB 4D99A 2DCUA 2FEXA 1D5CA 1JKJB 3KR0A 4MQLA 3V48A 1TC1A 4F3KA 4B6RA 3F73A 2RD2A 3NIBA 3ZBPA 4LBVA 1SA0A 2IYUA 2B7BA 2L17A 2VJYA 1GAJA 4KGVA 1NI4A 4X6UA 2IYRA 1FXWA 1RLOA 3PCXA 3ZD9A 4DGSA 2YIJA 3UMGA 5DNYB 3OUZA 1BFDA 1QZTA 4PZ0A 2PKCA 1V11B 2P9ZA 4HB4A 3O8QB 3AF5A 4I9GA 4Z2AA 4W5JA 5IVHA 3UT5B 5AHWA 4CWAA 1MC1A 1VI5A 3DBHB 13PKA 1BJRE 2NZJA 3VVCA 5B2EA 4KXWA 3PJFA 3R7NA 2EIXA 1EK6A 5HKKD 4CMBA 3Q6NA 3HYCA 3FKSA 4ZZ0A 4JSRA 1SG6A 1QKIA 2JAUA 3ER6A 3JD3A 1YC5A 4NDZA 3ZBQA 1ODKA 2WRZA 1QDUA 4HDSB 1DCTA 4IIGA 5ECGC 1LPBB 5EY5B 5IT9A 1I5RA 1H2HA 2IX9A 3OQVA 4HLDA 9GPBA 4GKAA 4RJKA 1YKGA 1F0PA 2FCAA 3BJRA 4P4GA 4C6TA 2JFYA 4ED9A 3A3PA 2IUUA 1XDGA 5FBWB 2PTGA 2WUFA 4MR8B 4TTRA 2NU9B 4II2A 5FOXA 3G59A 4IMRA 4QRHA 5EXEA 3ZHYA 4A8JC 1FDUA 1CIJA 2M32A 2Z5GA 3KOMA 1NOJA 2PX8A 1QVRA 2YRXA 4IEEA 4JLDA 4BC1A 1KI6A 4OHXA 4BLVA 5K0JA 3DDSA 4QJBA 3EF3A 1FFGA 1Z3IX 1NJ6A 1R4MA 1TA4A 2DUMA 3ETGA 4MP6A 4TMKA 3M3DA 3SMVA 1T5OA 5BWNA 4P31A 5HP4A 1RI3A 3P0JA 1ZN7A 2BISA 3JARB 3RFXA 3SS7X 3BJEA 4XASA 3NALA 1DINA 2AOTB 2F8MA 3IT2A 1M2OB 1NUHA 1SRQA 4FCCA 3TGPA 2Q0XA 3TSZA 2PV0A 4CIDA 3GP5A 2WVGA 3QNUA 4ECEA 2A0XA 621PA 1S89A 1MUUA 2H0AA 3MJCA 3NWBA 4OHVA 4OXIA 1JLSA 1FS5A 4GKKB 1LTHR 2V7VA 2ZUTA 3G1WA 4QHSA 1FYEA 4FI3C 5KVQA 3V32A 3DZHA 4QEKA 3ZS9A 3UENA 3W3AD 1R3UA 3GMSA 1K6MA 4IDOA 2E9SA 4R2IA 3RHSA 4YYEA 4UVEA 4N5LA 4CF4A 1GQ2A 2Y1OA 3SM9A 4Y9DA 1PDVA 1X2EA 2BEKA 1JEYB 1TYBE 3IEIA 2VP9A 2B35A 5FEUA 2JFHA 2B36A 1CF4A 2HF2A 2QD2A 2YMQA 3EBOA 1Q0ZA 3LK6A 4OYRA 3R76A 1UK7A 4BP3A 1PZEA 2UXDB 3S44A 5BV2P 1Z7GA 3GYGA 3L92A 1RQPA 3QG5A 1U0LA 4B3SB 3MWEB 3G1UA 4O4LB 4A0GA 3NC4A 1EEXB 1FDSA 4FDUA 2C7QA 4B3TB 4MLDA 5A1JA 3EXHA 3A0UA 1RPJA 3HUEA 1I3CA 3AETA 3IRUA 3PUWA 3IAHA 3CNOA 1VHWA 1Q74A 3I92A 2FUNB 4M3NA 5BN4A 2G7MC 2GN8A 3CT4A 1VKHA 3RODA 3ETDA 1I2MA 1PR0A 1S8NA 2R6FA 3ETLA 4RM2A 3UJ7A 1HE5A 2CYBA 4BKRA 4YRPA 5FOUA 2BJHA 5EJGA 2PE5A 1K0UA 5DCYA 3ELYA 4I1RA 2WHEA 3LF2A 3QW4B 4I2NA 3WLJA 3H4TA 1CT9A 3CUTA 1DTWB 3DMGA 4M0KA 4B4KA 2O5VA 4UM9D 3QEJA 1F8XA 3RVBA 1HLFA 5KYUA 1I7SB 3R5XA 1EJ0A 3TQFA 4B0PA 4PNZA 1UMBA 1H93A 2EJTA 3AFGA 1XKXA 4HB2A 1KDTA 4QUDA 1YR7A 3SXJA 2X3FA 4PAQA 3RDPA 1MAAA 4CQLB 3K9HA 2BM8A 2RKOA 2FN8A 1B73A 1QHSA 4I5EA 4ZO8A 3TWOA 1H0HA 4M0EA 5JI3E 4AL4A 1MMFB 5DYWA 1V2GA 5TSDA 1U7TA 3UGJA 2WZCA 4JXXA 1ZH2A 2H08A 3FOEC 1TQ2A 4Z1OA 1M34E 4L50A 1DIOB 4MVJF 1O4VA 4EGJA 3PQFA 1DI0A 3AERB 2SHKA 2XSZD 1NIPA 1P4AA 3A9SA 2CVZA 3ROMA 5ETJA 3S3TA 2G72A 1RQRA 1I24A 5JAZA 2DF8A 2ZVDA 3D1VA 3H8WA 5TGZA 4NHEA 1LX7A 1OB5A 4GOLD 4OIFA 4OM8A 2IV7A 1N5RA 4ESHA 2O3JA 3NONA 1RRGA 1DDIA 1I4LD 2QVGA 5JSHA 4ZALA 3O3NB 4EWLA 4FZRA 1P6UA 2OG2A 2V7BA 2QBYA 5EJFA 2XNSA 4FEGA 2C98A 1KOLA 4OBBA 3R3JA 3ANNA 4ENSA 1QR2A 4TKUB 1YASA 2DBZA 1DX4A 2WPNA 4HAZA 2HDNB 1ORVA 2CHUA 4U2DA 4KFCA 4LVOA 2X3YA 2ODAA 5C1BA 4LBWA 1NBME 1E5DA 1RI1A 1FDWA 1T0IA 2A88A 2IYAA 3E22B 1RLIA 4IDGA 1UQUA 4AWAA 2C9CA 3HCDA 4PQGA 5A03A 3KJGA 2XOKD 1J23A 4DS3A 3NTLA 2ZJFA 1XBTA 2VWPA 5T8KC 2YXEA 4TSFD 4KYUA 3G02A 1HE8B 1YIDA 4X1YB 4EG1A 5F98A 4HGPA 4K9OA 4QPNA 4FQ8A 1OASA 4YASA 1F2TA 1Z74A 2F3QA 3AUAA 1U1DA 3AEZA 4YP1A 1TKCA 1UFRA 3WKDA 2PUGA 2BHRA 3C87A 3KOZA 2BUBA 2LV8A 3KOXA 1UBOS 5AUPB 5H7XA 2UZ0A 5LXTB 2CVPA 1YFKA 2KLBA 1T9AA 3K0KA 4TUYF 4AYXA 3RQSA 2PYZA 4J75A 1USVA 3MWDA 4Q3EA 3WVNA 1L8XA 3EPHA 3DGEC 1E9RA 4TTPA 3C98A 2GR9A 1V5GA 4JLAA 1BNCA 3T3PB 3RJMA 3T95A 3QBVA 3GRRA 3N0WA 2C5GA 4J4BA 4XCQA 3V4OA 1OV4A 3BQ9A 2PD6A 4POAA 1JT9A 1PJ4A 2FUG6 3C70A 2M6RA 1HQCA 4NEQA 4BXOA 1VCIA 3F71A 4P38A 2HUNA 3AY7A 4F46A 1LSUA 3DVRX 1BWRA 4KPEC 4WXEA 2BFNA 4RQTA 4GLJA 1Z0UA 2EVWX 1G7SA 2ZGVA 4ZQFA 5FUWA 5TT1A 2VHVA 4V1CB 4U1RA 1F0KA 1T24A 1WWKA 4B7AA 1Z2NX 2Q5HA 1LEHA 3UJ6A 3N1UA 4H7JA 1Y4DE 1MO5A 1OYOA 2OV3A 3JQ8A 5K8CA 3M49A 1JMKC 4KN8A 2OQIA 2AC2A 2XTNA 2FVXA 2C4MA 3BF7A 5CB6A 4DLZA 3RTAA 3QHPA 3QX7A 4GNRA 2FFQA 2FFRA 5TS2A 4BN4A 1FC0A 2F1HA 3KLBA 4JBHA 5T64A 1LBEA 1KP2A 2OLEA 1PUXA 4G1MB 4EKDA 4R1UA 2XYHA 3K4PA 3MJTA 1JG7A 3DTVD 3EIEA 1T8RA 4BUZA 1Y33E 2WM3A 5JHGB 1FS6A 1E1CB 4ZV9A 4XKJA 3OM1A 2E4ZA 3M6IA 3PVCA 1E18A 4B6EA 5E3HA 5A04A 2CD7A 3SF8B 5JZVA 5FDFA 3PI6A 2WG1A 2FXIA 4M1EA 3QX9A 1KI8A 4QU8A 5TIIA 1HOTA 3NAGA 4M54A 4M60A 4RA9B 3DEFA 1NVAA 1EGHA 2YJ6A 3DGFC 2DTXA 1QVAA 3C5CA 3EVGA 3P96A 4K6KA 4PPGA 2GJAA 1PZHA 4RQUA 5IVIA 2ATIA 1U0GA 2B4KA 2AFIB 5LP6B 3HDYA 1F4VA 1T8UA 1E2MA 2YY7A 1FDTA 3FJ1A 3ITEA 1GEGA 1KO1A 3MOIA 1V7QA 3R6LA 4JJGA 4W9NA 3VTAA 4Y2SA 5GJVC 1Z39A 2XNHA 4CUJA 1X14A 1Y9JA 1KJNA 5J2TA 1P62B 2CYCA 2PQ0A 2IC5A 2GXUA 2WZBA 2VPXA 4A2PA 3G0HA 2B61A 4NJMB 2NU7A 1A2OA 3C3XA 4E5PA 3ICEA 2BBOA 4Q9NA 4OQ4A 3RVSA 3MEQA 3AVPA 3U80A 5B57C 1E7MA 4L7VA 5DE3A 3PX7A 2A84A 3NTUA 1FP4B 3ZGLA 3VNUA 1JDPA 4CFZA 2LXNA 3JATB 1W76A 1CR4A 3QLVC 4II7A 4RL6A 4UUNA 4MUFA 1ZD9A 4R6WA 1K4MA 3H4MA 1WXHA 4PONA 3HEBA 5FLXA 3E4CA 3FH0A 3UTCA 3WYBA 3KKOA 3UK1A 3KZVA 3EXG2 3FFTA 5E6RA 4BQSA 3SLGA 3LX4A 3DDZX 4ZAFA 2VDQB 3AM3A 1XJ5A 4PGHA 1YRWA 4IINA 4KH1A 4LDPA 3V2UA 2GLXA 4G0NA 4RIFA 1VM6A 3D3QA 3PTAA 1ESEA 3P9SA 4D8UA 1AZTA 4YJKA 3ZWPA 2ZIUB 1B15A 5COQA 3MB5A 3F6SA 4PYOA 3CB4A 3RIMA 1C9KA 1QV7A 4KXFB 3O4VA 1G4HA 4MR9A 5D1NA 1K7CA 3OF3A 3UHPA 3FRIA 2XUJA 3UWKA 4ZYUA 4ZFNA 2PO7A 4R54A 4U7WA 2O5CA 2C4NA 2PUCA 2BHSA 1T36A 2P2LA 4M8SA 4CL8A 4D0RA 3BMQA 5KVCA 2AFVA 4ECAA 4C7MA 1ZD4A 3D6AA 4FT2A 2XODA 3E5RA 1JLHA 1Z6PA 2PH1A 3SEQA 1OC2A 3B3GA 1Y1PA 2H5EA 2P35A 4K9KA 4JKOA 5F1PA 1ECFA 1P4JA 4BP1A 1BC5A 1QH8A 4X6XA 2G77B 2AX4A 3FX2A 2JGNA 3B7GA 5AHKA 4A82A 5BVHB 1DQZA 3WBJA 5I7WA 4EGFA 2Z9DA 4F60A 5JI2E 2CLKB 4MVJI 1I33A 1QWSA 1MZPA 3MW8A 1NP3A 1ZHHA 3JTEA 3MTDA 4ETWA 3D5EA 4P36A 1GNTA 1Y7HA 2O7QA 2F64A 2YIDA 3EIFA 3N3AC 1Q0QA 2VP0A 3IUEA 5KJEA 4DR6B 3CCFA 2QW8A 1KDZA 3TOVA 2JCSA 3ZD8A 5EERA 1UK9A 5CVTA 3M6LA 3H0KA 4KDCA 3UMRA 4I55F 5P21A 4CKEA 3IAM6 4PZUA 4Y0AA 2ODTX 2QHXA 5EEGA 5K6AA 5JHHB 3J81k 2PFSA 3RG2A 1C3EA 4GP6A 1Q11A 1G8MA 5G4KB 1TW2A 2FV8A 3SX4A 1JQEA 3OPYA 5JARA 2C2XA 2BZGA 5F52A 4E5YA 8ATCA 4TXLA 4PIVA 1U8YA 3MT9A 2WY2D 1SUIA 3SK0A 5KJCA 2HPZA 1P1FA 3KSZO 1AQJA 4XR4A 1I4EB 2PGXA 4ZEMA 3RU9A 3L0ZA 3H5TA 1SPBS 1VHJA 3ZHBA 5ITZA 1SBIA 1LU9A 1RHMA 3IIKA 3CH6A 3H2HA 4DT1B 1M6EX 1KZYC 4YRMA 1EZZA 5ALRA 3UB2A 3TRDA 2D59A 1RM5A 1N7GA 4V0SA 2X9GA 2RGXA 3EX7C 4CM8A 2YVLA 1TVKA 1S5PA 2JLCA 4I4TF 3QXJA 1Q17A 2ZTSA 3O93A 4DIMA 4W63A 1XEXA 4U9UA 3OX4A 1UM9A 2JLVA 4P4NA 2HCTA 4ZQEA 1BS9A 4FU0A 2FMTA 3E5NA 3IP3A 4EB3A 1Q84A 1TUGA 5I5GA 1OXKB 4B32A 4DWOA 3OHSX 1A9SA 2XMGA 4CV1A 3HGMA 1R3DA 1V6CA 3ZDZB 3U16A 3COWA 2NTEA 3TB4A 1KA9H 3LUCA 5B1IA 4KI7A 4XD7D 2IZOA 3ZZ1A 3PI7A 2X7JA 4UAVA 1C7IA 4GLFA 1R6VA 1VKNA 1D6MA 2A5JA 2AYYA 2CFCA 2HSEA 2I6SA 2CUKA 1E6CA 3AM5A 3DEZA 5REQB 3CR7A 5ILOA 5JZ9A 4NYJR 3AB3A 3PJEA 1CP3A 2H7YA 2LPMA 2YTZA 2ZQ5A 1V48A 1G2OA 3V8VA 4BLUA 1ZKMA 2FP4B 3TQCA 2JCVA 4FM9A 2ZROA 4OXRA 4Q3NA 4NRDA 2II6A 4GMKA 2FEOA 5HWSA 4IDPA 3B38A 1T4BA 2I55A 4RTLA 3ONEA 1QFSA 5EJ5A 3LBAA 4TVBA 3WRVA 3FW1A 3UMCA 5L4SA 1IH8A 1HV8A 2CLHB 2VWGA 3QP9A 3NHMA 5CGZA 1MN6A 2WPDD 4Q1BA 2WTAA 3GJ5A 5IUJC 4K9MA 3A1FA 3GJ0A 3D02A 4CIBA 2GJSA 3AP3A 5ABPA 1X8KA 2OK8A 5A9TA 3R40A 4J0FA 4G84A 2RHLA 2VQSA 3EPJA 3AK4A 3EVAA 5EJAA 1KO8A 5KVAA 2Z6VA 4P58A 2W11A 1ESCA 2IGTA 2J3HA 1Z6QA 3JZFA 3FNHA 4RS3A 4B1FA 2JFOA 2GZMA 1KMNA 2I3BA 2ZYSA 3EXEB 1OFGA 1ZG3A 3LM8A 3NU1A 1ZLYA 4I99A 4HX2A 2R8PA 4E51A 2OFPA 5FADA 5CT9A 3RBVA 3ZUGA 1IJBA 3H13A 3NTVA 4PCVA 4D6YA 1L7NA 2X40A 3E7XA 1TVKB 2V6IA 3GLHA 4EHIA 2V5VA 4AULA 1YUBA 3RAEC 3WK8A 1ZM7A 3PQEA 2JLZA 3BHJA 3BWXA 3ZHRA 1ETHA 2WSSA 3QPAA 4FJ0A 4KC0A 3ER8A 5IAOA 4P7JA 2AYXA 1RLMA 2NSDA 2ODNA 3GLVA 4H1TA 3FKQA 5ALYA 2GA8A 3LO5A 2QTGA 3CLUC 1SXJA 4NX2A 1OKKD 2QENA 1QONA 4JLBA 5EKDA 1KTIA 3AQIA 1DCFA 5IUKC 2PA3A 3RROA 3ZLBA 4FYWA 4MVWA 2B9EA 5AH0A 1XVVA 5EYPA 3AX6A 4D3FA 1BMTA 1YMUA 4D80A 5DT9A 1JA0A 2PUTA 3O0DA 3OHPA 2Q2OA 2WM8A 2WNIA 2YV3A 3D8NA 3F9RA 4G0YA 4MS1B 5NULA 4IILA 2QX9A 2XBUA 3Q41A 2G08A 4NNPA 5EIWA 1DQSA 4BJ1A 1AV7A 4CCAA 1HE2A 1FUYB 2VATA 2X9QA 3PA8A 3GPIA 5D1HA 1Z0IA 3MPOA 3L7YA 5K0NA 3TR5A 1WXQA 3N8DA 4TTVA 3V3KA 3VAAA 3KJIA 5F1YA 1N0HA 4F0JA 2ZR9A 1C9JA 4IXDA 2REQA 1UANA 3CNEA 3H4VA 2B20A 3AILA 3RR2A 5LL6P 5IC4A 3DLCA 1L5WA 3D6JA 3STXA 4FYMA 5K3SA 2G1AA 1HC7A 4X20B 2O8EA 2R1VA 4J1QA 3I1FA 4GPAA 5KQGA 2FFJA 1IN7A 3NBAA 5C32A 2CBXA 1HNXB 2CBZA 3ZQ6A 2QM8A 3BMNA 3WTCA 4RC9A 4WLNA 1ECLA 1OAOA 3FCSB 4BNNA 3QEMA 4CZ2A 5J40A 3NT5A 1GLVA 5I45A 2GM9A 1NXVA 3O6VA 2VNJA 1P18A 4UCXA 4H6XA 3BGVA 4YP5A 1U4NA 1WSDA 2O7NA 1F06A 3EF0A 3GEMA 1LDYA 3SXPA 3TLMA 4DSUA 3H2GA 3LF1A 3IESA 1D7AA 4FQ5A 3R8FA 2A0FA 4U0KA 2GAOA 2JLWA 2F59A 1SKUA 3CLRD 3EC7A 4RAQA 4N7MA 4D6PA 4J16C 3VDXA 4BKMA 3CZAA 1P3JA 3BXFA 1PQYA 3W2EA 4DWWA 5AI8A 3DR5A 1J0DA 4NF2A 2GCOA 2PWAA 4L8LA 5EQFA 4WOKA 5MHTA 3PNPA 5BW8A 2XB9A 1TLLA 5AXAA 4HDRA 4UBNA 4WT7A 1U9CA 3IUYA 1W75A 3MINA 3FVRA 2WIJA 3WWDA 1NBAA 4UTPA 1BHSA 2G76A 2H1HA 1UMDA 3F6YA 3WGGA 4D9EA 3AEUA 2HQOA 1NW8A 1QMPA 3E9MA 3OQOA 3BK7A 1QTNA 5AVWA 1NNEA 3HO1A 1JDNA 1J8VA 3VJRA 4K28A 2WHQA 1GV1A 1EFUA 2UZIR 2FZCA 2GBGA 3F46A 3GJ6A 3ISJA 3LWNA 4KWTA 4B43A 4HYQA 5EMNA 4URWR 1YQQA 3L7LA 3IKLA 2P4UA 3RS3A 1W5TA 1F8UA 2EHDA 3HV2A 3FZGA 4PYJA 2Q3BA 3W79A 5A5GA 1ZD3A 4LQCA 1BHO1 1KOJA 1S1MA 2VQ6A 2J6BA 2NU7B 1UKAA 3ASYA 4XM0A 3T7KA 2G4CA 3AVXA 4WNAB 3ZW9A 1LW6E 2ZJYA 3CKYA 5AYVA 4BE4A 5HZHA 2ZBQA 1RXSA 4KNWA 1VIMA 3ZKWB 5AW3A 3KJXA 5CVEA 1CJCA 4MV6A 5K3DA 1KDRA 4QBTA 3RRNA 4IGIA 1MT0A 3HO6A 2VUUA 1OR8A 1T8TA 2QR2A 1OKKA 5KAPA 1AVTA 2OGSA 2I54A 1WPRA 5FCDA 1O0BA 1PR3A 2Y1XA 1CXZA 1WXIA 3WK5A 2BFAA 3VR2A 1D2AA 2C1ZA 4FR0A 4DKXA 1SMKA 2M9MA 3UYLA 1N77A 1IRXA 1NY5A 1SD2A 2MJLA 3IOCA 2CDCA 3UA4A 1PWEA 4MMZB 3OCYA 3W1VA 4ZRDA 5AVVA 1HE3A 1IUNA 1OYWA 1TYCA 3KAJA 3OVMA 1E1CA 4HNGA 5F5XA 3ZGNA 3ZCUA 4CG0A 3CN7A 2FHPA 2I6QA 3OZIA 2JI9A 5FA6A 1ZWLA 5EHXA 3GLGE 1K0FA 6AT1A 1NC3A 4FLEA 3LZCA 2FRDA 4CDGA 1W5AA 1GGMA 4UBJA 2W42A 3N5KA 1FMLA 1XYYA 1AQLA 1O97C 2SNIE 1WXDA 3T4EA 1JJAA 1C1YA 3MJFA 4GBJA 4E11A 3R9XA 3JU3A 5C1OA 4F91B 3SIWA 1YJ8A 2PBRA 4EG8A 1XZLA 3V46A 1E7WA 3CF0A 5JDCA 2VVTA 4JGGA 5G40A 4OQYA 2R66A 1M2NA 5L3VA 3QELB 2E82A 1RIIA 3BWBA 1R5OA 1FFSA 3NRJA 1O5OA 1E66A 2YJ5A 2GKSA 4I2VA 4QSHA 3G2KA 4ARVA 4C4PA 2WWYA 3A1VA 4FBGA 2HCFA 3LC1O 4M0CA 3ZTTA 2YWJA 3E4DA 2IEYA 1RAGA 1HUQA 3DEIA 1SQFA 1VSBA 1PFWA 3EK2A 2Y6VA 3OAAD 3VR4H 2D5BA 4GPEA 3FPJA 2NVBA 2ZP1A 2EFCB 3PXXA 4ZTUB 3G5TA 1JFFB 4WKBA 5B7PA 1SUAA 3EZLA 4F4HA 3NGLA 2QROA 2R1TB 4R0MA 2EP7A 3BWMA 1HEYA 4WACA 4ER6A 1EFAA 1PV1A 4KK3A 5K1ZA 3SIPA 4B7XA 4DZTA 1N6HA 3QPVA 3S70A 4C21A 1J1ZA 5CFZA 5JYCA 2PLNA 5HJ7A 3C41J 3AHCA 5LXTA 1JLMA 3L02A 1M8JA 3Q9UA 4EGQA 2AFHE 1M1YA 3R4VA 5EZSA 1NV9A 2HGSA 4DA4A 3KXKA 1CDZA 1LFAA 2ATCA 1G60A 1H9BA 1KJWA 1N75A 3P9ZA 5BV8A 5EJEA 4H0CA 3KKNA 1EDDA 1VCMA 1MIOB 2J8ZA 1AMUA 1OXXK 5CDYA 1KZHA 1KU0A 3OOEA 3PHHA 1K92A 4MRMB 1C3OA 3IQGX 5L3SB 1GZ5A 4OQXA 2Q4EA 5FTKA 3JAMA 4R2HA 1JWBB 1U0JA 4B46A 2XE6A 2IXEA 3DTVB 3LV8A 1EJ2A 2XHZA 2XLBA 4P22A 1N6LA 4RSRA 4ZEXA 1SZJG 1ECBA 1HDRA 1ODSA 1TMOA 5HBGA 2GPJA 3PDUA 4YMIA 4WLVA 4JJ7A 1SK9A 1BE1A 3L06A 3LYAA 1CJTC 4MW6A 4WZBB 3KLMX 1UOQA 1NVKA 3DOIA 3OQIA 2I1LA 5FA5A 3ELBA 1P4GA 3L0DA 2ZYGA 1YJQA 4GPTA 3BXHA 1R9NA 3BL6A 3V4LA 3PF8A 1FYVA 2BZ1A 1G18A 2FOXA 4RJJA 5CPBA 1HT0A 3E9DA 1ZRSA 2HTEA 5M5BA 5F4BA 2VT6A 2X8BA 2HAEA 4IOJA 4QICA 4QGBA 4Y2RA 5E1DA 4G5FA 3NATA 4WECA 5EE1A 2QTWB 5KU1A 2HV8A 1BRTA 3O94A 1ZOLA 4Y9RA 3ONFA 2QTNA 4O8ZA 5AW0A 4E33A 1QKKA 2GK3A 3AERA 1NQVA 3GJZA 4HVAA 3VDQA 4HH1A 4P3NA 2CXHA 2P3SA 3GLRA 4Q01A 3P0HA 1OTHA 1JAIA 2AH5A 3R7SA 2IPNA 3QYJA 1JXQA 3IO3A 4ZRNA 1TU0A 4EX7A 4CI0B 4CHTA 5LPNA 2H00A 3UV3A 1GRVA 1X1BA 4UKDA 1DV2A 4XYBA 3VC1A 3VO8A 3EVTA 3QI7A 2ERCA 3NCTA 4JELA 3F2IA 1BXKA 2VJOA 4X63A 4I3FA 4II3A 5D7NA 1HKUA 3Q3JB 4YONB 2BBWA 1QIMA 3KDAA 3T3DA 2XOXA 1S01A 2R751 5DSTA 1J25A 2W6PA 4BNKA 3PNSA 4F84A 3LKDA 1OBVA 1XZBA 4LCJA 3HKCB 2HWKA 4G23A 1GWNA 3K70D 2DWPA 2VRCA 3S7TA 4B7UA 3RSLA 1BTOA 2HI0A 4KFTA 4MPRA 4MUEA 4DMMA 3ADCA 4CIWA 4RMIA 4EJFA 4IF6A 4Y6PA 1W49A 2ORVA 2BFBA 4GMHA 4RZUA 4WFIA 3ORSA 5JSQA 5HA5A 1LTKA 4ZIRA 2QVXX 2YMMA 3DT6A 1BSVA 4RVNA 4MB6A 2Z0MA 3EXAA 2IS6A 1G8PA 2WU1A 3QXHA 3KTDA 2WD7A 5B37A 3DFMA 3F9CA 3EGXB 3PFNA 1PYDA 1GPJA 4PNPA 4R5MA 4YCJA 3DBRA 2JFPA 4H17A 2X2PA 5LBUA 1VYVA 2WWRA 1UT5A 1XHEA 4ZDWA 3ANYB 4ALJA 4DNQA 4EFKA 1KC1A 1JEYA 1TT5B 2NYRA 3EAGA 3EMBA 1XSEA 1HPLA 2AX3A 3GJRA 2JAOA 3RRXA 4PC2A 2YWXA 4KQ2A 4PHGA 1PK9A 3TCNA 3EG5A 5ALWA 2J9XB 4DFDA 1NP6A 1ZCAA 4OMDA 3REQA 4QM7A 1KE1A 3BGWA 4WINA 4Y1EA 2AIRA 5F23A 2Q2QA 3PTZA 1SM4A 4R1PA 1TAHA 3L9WA 4XVRA 3SE0A 1F2DA 2P1RA 1WULS 2WKWA 1GQYA 3PGKA 2DULA 3B1VA 3IX7A 4UM8B 1TM4E 2VO1A 1H2XA 1DDOA 1UADA 3ITKA 4C4OA 5IZ4A 3AL2A 4DJTA 2AR7A 4GX0A 2BFDB 1HDYA 4MO9A 4PYIA 3I04A 2NPOA 1CUIA 3TZBA 3K7EA 1ZL2A 4WEQA 5EC8A 1O94C 2ZYRA 2ZBGA 2JD0A 1KI6B 2C2GA 1GZ7A 2R11A 4QECA 5DX8A 2W37A 1DTSA 1MVLA 5DYNA 1TEZA 2D2EA 1T1SA 2IX3A 2C9MA 3GPLA 4E15A 2HX1A 3GRAA 5FIUA 2Y77A 4RDCA 1XG5A 1ZN9A 1JALA 2KMLA 3VGJA 1NNI1 5MN5A 5C2JB 5KI6A 4PTYA 4XQCA 1UBSB 3UYKA 4B6OA 1Z26A 3I8XA 5LOVA 3WS7A 4TMTA 2H1OA 3GRFA 3L8EA 4O4IB 1PWHA 1INLA 4MCAA 4NNOA 2BFOA 3TAXA 3ET4A 5EZ6B 1VJ5A 3R7LA 5DK4A 1B76A 4H1WA 4CQMB 2UUPA 2Y2UA 3H5AA 4BJ3A 2BSXA 4BMPB 5JADA 1R88A 5DN6A 2JHPA 3CT6A 1LVUA 4NCXA 1FRZA 2QSUA 1R8XA 1W88A 5IAJA 2V1XA 4O6VA 5JEDA 1KGDA 3B9PA 3OIWA 4DE5A 1W96A 5IYZB 5JS1A 1UINA 4RY0A 1RKQA 2ON6A 4WSOA 1YB5A 1JG3A 2ZSUA 1G2QA 3KQUA 1JXOA 4TWIA 2WAYA 3EZXA 1FF9A 2FRXA 5DXFA 3CU5A 1I6MA 1QLWA 5LC1A 3FDZB 4M8KA 4EUNA 2PMWB 4GOND 3BBLA 3NC1C 3TDKA 3WWZA 5I9SA 4JBXA 3ZJ4A 2XECA 1QHEA 2O48X 4U6NA 1VJ1A 2JZCA 1Y6JA 2BOVA 5TR9A 1Q1BA 2G0TA 4PZYA 2RH8A 4N8SA 4BFCA 2P0AA 2O4CA 4EY5A 2WTUA 2WTBA 1JG2A 1MRZA 3PTLA 4URFA 1T9ZA 4ROTA 4ZCTA 1X7WB 4KAJA 2XXBA 3QE3A 5TQJA 2IPAB 4RA6A 3CRVA 3JQFA 5AVOA 2AF4C 5C7YA 4E03A 2FF7A 3NJ8A 5HCUA 1SHKA 3TSAA 4DRXA 4QD3A 3O0TA 2EX4A 2PCJA 3UQYS 3E70C 4K1LA 3FBWA 2FPMA 3T61A 3WFIA 4NBNA 3I9LA 3NJ4A 4URYR 2VJLA 1SHUX 1DO8A 3PNQA 4UUPA 5JANA 1NJ8A 4FONA 4G01B 4CDNA 1M8PA 1JQJC 4D5GA 1JYEA 2P1ZA 4DXAA 1Y0BA 3SI7A 2XNKA 4BLQA 3VPFA 4HV4A 3NW9A 3QW2A 5WRFA 2IL1A 3UAGA 3H9UA 3C6YA 2JKVA 1DJLA 2QS9A 3DTNA 3HFGA 3O91A 3WIOA 4EMUA 1RRCA 1PL0A 1ZUNA 3G0GA 5CT5A 3MXOA 4NYMQ 3II6X 2ZSHA 5H80A 4CKXA 1LWOA 4MVJD 4ARZB 4OUDA 3IPCA 1B3BA 3JWEA 1USGA 1DKQA 2IOFA 3B2QA 3HNPA 4KQ9A 1YS4A 1CUYA 3KHSA 3D81A 3Q9NA 3K0FA 3RS9A 4CM4B 2JLYA 1ONSA 2N1MA 5A4DA 5C51B 1HDCA 4MRPA 5JDIA 1UOEA 3NTXA 4GI7A 4V2UA 5EZYF 3KETA 3RTEA 4IJMA 4U2GA 1T1GA 3OLZA 4ZT3A 1ORDA 2W2OA 2EGHA 5JTUA 2HK9A 1NVGA 2DR3A 2PA0A 5FNZA 1AURA 1FYXA 1C0KA 3A4IA 1P0CA 3GRPA 1S4QA 3X1DA 4D9CA 1B3RA 3U7JA 4JSYA 1IFXA 3CKKA 4J0KA 2GASA 4TYPA 4KVFA 1FFAA 3OQBA 5IP5A 1KI4A 3ORYA 3DW3X 4HPJB 4L8FA 3TYXA 2XZPA 3CJQA 3GT0A 3H3JA 3RYHA 3WLTA 4AS1A 1LD3A 2RHOA 3Q7QA 2AT1A 3BF8A 4WOPA 4QASA 1XZAA 5T3YA 3OEED 3FYSA 3T3MB 2FJ0A 1J8FA 1HKHA 2JBAB 3EPKA 5FV4A 3H3XA 4DANA 2V4UA 1C30B 1KFJB 2PKEA 4P80A 5AOCA 3TX2A 3EQ7A 4R9VA 2ZIWB 2VSFA 5K8UA 2HHHB 2ONZA 1EB9A 1Z63A 4JY7A 4OU4A 2QN8A 1L5QA 2ZJOA 3OHMA 3B60A 4CEIA 1R0CA 2JH9A 2VDVE 4C6SA 3LRXA 1T8YA 3FCXA 1SUFA 2HA4A 3IKVA 4B4OA 3KTOA 3BMOB 2FQYA 2ZI5A 3CUUA 4UNIA 2R9VA 3E8SA 3MOSA 1IEWA 2CNOA 4P4UA 5A4AA 2F3SA 1L4NA 1YJCA 3HYRA 4LNHA 4PYNA 2E7ZA 2CNWA 2PBZA 1FNSA 1LRLA 1L7EA 4MMXB 4YT5A 4A1FA 3BRSA 4CF5A 4G5QA 5DRTA 2ZS9A 3I9KA 2YN4A 1TU4A 3I83A 3E7DA 2B9VA 1TOAA 4DIEA 4I4NA 1JDBC 4YP7A 1ISMA 4RVUA 1U1IA 2GRUA 3NWJA 2WWFA 1EQUA 4P7KA 4PPYA 4GX2A 3GGGA 3CLSC 1U7DA 2I4IA 1OLOA 1NBHA 3L7KA 4RWZA 2CE2X 4FDMA 1YR3A 4Q9KA 1UP7A 1JQ5A 2ZREA 3CEHA 1L8AA 1SBNE 4NZMA 3RT9A 1WW8A 4JB0A 4PHHA 4TRNA 5IJAA 4UNNA 2OBXA 2IZ0A 5T4HA 4BNYA 5L9AA 1TYDE 2NO6A 2QZJA 4ZMSA 3DNFA 4FKZA 1MJ5A 4NCBA 3VR3D 4Z4HA 5G4LA 4C0LA 2PXXA 4JYCA 1X1TA 2RGUA 4NOJA 4QEDA 1ODLA 4V0LA 2NG1A 4QOIA 3S28A 3ES9A 2WJYA 1FYWA 2CFSA 4E88A 2C7RA 4LF6B 3P1JA 5FB3A 1VPLA 5HQ3B 1SC9A 2YY6A 3LYUA 3FRJA 5HBRA 2FFHA 1TMYA 3BTVA 4FN5A 3ITNA 1EG2A 2FEMA 3IP7A 1DRVA 1XDSA 4DSZA 1GPYA 2GCNA 2PZLA 4EG3A 3ELDA 1YQWA 3SP1A 1JPUA 4OU5A 1E9BA 2GTIA 3W8NA 4RQBA 1YI8A 3LRPA 2JK1A 4G0ZA 3WISA 4JQSA 1LRJA 2VK4A 2PUDA 5B5SA 2W2LD 4RD1A 1XCMA 2H1FA 4ZYVA 2EFJA 2VHJA 2ZDHA 2C7GA 3CUSA 5FLKA 2VNSA 2P41A 4NE7A 3VPCA 1UXOA 3VZSA 1N5LA 3AUJB 4NVRA 4BBAA 4C88A 5IT4A 1Z16A 3BD8A 3GLFE 2VQFB 1HF3A 4OAPA 3K0FB 4JXKA 3GJ7A 1YNOA 1XEWX 3BZWA 2ANCA 3F96A 2ZPUA 3PPVA 5JVDB 4E6PA 5HFAA 3U1TA 3S99A 1UCFA 2HREA 4K1XA 2V7GA 1SURA 1NRXA 3IQZA 1QGOA 4F4FA 4M0LA 4D8YA 4YMHA 3VA7A 2Y93A 4GOJA 4PIPA 1ZITA 1U6KA 3ID6C 2GVNA 4GVXA 4JX8A 2DG2A 4CEJA 1F4LA 4RELA 4U9HS 4EGAA 1GZVA 1R16A 1Y9AA 3IEXA 4V0KA 2OV8A 4MI1A 4AP5A 2A0WA 2W4QA 4EVQA 2J09A 3PGA1 4D44A 1OSNA 1TZ2A 2OM2A 3MQ2A 4C7BA 3R74A 2CNBA 4FFBB 4ZXFA 1LLFA 1D04A 4QJ3A 4RENA 1NQTA 4C29A 2L0XA 4QUKA 3RABA 2Q6LA 3JYOA 3DDHA 3HCBA 3D4BA 4ZEVA 5AKJA 4XYEA 2FZVA 2Y92A 4NAUA 5TMEA 3QVKA 4HNRA 4L02A 4GMXA 1A95A 2OXCA 4FDLA 3O95A 3SF0A 3D59A 4U02A 8GPBA 1AOXA 2FPPB 3VKFA 3FAZA 3LX8A 2W2VA 3TGLA 3PC3A 5B3JC 5A1TA 3LIPA 2PKYX 2OGTA 3KQQA 3SFZA 5K2OA 1VIYA 3UUEA 1QZ3A 1VA5A 1V5WA 3PHBE 4B4WA 1MO3A 3C4VA 4QPCA 1OLXA 1NFRA 5FP0A 3GCZA 1H1TA 2Y9PB 5LQNA 1W85A 4E5KA 4JT8A 1Z36A 1F14A 4ALKA 2DKNA 1DU4A 1I36A 4TVKA 1UWVA 5KO2A 4AUNA 4D82A 1Y7TA 1X8XA 2X3UA 2VF8A 3T12A 3EGCA 5AKEA 1P9WA 2DPGA 3IA7A 4C4XA 3SZRA 5CITA 3EZ7A 1L7QA 5J5CA 1DOZA 2JRCA 2RAUA 4AG5A 4QL3A 1NKTA 2QG6A 2QN1A 4M83A 3C7KA 5EIXA 3E81A 1DWPA 5CFMA 2PVSA 2CZQA 4TZKA 2O0HA 1DO0A 4BAZA 4U8GA 4Z4EA 2YDXA 1T6NA 1TZBA 4LHSA 3BIOA 2BEWB 1EX9A 4MV9A 1NR1A 5ADWA 1R15A 3AOEA 2F90A 3H17A 1QB7A 3ST7A 3I23A 4AZWA 2B1IA 1IZYA 2UDPA 2R7MA 3DFFA 3DDNA 3RB8A 1N2ZA 2ZRPA 1KHTA 2ZBVA 3C3JA 4TUYB 1RHQA 3JWJA 5AUNB 3GPCA 2LIVA 3L6UA 3QHAA 3W05A 5FWNA 4ETIA 4XIIA 1Y3AA 3GDWA 4EL0A 5IKXA 1FRVA 1PD1A 3BYZA 4Z6KA 1CY7A 1N9GA 2HDHA 4WN9A 5AHRA 2WIGA 4CLRB 3QYPA 2Z1MA 3A70A 2G6TA 3JRXA 2AEMA 4BLSA 1JLKA 2VP4A 4FGJA 3Q0TA 4PBRA 2PS9A 2QXYA 1R2QA 3INGA 1NT4A 1WJGA 4O4HB 4CTMA 1CRQA 4PX2A 4ZKDA 3EWNA 3OKFA 2IHKA 4R84A 1GZDA 3U31A 3UV7A 3UCXA 1X70A 4XJSA 3UK6A 1WY5A 3K8ZA 4DYVA 4UD6A 3T99A 3ETCA 1EVZA 4JJ8A 3LU1A 5COAA 3F4BA 1PP4A 2GYUA 3H2KA 3D6UA 2NU6A 4O0LA 4ZDIA 5JY1A 3EZ9A 5BR8B 3EUEA 3BCUA 1P1IA 2OV4A 4I0WB 4G3XA 2KB0A 3VU9B 5BYAA 4C30A 4CCWA 4QG7A 1T5DX 3ABRB 1EBUA 1Q0LA 3FNGA 4KOAA 2F00A 4O3FA 5DNEA 1XD9A 4BZWA 3GEHA 2ZANA 4FFMA 5CT6A 2YN0A 4Y9TA 4KP7A 1LGYA 3OCXA 3W9SA 2FSUA 1JBEA 3QMMA 3TD2A 1QKJA 4L5JA 3U6KA 4RTKA 5AK4A 3EG9B 1JKIA 3KVVA 5BO5A 3ZGVA 4ROSA 4NDNE 2YKGA 2YMLA 4KXLA 5EAIA 5HE8A 2NSHA 3CX6A 3GJ8A 1ML3A 4PWZA 5BNFA 4IO1A 2C7BA 2EZ9A 1H4TA 3C6MA 4UHJA 5K8TA 3Q15C 4FNAA 4DY6A 1P0IA 2QQEA 3UF0A 4BNJA 4DUYB 3Q2OA 2ANBA 1U02A 4R69A 5JS8A 1I30A 2NZYA 1HM5A 3DCNA 3WO0A 5K01A 3U09A 1SQ5A 4YAOA 1ZBQA 3I9FA 3DMTA 2NTJA 2QORA 8ADHA 1FU8A 4HNTA 3AP1A 5A06A 3PXAA 2FPRA 1GL3A 3C14C 3C8ZA 2GM4A 4D9HA 2OYRA 1LS6A 3BCSA 2VJKA 4U3JA 2NZXA 2V0GA 1M6VA 1GTVA 1DDGA 5F1OA 2Y4NA 1PG5A 2WUEA 4LSZA 3OFVA 4HAYA 2H2DA 1AB5A 4FGUA 2O07A 4LQDA 1BXZA 4OLHA 4UUQA 3V7FA 3T1TA 2J85A 1KI7A 2COEA 2AK3A 5DXJA 3VPGA 3FB1A 2ZUSA 1AZLA 1YJ5A 1YFLA 2IU3A 1A76A 1DKNA 1MLDA 2YCLA 4FUQA 5AW1A 4JR0A 1KXZA 3ZV6A 4IIFA 1EE2A 1VI2A 3EIWA 3PRJA 3TRFA 1MJHA 4HZIA 1IN8A 2UZ1A 4P08A 4PLCA 5AI4A 3AR2A 1OI4A 2I99A 4GU5A 4I4CA 1U8TA 3PIDA 3T06B 5DSXA 3WJAA 4BWVA 1AHIA 2GHRA 4MTCA 4DJAA 3LY5A 1RFGE 5EZ5A 2Z95A 4XWKA 2AXNA 2BDUA 3BIXA 3FF1A 2F2TA 4OJKA 4TTAA 4MPPA 2FA9A 4KIJA 1DBPA 3CH4B 4Z4CA 2BTQA 4U2EA 3EGWA 4EB6A 3HHPA 1T2CA 2ZB4A 1YZ3A 5D6OA 3QKSB 4ZMBA 3HHEA 4IO0A 1ORTA 1RMTA 4KTVE 2I6XA 3K6JA 3KVYA 3L6EA 4HXEB 4KPFC 4U8HA 5H02A 4AXBA 3MMPA 3UUFA 4BV2A 2ZRIA 4K87A 3I12A 3OG9A 5DHPA 3GFTA 3QEKA 1QP7A 7YASA 5JWHA 5GMOA 4EPWA 2H4ZA 2A14A 1IWPB 3LPDA 4EO9A 1AT1A 2NO9A 2C9DA 3OPYI 2NUPA 1U9IA 3B36A 4KQ1A 1GAEO 4N6NA 4BNHA 2C58A 4WZBA 1CSEE 1IBSA 3FNFA 1THMA 5K7SA 3S1SA 2BZSA 1RBZA 2I3DA 4INPA 3EPPA 3SGLA 3D5QA 1DEHA 1JW9B 2K87A 2XW6A 4HWGA 2NQTA 1KMCA 2IBSA 5A3VA 1H3FA 4G6ZA 1PQ4A 1U1GA 3N2NA 5KEIA 4LBZA 1G59A 1EM8B 4TMZA 4HY3A 4UU8A 3D6HA 3PUXA 3CZPA 4Q9JA 5KOJA 3FZQA 1CNFA 1BS2A 2TMDA 4GBMA 1LDEA 1DUSA 3A1CA 1I4TD 1IOZA 1NF9A 1QHYA 1OH6A 4LRUA 1G4UR 3CZCA 2AG5A 1B0PA 2DPHA 4HMPA 3CVWA 1MDFA 5JYDA 1XNQB 3CS3A 1MENA 2V8BA 1TQ6A 1CVLA 1RTKA 3RS8A 2VHQA 4NMLA 2CT8A 3NVKI 2B7LA 3VPDA 3BL8A 4XSVA 1NVDA 4DC1A 2D5CA 1AQIA 4NEGA 3IDAA 1NTRA 2X1HA 4LW8A 3SHOA 3ZLUA 1ISFA 4ZVPA 4U2BA 2CLMB 4LWPA 1D1SA 3PKZA 5K05A 1K7FB 4AJIA 2BKXA 1EIZA 4NCNA 2WWGA 3SE7A 4OOEA 4LUCA 5BORA 3FY4A 4N8EA 1Z7BA 2Y76A 3FYTA 1V1RA 1U2RA 2E5FA 2KI5A 1EHCA 3D8BA 3IMEA 2B21A 5E2AA 1OI7A 2BHTA 4LRTB 4AN0A 4EJSC 4MGIR 4W9NC 2O23A 3ZHXA 1SFRA 4RTSA 2I4LA 3QU4A 4M2LA 1OJLA 4DDMA 2A3RA 2CLLB 3DXYA 3ZWNA 3G2IA 2PSEA 1SUPA 3MSCA 4PR0A 5GV8A 4BQQA 5LMUB 1A9PA 3L0CA 4HNVA 1KYVA 1UQTA 3OD1A 1JJBA 4LHYA 3V55A 1UXKA 4UULA 3W2TA 3G7SA 3W4KA 2FQWA 3R0VA 1KZGB 4UEOA 2FX5A 4TWZA 2Z5VA 2LP4Y 1HDXA 3TSCA 4J3NA 5EFZA 1V6AA 4K9DA 3CEMA 1OAAA 4QPZA 3RVKA 4CRWB 5A3RA 3Q0EA 1Z8HA 3E6AA 2P78A 2Q2WA 1VKJA 2AL7A 3N7UA 4RVGA 4LFAB 4ZVUA 4RDXA 2XRMA 4XQEA 1ZR4A 3P97A 1ZGBA 1AZWA 3NIFB 4XGKA 4F85A 5AVXA 4DCGA 3FVQA 1U0BB 3NHAA 1U8UA 1DJQA 2FRDC 3VKGA 1E9FA 4ERNA 2AZDA 3DB2A 4DC0A 4B84A 4KR9A 1QQAA 2AMJA 3DMPA 1MF7A 3JQAD 3K5IA 3SX0A 3DB1A 2GZ2A 3HR7A 3R6DA 4MTLA 2L69A 3JQGA 4GVLA 5K4GA 4MRNA 1NKVA 2R6ZA 4FOPA 2QI9F 1K68A 4EHNA 1Z2OX 5H81A 1RLTA 1XALA 2IXTA 2PS3A 4M86A 3FGOA 1C0IA 1LRKA 3NBKA 4HLUA 4YYZA 1UPCA 4Y7DA 4ZXPA 1UK8A 2AG6A 1H3NA 4ZKEA 4IJQA 1KQFA 1KOFA 5ECDA 1YR6A 1YKFA 3BXPA 2BEVB 3AGPA 4IJVA 1XJWA 4LRYA 1Q5PA 2IDMA 2VBGA 3Q2KA 1B4DA 4OB6A 5AVUA 4U6QA 3I58A 2VWQA 4UEKA 1QZXA 3QVGA 4R68A 4DCOA 2F1KA 1PFKA 3ZKWA 1H8HA 3KZCA 4D0LB 4GGPA 2VSOA 4DSAA 3FROA 5GIOE 1BW9A 1MFZA 4BNIA 3E3LA 2QN3A 4J4TA 3UAWA 1ADBA 5LQJA 3P9PA 2JZOA 4DNXA 1TF2A 1DQNA 2UYGA 1IQPA 4RVOA 4PX5A 3ZW8A 2Q6KA 3OOHA 1Z15A 4X24A 4ZO9A 4DC9A 1IQ0A 1H2YA 4NFSA 2QY9A 1X7GA 1TM1E 4UMDA 1L7DA 3U40A 1P2FA 2GD6A 1U6JA 2YICA 2VC2B 3AT1A 5L8VA 2QAJA 5DNUA 3M3HA 2D6FA 4KR6A 3I61A 3LP8A 3ESYA 5LCXA 4NBRA 1T1EA 1ZJ5A 5KYVA 1QQ7A 1XYGA 2EFHB 4AY3A 1XGKA 4B5LA 1JQLB 4DR1B 3MBOA 3RLIA 4LXHA 2Y3IA 4Q4HB 1CUJA 2OV1A 4FT4A 4X8LA 3CFYA 5FD8A 3F4LA 1UMDB 2GBPA 3C7CB 2C5AA 3TTTA 2VP3A 1LZLA 1V3VA 1MOQA 4MYDA 1UUFA 4GOMD 4U2FA 1J1UA 1TD9A 3LHKA 1FUUA 1YK0A 4E21A 4UZFA 2X0NA 2LE0A 3Q7IA 3PVSA 2DLDA 2R8YA 4D6XA 1E3DA 1WY7A 2HL6A 1XAGA 2JFUA 3CRZA 2PWYA 1VG9B 4D3DA 3EBLA 5CXXA 4UHFA 3NWPA 3W04A 2WE8A 4WBNA 1DAFA 4YCMA 2E0IA 3AF2A 3F8TA 4E09A 4QNRA 1E1QD 4M9CA 2Q5LA 4EJSB 3ILXA 4X7MA 1XXHB 4HGYA 4YP0A 3K8YA 1VBMA 4YXWD 3JXEA 1GG8A 3EGDA 3PSHA 4DR4B 1V37A 3C5VA 4CM9D 5GTDA 4KBYA 2J3DA 3EVFA 3WADA 1KKUA 3O2NA 1ECJA 1OI2A 2FETA 3N0TA 5HPYB 4R3UC 3D2CA 3ZU4A 1DNPA 1WTAA 2Z4RA 3BS4A 4ZTZB 3WP0A 3CX4A 4L2IB 2J7PD 3R0QA 3ZY3A 1SRRA 4H2DA 1IY9A 4MEAA 3QLEA 4M36A 1XB2A 3DO8A 1O6CA 2O19A 1XEFA 3GWGA 1XP8A 2AN5A 2CJWA 5A9RA 2BKAA 2CMGA 2GJKA 1ONPA 1WKBA 1SBTA 2BT4A 3IHTA 1BS1A 1L5LA 4NU6A 4PFSA 1GTMA 3CPJB 4MS1A 1J07A 4I1VA 4JH0A 4TGLA 4A0FA 2EZ4A 5EHZA 2FN7A 3OUUA 5AUQA 1JSXA 2Y67A 5BOSB 2PGOA 2O14A 4MKHA 1U0HC 3RVPA 5FWYA 2DKOA 2FSVA 2OWDA 3RUCA 4EEXA 1L1QA 5DT2A 4RD4A 3VHQA 5A0VA 3BFPA 1QG4A 5LIPA 1FJHA 1SXJB 1T9CA 4EW2A 2FPGB 3CVJA 4TYYA 2M6KA 1PW7A 2VPWA 4IP0A 4JMPA 1E2GA 1W1UA 3EQ8A 3GA0A 2VJPA 5FA8A 1JVNA 3GC6A 1K8ZB 5HNKA 1EDEA 1DAHA 1OA0A 5EN4A 4F3TA 1N0UA 1X39A 1ZOPA 1ADGA 4LHVA 1EFVB 1AS3A 1U3CA 2D2VA 2CF5A 2Q9CA 1DKPA 2Z1DA 3CUYA 4GW3A 4MV7A 4YJ3F 4KDEA 1BROA 1JA1A 3O26A 3VR5A 2HNBA 2BRUC 3IS3A 2D06A 2VHWA 5J59A 1MW9X 4LJRA 2GCEA 3GV0A 1JP7A 3DF9A 3FMPB 1GSIA 1H6AA 2NU8A 3X2SA 1XYVA 1T6ZA 3JQ6A 4ALIA 4F3NA 2UYQA 5IEJA 3BEOA 1X13A 3UAXA 3WSTA 3LCJA 2H63A 4ZDKA 3SWWA 1XZDA 1XEAA 2ZATA 4N49A 4QYWA 1W34A 3RF7A 1EK0A 1BDHA 4BTEA 5AXBA 3EGEA 1SCUB 2QJRA 2O2CA 1P2BA 3C1OA 4KR2A 2IH2A 3OP4A 2ECPA 4GDMA 4HYYA 3NAQA 4Z1MD 2HMYB 5A9SA 3UPTA 1RWWA 1CUUA 2CLIB 3N87A 3CRNA 5AI5A 1BYIA 3DVAB 2FPIB 3GFRA 5CMLA 4BQNA 1PGPA 5FR1A 1PX2A 3TZQA 4TT3D 3U1VA 5JAMA 1B2RA 2QL5A 1ML4A 1D4FA 1VKOA 1JV2B 4XAQA 2UVDA 4Z8XA 4D9KA 2OO5A 4QODA 4RIGA 2JJQA 3FE2A 3PC7A 3VKWA 4F2WA 2OC4A 3ME5A 4L51A 4F38A 1G9SA 1KR2A 2UXCB 1BA3A 4REMA 3HWRA 1QP8A 3X1YA 2DQYA 3O2SB 4DV1B 2NTNA 3TDNA 3RRYA 2FWAA 1Z8DA 3T4UA 1MO6A 4S1VA 2QU7A 4E14A