3R7WB

Crystal structure of gtr1p-gtr2p complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
314
structure length
294
Chain Sequence
MVLLMGVRRCGKSSICKVVFHNMQPLDTLYLESTSNPSLEHFSTLIDLAVMELPGQLNYFEPSYDSERLFKSVGALVYVIDSQDEYINAITNLAMIIEYAYKVNPSINIEVLIHKVDGLSEDFKVDAQRDIMQRTGEELLELGLDGVQVSFYLTSIFDHSIYEAFSRIVQKLIPELSFLENMLDNLIQHSKIEKAFLFDVNSKIYVSTDSNPVDIQMYEVCSEFIDVTIDLFDLYKAELQNVSQLANGVIIYLRQMIRGLALVAIIRPNGTDMESCLTVADYNIDIFKKGLEDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Gtr1p-Gtr2p complex reveals new insights into the amino acid-induced TORC1 activation
pubmed doi rcsb
molecule keywords GTP-binding protein GTR1
molecule tags Protein transport
source organism Saccharomyces cerevisiae
total genus 57
structure length 294
sequence length 314
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04670 Gtr1_RagA Gtr1/RagA G protein conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.190 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3r7wB02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r7wB01
1E1QA 3A58B 4LHZA 2CHVA 4BLTA 4C0BA 3KXIA 2WWHA 2ZUBA 3LLUA 1QHHA 4QBHA 2HV8A 3MSXA 1N6KA 3DM5A 1GUAA 4Q00A 3ADKA 3K9GA 3SFZA 3KKQA 4Q7MB 3RNLA 1UBEA 4DDTA 1OIXA 3BS4A 4A6PA 3RS5A 2VSOA 4BRWA 2N1BA 3SJBA 4LJ4A 3GLGA 1FOEB 2YZ2A 5FBRB 2QGZA 4E07A 2ZXUA 2ZI9A 2QAGA 3H84A 2VP2A 3I72A 1LF5A 4JLNA 1RW4A 2DFLA 2WJIA 3CX7A 4FW9A 2PCLA 2QG6A 2ZU0C 1E98A 4A36A 1JB1A 4MYTA 4DCUA 1GSIA 4RD1A 1W5TA 1OW3B 2Q6TA 5BYKA 3FDIA 3L2OB 2VSFA 3B1ZA 1II8A 2LWIA 2ZE7A 2RKOA 1QHHB 2CK3D 4AKIA 3CX6A 3MCAA 3U3KA 1G20E 4EFLA 4HUTA 3GJ8A 2GTPA 4ZIRB 4PHFA 1SULA 4H1UA 1OHHA 3DL0A 4MUBA 3M6AA 4LYAA 3GLGB 5FOUA 2ZRPA 4B35A 3EIQA 1K6MA 2QAGB 1PV4A 3U6BA 2WOOA 1XD8A 3L0IB 4LJYA 1MT0A 3QXXA 2JA1A 1M2OB 2GVDC 5CM8B 3T12A 4F38A 2E9SA 1XJQA 5DN6D 3RS2A 3QJYA 1MRSA 4DDVA 1TEXA 1ZM7A 3TAUA 1FQJA 1KI9A 1N6IA 4B2LA 3Q7PA 2GJ9A 3KQKA 1NY6A 2FX3A 5FR1A 4PPQA 4Z1MA 2ZR0A 1II8B 4ACAA 4GDFA 3IPYA 4MUAA 4A15A 1AKEA 3HR8A 4AIIA 3I1FA 5CDFA 1CU1A 4HAZA 3WMEA 1Q1EA 1JR3A 1KOFA 1XNJA 1S0UA 1SKYB 4JJZA 1GITA 2FOLA 1EESA 2KSQA 1E99A 3FMPB 4RD3A 3KQNA 5DNYB 3OFND 4MITA 2ZTSA 5J4VA 3R9XA 5H68A 4IFBA 1IXSB 3ZD6A 1Z83A 4HEJA 4TLBA 1I2MA 1VDZA 2ANCA 4MKHA 1E2QA 2H18A 1G3QA 3K0CA 3TQFA 1GL9B 1QG4A 4XTCS 2X2FA 4CEHA 4ESHA 1VG9B 1N5LA 2I4IA 3TSZA 3WRXC 2NMVA 2XNSA 1RIFA 2AL7A 1LNZA 5E7MA 2UZIR 2ZI3A 3OEED 3H2YA 1Q21A 2VO1A 2FSGA 4I1VA 1OFTA 1R8QA 4WXPA 2ZRCA 3QG1A 4LCBA 4Q02A 2AKAB 2ZRGA 1OB5A 5EE3A 1F3OA 1M74A 5JS8A 4M4SA 4BFYA 1GTVA 3GJ5A 1OH6A 4JLAA 1W2HA 4JS0A 1Z6GA 1UFQA 4KVAA 5GJVC 3WYGA 1R0XA 3NKVA 5AK0A 1KI2A 1DBSA 2CEAA 4PZYA 5G53C 5HZHA 4CEHB 4XOIA 3PUYA 4N1AA 1MRNA 4MGKR 3QKSA 5TVKA 1AK2A 3QEOA 4Q4LA 2ZE6A 2ZSAA 4Z54A 4BGDA 2JLVA 3QQ5A 4OQNA 4ASUD 1E79A 2G1JA 3WMGA 1LVGA 3SE0A 4OQLA 2JLXA 3REGA 1T5IA 5DH9A 2J0SA 1ZUNB 1Y3AA 2QE7A 4G1UC 2JATA 1E9BA 2JASA 2AD1A 2GBLC 2I1QA 2YWHA 1W2GA 3TW8B 1BMFD 2ZRBA 3KJIA 1J8MF 4TSFD 4U00A 3AEZA 1P72A 4LBZA 4NMMA 4P32A 3A37A 3QIAA 2V6JA 1S9DA 1YRBA 4LC0A 1T4GA 1XEWX 5DSZA 2IC5A 4JLDA 1JECA 3FFAA 1P62B 1E1QD 1A7JA 2FSFA 2H92A 3CW2A 2C99A 3GMTA 3BB1A 3AF3A 3Q72A 4KXFB 2ZRAA 3LO5A 1TQDA 1E2MA 1R2QA 1RFLA 2FGKA 3VX4A 3W5JA 1S9HA 3WHLA 1W44A 4JVNA 5D3QA 5BN4A 1KMQA 5G40A 5IK2D 2IXFA 5L3VA 3LAWA 3AF0A 2FWRA 4PSAA 4DHEA 4DIDA 1GDDA 5BN5A 3UG6A 1VCNA 2BBOA 4Q7JB 4US0R 1YZKA 1M1YE 3KUCA 4Q47A 1E4VA 2XSZA 4JLOA 5FUYA 2H7VA 5JBQA 5B57C 2PCJA 3CPHA 3EPHA 2O8EA 3LX8A 1DAMA 3GFOA 1KZGB 1OSNA 1U0LA 2OFOA 2REBA 4C30A 4TMKA 3AUYA 3KKNA 4U7DA 2IYUA 4H1VA 2W6ID 1UJ2A 1XCGB 3NBZC 3D8BA 3T15A 2IEYA 4P4TA 4JYBA 1NJFA 2VEDA 2ZSBA 1OHHD 4HB3A 1Q0UA 2IYWA 1JPJA 3FMOB 3AGQA 4B3CA 1W0KA 4G5SA 4QNRA 4FMBB 4KITB 2IYLD 2VHQA 4PAMA 1G16A 2FU5C 1R0ZA 2OXRA 2FPKA 1E9FA 4LX0A 4P3YA 2JLYA 4ARZA 2ZYVX 5JMTA 3B60A 4PAQA 2CNWA 4MGZR 4KHZA 4ZDJA 2VP6A 4NCKA 2G9NA 1TAGA 1P4SA 1HT1E 2O8EB 3MWLA 4TZ6A 2JJ2A 3FKSA 4TLCA 4O0MA 2XAUA 1GNPA 3DHWC 1V43A 2FG5A 4Z1MD 4D4KA 3KQLA 1GNQA 1NMZA 3LNCA 421PA 5BW8A 2QTFA 3O8BA 4Q48A 1E9SA 1ZCBA 3KDSE 1Z0KA 1YZGA 3F5FA 4RD0A 1P2TA 3ZVNA 1XBTA 5CJPA 3CF2A 3KZ1E 4IOKA 1XTQA 2J7KA 2A3RA 2B6HA 1ZD9A 1G3MA 5CJ2A 4TMZA 4PPFA 1NVWQ 1AN0A 3CLVA 2X77A 1UKZA 2Q9AA 2VYFA 1E2EA 4I81A 1OB2A 3CB4A 3HJNA 3ZJYA 4B33A 1IM2A 1OYYA 1AM4D 1YE8A 1WB9A 2OEPA 4BE7B 2J59A 4ZDIA 2BJWA 3O47A 2GXQA 4HAUA 5EXPA 3VR2A 1PVOA 5ELXA 2C98A 2ZYTX 3WMFA 3AP2A 3K1JA 3U3OA 3K9HA 2EVWX 4BECA 3EIHA 4YQFA 4Q9LA 4ZCMA 2ONJA 1Z29A 1JEDA 2GJKA 4TL7A 1G7CA 4ZCIA 5GVSA 1DAKA 4HAVA 1ZNXA 3CRVA 4TL9A 1GOTA 1E2FA 4OBEA 4Q18A 1KO1A 1N5KA 2P0EA 4ITRC 3DZDA 1G8PA 4I99A 2WWWA 4NZYA 4YC7A 3SYNA 2WOJA 4K8OA 3NH9A 4DIEA 4IEIA 1DS6A 1NL3A 2G6BA 1EG7A 1UBCA 4IW3B 4W5HA 5CYOA 1B0UA 4XH9B 2CXXA 1DAEA 2A9KA 3RSLA 2WHXA 1R7RA 3KL4A 2IWHA 4V0LA 2A2ZA 1WDTA 4F4IA 4V0KA 2GBLA 1US8B 4ON9A 1GVNB 5JWHA 4LBYA 1D2NA 3NWJA 2C95A 3VR5A 1TADA 3CWZA 3PIRA 1Z63A 2IF0A 3U7HB 1HA3A 4A82A 2A5JA 2EYUA 2HXYA 4ZI3A 3W6NA 5KO2A 5KNBA 4O3MA 3QOFA 1T3HA 1Z6AA 1A2BA 1SVMA 3X1YA 1E79D 2GVZC 821PA 2Z0MA 2ZJYA 1N6PA 4R2HA 2BMFA 1ZC4A 2RGNC 1BS1A 3TLXA 1OF1A 1DOAA 4B6EA 3SJAA 3DEFA 2AWOA 4PHTA 2F9MA 3HU1A 2WPDD 3RRMA 4GOKA 4Y0AA 1AKYA 3SBDA 5GADl 3ZD7A 2P2LA 4KV9A 3GEEA 2XX3A 3TQCA 2YWFA 1XEFA 5CB8A 1ODFA 4XSHA 1P2UA 3NIBA 2MSCB 1GWNA 2PZFA 4QG7A 4D4JA 4HYYA 4CT5A 2R6AA 5FPYA 4DB2A 3X1WA 1KNQA 1F60A 1U81A 5BQ5A 2LKCA 3QKTA 3ZIAA 5J4KA 2RGXA 1KMHA 2FFQA 3HU3A 4QGAA 4OI1A 2EQBA 3VHXA 4NYIR 4B75A 2ZSDA 4M1OA 2ORWA 3I92A 4LSGA 3HYRA 1P5ZB 3RSOA 3DMDA 2XZOA 1S8FA 5DI3B 3KJEA 4AYTA 1E9RA 1JBKA 1P2VA 2P3SA 4IDPA 3W9YA 4PTLA 5TARA 1E2NA 4M53A 5EZ5A 4CDGA 4DCSA 4DLTA 2G77B 1ZMXA 2ZRIA 1VMAA 1ZIOA 2BMEA 2D2EA 1IY0A 3GJXC 1SHKA 4LGMA 1G19A 1MO3A 4GZMA 1T8UA 4A2QA 3THWA 3LVRE 3A4MA 3NEYA 3W3AA 2QM8A 4YXWD 3K70D 4AKHA 3RRYA 3IIKA 3UXMA 5EXTA 2ODBA 1DELA 4NYIQ 1G4UR 4OK3A 3KJGA 3P27A 1U2RA 1U9IC 5JI3E 1G1MA 1VG1A 1NVVR 2GF0A 1NP6A 1G6OA 3UANA 3U7FB 1RZ3A 2XB2A 3ADBA 1OIWA 4QHSA 4MA4A 2GXAA 1H8HD 5TB5A 2J1LA 4KSBA 3FOZA 1XTRA 4NHOA 2FN4A 4P31A 2ZJOA 3AVTA 4RZ3A 4MH0R 2CNWD 2ERYA 2VF7A 3LXXA 4LJ7A 4LWZA 3UG7A 1COWD 3UIEA 3W6PA 2P67A 3MJHA 4HLQB 4EQ6B 2BIFA 3W6OA 2JJ2D 3L0OA 1O3YA 2CL0X 2E1RA 3KQHA 5J4YA 1QVAA 3R9IA 1KK2A 1Y63A 3AP1A 1KO4A 1E1RD 2NO6A 2DB3A 1NVVQ 1QHYA 5B64A 4KFRA 5C4MA 1RKBA 1G64A 4E5UA 2WMOB 1BOFA 4HLUC 4LK2A 4AY2A 5FI0B 5JI2E 1AJEA 2DWQA 4EIWA 3K0SA 3BWDD 2VP9A 1YZUA 3IQWA 4UNRA 1UF9A 3W34A 5KNCA 3DKPA 2PLRA 3IDQA 5EXXA 4P0TA 5H70A 3GLFE 2QQEA 2ZSEA 4FWIB 2H1LA 1TUEA 2C9YA 1FUUA 1H8EA 1EFRD 3FHCB 4NONA 3RRNA 4US2R 1ZUHA 1R0YA 2X8AA 3RDPA 2Q0HA 1QRAA 4GZLA 3CNOA 4QHTA 1GILA 4HDOB 2BV3A 2ZJ5A 4MRNA 4A9AA 5ANRB 5L3SB 4QM7A 2XITA 4TTQA 1XXHA 1G3UA 2PT5A 4DLZA 3E1SA 1M7HA 4PR0A 3T1VA 2ZS9A 1C4OA 2V54A 2RGNA 3HWSA 3QBVA 1KTVA 1G4AE 5FUWA 4G3XA 3THYA 1Q3HA 1E2HA 2MSDB 3TH5A 1RE0A 1ZM2A 1RC8A 2FNAA 4KBGA 3A1TA 2FFBA 2HXSA 2PL3A 3EWSA 4NCNA 5EP1A 3SI7A 2ZITA 4RD4A 1XCMA 4K81B 4D0LB 2DWOA 4O25A 1DPFA 3A8TA 1DAGA 1J70A 5EP2A 4B73A 1X86B 5CYPA 4R7ZA 1E0AA 4M1MA 3IPXA 4ZDWA 2JIZA 4HB4A 1OFHA 1MO4A 2QGNA 3EWAA 5FTMA 1KI4A 1L7VC 1XXHB 2YVUA 3HU2A 4HDQB 1JNYA 1NMXA 4NYJR 2MSEB 2PMDA 1R10A 4JSTA 5GJCA 4AURA 1DAFA 5BYJA 4PHHA 1N6OA 2PX3A 2C77A 1NN1A 3THYB 1OKKD 3UMFA 5HE9A 4DT1A 3QPUA 2OCPA 2QUZA 1JXMA 4B76A 1L8QA 5JCPA 5LDDC 1M7GA 4C0JA 4BPBA 4BFVA 1EFTA 2J7PA 3LRPA 1SKQA 2I3BA 3BERA 3OE7A 3ADDA 2ZUCA 3K9LA 3KKOA 3U6KA 2W2XA 5AUPB 4DSUA 2QNRA 3H4MA 4NYJQ 1MR3F 1E96A 3AVQA 5KSPA 1YVDA 3R9WA 2BDTA 1EWQA 2WJJA 4GMDA 4QGGA 1P3JA 2YC2C 3PXGA 1T8TA 1F5NA 2HDNB 4NYMQ 1TNDA 2NZJA 4ESVA 1VIYA 1YZLA 3NTUA 3TSOA 3ADCA 2ZM5A 5F9HA 4DT1B 4F7WA 4DCNA 5TV2A 3T35A 4HAWA 4PC6A 3WP0A 3CF0A 1ZD1A 2F55A 2YHSA 2OBMA 1NKTA 2J45A 5CM9C 2QTHA 3SEAA 2Q9BA 3EA5A 4B48A 3N5CA 4NBSA 3OIVA 2C78A 4ZCLA 1UDWA 3MLEA 2QN6A 5FL7A 3HDTA 5FOXA 1SXJD 2Z5FA 3C5CA 3VX3A 1W46A 1N0WA 4HLUA 1G8HA 4UJ5A 1WP9A 1XMJA 2ZPTX 3W8RA 5E7IA 2FZ4A 2JLZA 2NO9A 1UEIA 2YINC 4OHZA 3I32A 2WSSA 5DIFA 3VFDA 3I73A 5JHHB 5FI1B 5IRCD 5FTLA 1OH5A 2ZETA 4GOXA 3Q8XB 3GD7A 3CBQA 1CR4A 1W0JA 1XB2A 4C0LA 2OBLA 4WXRA 4URVR 4AI6A 1E2KA 1K5GA 2ZRKA 4BFTA 4JBXA 1NMYA 1Z3IX 2R44A 2QPTA 1VYUA 3TRFA 2N42A 2GDJA 4GNKA 1P9RA 5EP4A 4CRWB 1GKUB 4RFSA 4V0ME 4TMTA 3KQUA 1Q20A 5E4FA 3WHKA 3TNFA 5DYIA 5FR2A 1XPOA 5FPKA 3MWKA 2RAPA 3ZGXA 4A8JC 1HQYE 3A36A 1CLUA 1G7TA 1NKSA 2GKSA 5FL3A 1NBMA 2B92A 1OV4A 1R5BA 4JBWA 4FCWA 1CKEA 2R9VA 2VL7A 2WTUA 4NL4H 1HY3A 1CJKC 1H8ED 3B1WA 1Z6TA 2PLFA 1Z8FA 5EQTA 3L0SA 2MMCA 4URXR 1TQ4A 5FTJA 4ZKEA 4CF7A 3I62A 4IOLA 2ZRFA 2WJVA 2ZJZA 4DSOA 3EAQA 2G88A 3ZZ0A 1IN8A 4I4LA 3HR7A 3TVDA 1G291 1A2KC 4RFSB 4X8LA 4PC7A 2DR3A 1OXXK 1GKYA 2O0KA 2IUUA 1P61B 4ZIRA 1R6BX 2GNOA 4CEJA 1HQCA 4ABYA 3H0KA 3L8YA 3I5XA 3U4QA 2VQSA 4LC1A 2VHTA 3RWMB 2DPXA 2WM9B 3NC0C 5BN3A 3BXZA 1U8YA 3IKJA 5JZVA 3PV0A 2UKDA 4RD6A 3M4YA 1HV8A 3WYAA 3W90A 2X2EA 2XJ4A 2ZRMA 2V4ZA 3QXCA 2XZLA 1X8JA 2XTMA 3CM0A 2FPMA 3Q7QA 3E2IA 1TMKA 1WRBA 2FFHA 2QAJA 3NHBA 4PZLA 5FUVA 3ZDQA 5K8LA 1S4QA 4F93B 3DOEA 1RRFA 5KDOA 1I4TD 4IXNA 2IYYA 2GCNA 2OILA 4D80A 2W6JA 4PSVA 3ND9A 3C4JA 1SVOA 3PEWA 4B74A 4FN5A 1KI8A 3EC1A 3CRMA 3AKEA 4CEJB 1RYHA 4DCTA 3U4QB 1KJWA 3QG5A 2IS1A 2JJ1D 3U7EB 1YZTA 4WAUA 4BLSA 4BQSA 3ICEA 4BLRA 2AD5A 1Q44A 2D4HA 2PEYA 2QMEA 3BH0A 3WNDA 4IVRA 4EPVA 2OESA 2K5UA 1KDTA 1CP2A 3U3MA 2ZI7A 1W36D 5FTKA 2OM2A 5J5CA 1HUQA 3OE7D 1T3LA 3ZLJA 1X1SA 3QXSA 4OHXA 1QHIA 3VR1A 3U61B 1G41A 2LKDA 5DO9A 3FMIA 1KO8A 3FKQA 3Q9LA 2YWGA 3HPQA 4B3DA 2WVJA 1G5PA 1KKLA 3M1IA 5A4JA 1J7KA 3TUIC 4JL5A 4AKGA 2O8BA 4LI0A 2QRZA 3AF1A 4MKGA 1TEVA 2HT1A 1CRPA 3IIJA 2P6NA 2O8CA 2H57A 2R6GA 4M22A 5DYGA 3KXKA 4DSTA 5EJEA 4EDHA 2IUSA 4M1SA 4PQRA 2ATVA 1XMIA 2OFXA 3NG1A 4PO8A 3RWOA 1E2IA 2BEKA 3B85A 4Q4AA 4A6XA 2FFAA 2NO1A 5FOSA 5FL7D 3GJ6A 2ZQ5A 3C41J 1IY2A 3JZMA 3KJHA 1IN7A 5FPHA 2A30A 4QHYA 1WXQA 1X1RA 2HJVA 4B47A 2DCUA 2GEVA 4KCGA 3HP1A 3RLFA 5K8TA 1MOZA 3TR5A 3U2QA 3VQTA 3FVQA 4XSGA 2DFKB 4HAXA 4A8JA 2IYQA 1Z0IA 2WSSD 4TQUS 1OH7A 1K8RA 2O8BB 2ASEA 3MMPA 4PPNA 2ERXA 2O8CB 3VMFA 4FMDF 2G3YA 5DHAA 1W0JD 2J87A 4JLVA 4WIAA 3D6TB 3UMRA 2VRWA 4NH0A 5EXSA 2GEUA 1SQ5A 3A4LA 5K8UA 2QBYA 4Q4AB 4KFSA 2DBYA 1UM8A 2KB0A 3AGPA 4LV6A 2QMOA 1IOZA 4XIGS 3GLHE 1N6NA 3GJ7A 4Q03A 4XWOA 2EFDB 5JEEA 4OJKA 4A8JB 2D3WA 1FTNA 1VCIA 2GWHA 5EUQB 3LW7A 4JLPA 3GJ3A 3ZS8A 1AS3A 3BIFA 4RZUA 3THXA 5GVRA 4YMVA 1VKJA 4M9QA 3ONWA 4PPGA 4HB2A 5G41A 4HZUB 4AKEA 4IHQA 4G0NA 4L9WA 3FFBA 4OHWA 3B1VA 4TLAA 5FOWA 2QBYB 4V0MA 4JLMA 3CKLA 1KI6A 3EPLA 4DLWA 3PJRA 1GL7A 2NO7A 3FYHA 3R8CA 4AWXA 3T61A 5H8WA 2BOVA 1IQPA 1N25A 1D9ZA 3B82A 4B32A 2GEDA 3PG5A 5CLQA 1HTWA 1E9AA 3NC1C 1G9XA 2P5SA 2OAP1 4C4PA 2EFCB 3I3SR 3THXB 4NPHA 3NBFA 2IYRA 1Z6YA 2XTZA 3GJ0A 4YMWA 4G5OA 1YZQA 3DOFA 1UADA 1AZSC 3Q85A 1NJGA 1DARA 3GFTA 2HLDA 4TQ9A 1KI6B 5A5GA 4TYPA 4TTRA 1IN4A 1J8YF 4C0QC 4PQYA 4N0EA 4RSGA 1XCPA 1XMVA 3VR3A 1SXJE 2WIBA 4W5JA 3IILA 5EE1A 5JWRA 1XEWY 3EARA 3M0EA 1W4AA 3MD0A 2AFIE 1VCOA 2ZJBA 4OHYA 3NH6A 3QEJA 2ZJAA 3KFXA 5L3RA 2CJWA 1OXVA 3VR4A 4C3ZA 1VECA 5DE3A 1JQJC 2BMDA 2VSXA 4B71A 1L4YA 3MAAC 5JJLA 4GBMA 1CULC 2IS4A 5E3HA 2V55B 1YR9A 1M8PA 3GLIE 4LHVA 5SZIA 1G6HA 1E2JA 4A0HA 1B23P 1SVLA 2KWIA 2ZU6A 4F4CA 2EWVA 2NZ8A 3E5HA 2VBCA 4LJ6A 1G7RA 4FINA 4Q1FA 1JR3D 1DO2A 4YONB 1VYTA 4FMCF 4HDCA 4YMSA 5JECA 3V9PA 2XNDA 4PANA 3GP8A 5E95A 2FH5B 3P26A 2CJWB 2F43A 2IBMA 2VHCA 5KDDA 2WKRA 3B13B 5P21A 2CBZA 4DBLC 3AUXA 2GJSA 3K09C 3I8XA 1XMSA 1U99A 1US8A 1IXZA 1TF2A 2DFTA 2FGJA 2RGBA 4M1YA 5KSZA 1FP6A 3I61A 3OIUA 1E2PA 4LUCA 5HKKA 2BWJA 3I8SA 4B3FX 3PUVA 3AVOA 5LB2A 3ZQ6A 3T1QA 1JXOA 2YNMA 1U0JA 2G83A 3OAAA 3PFIA 2CCKA 2HT6A 4IRUB 4JJKA 4LOAA 5JWOA 4ERNA 3UATA 2EFEB 4W7SA 4RD2A 4DLRA 1ZNYA 2PEZA 5KPJA 2WV9A 3HYTA 3ZZUA 3F0TA 4YMUA 2NIPA 4L15A 2B8WA 2F43B 2JLWA 4A2PA 1XTKA 3CZPA 3REFA 1G8FA 5TDHA 2NG1A 3LQQA 3QKUA 3QXHA 4DCVA 4B3BA 2XOKA 3AVWA 4X8HA 3OIYA 4BFUA 2CDNA 3KKPA 3IO3A 3LBNA 1J2JA 5HTKA 3EC2A 1W1WA 4IKEA 1BO6A 2Z83A 1IONA 1WMSA 4LBVA 4UNPA 4LJ8A 4Q19A 1XPUA 4V0OA 4HAYA 1ZCAA 2D74A 1E9DA 3TIFA 3W8NA 1NNEA 1PZNA 4WOPA 2QP9X 2W2TA 4LDJA 3NDPA 1Z2AA 3L43A 4UXIA 5C2JB 4DB4A 1LF0A 3DDCA 3L8ZA 5F98A 1KSGA 1W4BA 3IHWA 1MV5A 3X1ZA 2PMKA 3DO6A 4CW7A 1TU3A 3CIOA 2QE7D 3TVTA 5G3YA 2V7QA 3I4LA 1W5SA 5DI3A 1WQ1R 1TU4A 1GP2A 1DG3A 1ZM9A 1VTKA 4TN1A 1L2TA 3C7KA 1QVRA 3K0FA 2RHDA 2FMXA 4C0AC 1FTSA 4IVPA 4AYWA 1JQLB 1D6JA 5JJIA 1RJ9A 1KDOA 4JLJA 1LFDB 1XRJA 3GLHA 5JRJA 1GRQA 1R0WA 4TT3A 2QSZA 1EWRA 3DMNA 2KI5A 1NY5A 1T9HA 4KLZA 2EYQA 721PA 1Z2CA 4NKRA 4D82A 2QMUA 1S3GA 1LB1B 2AX4A 3GQBA 1NSTA 3KUDA 2QT1A 4OJQA 4M21A 4WVFA 3GPLA 2IEZA 3PEUA 1KAGA 1UBGA 3RABA 2J41A 2REOA 3DKVA 1P7CA 4FMCB 1ONBA 2JLQA 3S1AA 2XSZD 3H86A 2CLSA 1BYUA 2VA8A 4LBWA 3K0FB 5GJWC 3THOA 4IEEA 4KAXA 2F1JA 1FL9A 3AV0B 4EQ6A 4BZXA 3KB2A 1YQTA 1RJ9B 2HUPA 4QJ5A 4MRSA 1GNRA 3GLHB 4L4UA 3PUZA 4PC3A 3UWOA 4KFTA 1M6NA 1N0UA 2YV5A 3B9PA 3U3JA 2VLIA 2SHKA 2OLJA 3E70C 5AJWA 2BHRA 2KBFA 4LYJA 4LHXA 3BE4A 4NTZA 1W0KD 4FCTA 3P4XA 4Q66C 3IEVA 3MWJA 3QVUA 2CL6X 1G8GA 4KVGA 3K53A 2J5XA 3P20A 4JKIA 2F1RA 4MKFA 2ZSFA 4J0QA 4DC9A 1KHTA 3QF7A 3K09A 3S1AB 4QXAA 3SQXA 2RGAA 1WE2A 2UZ3A 3QSYA 5FBLB 3QENA 3ECCA 4TMXA 1NRJB 3UK6A 2P5TB 1DADA 4GP6A 5SZHB 1UKYA 3FKSD 1L4UA 4TL6A 2W2VA 4UXHA 5F2EA 4G01B 4KI0A 5AJYA 2Z43A 3LQRA 4TQAA 3CX8A 4Q4HA 3TUZC 5HCIA 4FXPA 5KPDA 5L3SA 1SVKA 4IXMA 1W48A 3P1JA 4TLDA 4ILEA 4BASA 2VHUA 3G82C 2KE5A 1QHNA 2G1KA 2C2HA 1P75A 2A7QA 2B8TA 4WW0A 4M1WA 2GAOA 3SNHA 4D6PA 4OI4A 3RS4A 2J0VA 3X1XA 2WWYA 2P6RA 3IGFA 2IL1A 2GK6A 4JT4A 2ODEA 4DXAA 4BFZA 4OQMA 2BM0A 3SR0A 2OE2A 2V1UA 5HKKD 1TQ6A 1UEJA 3BB3A 4JL8A 1E2GA 4E09A 4QOSA 4Q1DA 1TX4B 1W49A 3Q5EA 1EFHA 4CGZA 1XJ0A 3EX7C 4Q4HB 3A1SA 4BLOA 3OAAD 3R7WB 4N3NA 4FIDA 4G5QA 3RC8A 1ZNZA 1Z5ZA 4DZZA 3EXAA 5KSOA 1G18A 1Q12A 1Q22A 4RZXA 5EUMA 4KSCA 1XEXA 2YOGA 2IWRA 1ZVQA 1KKMA 3PVSA 4HLDA 4Q7KA 2D06A 5EP3A 4HATA 1VCMA 3AKDA 3GLIB 3SDZA 4Q21A 4EPRA 2GCPA 2ZS8A 2GZAA 1N0VC 4URUR 3LFUA 2DWPA 2C9CA 2QT0A 2G0NA 3SFVA 1E94E 1UAAA 5JFGA 1S2MA 1NN3A 3BH6A 4Q9HA 4Q9KA 3OZXA 1DTSA 1W4CA 2ZANA 4Z8YA 4CYMA 3RANA 3V4FA 1W4RA 5SZJA 5AWFC 1JAHA 4CVNA 2FSHA 3KB1A 4P4UA 4R2IA 3AVVA 3IBGA 3EZFA 2WICA 1UDXA 2R2AA 3CPEA 5GJBA 1XEXB 4KJZA 5CIWA 5LPNA 4IDHA 3A6PC 2QPAA 2PBRA 1XX6A 4Q1AA 3LD9A 2R62A 1IN6A 2FDCA 3SC3A 1Q1ZA 1NSFA 2WAYA 1N5JA 4RZ2A 1E2DA 4W5WA 2JDIA 2OG2A 3FB4A 2OZEA 4HLCA 4NYMR 1CS4C 2V6IA 3TBKA 3VTKA 4B34A 2CE7A 2GAAA 3T1TA 5FBQB 2GZHA 2IHYA 3BJIC 3QBTA 1A5TA 1DG1G 4URWR 2WMNB 3K0AA 5CDFE 3B8HA 4MGIR 3ZZTA 1JR3E 1Z06A 1Q1QA 1E32A 2EFGA 3ZIAD 1U9IA 4MRPA 4TLEA 2YOFA 5J4LA 1WF3A 2FSIA 5DI9A 1KI1A 3WYFA 5KYKA 1XTJA 2ZI6A 4UNQA 1OJLA 2Z6VA 5DHFA 5E7JA 2OHFA 2V1XA 5IDVA 1CJVC 5BXQC 3PEYA 1JALA 2QU8A 1IN5A 3OHMA 4H9GA 5CLLA 1YRAA 4XJXA 121PA 4ZI2A 2QSYA 2GILA 3LWNA 2NO0A 4MGYR 1II9A 4TTPA 3Q3JB 4AG6A 1PLLA 5FUXA 3AM1A 4QGFA 1N3BA 2FJUA 4AD8A 3K0AB 1GZSA 2GETA 2Q3FA 2XJ9A 2ZEJA 1RRCA 4NCIA 3OFNA 2OCBA 3LXRA 1R4AA 3CONA 4B43A 2ZJ2A 4DJTA 2BM1A 3C16C 3ZS9A 4A1FA 2BCGY 2C8VA 4ZV4A 1KK0A 2IW3A 1JJVA 1GAJA 3TR0A 3WNCA 4Y0VA 3EPJA 1YZNA 3MUFA 3TSWA 3GJ4A 3CR8A 4URYR 3FTQA 2UVQA 4Q01A 1ANKA 3C8UA 3FHTA 3QXJA 4BEBA 5B58C 2C03A 2C9OA 1NG9A 1FQKA 1BKDR 1EGAA 3V4RA 4JL6A 3T06B 4C9BA 4MYHA 5L3QA 1JPNA 3WRYC 3NXSA 1JEEA 4QFMA 3ZVRA 1HURA 2VP5A 1FX0A 3RS0A 2ZRDA 4LHYA 2CL7X 1HH4A 3JVVA 3OEEA 1SZPA 1OIVA 4XWKA 2IHBA 4D4MA 3BFKA 3CF6R 2X1VA 4WZBE 3LX5A 3WBJA 3BRWD 2R6CA 1WBBA 1FPMA 3KTAA 4EKDA 1GRRA 3CRRA 3FGNA 2P65A 2ZR7A 3VKWA 4Q9JA 3CO5A 4NCJA 3DZ8A 4JSYA 3RYTC 3AVXA 3GEIA 3SYKA 1FZQA 2W83A 4HI0E 4ZDKA 3AKCA 2XTNA 4WZ6A 2NPIA 2RH5A 4BZPA 4RCYA 3ZH9B 4AYXA 3GFPA 5JSZB 4DRZA 2OAQ1 5FFMA 1O87A 3OF5A 5L3QB 3TW4A 2QY9A 3VR6A 3MWYW 4ASUA 2QRNA 3EA0A 3RAPR 2VTKA 4KYUA 1FX0B 1KJYA 3NDBB 1YKSA 1PUJA 4RKFA 5M04A 2JEOA 1D2MA 4QJ4A 2F3RA 1X8KA 2YYZA 4MQBA 5A0FA 3CRW1 4BWYA 1E3MA 1DE0A 3GLFA 2IA5A 1Q1BA 4EJSC 3U44B 3KX2A 4D25A 1BMFA 1WCV1 2J9RA 3CRQA 3KTAB 3U60B 4OI2A 2DYKA 1ZUIA 5EE9A 1CEEA 521PA 2LCFA 4D2IA 3WY9A 3LY5A 2QP4A 2AN9A 4IOMA 4ZKDA 4LPSA 1ZU4A 3CNNA 4X8MA 1ELOA 4CIDA 2Q3HA 2ZROA 2WBLC 3VKHA 2GESA 3TGPA 4A92A 2JJ8A 2JIZD 1OXUA 4B2PA 4LJ9A 4IOJA 5IK2A 4NDZA 4ACBA 2N46A 2KJQA 4C7OA 3R8FA 3TUJC 4TL8A 3LBHA 3GLFB 1F48A 2Z4RA 1PLKA 2A5GA 3GCGA 3C5HA 2HYIC 4M8NE 1OH8A 2FV8A 3AF4A 1Q57A 4O2LA 1AGPA 2BEJA 4YDSA 4E22A 4OI0A 2WJYA 4D0GA 3LVQE 1W7AA 4D81A 4XVQA 2JDID 2CE2X 4BZQA 3LH5A 2JLSA 4NE2A 1IAQA 1FP7A 4OK5A 3OESA 4M1TA 5L8VA 1ZW6A 1VHLA 2FPLA 2J7PD 3TAHA 1KO7A 5CK4A 4GI7A 4FD2A 3A1VA 3L0PA 4PO1A 1A82A 1FNMA 2W6IA 3ASZA 2ATXA 3LLMA 4OYHA 5G3ZA 2H17A 4AG5A 1WBDA 3WBKA 4CT4B 1OYWA 1G5RA 2ZI4A 1F6BA 3DVLA 3BD9A 4QJ3A 1VIAA 4GOJA 2ORVA 1VYVA 5IF9A 4C7OB 3EASA 1KSHA 3SHWA 1Z0AA 4GMXA 5IHPA 2YJTD 4DDUA 4IDQA 1E9CA 1VHTA 3EG5A 2GJAA 1IXRC 1FNNA 3QF4A 2AXNA 3PITA 1J99A 4EFMA 1XZQA 1IJFA 2RGCA 4CZ2A 1OXSC 3VNUA 5C1BA 5IT5A 3IIMA 2D62A 3JZAA 2AWNA 4EFNA 2QEQA 1S1MA 2CMKA 3Q5DA 1TQ2A 3K70C 4B3GA 1K5DA 3SHFA 4TWZA 2C5LA 3OEHA 4BRUA 4D0NA 1N5IA 1F2UA 8OHMA 1XF9A 2BBSA 2ZIAA 4V0NA 2OO7A 2XZPA 2WWFA 1AS0A 3FPAA 3D7MA 1D9XA 1CBUA 5B2ZA 5FH9A 3SQWA 4S35A 6Q21A 4R71A 4L5BA 4GPTA 3QF4B 3ICQB 1AQYA 3LW8A 4DKXA 1GIAA 4E03A 4YDHB 5CIQA 3I5YA 5AUNB 1CJMA 2R65A 2J0QA 1S3SA 4RJLA 4POAA 2PH1A 5DISB 1HE1C 4HZUA 4PAOA 2IXEA 1F2UB 1QF9A 1CRQA 2IK8A 2QP3A 1RYFA 2WKQA 3CR7A 3EZ9A 4GL2A 1ZIPA 2R6FA 3C14C 1PLJA 3A4NA 4HSEA 4TZ0A 4JIMA 4PC2A 1ZC3A 2GJ8A 4EUNA 3U5ZB 3AP3A 3A1WA 3DM9B 1BYIA 1NBMD 2ZYUX 1I2DA 4NP6A 4EJSA 5FPSA 2EWWA 3TKLA 2E87A 2W58A 2RCNA 2YOHA 3B2EA 3NVAA 2OT3B 3PR1A 1OFIA 5EE0A 5LBIA 1RPZA 1TUIA 2VH5R 2GCOA 3UWKA 1KIMA 4FCVA 5F9FA 3BC1A 2YC4C 1EX7A 3B9QA 1XFAA 1YU9A 4R9UC 2YWEA 1Z07A 4DLUA 2BJVA 4I1OA 5TY0A 1EFCA 5J40A 1KI3A 3B7GA 4BLQA 4Q1EA 2GF9A 1GFIA 2V8OA 1QZXA 4GFDA 4U02A 2I1VB 4ZPXA 3T5GA 1R8SA 1QG2A 1LW7A 5FPTA 4WA7A 1KDPA 1RRGA 1ZJ6A 1ZNWA 2HJGA 2FEOA 3X1DA 3IUYA 3K8YA 4EJSB 2WPDA 4DDWA 2F9LA 3BAFA 4LJ5A 4OHVA 3PEVA 2RB4A 2X19A 2IF2A 2Q9CA 3VKGA 2GCOB 1DAIA 4S2EA 4BFWA 5FBVB 2VF8A 4UXJA 3SU8A 3R20A 1XP8A 3QKSB 4QRHA 2ZREA 4D26A 1T0JB 3AKYA 5KTYA 4LPKA 2V3CC 2NTYC 4MRVA 1DO0A 1NVUQ 1T6NA 2IS2A 3F3YA 3NBYC 4OK6A 4ZO4A 2W0MA 5EE5B 4DSNA 1NN0A 2F6RA 1SVWA 1ZD8A 2W6JD 4XVUA 4MYCA 5CK5A 1Z22A 1MKYA 2A5YB 4A4DA 2IYTA 1FMJA 3B5JA 2JLUA 4QC2A 5K8IA 4DUGA 2REXB 4MRRA 4C0HA 3CZQA 1I4LD 3D3QA 4NCHA 1X8LA 4HZIA 2VPPA 1CJUC 2C96A 4KO8A 4YXWA 2NPFA 2XXAA 3ZYCA 1G21E 3TE6A 4A2WA 1XTSA 4QBIA 4OKSA 2BBTA 2RGGA 4Z51A 4FMDB 2O8DA 4QL3A 4GT1A 1QBKC 4L9SA 4RVCA 3RRZA 1EFUA 2AK3A 3F8TA 2XB4A 2QTVB 2PT7A 3BORA 1A1VA 1H8HA 2ZVPX 5KOYA 3EZ6A 1MH1A 1Z47A 2WKPA 4KBFA 3CH4B 3MRSA 4B2IA 2C04A 2ODWA 4C2TA 2XGJA 1COWA 5DGXA 4C0KA 2NOAA 1UKEA 1MABA 1KZ7B 1KY2A 1NVXQ 1U8ZA 3SJCA 2BC9A 1Z28A 3UPUA 2CHQA 2W0SA 4XVRA 4A0RA 3K70B 3ZVLA 1QHSA 2XXAB 1U0HC 2DFNA 1E1RA 3OEHD 1C9KA 4XWAA 1AIPA 2J0UA 1G3IA 2ZRJA 1SXJC 2O8DB 3SBEA 5HPYB 2OUKA 2OV2A 4RCZA 2GXUA 4UNSA 2HCBA 5KSYA 2EU8A 1XXHE 3W5IA 2IX3A 2BKUA 2IYSA 2HEIA 2IS6A 4M0LA 2VP4A 4X8OA 2JAQA 2O0JA 4LJAA 4ARZB 4PQFA 1WA5A 4EPXA 3AB3A 2VHJA 1XPRA 1EFRA 4K46A 5AJXA 1MABB 1P9WA 2FF7A 1P2SA 4JYCA 4UNNA 5KUTA 2ZVQX 4YMTA 4Q1BA 5HCNA 1DAHA 3GEHA 5EZ6B 4I1UA 4TYWA 3QI2A 1D5CA 2J0UB 1FW6A 2ONKA 3QKRA 2OCYC 2R6DA 4IJMA 2CVFA 4MKIA 1VG8A 4QBFA 1XTIA 1YR8A 2QL6A 4M2LA 1JAIA 2OXCA 1IBRA 3ASYA 4KLNA 4LRWA 4LZZA 3G0HA 4A0FA 1U8AA 3QY0A 2TMKA 4PC1A 5FOTA 4DLXA 1U94A 1AZTA 3IEUA 4G5GA 2H8KA 4JZKA 4PX9A 2Z4SA 2O8FA 1E2LA 1Z0DA 2F3TA 2GZDA 2PZEA 2AKYA 2XEXA 1CR1A 3LA6A 3MGCA 4B3XA 3QPWA 2BCJQ 1KY3A 1KI7A 4BEJA 1SVSA 1AS2A 1NG1A 4JLBA 3VU9A 1Z0FA 1UKVY 2EW1A 3PUXA 3T1OA 3VNVA 1JI0A 1X3SA 4GP7A 4QGHA 5JS7A 3K9NA 2NGRA 1GKIA 1E6CA 1CJTC 2WWIA 2VP0A 1N6HA 3QE0A 4Q1CA 3ETLA 4XD7A 3SJZA 5JEDA 2J46A 3QKRB 3WP1B 4AK9A 2QA5A 1OE0A 1G17A 1N6RA 2ZJ8A 1TF7A 2G0TA 1KAOA 2O8FB 1OKKA 1PJRA 4JVLA 4JBYA 3LDAA 2HF8A 3PCRB 3U3RA 1OXTA 1T0HB 2QZ4A 2A5FA 3BFVA 1QDEA 2CVHA 4JT2A 4Q7LA 2D7CA 3IQXA 3KFVA 3N2EA 4G5RA 5C4GB 2FE4A 3VU9B 2WSMA 2HYDA 4LY6A 4AC9A 2CCJA 2HLDD 3A1UA 5CB6A 4US1R 3BK7A 1IY1A 2A78A 2QPOA 3HPRA 4QBGB 3W3ZB 1DEKA 1LTQA 1NI3A 2OFWA 3G5UA 3RS3A 4B6FA 4PSKA 5B30A 2ZS7A 4DEXA 4KFUA 2AR7A 4I1SA 621PA 1AQUA 4MDEA 1RVDA 2BKEA 2DHRA 4CEIA 2GRJA 4PXAA 3SYLA 1EK0A 2ANBA 4WZAE 1S1CA 1U90A 1KSJA 3BFXA 4DUGD 4O2RA 3EPKA 2V9PA 5H1YA 1W36C 3AVYA 3EW9A 1A4RA 1E4YA 1ESMA 1KJZA 1KSFX 4LV5B 4P33A 5KU1A 1G7SA 1YR6A 2OCAA 4R98A 2HCJB 3JVUA 1SGWA 3FWYA 1ZM3A 4GSYA 4Z8XA 2QMHA 1SXJA 1ZM4A 5C18A 1E0KA 1LS1A 1P60A 1NIPA 2PJZA 4DWJA 3AVUA 2GXSA 2IYVA 1KMHB 3IHLA 4JLKA 2CLCX 2FEMA 1G8YA 2Y8EA 2FZLA 5KHOC 3R7WA 2CLDX 1FUKA 2MMGA 1N2CE 4TYNA 1HYQA 1T91A 1E69A 3RC3A 4DEYA 4CEIB 3SN6A 1P9NA 4M9SA 1T3SA 4RFVA 2QROA 1DVRA 3WXMA 2QQ0A 2ZI5A 2XNDD 5FOVA 1XZPA 3B6EA 4PHGA 1NBME 1MO5A 1XD2A 1XJCA 5BWMA 4BUJA 3C15C 3O8CA 5KNDA 3GLIA 4URZR 2JGNA 4WBSA 5LD2C 3QUSA 3PENA 5TXGA 1G5TA 3THWB 3N70A 3OIWA 2IXGA 3B78A 1TF5A 1KK1A 2AXPA 2ORIA 3SS8A 1GL6A 4RKEA 1ZRHA 1Z6XA 2O52A 1SXJB 2OBNA 4M9ZA 4EAQA 4UQOA 3L82B 1E0JA 4PO9A 5JCZA 1TTTA 3X2SA 3O8DA 4N0DA 2WWXA 1CXZA 3KKMA 3AQ4A 3J81k 1Z0JA 2CHGA 3TK1A 1GM5A 3UMSA 2J3EA 1XD2B 1NLFA 3GLGE 2IYXA 4OQXA 5JJKA 4C0SA 1AA9A 1II0A 1E0SA 2EFHB 3IO5A 3CWQA 2Q21A 2XOKD 2Q3MA 3SOPA 1P6XA 1XD9A 4IDOA 3T34A 2PZGA 3RHFA 1M34E 1UPTA 3AH8A 5HE8A 2W00A 4BFXA 4DLVA 1PUIA 1NLZA 2D2FA 3D31A 3NBXX 1J90A 4U5XA 3B1YA 3LV8A 2ZE5A 1YHNA 3CNLA 5D3MA 5CITA 1SKYE 2GHIA 2QENA 1NF3A 2P6UA 1ZAKA 4XTRA 1FFHA 2O0HA 4RY2A 4Q9IA 3NEJA 2V7QD 2GA8A 5TMPA 4V02A 1IJEA 1EX6A 5HR5A 2H5EA 2O5VA 3FMFA 4OQFA 3ZVMA 3P32A 2BVNA 1C1YA 2IYZA 4XD7D 4A0GA 2F1IA 2ZRNA 2OLKA 3BGWA 2CK3A 3MJRA 3PQCA 4PZZA 4EPWA 2WWGA 2F1HA 1D2EA 2ECKA 2QORA 4JKYA 1I4DD 5AR1A 2WJGA 4KODA 2WIAA 1ETUA 4IFEA 4TT3D 1KGDA 1KNXA 5AJVB 3TMKA 1YJ5A 2ZRHA 4P4SA 4JVSB 2ZRLA 2QAGC 5D3MB 2JJ1A 1XU4A 3V00A 2HF9A 5JRZA 5KDLA 4D4LA 3KXLA 3RS7A 2QI9C 1ZYUA 3PUWA 1N6LA 1G3RA 2QM7A 3AF2A 4C2UA 2AK2A 3ND8A 1CTQA 3BOSA 4HUQA 1CF4A 3FE2A 2BMJA 4MYUA 2CCGA 1CR2A 3P4YA 5DN6A 2VIIA 4UKDA 2ZAMA 1GG2A 4QNMA 2ZE8A 2GK7A 3LBIA 4KYIB 1Z08A 4DVGA 3N2IA 2B7BA 2RGDA 1KDRA 1KO5A 3VAAA 4LYHA 5UKDA 4EPTA 1LV7A 2D7DA 2IT1A 1CIPA 2F7SA 1OLOA 5F3WB 3DPUA 3AVPA 3BBPA 5FBWB 5AUQA 2BBWA 3QNUA 1QHXA 4GRAA 4V03A 5SZKB 2PJRA 4QM6A 1LS6A 3MG9A 3TJZA 2RMKA 4P4SB 4Q5IA 1IHUA 4F92B 5JLJA 1NN5A 1ZBDA 4BLPA 1OFUX 3BB4A 2FA9A 2JLRA 2WJHA 1HT2E 1XWIA 3MFYA 4HUQB 4LV8B 4Q4JA 1R5NA 4JMPA 1EXMA 1HE8B 2JCSA 1OT3A 3FHOA 4YLGA 3UKDA 4MDFA 2ZR9A 1Q3TA 1SHZA 1W36B 5AJZA 3CPJB 1XDBA 4OL0A 4B44A 1ZINA 5LB4A 4QKQA 4NU0A 1ZU5A 1OPXA 1MO6A 4LHWA 2WZQA 3EZ7A 1JJ7A 5DLQC 3WNBA 2YKGA 4PFSA 1E9EA 1U98A 1KK3A 2DY1A 3EZ2A 5J4HA 3ZQJA 1TPZA 1VPLA 5JSZA 3B1XA 1R5OA 4DLYA 4BFSA 4M9XA 2NQ2C 1SVIA 1D8TA 3H1TA 4JVMA 2ZYWX 1F2TA 3CUEF 1V5WA 5JHGB 1NLYA 2R8RA 2AHOA 4HB0A 2RHMA 2WAXA 1JR6A 1BH2A 4TMVA 4DLSA 2A5DA 5J47A 1H65A 4F4JA 4Q4JB 4FWTA 2AFHE 3U44A 1W47A 3K0EA 4M1KA 5C46F 3QPVA 2B7CA 4LYFA 221PA 3SZRA 5LD2B 3K0CC 3IBYA 3BH7A 4FI3C 2ZUDA 5FTNA 4L8GA 3VHLB 4IDNA 4IVQA 1M7BA 1GRNA 4L16A 1TL7C 1CR0A 1RRPA 2ZAOA 4II7A 4TYQA 1ZP6A 1NIJA 1S96A 4TMWA 3T5DA 3CH5A 3NHAA 4UJ3A 1QHGA 3U7GA 1P73A 1UBFA 2PX0A 1F2TB 3EIEA 2KBEA 1FMLA 3RVBA 5AUOB 2ODNA 5HZKA 4W9MC 2RGEA 1LY1A 4EPYA 4KU4A 1YR7A 1T5LA 2OSBA 1X6VA 1VG0B 1HEIA 4TSFA 1ESNA 3QVVA 3O8RA 1AGRA 2L0XA 4F91B 2IUTA 4TYYA 2H16A 1KYIA 1BIFA 2B21A
chains in the Genus database with same CATH superfamily
3HLFA 3ROZA 1J0XO 1QVWA 1G2PA 4JLUA 3KKQA 3RNLA 4DA7A 4EGCB 1GPDG 1Y6QA 3C24A 3H84A 5JOQA 3K9BA 5JQGB 4DR6B 4C5BA 1I3MA 4RLSA 1IQUA 4UE3S 5BYKA 3L2OB 2OD9A 1G20E 3GJ8A 2FWPA 2FVYA 4LYAA 3WLSA 3A6FA 3SOIA 2WOOA 5KINB 2WR8A 3QP4A 2CT8A 2E8IA 3VNQA 3HYCA 1M34B 1S5PA 1N6IA 3W8FA 2J4DA 4Z1MA 1WB5A 3MJFA 4AIIA 5A7HA 4B7XA 3C8MA 1NX6A 5KJFA 5BYBA 2CBXA 3WS1A 3PVZA 1WOMA 1K08A 1PT6A 1NLMA 4HCJA 2CDBA 2VQDA 1KIFA 3KQWA 4JI6B 4WKOA 1D1SA 1RHKA 3E15A 3EGXC 4HEJA 1YSPA 4TLBA 1H2ZA 4XWGA 4IAOA 1AUVA 2H18A 2HGSA 3RUHA 1NXYA 3MQ0A 2X2FA 4N3BA 1RIFA 1UAYA 1ZUNA 1VEUB 1M74A 4BFYA 4EM6A 1B8VA 2P11A 5DHQA 2WG0A 3D8NA 3Q7TA 2G1JA 5JSQA 2IYEA 5M29A 3SE0A 3WLAA 5EQJB 3F4KA 5M7EA 4HO1X 1RWQA 4K7JA 1R3UA 3AFIA 2RH8A 4BTEA 1A7JA 3PBSA 5C0OE 1H1LA 1XA4A 4WN3A 1PJAA 2WU4A 5EKSA 1RWOA 3DTKA 3H5IA 5D3QA 4BYMA 3VOSA 4F04A 3C3MA 5CNKA 1EUDA 1OT5A 5TPWB 4KOAA 2PCJA 3ITEA 3UENA 3R6WA 1V5IA 4JQSA 2WNSA 3D8BA 2VEDA 4NFHA 2RG7A 2IYWA 4GPBA 4PCLA 1DHTA 4ZHQF 1LDEA 4ZDJA 1DJPA 2BJHA 2B2CA 1OZFA 3B7WA 1HT1E 3FOEC 4TZ6A 4G25A 4KI7A 2GLXA 1GNQA 1XQ6A 1QIDA 421PA 1MMFB 3L6CA 1XTQA 1Y7PA 4ENVA 2QUIA 1XPBA 3OLCX 1WR8A 1UKZA 2BLLA 4PZEA 3CB4A 1OYYA 3KJXA 2I80A 3Q07A 2ZYTX 3VOBA 1L9XA 3GVXA 1N92A 1YFZA 3L5OA 4TL7A 4A5RA 1FLVA 4TL9A 3WB0A 1ZUWA 5D84A 5A91A 3OP1A 1PT7A 3F6CA 5CYOA 1K0FA 2B8EA 4JCOA 1JAXA 4DQUA 2XF8A 4X3OA 3DEYX 1C29B 1UQTA 4UOEA 1GADO 4KL8S 3RFTA 3ONNA 4O3MA 1YLJA 2MSNA 1LNQA 3LUQA 2Z0MA 2ZJYA 4Z4HA 1Y4AE 4DUPA 3SJAA 1T6BY 1U1CA 2R5WA 2VXCA 1QYIA 3SYTA 5GADl 4PO3X 4XT2B 2D0DA 1JDVA 1PS9A 2PZFA 5IULC 2B4AA 2E5WA 4NFLA 5CEEA 4QXPA 3ZHSA 2FX2A 1PRYA 3EIOA 3S81A 4C4TA 3HYRA 3LYHA 4OJNA 3U9TA 4DMGA 1H2AS 4NICA 1GSHA 4ALMA 6REQA 3IQDB 3GJXC 4ZJZA 2C0CA 3ZDYB 4IUBS 2XWQA 2QM8A 3QLVA 4EJ2A 4NYIQ 3P27A 2P9CA 4DRXA 2GF0A 2ZB8A 3ACCA 3IBTA 4QHSA 4O01A 5TB5A 4HH3C 3T5AA 1BDBA 1HYBA 2XF2A 4P36A 1FEZA 4XB6B 5EGSA 1T8YA 4HFJA 5B64A 3UMJA 3NRCA 1T2AA 3NBAA 5AVSA 1JEAA 3JQPA 4P0TA 4JEMA 3Q7SA 1XQWA 3HBLA 4BGUA 3CCCA 4ZV9A 4L8WB 2IXDA 1XMPA 2ERCA 3IH9A 3G8YA 1E1NA 3INYA 1JEYB 4WH0A 1W1UA 4G3XA 3THYA 1YVEI 3FM9A 3BECA 2FNAA 2QL7A 3SI7A 4CF5A 4NECA 1STOA 1PDOA 5CU7A 4QXQA 3T52A 5SICE 2NAFA 2Z6CA 2QJ5A 1MA3A 1NNUA 5JROA 1O7JA 4CKCA 1P3JA 3OPLA 5ALNA 4N9QA 2HI0A 1TNDA 3TSOA 4DT1B 2GHTA 4AMVA 1GPKA 5CM9C 2D01A 1DKUA 1RKUA 3MLEA 2ZSUA 2JBAB 2PUTA 2ZUWA 3VX3A 1K54A 3AI3A 1BVRA 2WSSA 2JAOA 5HKAA 1CQIA 4PX3A 3WKBA 4YALA 1Z3IX 3TRFA 4XM1A 3AF5A 5C8YA 5HOEA 1U28C 1L4HA 5MN6A 4ZRRA 1JHAA 5LYJF 3PU6A 5FR2A 4ZQEA 5FPKA 2RAPA 1EINA 1OV4A 4JBWA 1Y7TA 1Y1SA 4NL4H 3BMQA 1HY3A 3OLVA 3EQZA 4GLQA 4WKNA 3UDXA 4UVEA 1YFLA 2J30A 4HYTA 4IOLA 2WJVA 5EWJA 5I3ZA 4EUSA 4BNWA 3H18A 3B1JA 5DGDA 4AO7A 1DQPA 1AKVA 4ZIRA 1DPGA 1Y4UA 4MVCA 1KJJA 3IKJA 4QSHA 1M2OA 3L0DA 5EMNA 2NVWA 3CPTB 3ZDQA 3DOEA 4PBTA 1WVGA 1M76A 2AE2A 3OWXA 1JQ5A 2ACGA 5A4DA 3HDHA 4P3PA 3JTMA 3UJ7A 2IS1A 1YGYA 4WAUA 4EB6B 3HLDA 3WTBA 1MW9X 4L27A 1LX6A 2ZI7A 2OM2A 1SPXA 3GRPA 3RTEA 2ZYDA 3I28A 4KIGA 4CLCA 5L4LA 1H2EA 3H65A 1TZKA 2FB9A 2FXIA 5IANA 1C4KA 3NHJA 4BXOA 2N0SA 3ZWQA 4PO8A 4DWWA 1QB7A 4D5GA 2AMVA 2CB0A 3PE6A 3DLHA 5KVQA 4NCBA 1KEZA 1WBJB 5AW9A 3FCEA 3W2IA 3MIIA 3BQAA 4Y3IA 1TT5B 3LUFA 3HZZA 3A6HA 1IOZA 3GJ7A 4XWOA 1P5FA 4OJKA 5EUQB 2C6WB 3C5EA 1XG5A 5GVRA 3FJOA 4K6CA 3JAKA 1CVIA 1HSZA 2FZKA 4HB2A 4IHKA 4L9WA 3B1VA 4JQCA 5EHXA 2QZPA 4DLWA 1VP9A 1L6IA 2ZYRA 2PD3A 3CCBA 4GU5A 5E4YA 2I29A 3THXB 3HJIA 3NBFA 1BJKA 1YZQA 5DF1A 2XXJA 5C9ZA 3OCJA 3PC2A 4TQ9A 1K38A 3UT5B 1A97A 3KSZO 5EE1A 2PTGA 1JHXA 5C31A 3H2GA 3EARA 5GPBA 5AVTA 3RNOA 5L3RA 2CJWA 4C08A 2XI4A 1RBZA 3UJHA 4YH1A 4MA0A 2CZCA 3DKRA 1Y9AA 3UBMA 1CULC 4B3HA 4UHDA 5JU6A 1P0MA 1HFEL 3HRHA 4A0HA 3K5IA 2LV8A 5CA1A 3ETJA 1WPGA 4AIRA 2AOVA 4ARIA 4LJ6A 4REQB 2QD5A 1WO8A 1IVNA 1L5GB 3O83A 4MKZA 1IXZA 3ZWWA 1FP6A 4KLRA 1KU6A 3MJTA 1U0JA 3PFIA 4YJFA 3OTGA 4R3NA 2WV9A 1NDQA 5HRAA 1FK8A 3O26A 4N65A 5TQ2A 3MOIA 1UPBA 2BHTA 4U39A 4LY9A 2OP1A 3KKPA 4MINA 4IQFA 2FR0A 2Z83A 4O4LA 3AEKB 1N7GA 1GNVA 1ZCAA 5CDTA 3W8NA 5U9CA 3W5UA 4D3DA 1Z35A 1M2VA 4O4JF 2WG2A 4QREA 1YF3A 3QUQA 5HAIA 1ZM9A 4NG2A 4UTPA 3VU8A 2ZLYA 4X94A 3DMNA 4GGOA 4AJNA 1YH3A 2WWTA 4UOQA 2EJBA 2FW8A 3NHMA 2G5PA 1C30B 4ZMBA 3RABA 4AS3A 1XVAA 2Z2KA 4FS8A 1RACA 4FZ3A 4YP1A 4MRSA 4BBUA 4MVXA 2LDXA 1SK9A 3IB6A 4ZEXA 2LUOA 4HGPA 2WWVD 3F98A 4ER0A 5DIZA 4F6RB 3Q10A 3DTVA 1JA1A 1FDSA 2BR5A 1SCWA 2MJLA 4MKFA 4DC9A 2UZ3A 2B35A 5A71A 1DADA 4GP6A 1L4UA 2HRZA 3S5UA 3BXOA 1YZFA 3DHYA 4UBOA 2B4QA 4WADA 4C4ZA 2W11A 1VGQA 4CE6A 2GTIA 4HDSA 4D6PA 4Y9DA 2PD8A 4GRDA 1VHWA 1X15A 2DF8A 2M1XA 2OE2A 4QDUA 4Q1DA 4QAJA 1UMBB 2A0UA 4PG7A 4CIBA 3RC8A 4G5QA 4IH9A 5K3FB 5BXYA 4GUDA 5BSGA 4CCWA 4ARUA 4Y2TA 1WV0A 3I04A 5FCDA 2HJWA 2Q5HA 4I8DA 5DWQA 2QT0A 4PS1A 2G0NA 3Q9UA 3SFVA 3G0BA 3NCTA 1S2MA 4Z49A 2C2KA 1XFDA 3RTCA 2XB9A 2DBQA 3QXGA 1AU9A 4NBWA 4ZJ1A 3CZAA 5ER6A 2WAYA 1N5JA 4BO7A 3AJ9A 4FKZA 1E2DA 4DUYB 2W0NA 2W9XA 4OQ4A 2A1IA 4FU0A 2QN1A 1ODIA 3EOAI 1CB7A 1LC3A 2I76A 1ZKJA 3OBIA 4XUDA 3EOBI 3OUTA 4OL9A 3G32A 4FFRA 1C7RA 1VSVA 1DP6A 1HSOA 2E5LB 5HWTA 5DI9A 1M2JA 1VBKA 3WYFA 5E7JA 4J4HA 5KMGA 4MGYR 4YQYA 1L0GA 2GNAA 2FJUA 2RG1A 4MWOA 5KHLB 2OCBA 1DCTA 3DEAA 2G4LA 4Y0VA 4LE0A 2FR1A 2Y27A 1EWTA 3QXJA 4A8HA 1UJNA 1DIBA 2DMRA 1EHCA 4JL6A 4L9RA 3WRYC 3BHMA 2VP5A 1JHZA 4X24A 4D1YA 1XK6A 4L8YA 4K87A 1V8BA 1PEAA 1K6EA 4G1CA 3CRRA 2ZR7A 3VOZA 3PLNA 5H4HA 4QUAA 3T0GA 1DP8A 4ZDKA 4PLTA 3RJMA 2IYFA 4WZ6A 3CN9A 3ZHTA 3RUAA 5LWQA 1FX0B 3G2NA 4XCVA 1FQWA 4Z4GA 2PX2A 1IULA 3DF7A 1DE0A 4QG3A 4NEGA 3CRQA 2FZ5A 1KBOA 2FSPA 2VTVA 4RF5A 5AKIA 2OO5C 1JIUA 2Q3BA 4MLCA 3E9YA 1O6FA 3PKIA 5IJXA 2QXTA 4E31A 3JQ7B 3AQIA 4M54A 5IP5A 4RPKA 2HWKA 3GC6A 4UVDA 1MFPA 5DVAA 2ZL1B 5AHRA 3TBFA 5AHKA 4IMIB 2B8JA 3D54D 3M6XA 1FP7A 2XVZA 4YI3A 3QWFA 4PO1A 1FNMA 1UM9B 3NNNA 1G5RA 2DPYA 3Q12A 3RSGA 2DTEA 1NU8A 4QELA 4UUOA 3WB2A 4KPUA 4CZ2A 5IAOA 3HSKA 4EFNA 3JZAA 3LU1A 3BX1A 1CUVA 4D0NA 3H8SA 1XF9A 2BTQB 1ZGZA 3WK4A 2XNJA 2KLIA 1D9XA 1I24A 3LKBA 1AQYA 3QLEA 3BWLA 3HCOA 5JTUA 5AUNB 1OXBB 3HDGA 3CSSA 4MW5A 2ZQ8A 2DBRA 1QPGA 3EDQA 4ZO8A 1C0KA 1PWHA 2IXEA 5BV0A 4MWEA 2PN1A 2Q4BA 2XF3A 4RC9A 5BQOA 1OTXA 1M10A 4DDMA 4NP6A 4F3KA 3DP9A 3NAMA 5CCEA 2IODA 4W1SA 3H2ZA 4BV2A 3BEBA 1GFIA 1K68A 1AG9A 3DMRA 4ZPXA 2VJOA 3ESXA 1MRZA 4WA7A 4OQHA 3BAFA 1G68A 1ERMA 2PPLA 3IXDA 1ZSNA 4K0XA 4BFWA 1G55A 1QQ5A 4HNGA 3AKYA 5EYPB 1DO0A 5G4KB 3U7JA 2IS2A 1JIIA 2P62A 1BSGA 1B2LA 4MAMA 9ATCA 4DG5A 1E3EA 1I4LD 4HJ3A 1JQKA 4LWQA 3UB9A 1G21E 4QBIA 3LGXA 4B6GA 1AK1A 2W4MA 3MT0A 3OJ0A 1NJ4A 5IBPA 2AK3A 1XLWA 4B09A 3BORA 4BX2A 1A1VA 1QE3A 1UANA 4KQDA 3BF8A 1PDWA 1I3OA 1N5MA 2IKSA 3OEHD 1SXJC 5C7YA 1SD5A 2BGJA 1UAGA 4UNSA 4H08A 1OU4A 3W5IA 5HA5A 2HEIA 1X80B 4INPA 4TRJA 2P9QA 3WMRA 1XPRA 3KLOA 1U0FA 5KUTA 2UUBB 3KHUA 1MPTA 1PGOA 4PLYA 2XRFA 4D8XA 5F33A 4AZ3A 2QYBA 4XIJA 4C43A 4OU5A 1BCSA 1LK7A 4DDHA 4BEJA 1GHMA 1QFYA 4JLBA 1TJ3A 3W6UA 5HFNA 3ME5A 4TXJA 1N6HA 3ETLA 5JEDA 3AR4A 3IUEA 4ROTA 3KKKA 1OE0A 5CDGA 3O90A 4UULA 4NE9A 2NZVG 5A8BA 3RTYA 4L3WA 1ID1A 1F5SA 4R1OA 2CVHA 1S66L 1P77A 4DVJA 2V97A 3IQXA 4G5RA 1WMAA 2X4DA 4G36A 5I7SA 3T4LA 3G5UA 4EJFA 5FQ9A 3C6MA 4LVNA 1HTZA 3V9AA 3MYRA 5D6NA 4Q7QA 4KDEA 3H5OA 4PY2A 3WHIA 2OCAA 3RC9A 5EVCA 4Z7OB 4I36A 4OVDA 5EIOA 4JOBA 2Q8NA 1NIPA 1LTHR 3T5MA 2OVBA 1QO0A 3ISJA 4H4DA 2M6LA 1MO5A 4RTSA 1D2CA 3ZU4A 1NQAO 3CBGA 3GLIA 5LD2C 3ORFA 1ZMBA 4E15A 3OIWA 3REQA 1KL7A 1V47A 3A7EA 1ISSA 1K4EA 4GUAA 1O94D 4M9ZA 1PL6A 1GFWA 4RABA 5I8PA 1GPLA 5EJAA 2YCBA 5AM5A 3TK1A 1NZJA 4B6PA 4GN2A 1AUQA 5JJKA 3DAPA 3CWQA 3JWPA 2V2FF 2GM9A 1MAAA 1C8VB 4I5DA 1GUFA 1VA4A 4O6VA 2J07A 4ME4A 2GHIA 4RF3A 4CKEA 1I3KA 4X69A 1RT9A 4GC5A 4G4JA 4JLFA 2O5VA 4WOKA 5H7XA 3ZZ1A 1FVFA 1PWYE 1AZLA 2BVNA 4A03A 3N0TA 2VGJA 1HYGA 2QORA 2ECKA 5EJ4A 4TT3D 2Q50A 5JSKA 4AO6A 4Y7DA 1RJGA 2D0OB 3RIEA 3RS7A 2FWAA 3ZWAA 1IL0A 5DN6A 4QNMA 2DKNA 3AJ8A 3N2IA 4EPTA 3VAAA 4ALKA 5F3WB 1HKUA 2DX7A 2QY6A 3AVPA 1JR2A 3UN7A 1XV5A 3VZQA 4HEA1 5EOOA 4HQKA 4V03A 2PJRA 4MN7A 4MCAA 3ZW9A 4QWOA 3TIIA 3DFZA 4CR8A 1XYVA 1Q3TA 2FPGA 4OL0A 1PEKE 1ZINA 2X9LA 2MSKA 3D59A 4CPKA 2VQ6A 1OYVA 1TPZA 3ENVA 2HK9A 1LWNA 3KOYA 3RAFC 4PG4A 1F2TA 4QU5A 2XGGA 4AMUA 4O63O 3ICCA 4KXMA 4FWTA 4QGSA 221PA 5NULA 3PVCA 3BH7A 4UDOA 2W3DA 4IVQA 4II7A 1ZP6A 3OJXA 3FSEA 1JL3A 5ADHA 3CLKA 1W5EA 3OETA 5AVEA 1AUPA 4NJOA 5AW7A 3V2IA 4MBHA 1RXVA 4U9HS 2ZWIA 4F91B 2L18A 2NXWA 1DWPA 3IJ5A 5IU1A 1XZ8A 1E1QA 3R0JA 4D41A 2I3GA 3PDHA 1OUMA 3OHPA 5CA0B 3UB6A 2NZYA 4FW9A 2UXCB 1XZHA 3K4QA 5KQLA 2ORED 5IBQA 3RF7A 4X44A 1AX9A 5HWSA 1WYBA 3GLGB 2AVXA 1I80A 1N2BA 5CM8B 3C6BA 2C5FA 4WX2B 2X5JO 3KQKA 4AZWA 3RVMA 3DAVA 1L0EA 1CU1A 5H9WA 1E99A 5M19A 1ADFA 4EOGA 2XA1A 4V2IA 4MITA 4AUNA 4DRYA 3I4CA 3V1MA 1Z83A 1YDMA 5CEBA 3N86A 3KXPA 1UDBA 3A2LA 3F7NA 1P4GA 2Z2XA 3IAEA 1AKNA 4FN4A 2UZAA 3V7UA 1Z38A 1TXGA 1N77A 2C59A 1OFTA 3FYSA 2ZRCA 3AB7A 2PMEA 3DLTA 2A1UB 4RDXA 4BNIA 1JLLB 1DHRA 2PZLA 2GTHA 1JRLA 2JASA 4U00A 5D6OA 4LMPA 3RM3A 3OCXA 3H9CA 4NMMA 1N4DA 3A3DA 5I51A 3J7AC 2V6JA 4HRAA 3GMTA 3P52A 4H4CA 4FYKA 5BN4A 2BFMA 4DV7B 3LG2A 2JN7A 3H5VA 5D01A 2JFOA 4OCZA 2EP8A 2WB2A 1TJ5A 2XSZA 4AZ0A 4JLOA 2P4UA 3WAKA 1YK1A 5B57C 4AJLA 5I47A 3LX8A 2OFOA 4C30A 1FVHA 4I9GA 1L5HB 1GAQA 2ZWMA 3N6IA 3AGQA 2XFSA 4Y6SA 2FPKA 1E9FA 4LX0A 4ZT4A 2JLYA 4ARZA 2IIBA 2VP6A 4PSDA 1OC2A 3X2FA 3MWLA 4EKIA 3UNXA 4ZVKA 1ISJA 1V43A 4I55A 3MF4A 4FSXA 1R0LA 4RD0A 1H2XA 1F5MA 1OBOA 2A3RA 1AN0A 1OB2A 3CC8A 4YY3B 1YS1X 3EODA 2Q6VA 4ZC8A 2BJWA 2N9UA 5ELXA 1VE7A 2YN2A 2IIVA 4EEZA 4AP6A 3B3GA 3IPAA 3GVHA 4BX0A 2WOJA 3PGKA 2XCQA 2HQSA 2IHNA 3EDCA 3TLJA 3TD9A 4V0KA 4C7JA 2FEXA 1WW8A 3RAEC 1CUIA 1HL7A 5KYVA 2NYRA 5FDFA 4LZPA 3EB9A 3PXEA 3GELA 4XFJA 4C6RA 4NZPA 5DXAA 4WBGA 4I3AA 2B98A 1W63Q 4KPFC 1UPUA 5KTMA 4XA8A 4Q1VA 4XRRA 3EXG1 2ZYHA 3SX2A 4D60A 4MCWA 3EG9B 5DKFA 1JXQA 3HJAA 3QHYA 2BDEA 3UOGA 1X94A 1P2UA 1QE5A 2C5BA 1D2RA 1KE1A 3PNBA 1ZL0A 4QU0A 4NYIR 4M1OA 3JCZA 2X7JA 3QEKA 1VMAA 1XHLA 4A2QA 4FYPA 3G3EA 3W7BA 1NMSA 5AT1A 3U7FB 4RPHA 4HI4A 5FLXA 2RJOA 5DDIP 2J1LA 4FDUA 3A6JA 3I34X 2Q62A 4QTXA 2Y2NA 3LZ6A 3W9UA 3C3AA 4DWVA 3O31A 4L28A 2L42A 3BFEA 2DWQA 2Z98A 4X1YA 1A98A 3IDQA 5H70A 1RAIA 4CM4B 1T2VA 2DHQA 1CZRA 2RI0A 2P75A 4NONA 1ZUHA 2X8AA 3RDPA 5CB4F 2X02A 1O95C 2Z2JA 1XXHA 1TDLA 1KE0A 4X1IB 2D0IA 4RM2A 3LHKA 2AN4A 1S4RA 1Y6FA 3QBVA 4ZXFA 5B3AA 1CUGA 3TH5A 4KBGA 2HXSA 2ET6A 5BW6B 1EKXA 3A4TA 1NVGA 3ZW8A 3BIJA 1Z4QA 1EXVA 3WGIA 3JYNA 5EKUA 3H99A 2WGWA 3FSJX 5IN5A 1QP4A 5B7PA 4OOLA 5T57A 3QOXA 3C3EA 3LIFA 3ICPA 5LDDC 1WZUA 3BIXA 4EG6A 4HOIA 4BUZA 1VSUA 1LH0A 3IDSA 3AVQA 1PFYA 2PUCA 5C7OO 1R66A 3MWDA 4LZNA 2V0CA 1T8TA 2DHDA 2IGTA 1WUKS 2B6NA 2VI5A 1EFLA 2H85A 2ZYGA 1C0PA 1RMYA 3OPMA 4IIEA 2QN6A 4I4CA 4UJ5A 1EFVB 1KFBB 4DE3A 3RT1A 4HGNA 2ZIXA 3W2EA 1JUDA 3KD2A 2R5NA 3HY6A 2QUJA 5AHWA 1EQUA 2QRMA 1KEKA 3HXTA 1W79A 1DJLA 1U0RA 2Y1KA 3CSDA 4D3FA 5B36A 3T7CA 5E4FA 2R60A 5ARCA 4IG4A 5GWXA 2BGMA 4NOKA 4ODIA 4X55A 2R9VA 3L79A 3BMCA 1U2EA 4KAJA 3IS2B 1ORIA 4HL6A 3COZA 2RONA 1C50A 3QOYA 4I4LA 4DS3A 3HR7A 3RHSA 1ZS9A 4B7UA 1GKYA 4IYRA 3MN1A 3U4QA 4QLOA 3HLKA 4X84A 3OG9A 2I54A 1UBSB 3CM0A 4PM5A 3Q8KA 3VBEA 2X7HA 1QC5A 3G6WA 3B5EA 3P2KA 5CTMA 2A67A 2W3FA 4MV3A 3HV2A 4EKGA 4JV5B 3TZCA 1ENZA 3UOWA 1X7GA 1NP3A 5CLJA 1KA9H 2VCYA 1DTEA 5CCDA 2FOXA 2Q7OE 3U61B 4E21A 1IVYA 5DBEX 4XDHA 3IE2A 3UUGA 3L07A 2ZCJA 2OZPA 1KKLA 1SY7A 3TDKA 4KH0A 3QE4A 3IIJA 1JJIA 2R6GA 4ARAA 1XKQA 1L8XA 3ZV5A 3PQ3A 1IY2A 2ZSJA 4BU1A 2QRVB 3VOTA 1QYVA 3TR5A 4E32A 4Z4IA 2QVXX 4PW0A 4IQ0A 3UMRA 3G5MA 3BEOA 3NTQA 1XDSA 3AGPA 4C05A 5BRNA 3SVZA 5TBMB 3U3ZA 2R1TA 1AS3A 4M3NA 2H5IA 5ES3A 3PBNA 4ZWNA 3HB4X 5FBHA 2YV3A 3F1LA 3S2IA 5H8WA 4EZBA 1FXUA 5CMLA 3LUDA 1QGZA 2B7LA 3NC1C 4BNJA 4AN4A 3SBOA 2YMLA 2FJPA 1WQ4A 4L0CA 1GXSB 3N7AA 2CVZA 1JZQA 4JXWA 4ZT7A 3O8QB 2FKAA 4J2HA 2X1HA 5EIFA 1SXJE 3B3AA 2AFIE 4HQFA 3AR3A 4CMCA 3ZHHA 4G56A 2P6OA 4C3ZA 4B71A 4N92A 1L4YA 2IS4A 3L9WA 4JT9A 2YX1A 1QTRA 4FXOA 1L1RA 3CLTC 1G7RA 3D7KA 4XGKA 2K7SA 2BI4A 3P26A 4CDRA 3RJZA 5KDDA 2GJSA 3EXHB 4YWJA 1YQEA 4E0BA 1AT1A 1QOQB 4BEVA 1P29A 5TVGA 3BKXA 2YNMA 4WQMA 4M1QA 3AYXB 4X20A 4S2PA 4EKEA 1UKAA 3DTTA 1JSCA 1YASA 5CGQB 4QOHA 3CZPA 4Z53A 5CX4A 3G0CA 3HBAA 2ZQCA 4BFUA 2H4HA 2JH8A 3EC2A 4MRMA 5CG2A 2EERA 5K0TA 1K7EB 2C5EA 2D74A 3OZIA 3NDPA 2XUFA 1CS0A 4DYHA 2PMKA 1F6DA 1EXNA 3IDOA 1XTUA 2Z8YM 2AXEA 2XAAA 5MFZA 2H2IA 5DK6A 4YRPA 2XRZA 3ABIA 3PC7A 1LFDB 2CXOA 4HNHA 3BFDA 4K9KA 2FQWA 1EWRA 3HVRA 1A71A 3RVLA 2AX4A 3KUDA 2IEZA 1O6GA 1PR1A 5AJUA 3OCWA 3NIAA 2J41A 4GS9B 2BEWA 3TLBA 3DJFA 3EK2A 3RYHA 1FDVA 3MWEB 3SS4A 1DU4A 2HUPA 1IXKA 4M6WB 3PUZA 3VR0A 5E2EA 3IBRA 3GXOA 4FCTA 3K53A 1GUDA 4G5FA 2ZSFA 1FB5A 2EZ8A 3EZXA 4CU2A 2NV2B 3W5CA 3LCCA 2Z30A 1MIOB 2H7XA 1I7QB 4YEDA 1UKYA 3FZQA 2Z43A 3PFFA 1MPLA 2XDMA 3TJZC 3ETEA 3QFFA 1LXCA 3OOYA 2IOFK 4M0EA 2F62A 5ALGA 2ZT6A 3VNRA 4M1WA 5G4ZA 1O03A 2YS7A 1DJOA 2BFBB 3VSKA 4XM2A 1G38A 1GU7A 2ISQA 1PYOA 1XDUA 1UEJA 3R7SA 4RHYA 1XJ0A 3HABA 3EX7C 4N3NA 2P9GA 4Y9UA 4JBIA 6AT1A 1Q12A 1Q22A 4F2DA 4GM0A 3GRVA 3PVSA 5LQJA 1VCMA 3SDZA 4PNZA 2QRQA 2RKWA 3VR5D 5C51B 1YS4A 4Q9KA 1MAVA 2ZOIA 1P7VA 3P94A 3DV0A 1KGFA 4DDYA 2GCEA 3LD9A 2P9FA 1SB9A 2GAAA 4R1TA 4URWR 1JDPA 4HDAA 3QRWA 4CIVA 2EFGA 4YIHA 2RGYA 5J4LA 3T4OA 5D2CA 3RK1A 3S2YA 5SY4A 3OOWA 1U7OA 3BJZA 2V1XA 2O2EA 4P7FA 1OLSA 4Y1FA 4QATA 1SJ9A 4XJXA 121PA 1U1DA 1VQ1A 4WK2B 2UVDA 2XQKA 3AM1A 1KE2A 2Q2WA 5A03A 3SX4A 5JQGF 1Z13A 3EVEA 3G49A 1ZJWA 4L2IB 1WCXA 2FQQA 5HQJA 2QD1A 1VL1A 1P4HA 2Y1FA 4URYR 3FTQA 2NWQA 4Q01A 3T3PB 4H0NA 3QPAA 3BICA 2O2CA 1V8OA 2XXBA 3DMYA 3SVTA 1E1CA 1VRCA 3KUKA 3A9RA 3WLLA 4BJ5A 1LSWA 3EVAA 3HDQA 5JADA 3WLOA 3TJMA 1MOSA 1QJ4A 3ZE6A 2NPIA 3VHQA 3HKDB 3HLEA 1XHEA 3TX2A 1VJ0A 2HRDA 3LC1O 3N0WA 1L5VA 1LBQA 2YYZA 4PFJA 5EWLA 3N6XA 4I46A 2GSWA 4GQIA 2W4QA 4G8DA 1Z37A 5CAEA 4YAIA 1P9OA 4X97A 4UA9A 4LPSA 3CUVA 5A3SA 4KG6A 2GESA 5CLFA 3COVA 2HCTA 3KCNA 1U1EA 3MJQA 4WL9A 3IALA 5EIXA 1XZDA 1WEKA 3ZCRA 1BEZA 4WXYB 4I1RA 3GLFB 2Z4RA 5A06A 2FV8A 3BLSA 4EYOA 4Z4EA 4QBTA 1KC1A 4FD2A 4Z9AA 3W2ZA 5F4ZA 4GOJA 2WP0A 2XCSB 2AZ4A 3GZTB 5K8CA 1DJNA 4XJSA 3QVSA 2V7GA 4B84A 3IBCA 2WIKA 1A76A 3DBHA 5B2ZA 4PZCA 4DLKA 5C52B 1G1AA 1L1FA 2JAXA 1F4LA 5CLIA 4E03A 1P3Y1 2IEIA 5ALMA 4POAA 4HZUA 4S2NA 3C48A 3WWOA 1F2UB 1QF9A 4MJ7A 4J0HA 1C1XA 4D8TA 1ZC3A 2QVYX 2V7BA 3HR4A 4Q3EA 2ZYUX 5FPSA 2ZIGA 1XP5A 3B2EA 5CCXA 5IAGA 7MHTA 2I62A 3T9FA 1FYXA 3T1NA 2EZUA 3ETCA 3L1KA 3H7AA 1EFCA 3FSRA 4OX9Y 2O99A 5F5LA 3JY6A 1JT2A 3F8SA 1UP6A 1JWAB 2XUDA 3BUSA 4Z0TA 2GCOB 1Y8ZA 4LPKA 4LRZE 1SCIA 4MRVA 3WLKX 3WIBA 2RAFA 2QTVA 1OVGA 4MEBA 4BO8A 2Q3CA 1ZD8A 3F3KA 4YGXB 2IYTA 4KE7A 4QDXA 4UU1A 4RUKA 1GCGA 4XUXA 2N3ZA 3H11A 4R9VA 3ZHQA 2D54A 4A91A 2NPFA 1T4DA 1N2HA 1R8XA 3F1KA 3FYZA 4L9SA 4RVCA 2F8LA 5BVHA 4IDBA 2C9DA 2P91A 1UFKA 4EGJA 5LZ2A 3D3JA 3PNOA 3RUEA 1I9CA 3UPUA 3IJRA 1V9LA 2UYCA 2WSYB 4OA8A 4KXYA 4OHUA 3WWEA 1J97A 2UVPB 5C32A 2VP4A 1GZ4A 2VHJA 4O5AA 1E7MA 3IHBA 3F1OA 5A9RA 2NNLD 3ZDCA 1T0IA 2HZ5A 3QPWA 1PE0A 4IY1A 2VJMA 3LFHA 1ZGCA 3NUQA 3TRKA 2YFQA 3QA3E 1ECBA 4LVUA 3PXPA 2G0TA 3ZWDA 3RRFA 2JHGA 2CMGA 2E1PA 1N2ZA 1Y9DA 5LUAA 4YA6A 8ADHA 3T3MB 5DN9A 2CCJA 3MPOA 5CB6A 4F56A 2WFLA 1GPMA 3IVRA 4OH0A 2QKYA 1RVDA 4BEWA 2WVAA 2QN7A 3H8VA 4Y18A 4M99A 3COWA 2CFOA 3H19A 3KNZA 1EH5A 1VHMA 4YJ3B 1V1MB 3FNFA 1XOIA 5T8KA 3QWBA 2EARA 2GXSA 4KQOA 4XEUA 4WLFA 1P9NA 1DY6A 3FTCA 1LEHA 3ANLA 5BWMA 4JP5A 4OP3A 1DJMA 1RAEA 2CXPA 1AURA 5FUMA 4IZHA 2X9GA 2VTBB 2A0KA 2HWWA 2I1LA 1T2EA 3FGOA 2NYVA 1JEQA 3ZOKA 5KWEA 3OZBA 1RLJA 1CXZA 2QX9A 4X3CA 2IOYA 1B76A 5A9SB 3B70A 3IO5A 3PNSA 1K2VN 2G40A 4LW8A 3DE5X 2P2NA 3B36A 4P85A 1OBCA 2HBZA 2ZUVA 2R6R1 3ENKA 4LA4A 3M2KA 4U5XA 3OE5A 3SSNA 1RPAA 1SKYE 2W42A 2RI1A 3OZEA 2DPHA 3N58A 2GYUA 5TMPA 4JXJA 3MXRA 2H5EA 2YASA 2V8FA 1EVQA 4PZZA 2Y9MB 1L0BA 1L5ZA 3R3SA 1D4FA 4FFLA 2ZRHA 5E6UB 3FNIA 3V8PA 3FE2A 1WS6A 2HC9A 2GK7A 4ZGGA 2ECOA 1JAZA 1A5BB 2F7SA 3UWMA 5FBWB 3A7DA 8LDHA 4BYGA 5JO9A 1Z26A 2XCLA 1IHUA 3IV6A 4G0OA 1Q2UA 2WJHA 2QSJA 4CLDA 4JMPA 3UKDA 2JCSA 2Q3DA 1VMKA 1SHZA 4KZBA 4GGPA 1NQXA 1CK3A 1YR1A 4P9NA 4LJKA 3D4FA 3ASUA 5I4IA 3CUEF 3KZNA 2A5DA 1F38A 3C8HA 4M1KA 1SBZA 1H0MA 1REQB 1APBA 1ZMRA 5FTNA 2ZUDA 5ULLA 3T7AA 1M1NB 3UFXB 4NEHB 2QQ5A 3HCWA 4DANA 3MBOA 4QPZA 4TXHA 2AOTB 3HUTA 5AUOB 1SCNE 2FE1A 1RWPA 5ADVA 1NONA 1VJ1A 2L0XA 2IUTA 3CT4A 4C0BA 2P3LA 1FRFS 1D09A 2DULA 2HV8A 1KGEA 3IF6A 1FJXA 4JOQA 1OIXA 2LRHA 5C5CA 3IT1A 1JU3A 2W2NA 3L8CA 2ETVA 2ZXUA 3W1EA 3VNSA 1LF5A 3W2TA 5KWIA 5BNFA 1RW4A 1VLMA 2PCLA 4QTTB 3UAWA 4IGAA 4PIVA 4OSOA 2OC4A 4K9QA 4UQPA 2EG9A 4O5OA 2ZE7A 1QHHB 2O1WA 3T1SA 3KLPX 4X61A 4HUTA 4Y2GA 1SULA 1ZVMA 2ZRPA 3QM1A 3V7WA 3VVCA 4YP5A 2IJGX 4QT0A 3KSFA 1WD7A 3R0XA 3FUWA 4UDXX 1ZMOA 2OHIA 5F7XA 1MAUA 3CJQA 1RXSA 3A3JA 3EMBA 3HY3A 5ER9A 4F4UA 2FW0A 3JQDA 3HEBA 1TK3A 4DDKA 3DQPA 2G6TA 4H6JA 2CLHB 2DBZA 1JHUA 1GL9B 1L8LA 2VJYA 5D1HA 4QDOA 1N5LA 4R1SA 4YHHB 4YRJA 2JB9A 3A1CA 5E7MA 5BR7A 5I5EA 2F17A 2PUGA 3QG1A 4UHFA 1YJCA 3MOSA 2VATA 2WA2A 2H59A 5FLYA 1LSSA 5BV2P 4ID4A 1OC4A 3USES 1DBSA 4BN5A 1A9QA 5FOQA 3NWOA 1QDLB 3U37A 2HDSA 2M1ZA 3LL4A 2YZGA 2DFDA 4G1BA 2AD1A 2OQIA 3EVFA 1BMFD 3AEZA 2WSIA 4XYGA 4PNPA 4LC0A 2CFTA 1P62B 3CW2A 4J2TA 1RFLA 1SR8A 4IRXA 3PQ8A 3A0UA 5G40A 4S0XA 2AFHB 1LLDA 4BDSA 5BN5A 3D8RA 3KSMA 3E3NA 5SYNA 3OTQA 2H7VA 5TGFA 2HU8A 3D6FA 2YRFA 4MUIA 2REBA 3SKYA 3N3AC 4CV2A 1ZD3A 4P4TA 3KKZA 4L07A 1YA4A 4IIFA 3EF1A 4FSDA 1DCKA 3G2IA 3HCPA 5EUAA 2VAWA 1IEMA 5HP4A 3ONEA 4MMZB 4OQQA 1Z4KA 4KH1A 2JZCA 1U2GC 3UPTA 1QAMA 3K2EA 1M2NA 1ZD9A 4GS5A 1Z15A 2QUAA 5JYDA 1TTPB 3KPVA 5FAXA 4ZDIA 1IYQA 1HYHA 3K9HA 2X40A 5KWSA 2ONJA 3BFGA 2VDWA 1N9GA 1H4QA 2I33A 1NW7A 3C3XA 1OTDA 4IHJA 3PDIB 3CVYA 1EG7A 4KZAA 5LA6B 2A9KA 3GUZA 4DXBA 3LLSA