3R7WB

Crystal structure of gtr1p-gtr2p complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
314
structure length
294
Chain Sequence
b'MVLLMGVRRCGKSSICKVVFHNMQPLDTLYLESTSNPSLEHFSTLIDLAVMELPGQLNYFEPSYDSERLFKSVGALVYVIDSQDEYINAITNLAMIIEYAYKVNPSINIEVLIHKVDGLSEDFKVDAQRDIMQRTGEELLELGLDGVQVSFYLTSIFDHSIYEAFSRIVQKLIPELSFLENMLDNLIQHSKIEKAFLFDVNSKIYVSTDSNPVDIQMYEVCSEFIDVTIDLFDLYKAELQNVSQLANGVIIYLRQMIRGLALVAIIRPNGTDMESCLTVADYNIDIFKKGLEDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein GTR1
publication title Crystal structure of the Gtr1p-Gtr2p complex reveals new insights into the amino acid-induced TORC1 activation
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 57
structure length 294
sequence length 314
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04670 Gtr1_RagA Gtr1/RagA G protein conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.190 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3r7wB02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r7wB01
2FFBA 2BHRA 2ZQ5A 3PCRB 1FZQA 2IYSA 5FTNA 4Q4JA 5L3QA 1FUKA 1E0AA 1MRNA 4D4JA 2RGEA 1KI2A 4FMCF 5H70A 3TQCA 2C5LA 1W44A 2KB0A 2QQEA 2FA9A 1WBBA 1RZ3A 2ANCA 2ZYTX 1YRAA 2FMXA 2XOKA 4LK2A 2IWRA 3MCAA 4AK9A 3VX4A 1OFUX 2G6BA 4MRPA 2WBLC 1KJWA 2IL1A 4KV9A 2R9VA 1S3GA 2D2FA 1R8SA 2ZVPX 2R44A 4QBIA 3WHLA 2IHYA 4P4UA 4Q4LA 2HYDA 2P5SA 1CR2A 4P4SB 1J2JA 1TF5A 2R8RA 4MDEA 4CT5A 2QZ4A 4JLJA 2IYYA 1Z08A 4AKIA 1Y3AA 4BQSA 1NVXQ 1G4AE 5KNCA 2UZ3A 4KAXA 2CXXA 4IVQA 1G17A 2F1HA 4A0GA 3QVUA 1PVOA 3CZPA 3KKOA 3IPXA 2MMGA 1ZNZA 3TUJC 3OEHD 2O0JA 4XD7A 4KI0A 1QHNA 1XBTA 2G1JA 1JQLB 4BLRA 1R5NA 2ASEA 1AGPA 1FQKA 4O2LA 1OXUA 2ZYUX 2AR7A 1I4LD 4RD1A 5CDFA 1NVVQ 2PL3A 2ZIAA 1E0SA 3OHMA 1VG1A 2QROA 3TH5A 5G41A 1EESA 5EP4A 2ZJ5A 1MR3F 2ZSAA 2GNOA 2OV2A 1E1RA 4F38A 5F3WB 1YZKA 4Z54A 2BM1A 4C4PA 4KSBA 3W90A 3BD9A 2REBA 3CKLA 4HLUC 2IUTA 4PFSA 2XZPA 3QI2A 2PMKA 2FPMA 3DVLA 3T5DA 4W7SA 1M8PA 2FX3A 1SKYE 2YWGA 4IXMA 5EP1A 3W6OA 4DDUA 1VPLA 1NG9A 1YU9A 3OIUA 2QBYA 3OAAD 1UBEA 1OXVA 1BYIA 4DCNA 3I5XA 1VCNA 2NO7A 3ZQ6A 3GLHA 4CVNA 1SQ5A 1V5WA 5AUNB 3I73A 3MWYW 5CYOA 3RRNA 1G3IA 1NKSA 3F3YA 1YR8A 4PPGA 1GDDA 1XB2A 3T34A 2CJWA 5ANRB 2ONJA 1HV8A 1D2NA 1VIAA 2OFWA 2QM8A 2XTNA 5JHGB 2WMOB 5FOTA 5M04A 5SZHB 2Z4RA 4CYMA 1E3MA 2WKRA 3RLFA 1S8FA 5C4MA 3QVVA 4GOXA 5B64A 1ZCAA 3B1YA 4L15A 4QC2A 4TSFA 2ZXUA 4HB0A 3LH5A 4DB2A 4LHZA 4MUBA 2ZJAA 1TPZA 5CK5A 3ZD6A 3LBIA 3K8YA 3MJHA 5EUMA 2IS4A 1GFIA 3EZ7A 4WXRA 1ZM3A 4P33A 3SU8A 4IEEA 4CRWB 4EJSB 4TN1A 2ZJ8A 3RS3A 3A36A 5LPNA 2W6JA 3K53A 3KXKA 3AP3A 1YZGA 2C78A 4L16A 3NBFA 1S0UA 1W36C 2ERYA 2EFCB 2GCOA 3HPRA 3P4YA 1E9SA 3K09C 4HZUA 4D82A 5HZKA 4AKHA 1S9DA 3H0KA 5KDOA 3LRPA 3AGPA 4Q9HA 4F4IA 1QVAA 1CLUA 2H92A 3B1VA 1IXRC 1NF3A 4W5HA 3K0AB 2ZRAA 5KPJA 3AF4A 2YV5A 4ZI2A 1QVRA 1EX7A 5TDHA 4XIGS 2E9SA 2XJ4A 4OQLA 1YZUA 2BMDA 1SVMA 2BEJA 5CYPA 4LZZA 3TKLA 3LLMA 3BGWA 2ZRIA 2NO9A 3SQXA 1GL9B 4IVPA 1IY2A 3IHWA 2IBMA 2A5GA 3FHCB 5HE9A 1OT3A 2FEOA 2Z0MA 3OEED 1D5CA 4XJXA 3W6PA 3KQNA 4Z51A 1Q22A 1Q57A 1N5LA 1U90A 1Q1BA 3C7KA 4MRRA 1ONBA 2HXYA 2RH5A 1XD9A 2ZITA 1UKVY 2QAJA 4TTPA 3GEEA 1Z0AA 4TMWA 4B3XA 1VYTA 5A4JA 2GDJA 2OO7A 2WJJA 3Q72A 3X1DA 2XOKD 3P26A 4B74A 1KAGA 1Z07A 2E87A 1ZD1A 4M53A 1KSJA 3A1TA 2OBLA 4IOMA 2EFDB 3BB1A 4HLCA 2FFAA 2RGCA 2CLCX 4KXFB 5D3MA 1MRSA 2GHIA 2VHCA 3R8FA 1XEWY 3H86A 2H57A 2C04A 4RY2A 4B75A 1ESNA 4XWKA 1NY5A 2ZAMA 3EIHA 4GT1A 2F43A 1NLFA 1KNQA 1GILA 1VDZA 4EFLA 4DLSA 4Z8YA 2EFGA 5G3YA 2Q9CA 2HUPA 4TYPA 3QG1A 5DI3B 5FBWB 1E32A 2ZANA 3MFYA 5BWMA 3IEVA 5HE8A 4K46A 2BCGY 4XD7D 4C0SA 1JBKA 1XRJA 1AQYA 1JJVA 3O47A 3CLVA 2FSFA 5JWRA 1FTNA 3NVAA 2J1LA 4YMTA 3IIKA 4NP6A 1EFHA 1GKIA 2YWFA 2HYIC 4MYTA 4C0KA 4BEJA 1NP6A 1S1MA 4LV8B 3PR1A 4JS0A 5EE1A 4PO9A 4B3GA 4WOPA 5DSZA 2Q9BA 2ZS9A 5LD2B 1NMZA 2FSHA 2GF0A 4AYWA 2GXQA 4K81B 1B23P 1E1RD 2ZRDA 1Y63A 3SDZA 4DZZA 1LV7A 1TQ4A 1CP2A 2ZUCA 3GJXC 4ACBA 5TY0A 4D25A 2OFXA 3LQQA 4BFYA 3QXCA 1HE8B 1MO3A 3ZD7A 4FWTA 2UVQA 3A37A 4DRZA 4MKHA 3C15C 4PPQA 3ADBA 2B21A 2IUUA 4YMUA 3PITA 3AP2A 1T3LA 1E2EA 2GBLC 2VSXA 4TQUS 3SR0A 3TVTA 3L8ZA 1JEDA 1KI6B 4D0NA 1DG1G 1S3SA 3EC1A 4GMDA 3C5HA 1XTKA 4AY2A 1E0KA 4I4LA 4WA7A 4HDQB 4U7DA 1YZNA 1D9XA 2QU8A 4M1YA 1BH2A 4URWR 5FI0B 4FN5A 4BUJA 1F48A 2GXAA 2OM2A 3DEFA 4C30A 3AKCA 3FMPB 4XWAA 5FPSA 4AKEA 1KMQA 3B85A 3K1JA 3F0TA 4KYIB 2WKQA 1XX6A 3N2EA 1OHHA 3A1WA 2IUSA 3SFVA 1KKMA 4C9BA 1G41A 3QPWA 1J70A 1AIPA 4TSFD 1SXJA 4FI3C 3TSZA 1AQUA 4DT1A 3THXB 2ZAOA 4GDFA 4OI2A 3CF6R 1N5JA 3L0OA 1G7CA 3ND8A 4PHHA 1UEIA 4TLCA 1G21E 3U3OA 1IY1A 3CRMA 2ZRPA 2FPKA 1KO7A 2AFHE 2QP9X 5DLQC 3WXMA 4TLEA 5FR2A 2YOHA 5JSZB 3QXSA 5AWFC 2YVUA 3AKEA 2W6JD 4HDCA 3VHXA 4UNNA 4PC3A 3ZZTA 1IN8A 1YR7A 2Z4SA 1GNQA 1UJ2A 1JR3E 1E2KA 2YWEA 3FFAA 2JLQA 4GBMA 3U44A 2NPIA 2RKOA 2WIAA 2QRZA 3K9HA 4M1MA 1A2BA 5DI9A 5GVRA 4HB4A 2F7SA 1BS1A 1RC8A 2F3TA 5K8IA 3G82C 3VU9B 3A1UA 2GK7A 2NG1A 4JLAA 2BMFA 1ZAKA 3IQWA 4G5RA 1F5NA 1XP8A 3W5IA 1MO6A 4Q7LA 4TMXA 4ASUA 4EIWA 5JLJA 2JLYA 2O8EA 2J7PA 3UWOA 2Z43A 4MITA 2XTMA 1RRGA 2O8FB 4DCSA 3MUFA 3U3JA 2XJ9A 3NH6A 1G7TA 3QBVA 3NC0C 1GTVA 1HY3A 1UKYA 4XSHA 1U0JA 4Y0AA 4ZO4A 3KTAA 2WICA 2FZ4A 2ZI5A 3GJ0A 3T1OA 1RKBA 3IKJA 3CR7A 1ZMXA 4DCVA 4DIEA 3TNFA 3TUIC 1XTRA 2A5DA 2JEOA 4DLYA 2PMDA 4KBFA 2FOLA 1P3JA 3OIYA 2BJVA 5CK4A 4M4SA 4LJ9A 2BEKA 5JCZA 1U94A 2G1KA 3VAAA 4B6FA 1EWRA 3SI7A 4R9UC 1Q1ZA 5L3SB 2D7CA 2G0NA 4LOAA 2NMVA 1U8ZA 3EPKA 1QHSA 1G7RA 4NBSA 4NYIR 1JI0A 4EPTA 3WP0A 4TWZA 3W8RA 4Q5IA 1XFAA 3W3ZB 1PLLA 3LNCA 3EZFA 5J4HA 1J8YF 3LX5A 4LBWA 4Q4AB 4QM7A 4PAOA 3SC3A 5P21A 4XVQA 5B58C 3U6KA 5H68A 5IDVA 3CBQA 1J8MF 4YXWA 4NPHA 5EQTA 4A6PA 3MGCA 1Z0FA 1MOZA 1W47A 2PCJA 3D31A 2ZE8A 3DM5A 4PC2A 1X1RA 5IHPA 1R0YA 1QHXA 4TMVA 3U7EB 1KI7A 1R7RA 2Z6VA 1QG4A 3EPHA 1NMXA 1P9RA 4X8OA 1N6NA 3J81k 1SGWA 1DAHA 1F2UA 4RD0A 3TR0A 1G7SA 2G3YA 3TE6A 1QF9A 3KUCA 5DGXA 4J0QA 3MRSA 1IONA 2IK8A 4IJMA 1AKEA 4RVCA 3AF0A 4L9WA 1LFDB 4RD4A 3BBPA 4A15A 4FMCB 2RGNA 1ZNXA 1X86B 2JIZD 4V0KA 3RAPR 4EDHA 2O52A 2B6HA 2ZUDA 4QL3A 5LB4A 1GUAA 3NH9A 2AX4A 2ZRHA 3TLXA 3KB1A 4RJLA 4D0LB 2IYZA 2G77B 2GZDA 1E2MA 1KDPA 3DDCA 5K8LA 1D9ZA 1QHHA 2RGXA 1FPMA 3SS8A 3RDPA 3BC1A 1N6IA 4KFRA 3LW7A 2V1UA 3WY9A 3TJZA 2GJ8A 2V55B 4JL8A 5J40A 3MD0A 3GLIA 5FUVA 4GZLA 1PV4A 1Z06A 3CPEA 4D4KA 4Q7KA 3K9LA 5FBLB 3T15A 3AVWA 2EYQA 5UKDA 5CB6A 1DADA 4IDNA 5DNYB 1FX0A 3A8TA 3NBZC 2J5XA 4ARZB 1US8A 3S1AB 3NBYC 3DOEA 1BOFA 2GXUA 4M9QA 4MKGA 4P3YA 4A8JA 1SVKA 3PIRA 1P2VA 1DBSA 3EWAA 2GVDC 1ANKA 3F8TA 1SKYB 4V0OA 1D2MA 2CL6X 3KXIA 1U2RA 1KJZA 4LPKA 4MRSA 2WWFA 1SHZA 5SZKB 1P72A 1K8RA 4V03A 1P6XA 1OHHD 2FGKA 2VHJA 3E5HA 2QT1A 5BN5A 1FW6A 4BLPA 4DHEA 3CWQA 4F93B 1NVWQ 4B71A 1N0VC 3AV0B 4UNSA 3ZDQA 1SXJD 5CJ2A 4TQ9A 4F7WA 3DO6A 2AD5A 2XNSA 1KO4A 2ZYVX 1ESMA 2ZJBA 1GP2A 2ZE7A 3VKGA 2ZRGA 2WJVA 2LWIA 4JYBA 5KOYA 1N6RA 2B7BA 4IFBA 4IOKA 3THWA 4XOIA 1N6PA 2XNDA 1OPXA 3AVYA 4YMWA 3H4MA 2OCPA 2ZR9A 2AD1A 1KTVA 1ZJ6A 1ZM2A 4G1UC 4M1OA 4MH0R 5SZJA 3WNDA 4LJ7A 2ZRFA 1CF4A 4HUQB 1X3SA 1E2IA 4ZCIA 4Q18A 1T0HB 1JXMA 4DLTA 2HLDA 2X2EA 1I2DA 4HB3A 1Z0IA 5FOSA 4C2TA 2NO1A 3LXRA 3GLGA 3OFNA 3BFVA 3U4QB 1NVVR 2WJIA 3QF4B 4M22A 5L3VA 3Q7PA 4JIMA 1UPTA 3FMOB 4LI0A 4PQRA 4UJ3A 5KDLA 4ASUD 5ELXA 2J7PD 2OZEA 2R6FA 3KKMA 4MGYR 1T9HA 4Q47A 3SYKA 4PZLA 2EWWA 3B1WA 2J46A 3CR8A 4E22A 3FMFA 3FHTA 1E79A 2HXSA 4B73A 1G64A 1KGDA 2J0VA 3T12A 3C14C 1OIVA 1C1YA 1IN5A 4Q21A 2R6GA 4H1UA 2KBEA 1ZYUA 2QAGB 4WZBE 3GP8A 2GAAA 4PO1A 3Q9LA 1OH5A 1CS4C 1Z63A 1T4GA 3TQFA 4TL6A 4C7OA 2QGZA 1CULC 3BXZA 3FVQA 5EP3A 1YKSA 3KQHA 1OF1A 1I4DD 4LJ6A 2HT6A 3FKSA 4WBSA 2VQSA 2KBFA 4DJTA 2QN6A 3CPJB 4LCBA 4M1SA 4PC1A 4QGFA 4DCTA 3RC8A 2J0QA 1NN1A 4P31A 5FPHA 2PJRA 1OFHA 2VA8A 2J87A 3REGA 3E70C 4FINA 4M0LA 3RS0A 1XPRA 2RGAA 3CRW1 2AWNA 3K70B 2CHQA 4TTRA 4FCWA 1Z6XA 4GSYA 5EXXA 2IYXA 2CHGA 2O0HA 3L0PA 4TMTA 2YNMA 1TQ6A 4YXWD 4C2UA 4DCUA 1X6VA 2B8WA 2SHKA 2GWHA 2C03A 3L0IB 1J99A 2JDIA 3GJ4A 5DIFA 2ZETA 1A2KC 1W0KA 3MWLA 4JLOA 1G3MA 1NLYA 4GI7A 2Q3HA 3RSLA 2LCFA 3BWDD 1OV4A 2GRJA 2O8CB 4LDJA 4A0RA 3PUWA 4R71A 5F98A 2WZQA 1LF5A 1II8A 4XTCS 1KK2A 1SVWA 2J0UA 1NN5A 2J7KA 2WWHA 4NCJA 4OL0A 2IYUA 1VHLA 2WM9B 1Z8FA 4F91B 4KODA 3CRVA 5EE9A 4RZ3A 5K8TA 1WBDA 1Z47A 3IO3A 4WXPA 2OCAA 3FMIA 3UK6A 2PLFA 3HR7A 5KHOC 1G8PA 1S1CA 3A1SA 3MAAC 2J3EA 4KBGA 2ZU6A 3AUXA 4RKFA 1W0JA 1L4UA 2QPTA 4LYHA 4RD6A 3TK1A 1P5ZB 1ODFA 3T1TA 3AH8A 1ETUA 3GD7A 2IW3A 4B43A 3T1QA 4Q9KA 4NYJQ 3X1YA 4B47A 4BEBA 4DLWA 2ODNA 1AS2A 2RMKA 3HPQA 3FOZA 1QHGA 3B1ZA 2P2LA 4NH0A 5JFGA 3G0HA 2OFOA 1E94E 4RCZA 1VYUA 2GJAA 1NJFA 2I1VB 5FOVA 3QQ5A 4AWXA 5EE3A 1GSIA 1ZUIA 2DFKB 3U7FB 1KI1A 3GJ7A 2PT7A 3KZ1E 1E2LA 2WWXA 2KJQA 3OESA 2BVNA 2IA5A 5EUQB 1YR6A 4WZAE 4EPRA 3VFDA 4LY6A 2EU8A 221PA 2HT1A 4I99A 3UMSA 1XF9A 2OILA 2WJYA 4AYTA 2Q6TA 1VG9B 1A82A 1KJYA 5JZVA 1XD2A 5D3QA 4OK5A 2N46A 4Q7MB 2ODEA 2WIBA 2P6UA 3P20A 4JBXA 3HJNA 4KYUA 2NQ2C 2CHVA 4QXAA 1A4RA 2Q21A 3EZ2A 4ON9A 3Q8XB 4C0JA 5DO9A 3BORA 3QKSB 1DARA 1M7HA 1GL7A 3JVVA 3V4FA 4A82A 2CE2X 2H17A 3AEZA 3BRWD 4V0MA 5J4KA 1LB1B 3WBJA 1KI8A 4ESHA 1EFRA 2CCKA 2QEQA 2QTHA 5HCIA 2Q9AA 4QJ4A 3KJHA 5GADl 3RRZA 3THYB 2HCJB 2GESA 2XNDD 4I1UA 2NOAA 4BRWA 4KJZA 4WZ6A 1Z0DA 1OH6A 4P4SA 2ZJ2A 2OT3B 1GAJA 3IQXA 3ZZ0A 4OBEA 4KO8A 2CK3A 4MGIR 3MSXA 2BM0A 4M8NE 4S2EA 5BXQC 4NTZA 1Z0JA 4XTRA 1XTJA 1VECA 2JASA 5L8VA 1E9DA 2A5FA 2DYKA 3PUVA 5EZ6B 3N70A 1M2OB 2FSGA 1RRPA 2HDNB 2HLDD 2WKPA 4KLZA 1F2TB 3K0FB 3TVDA 1JXOA 4M1TA 4YMVA 3OFND 5KYKA 4DDVA 3EG5A 3VR4A 3HYTA 4BLSA 4LGMA 2DPXA 2AXPA 5AK0A 1CU1A 2D2EA 2HF9A 2QMOA 3K9NA 4JVLA 1YR9A 4CW7A 4JLPA 4TYYA 3Q5EA 1LNZA 1E79D 4JVMA 3LWNA 4O0MA 4C0AC 2QY9A 2C8VA 3ECCA 1TUEA 5CIQA 3U3RA 4V0LA 4QBGB 2QPOA 1ZBDA 3SBEA 3TW4A 2BMEA 2N42A 1E9AA 2IEYA 5FFMA 4RCYA 4RZ2A 1UKEA 4F4CA 1C4OA 1OXTA 3L8YA 4LYAA 2FFQA 2P3SA 4LHXA 1DOAA 1AZSC 2X19A 3FKSD 3NIBA 5FL3A 3EAQA 2AHOA 4TLAA 3JVUA 4GMXA 3FKQA 1S9HA 5LDDC 4PSVA 4B3FX 3U7HB 1Q12A 3HU3A 2FWRA 4B44A 1JECA 2CCGA 5EXSA 3UWKA 5BN3A 1G1MA 2DHRA 3MWKA 4PX9A 3LQRA 3LVQE 2VBCA 3B6EA 1U0HC 2F55A 4Q03A 3CX7A 2W6IA 1KO5A 4JVSB 3UKDA 4OI1A 2EWVA 3PQCA 3CH4B 3Q5DA 3P4XA 1XPUA 3WYFA 2VL7A 4BGDA 3U60B 4II7A 2JDID 2F6RA 3CB4A 3W6NA 2FDCA 1W0KD 2P6NA 3CWZA 2ZJZA 4NONA 4Q02A 2XB2A 4AG5A 2WOOA 1GNPA 2R62A 2IYWA 1G3UA 1Z5ZA 1EFTA 1P62B 1GIAA 2LKDA 2XTZA 1E4VA 4BE7B 4LJ4A 3KDSE 4M1WA 4EJSA 2O8DB 3EZ6A 2V1XA 1E2FA 1GG2A 2YWHA 3QKRB 4O2RA 2JLRA 4AKGA 1M74A 1W36B 3SNHA 4LJYA 2ZI3A 1XXHE 3AUYA 3X2SA 4ZIRB 2WVJA 4EQ6B 1CJMA 1Q1EA 1SVOA 1W0JD 2X1VA 521PA 5C4GB 4EFMA 5B2ZA 2D7DA 3K0AA 4UXHA 4EPXA 1B0UA 4OI0A 2Y8EA 2YOFA 4BFVA 1X8KA 2WWIA 1NBMA 5SZIA 4Q1FA 4A9AA 2VP2A 4A2QA 4EUNA 2YKGA 4B3CA 4Q7JB 2NPFA 2ZS8A 1OW3B 3GLFE 1RPZA 4IHQA 1G18A 1VMAA 4PSAA 4KITB 3AM1A 1PUJA 3TAHA 4CDGA 5H1YA 1M1YE 1F6BA 4LBVA 1FMLA 4GP7A 1IHUA 1VCIA 3NBXX 3BH6A 4BFUA 1HEIA 4A2PA 3WRXC 4FWIB 3JZMA 2VHUA 1R0ZA 1W49A 3K9GA 3VR5A 5KSZA 3KJGA 4IOLA 2IS2A 3PV0A 2ZR0A 2YYZA 3H1TA 4XVUA 4ZDKA 4LC0A 5E4FA 1ZM7A 3RS4A 4RFSB 3UIEA 4F4JA 3E2IA 4FD2A 1T6NA 4UKDA 3ZVNA 2ZRMA 5HKKA 5KSPA 4TYQA 1WE2A 1UADA 4XVRA 1MABB 1PJRA 4Y0VA 1EFRD 4FMBB 1MO4A 1Z0KA 1BMFA 1DTSA 3CF2A 1NL3A 2WAXA 1E96A 5AJVB 1D8TA 3RYTC 2CK3D 2GILA 3CNLA 3T61A 4AURA 4QRHA 1ZIPA 3EPLA 1VYVA 2IT1A 2QG6A 5DI3A 1DELA 2YHSA 1TAGA 2RGGA 4C0BA 1GVNB 1GRNA 4Q4HB 4HAVA 2VHTA 3LLUA 2C96A 4KVGA 3DHWC 4TYWA 3TSOA 4C3ZA 2D62A 3U3MA 5EE5B 4FCTA 2ZU0C 1XEXB 3CZQA 1YZQA 5FPYA 3EASA 4YMSA 5G53C 1HURA 2Z83A 1TQ2A 1HTWA 5JJLA 5FUXA 3PUZA 4JJKA 3FFBA 2ORVA 1W7AA 4AI6A 4PZZA 3WMGA 1CJTC 4PZYA 2EVWX 4LJ5A 1G20E 2FFHA 2O5VA 2WWGA 2V7QA 5BYKA 4ITRC 3B2EA 4OK3A 3BAFA 2IS1A 4MYUA 2RHMA 1XWIA 1E9FA 5JI2E 5KNBA 5AUOB 5L3RA 4BFTA 5KDDA 1S4QA 4LYJA 1TF7A 5F2EA 1ZU4A 5FTLA 4MRVA 2JJ1A 4KHZA 3TW8B 4A1FA 4N0DA 4CEJB 1KI6A 2D74A 5JEEA 2QP4A 1F3OA 1ZIOA 1R5BA 3W3AA 2YJTD 4PPNA 1T91A 1XTQA 1W4RA 4YLGA 3WNBA 4PSKA 1SXJC 5TV2A 3A1VA 1NSTA 1KYIA 2CLDX 3HU2A 3CRRA 1FOEB 4QGHA 5LBIA 1I4TD 5CITA 3RANA 1SVSA 4HI0E 5AJYA 1ZM9A 4DLZA 1HT1E 5JJIA 1NMYA 3PXGA 3QSYA 2W6ID 1G3QA 2PH1A 2PJZA 2QP3A 1KSFX 4RD2A 4JJZA 4LSGA 3BJIC 2J41A 5CDFE 3LXXA 4CEHB 4ERNA 5CIWA 1EK0A 4OYHA 1M7BA 1W4BA 3GEIA 3THXA 4WW0A 1CRPA 3QJYA 3CX8A 2CVFA 2QPAA 1AJEA 1OIWA 1M34E 1OYWA 2RHDA 3OE7A 4YONB 1HH4A 2R6AA 1YVDA 5E7JA 5BN4A 3BB4A 4TZ6A 5JSZA 5JI3E 3AVQA 4MGZR 4JLMA 1X1SA 4OQNA 3QXHA 1VCMA 1ZUNB 1XCPA 1UM8A 4C0QC 3HDTA 4CGZA 2IEZA 1U0LA 2W83A 2NIPA 4HUTA 1RRFA 1JALA 4B34A 2UKDA 4F92B 1TF2A 4EPYA 1N2CE 1NRJB 2OUKA 3DMDA 2FEMA 1MH1A 2DBYA 3VU9A 3R7WB 1NBMD 4LJAA 5FR1A 2F9LA 3CNNA 4G0NA 2CVHA 1ZC3A 3X1WA 2G88A 2ZPTX 1WMSA 3GCGA 1Z83A 2O8FA 2CMKA 1WB9A 4OHVA 4OK6A 4POAA 3ETLA 3R20A 4TT3A 2QMHA 4P32A 1WCV1 3KQKA 1XTSA 2MMCA 4PQYA 4NCKA 1JJ7A 2GVZC 3IUYA 4C0HA 4Q19A 5C46F 1R10A 1KI4A 2PEYA 4B32A 1E69A 2ZRLA 4NKRA 4MA4A 4DSTA 1QHIA 2R2AA 2WWWA 4FXPA 2QGNA 4US2R 1VCOA 3K0SA 2ZE5A 4R98A 5AUPB 1C9KA 2IWHA 3AVXA 3EX7C 4LPSA 5F9HA 2JLUA 2C9OA 3M4YA 5L3SA 5GJBA 2X2FA 1DE0A 2AFIE 2A3RA 1IJFA 5HKKD 4KSCA 3OZXA 4RD3A 1P61B 1IN4A 4LJ8A 3UPUA 3I8SA 1BMFD 4MYCA 1RVDA 3PG5A 4NU0A 4Q4AA 2I4IA 4QNRA 1Z2CA 2RGNC 1K5GA 2XXAB 3SJZA 2HJVA 1N6KA 1GL6A 2QE7A 2PT5A 2CEAA 1OFTA 5FUYA 1U8AA 3N2IA 4M21A 3RWOA 4BASA 4BLTA 4BFXA 3BIFA 2N1BA 1N0UA 3JZAA 2QORA 3BK7A 3KJEA 4Q1DA 5B57C 3ZYCA 4DDWA 1E2QA 4NZYA 1CXZA 5C1BA 1GKUB 1E2GA 3VR2A 1LY1A 4URXR 5HZHA 1GNRA 3IGFA 4LV6A 5JRJA 2WJHA 1RRCA 2JLWA 2MSDB 1CEEA 4ZKEA 1Z6TA 3KQUA 4UJ5A 2QI9C 2VLIA 1KZ7B 4JLVA 3PJRA 2DB3A 4MDFA 2BKEA 2BBSA 2V7QD 4NHOA 1MO5A 3Q7QA 4NYJR 4A8JC 3NDPA 1E9BA 4LBYA 3IILA 2P6RA 3ND9A 4G5QA 3BB3A 1IQPA 3I1FA 2Q3MA 1P9NA 1P2UA 2ONKA 2RAPA 4O3MA 4NMMA 3SHFA 5DISB 2JJ1D 2R6CA 1GRRA 3BH0A 3NC1C 3TUZC 2O8BB 1G5RA 4ARZA 1JPNA 3S1AA 1XPOA 3AP1A 3AF2A 4PXAA 1KMHB 821PA 5BYJA 1TEXA 5JHHB 2ZRNA 3LW8A 4KU4A 1KO1A 1VIYA 3SYLA 4D26A 1G8GA 3RS7A 3B78A 3PEVA 1M7GA 2ZJOA 1U98A 4NL4H 3FB4A 4DIDA 4DSOA 1KSGA 3QIAA 4CEIB 1W4CA 2KI5A 1G9XA 1H65A 1WXQA 3RRMA 3IBYA 1DAEA 5DYIA 5A0FA 1TX4B 3C5CA 2VF8A 5TARA 4JL6A 3GEHA 2FPLA 3WHKA 5FH9A 4HYYA 1U8YA 5FBVB 5KUTA 2QMUA 2DCUA 1KDOA 3QNUA 1JQJC 2AKYA 3NWJA 1COWA 1P7CA 2ZR7A 1TL7C 3OE7D 1S2MA 1TTTA 2XSZA 2OESA 3LD9A 1NN3A 4ZCLA 1T5IA 1TU3A 4IOJA 2IXEA 4HUQA 4NDZA 2AL7A 1S96A 2ECKA 3WRYC 2JGNA 4I1SA 2F3RA 5BW8A 4DEXA 2CCJA 3UMRA 1AS3A 3VHLB 3UATA 1BKDR 3CIOA 4WAUA 4HATA 2C98A 3NHBA 1H8HA 3ADKA 3KL4A 4PANA 3VNVA 1OB5A 1NJGA 3L82B 4IW3B 1RJ9B 3BH7A 3X1ZA 3QXJA 3U4QA 4HAYA 3QF4A 3K0CA 3ASYA 3KX2A 1N6LA 5J4YA 1WDTA 3K0EA 3I61A 3EPJA 1SVLA 2PZGA 4GOJA 3CF0A 3WMEA 1W5TA 3MJRA 2QL6A 3PEUA 4Q1EA 4TT3D 5TB5A 4RKEA 2DY1A 1XXHB 3ICEA 1HQCA 2ZS7A 2JLVA 5IF9A 1N0WA 1VKJA 4CT4B 1XNJA 3PUXA 3ZIAA 3A6PC 2GJKA 1XMVA 2QAGA 5FPTA 3UXMA 1IY0A 1F60A 1H8EA 4Z1MA 1SXJE 2OCYC 1IXZA 3QOFA 3WBKA 2WSMA 3SBDA 3MLEA 3O8CA 2FH5B 1AK2A 3GLFB 4WIAA 1EX6A 1A1VA 3LY5A 2C9CA 3I72A 2YC4C 1DEKA 2KE5A 1OYYA 1L7VC 3IO5A 1NN0A 2IXGA 4YC7A 2V6IA 1ZU5A 1NIJA 1M6NA 1DPFA 2ZUBA 4IDPA 1JR6A 3QEJA 1NI3A 1Q21A 2ZSEA 1DAKA 1U9IC 1KK0A 2KSQA 3AQ4A 4A92A 2RB4A 2JLXA 4JBYA 2XX3A 1W5SA 2WV9A 4B2LA 2ZI4A 2C2HA 1U9IA 1JEEA 5CB8A 1J90A 2CBZA 2IYRA 4NE2A 3T06B 5DHAA 4Q1AA 1TEVA 4BWYA 4IEIA 1GRQA 5AUQA 3CRQA 4QG7A 1NIPA 1YZLA 4FCVA 4M9ZA 3LV8A 4D81A 2ZI7A 4Q48A 3KFXA 2OBNA 4JYCA 4URUR 4Q9JA 5H8WA 3QENA 2BKUA 5CJPA 2QENA 2O8CA 3RWMB 1YZTA 5EXPA 5JS7A 1DAIA 1AM4D 3QUSA 4BFWA 2ZI9A 4B3BA 1JPJA 5GJWC 3C8UA 1ZINA 1G6HA 1NKTA 5C18A 1WRBA 1TMKA 1VHTA 2HCBA 3ZLJA 4R2IA 2RCNA 4DVGA 1G8HA 1W2GA 5TMPA 4FW9A 5HTKA 1XJCA 1L2TA 2NTYC 4LHWA 1IN7A 4MUAA 4L8GA 1FP6A 1DAFA 3CUEF 4URYR 3TIFA 4BPBA 1G4UR 3EW9A 4X8LA 2OAP1 2VHQA 2VIIA 3H2YA 3CX6A 2R65A 2BWJA 1E9CA 4GOKA 5DE3A 2C77A 1ZC4A 5LB2A 6Q21A 4QJ5A 2DWPA 2L0XA 2XAUA 2OCBA 4S35A 3NHAA 4Q4JB 4MKIA 5L3QB 1R2QA 4B2IA 2V4ZA 4HEJA 1K5DA 2A5YB 4DSNA 2REOA 2J59A 4JL5A 1G5PA 2JJ2A 1HE1C 3NG1A 2FNAA 3WYGA 1CKEA 4HB2A 3SN6A 2H1LA 3SJAA 3B9PA 2CDNA 3M0EA 3PENA 2OXRA 5G40A 1KO8A 2X8AA 3FDIA 3F5FA 2ODWA 3CH5A 3N5CA 1E0JA 3EIQA 1R4AA 1N6HA 5CLQA 2W0SA 2ZRJA 4NYMQ 4L9SA 2ZTSA 5GVSA 5TVKA 1Z6AA 3QKSA 4OJQA 4QBFA 1FUUA 2B92A 2I1QA 3OIVA 4TYNA 3AB3A 1UKZA 2BDTA 3W8NA 3FYHA 721PA 2WOJA 3HR8A 3EC2A 1COWD 3THYA 4Q01A 1W48A 1KY3A 4GRAA 4H9GA 2XSZD 4OQFA 1ZM4A 3QXXA 4B3DA 3SEAA 2ZJYA 1BYUA 1R5OA 3L2OB 1E2DA 4V0NA 3GLIE 2WSSA 5EE0A 5FL7A 1TQDA 1HT2E 3HP1A 1XD8A 2R6DA 3IBGA 1G8FA 2OLJA 4PHFA 3CONA 1YJ5A 1XMIA 2GA8A 1PUIA 4UNQA 2OBMA 2FN4A 2QTVB 1F2TA 2W2VA 4QBHA 3K0FA 1H8HD 1IN6A 3R9IA 3ASZA 3GFTA 4LBZA 5JJKA 3C4JA 4TL7A 4EPWA 1L8QA 1Z28A 1Z6GA 3DKPA 3IIJA 3ZGXA 1XZQA 3U2QA 4B33A 3RSOA 1OIXA 1JR3A 3PEYA 3PVSA 3EA5A 1DS6A 3IDQA 3LBNA 2QBYB 4GNKA 4EPVA 1OH7A 4QHTA 2A5JA 3SQWA 3ZIAD 4A0FA 4URVR 3B82A 3AKDA 3GLHB 4R7ZA 1SULA 3TGPA 1H8ED 4Z1MD 1RYHA 1N5KA 2GEUA 2I3BA 4D4MA 5DYGA 3GFOA 3D6TB 2DFNA 4HLUA 3A58B 2IX3A 4BRUA 1FNMA 5JBQA 2CJWB 3SJCA 8OHMA 1IM2A 3DPUA 1W1WA 3VNUA 3QPVA 2FZLA 4NCIA 1XJ0A 1LTQA 4AIIA 4EFNA 5K8UA 2B8TA 3EWSA 2QQ0A 1HA3A 1ZP6A 5KU1A 2HEIA 4JT2A 4HDOB 3KKNA 4LUCA 2WWYA 4CZ2A 4B6EA 1UFQA 1II0A 3P1JA 1G6OA 1Z22A 1RE0A 3DZ8A 2WMNB 2O0KA 3K70D 2A9KA 5FBRB 3V00A 2ORIA 3QF7A 1MT0A 1OB2A 1P2SA 3IPYA 5JECA 1GM5A 3R9WA 4IDHA 3GLGE 3R8CA 4O25A 1E2JA 3B13B 1O3YA 4D6PA 2BBTA 4EJSC 5E7IA 5E7MA 2BJWA 2ZYWX 4M1KA 3FE2A 2GK6A 1SVIA 3VX3A 2CL7X 3I92A 4LV5B 3FHOA 3VKWA 3SZRA 2DWQA 2GCOB 1IAQA 2IC5A 1YE8A 4MQBA 4CIDA 2BCJQ 4HZUB 2F1JA 1Z2AA 3MG9A 2H16A 3GJ3A 1Q0UA 4DKXA 4GP6A 4YQFA 3CM0A 4JKIA 4HSEA 2G9NA 1CBUA 2ANBA 3QE0A 3PEWA 1CJVC 2ERXA 2FGJA 4TLDA 3WYAA 2O8DA 5DH9A 2CLSA 1AS0A 3QKRA 3DL0A 2W2TA 2ZEJA 1XJQA 5DN6A 2GAOA 4QKQA 2F1RA 1E9EA 1Z6YA 5FOXA 4QFMA 1TU4A 4LYFA 4ZIRA 4HAZA 4XH9B 3K09A 3ZVRA 4EQ6A 2IYVA 1EFCA 4DWJA 1E9RA 4PC7A 3VTKA 1ZD8A 2FSIA 2DFLA 4BFSA 1PLKA 5B30A 1OE0A 4TL9A 4HAUA 3W34A 3NEYA 3I32A 1N5IA 2IYQA 2ZE6A 1CR0A 1QDEA 1W4AA 4RFVA 2FE4A 3B60A 2D06A 2PBRA 2PZFA 4US0R 1DO0A 3TSWA 2RGBA 1XEWX 3ZZUA 3QBTA 3I3SR 3ADDA 3ZJYA 1XCMA 4ABYA 3OIWA 5JRZA 4ACAA 3D8BA 2ZSFA 4Q00A 3UG7A 1U81A 2JJ2D 3O8DA 5BQ5A 5AR1A 2XZLA 2WAYA 3RNLA 2WPDA 4IDQA 3FGNA 2H7VA 2VF7A 1WP9A 4OQMA 5AJZA 5D3MB 3IIMA 1Z29A 1LVGA 1QZXA 1ZNWA 2TMKA 1XZPA 2PX0A 2PZEA 2F1IA 4GFDA 3RS2A 2F43B 4PAQA 4DLXA 4RFSA 4GPTA 1N6OA 1ZRHA 1QBKC 3ONWA 5JCPA 2IS6A 3BOSA 1P2TA 4AYXA 4C0LA 2ZSDA 1LF0A 1E1QA 4JSTA 4YDHB 3REFA 5FTMA 3HU1A 1UBGA 2YZ2A 1MABA 2VSFA 4QM6A 4AD8A 2FG5A 2A78A 4FMDF 1NLZA 2GJSA 4IRUB 2BMJA 3BFXA 5F9FA 2BV3A 3VMFA 3B8HA 1Q3HA 3ZQJA 2GKSA 3GFPA 2DWOA 2WSSD 4AG6A 2PEZA 3ADCA 1UBCA 2D3WA 5FL7D 3LDAA 2EW1A 2VEDA 5LD2C 3OF5A 2MSCB 3AGQA 3TBKA 1OKKA 2QSYA 3QKTA 1CR4A 2JIZA 4PHGA 1RYFA 3RVBA 4MRNA 1EWQA 1KAOA 2V8OA 4L5BA 4Q4HA 5E3HA 4OKSA 2J45A 4X8HA 3Q85A 1KKLA 2OE2A 4OJKA 3EZ9A 3TMKA 2D4HA 2DFTA 3SE0A 3GJ6A 2AN9A 1KI3A 4OQXA 1XEXA 3EXAA 4L4UA 4BZQA 1HQYE 5J4VA 3AF1A 4H1VA 1JR3D 2JATA 3O8BA 2GZAA 3C16C 4ESVA 1D2EA 1OSNA 1HYQA 3I8XA 2AK3A 3B1XA 1U99A 4P0TA 3ZS8A 3AKYA 4I1VA 5EP2A 5JS8A 1P4SA 3SHWA 1L4YA 2GZHA 2V3CC 2XGJA 4V0ME 3LX8A 3X1XA 3FTQA 4MKFA 4Q9IA 1T8TA 4ZPXA 2OAQ1 2IXFA 3T1VA 2VP4A 2G83A 3GPLA 3P27A 2HJGA 2GBLA 4OHWA 4QGAA 1T3HA 4CEJA 1FQJA 4G5SA 3HYRA 5FOUA 4OI4A 2IF0A 2NZ8A 1UDWA 2BBOA 2EYUA 1G19A 2DR3A 1SXJB 2GCPA 2X77A 4JLBA 2IF2A 1AGRA 2CNWA 3NKVA 3U61B 1XMSA 3ZVMA 1QRAA 4DT1B 5KNDA 2FJUA 1ZD9A 2VO1A 4W9MC 5FTJA 2JLZA 4QGGA 3SFZA 3LAWA 2VP6A 4HAWA 3W5JA 1MV5A 2GXSA 1P9WA 1UDXA 4B76A 2HV8A 3MMPA 4CEHA 2GCNA 1DO2A 1AKYA 2GTPA 2VP5A 4U00A 1WF3A 3U44B 5C2JB 4NCNA 3AF3A 1KY2A 3LA6A 2NO6A 1W2HA 4HAXA 4B2PA 4V02A 4DC9A 4I81A 1UAAA 1TADA 3B7GA 4BZPA 2C95A 3GLHE 3UMFA 4LHVA 5FUWA 3EIEA 3LBHA 3UG6A 1N25A 1GOTA 3L43A 4Q66C 1G291 4RZXA 1GKYA 2O8EB 5DN6D 4PC6A 1ZVQA 1P73A 1W36D 3I62A 1WA5A 1JAIA 1LS6A 121PA 2A2ZA 3SOPA 5CM9C 4JLNA 4JLDA 4QNMA 4E03A 1OH8A 4MGKR 1RIFA 2VP0A 2XITA 4HLDA 4W5JA 3VR3A 4RZUA 3KTAB 4D80A 2ZREA 4WVFA 1FFHA 3R7WA 1YQTA 2LKCA 2PCLA 3CW2A 4DBLC 4DUGA 2H8KA 3U3KA 3RABA 3M6AA 3WMFA 4BECA 2QSZA 3I5YA 4Z8XA 4ZDWA 4FIDA 5DHFA 4JMPA 3AVUA 2EFHB 3IHLA 2FV8A 1VTKA 5JMTA 3M1IA 1A7JA 1KK1A 2VRWA 5HR5A 1GITA 1KNXA 1KK3A 5AJXA 1CRQA 2QUZA 4E5UA 5FTKA 1ZUHA 2EQBA 1XDBA 4G5GA 3IEUA 2VSOA 2WPDD 4PTLA 4MYHA 2FF7A 1QHYA 2KWIA 4KVAA 1CJKC 2PX3A 3H84A 1EXMA 1SHKA 4JLKA 4LX0A 3QEOA 4IDOA 3WP1B 1CTQA 1E2HA 4E09A 2P65A 2MSEB 4YDSA 5EJEA 2C9YA 4IVRA 3B5JA 3NEJA 2NGRA 3RRYA 3AVTA 1E1QD 1GZSA 2XEXA 1T3SA 1IBRA 3FWYA 5IT5A 4XWOA 3ICQB 1F2UB 3PUYA 2ZRCA 1BO6A 1DAMA 3KB2A 1X8JA 4UQOA 4G01B 2XXAA 1E2PA 2G0TA 2QM7A 2JCSA 2GEVA 2CL0X 4OHZA 1NBME 2VH5R 1R0XA 3V4RA 1PLJA 1R0WA 4TZ0A 3U6BA 1VG0B 3KFVA 1Q44A 4DSUA 4UNRA 1O87A 1FMJA 1QHHB 1UEJA 1OKKD 1R6BX 1ZCBA 2F9MA 2WHXA 4M9SA 1E98A 2W2XA 4DB4A 1Q1QA 1P75A 3TRFA 1LW7A 2B7CA 1Q3TA 3P32A 4M9XA 2NO0A 2P67A 3T5GA 3GLIB 1G8YA 2V6JA 3I4LA 5EZ5A 1YRBA 1OXXK 5JEDA 4DLVA 5HPYB 2E1RA 2ATVA 2YOGA 3KUDA 4D4LA 5J47A 3HWSA 4KFTA 2BIFA 5JWHA 1TUIA 1HUQA 3QPUA 5IK2A 1ELOA 2P5TB 2Z5FA 3VQTA 1FX0B 1KZGB 2REXB 2W58A 2IYTA 4BLOA 1US8B 5E95A 1J7KA 2HF8A 4U02A 4D2IA 2JLSA 4A8JB 1DAGA 2AKAB 4URZR 4DLUA 1FP7A 3GJ8A 1JB1A 2ZSBA 3GMTA 4KCGA 2QRNA 3BS4A 3RHFA 2FU5C 4QOSA 4US1R 1NVUQ 2H5EA 3QG5A 4UXJA 5A5GA 3TR5A 4JSYA 2RGDA 4UXIA 2O8BA 2VTKA 1E99A 1N3BA 5FI1B 1AZTA 1NNEA 4JT4A 1XTIA 1K6MA 4EAQA 1KMHA 1P60A 4BFZA 1DVRA 3TAUA 2CNWD 4R2HA 3EA0A 3LVRE 1XMJA 1KDTA 2VYFA 4A6XA 2JA1A 1T8UA 2ZI6A 5J5CA 3THWB 2BBWA 1AN0A 1VG8A 4NYMR 4CEIA 1OJLA 4AC9A 1DG3A 3KKPA 2J0SA 2XZOA 1ZW6A 3A4LA 3CNOA 5KTYA 1E4YA 3G5UA 2CE7A 2VP9A 4DDTA 2ORWA 421PA 4PPFA 4BLQA 4A36A 4UNPA 4A2WA 5KSYA 4D0GA 2ATXA 3GJ5A 4U5XA 3BE4A 4QHSA 1X8LA 3CPHA 4N1AA 4PHTA 4DEYA 3VR1A 1AA9A 1RFLA 2P0EA 2QT0A 3OEHA 4W5WA 1R8QA 5AJWA 4KFUA 5HCNA 3GLGB 2GJ9A 4RSGA 4ZI3A 1E2NA 3ZS9A 3K0CC 1GWNA 4I1OA 2BOVA 1KHTA 4N0EA 1T0JB 1W46A 4QJ3A 3GQBA 4NCHA 2JAQA 1RW4A 3DZDA 1KOFA 2QMEA 3R9XA 2EFEB 2OEPA 4IFEA 2QAGC 1I2MA 4Q1BA 4OHYA 3EARA 3KXLA 3D7MA 1OFIA 1RJ9A 1KIMA 4XSGA 1NSFA 5J4LA 4DUGD 4C7OB 3AVVA 4TQAA 3V9PA 1OLOA 5FPKA 3CO5A 3NXSA 3DMNA 3VR6A 1E6CA 3ZH9B 1JNYA 2J9RA 3WNCA 1KDRA 1WQ1R 3DOFA 2OG2A 2ZRBA 3A4MA 1XXHA 3VKHA 3OAAA 1FL9A 5JWOA 4GL2A 3BFKA 4A0HA 3L0SA 2Q3FA 1QG2A 1XCGB 1MKYA 3QKUA 3QY0A 4G3XA 1IJEA 2AK2A 2V9PA 2ZVQX 1TNDA 4JZKA 4P4TA 5CLLA 4TMZA 5GJVC 4IKEA 4NYIQ 2C99A 2IYLD 1LS1A 2OSBA 4PAMA 5CM8B 4EKDA 4ZDJA 3K70C 4PO8A 1SZPA 4PR0A 3PFIA 1ZNYA 4HZIA 5GJCA 3GLFA 4OHXA 4B35A 3RC3A 3SYNA 1YHNA 2GETA 2WTUA 2AWOA 4LRWA 5KPDA 4QHYA 4LC1A 1EG7A 4TMKA 4N3NA 4E07A 1CJUC 2Q0HA 2A7QA 4Q9LA 2QE7D 3U7GA 2VPPA 3Q3JB 3D3QA 1XU4A 5EXTA 4A4DA 2A30A 3NDBB 5FOWA 3AVPA 2PLRA 2NZJA 4LHYA 3O8RA 4BZXA 1NY6A 1II8B 4DLRA 2J0UB 4PQFA 2BC9A 2AXNA 2GEDA 4X8MA 4KLNA 5TXGA 3RS5A 5IRCD 1BIFA 1EGAA 3ZVLA 3THOA 1T5LA 621PA 1Q20A 2QA5A 3DKVA 4ILEA 4ZDIA 2GF9A 1EFUA 4JBWA 3E1SA 1IOZA 4B48A 2IHBA 3AVOA 4M2LA 2UZIR 4G5OA 3DM9B 4TTQA 1UBFA 2QNRA 2JJ8A 1JAHA 4ZKDA 5G3ZA 1OXSC 1KSHA 2OLKA 1FTSA 1II9A 1SKQA 4CF7A 3C41J 1D6JA 1KI9A 4TLBA 1NG1A 3T35A 3B9QA 5KSOA 2YC2C 3MWJA 4IXNA 1V43A 2H18A 1G3RA 4K8OA 2OXCA 5FBQB 3BERA 1UF9A 4JVNA 5IK2D 2QTFA 2ZROA 4ZCMA 4FMDB 2ZM5A 3LFUA 1IXSB 1PZNA 4LWZA 3KJIA 2XB4A 3SJBA 1CIPA 3UANA 5KO2A 3NTUA 4GZMA 3U5ZB 2V54A 4JKYA 2W0MA 2ZRKA 3OEEA 3LO5A 1G16A 3KKQA 4TL8A 4ZV4A 1Z3IX 4Q1CA 3A4NA 1CR1A 4KFSA 2W00A 2YINC 3W9YA 1XEFA 4HLQB 2ODBA 1G5TA 4DXAA 3KQLA 1XD2B 2WJGA 2OHFA 1A5TA 1FNNA 2K5UA 3FPAA
chains in the Genus database with same CATH superfamily
4MWGA 2FFBA 4JP3A 1MH9A 3GROA 3PCRB 2R97A 1D4AA 4D4JA 1EAYA 1W44A 2XOKA 1OFUX 4F72A 3K6KA 3Q9SA 3QNCA 2IPXA 4CT5A 5EZYA 2DH5A 4I9UA 3OTOB 4R1QA 2IH4A 1OBHA 3QVUA 1XZLA 5MN5A 3OE4A 1XBTA 1F6WA 4MWTA 1ODTC 1OXUA 1A9PA 2GH1A 1JHDA 2QROA 4KQDA 4CNQA 1PKEA 5DPMA 1LZLA 2N3ZA 5ITVA 3E5RA 4Q0IA 5KJ1A 2BM1A 1O5OA 3GDFA 1H4VB 2PX4A 1K55C 3JQ6A 1NG9A 1S6YA 4DCNA 4KRGA 2V0CA 1N9ZA 2ZBBA 1BC5A 4QOFA 2XOEA 3DOCA 5ALSA 1VRVA 5J2TB 1TZJA 2A14A 3ONEA 1UXHA 3Q4GA 4X20A 5M04A 3SKVA 2HH9A 1UP4A 2CW5A 4RJ2A 1CZRA 4N9QA 3SSNA 4Z4IA 4RH0A 3HCOA 1WSAA 2QE6A 4XWTA 1TJ5A 3KSFA 4TN1A 1J1UA 2C78A 4CFZA 3GBPA 2QTCA 5BUZA 1F12A 3AY3A 1DJNA 1QVRA 3IXLA 3OLZA 5JANA 4R3JA 3DMHA 3TOXA 5FUQA 4GAEA 3SQXA 3CWFA 4IVPA 2XWSA 1OT3A 2FPXA 4YAIA 3W6PA 3DBLB 5KYXB 1N5LA 1GLNA 4HPJB 5M1AA 4QASA 1CZOA 1WUTA 2Y91A 2GN6A 3MM4A 3OLWA 4FDTA 3N7UA 4C08A 4Y2GA 5ELLA 1M3SA 4HLCA 4FOTA 4HVLA 2AZXA 1DFHA 2CLCX 3NU1A 4V24A 3WIBA 2IDZA 2BFMA 5D86A 2DBRA 2ZZKA 4RV4A 4YJ3F 2JLAA 1A3CA 1QYVA 2VJQA 5H9VA 5HE8A 1L7AA 2YXNA 4JA0A 1KMCA 4G81A 4RIGA 3RBXA 1QGOA 1GJRA 4R8KA 1GZ5A 5A2QA 4YMTA 3IIKA 1GKIA 4R2MA 1NP6A 4LV8B 5DSZA 4IYRA 3CX3A 4A7PA 4AZTA 1B23P 2FZVA 1E1NA 3GCZA 2B1JA 3PC8A 4K87A 4UTVA 1EZ4A 1ESEA 3O84A 3I5MA 1P1FA 3K0KA 2R11A 1ODJA 3KQOA 4IJVA 5CT9A 5K3OA 4EBLA 4QOGA 3PR3A 3NTQA 1D9XA 1L0DA 1FDWA 2AUMA 2GCIA 3HLTA 2C7GA 3DEFA 3IBFA 1CYEA 3ZTTA 2P35A 4XWAA 3PQ3A 2I7VA 2AFRA 1ONPA 4BKOA 2I67A 1DRVA 4PAWA 2HRRA 2NU7A 3GT0A 3WB9A 4C9BA 3QX7A 1Z15A 2ZRPA 3GXBA 3U4IA 5ALFA 2WU3A 2E4ZA 4FYMA 4YAOA 2IFTA 3ZZTA 2HWUA 4F3TA 5T6MA 4GBMA 2QZ6A 4G0MA 2ORED 4H6VA 1ZAKA 2QD5A 4Q7LA 1KOUA 1P33A 4DCSA 2P74A 1KKUA 3NC0C 4P7KA 1HMPA 3QFRA 3LP8A 4H35A 4EF4A 4DCVA 1ZMXA 4DJDC 2JEOA 1K4EA 4KWTA 5GV8A 5CK4A 4YP5A 1PDVA 4LOAA 3N2LA 4MR8A 3KVYA 4QSHA 1QR2A 5KVSA 4LBWA 5EL0A 1Y37A 4IZ6A 3FF1A 3KALA 5EQTA 1Z0FA 2P2NA 2GM9A 4WZAB 3DM5A 3DQPA 3BTVA 3KLPX 2R6HA 1DAHA 5C1IA 2OV5A 3NULA 1UZAA 3HY6A 4HL6A 4MA5A 4MVJG 2HCTA 4RD4A 1K6XA 4EDHA 2DTDA 1HZZA 4L2IB 5HIIA 3BC1A 1RBMA 3CVJA 2GJ8A 5FQMA 2G9RA 3NHZA 3T15A 3ANLA 5AMXA 3AVWA 2ACVA 4YT5A 4FFSA 2C2ZA 1VLZA 4HRXA 1YBMA 4PIPA 3MJSA 5CBPA 4RC9A 4OPRA 3NOUC 3RTEA 3A3KA 4K6CA 1SHZA 5JQGB 2JI9A 1K0FA 3JX9A 4UE2A 4D97A 2VRCD 1N0VC 3LPDA 4PGMA 4Y15A 4WMCA 3PU6A 2RG7A 1KYXA 1RAIA 2XUJA 5AM4A 4G1UC 3ZJTA 5IH7A 4BNTA 1QGDA 4RH3A 3E3MA 3RF7A 2X23A 5EEGA 1EJBA 2HLDA 1P4RA 3R6WA 3GDHA 5AVVA 2JE5A 3FSGD 4MGYR 4N7RA 1NFRA 1MEOA 1E79A 4B73A 3Q6MA 3KAQA 3HI4A 3GP8A 4HV4A 4PWYA 1RSZA 2VAPA 3FVQA 3NOPC 2RIRA 1UAGA 4BBAA 4BTVA 3NV7A 2PJRA 2B4YA 3OPPA 2HJ9A 4J29A 1Z6XA 3ZG8B 5EXXA 2VDKB 4MK4A 2H8GA 4C89A 4H0FA 2DETA 3MZ0A 1NPTO 5E6UB 4GI7A 2ZC7A 2PQ2A 5CG2A 1ZMTA 4FJ2A 3CF4A 1VHLA 3L1HA 3EXIB 2YX1A 1G8PA 3AUXA 1GQ2A 3R7DA 1QVWA 1GGVA 2WF7A 3SHQA 4BEBA 4DLWA 2ODNA 2P2LA 3TEJA 5KOHA 5I4KA 4REMA 4YJGA 3KZ1E 1GAXA 4YPVA 2O99A 1OU4A 3NOXA 1TZBA 1MX9A 4KDFA 2WFAA 5D3QA 4Z7OB 5JD4A 3DE4X 4YGXB 1AGXA 5AKHA 1PJAA 1RLOA 4RA6A 1ES5A 3V4FA 3FIJA 1KI8A 4PAGA 2FHSA 2GZRA 3DW0A 1W1IA 1Z0DA 1YVRA 4X0EA 3ZZ0A 4O4JF 5EPUA 4J0DA 3IXBA 1G6KA 3PUVA 2YQ4A 3JQEA 3GAZA 4Q3AA 1D04A 1CIVA 3QX8A 1CU1A 1M6HA 2WIFA 4U2FA 4JVMA 1G21A 4C7JA 3ECCA 5FPPA 1VMDA 2HK9A 5E8JA 4HCJA 5FFMA 5GOZA 2FZ5A 1MOPA 2X19A 3FKSD 4AJHA 1WIWA 4HSGA 1QIFA 2IEBA 3I9V1 4TXHA 3RVJA 4RE5A 2F55A 4JVSB 1KO5A 3MXQA 5EQDA 4FGLA 1YMSA 5K3CA 5J8XA 1W0KD 3CWZA 1RYZA 2XUIA 5LIPA 2EGGA 4E6WA 5F1KA 4M1WA 3LIPA 1H8ZA 4CM1A 2VBGA 4YDQA 4RU1A 3W2IA 2YCBA 3EDQA 5IN4A 5E0KB 3RAGA 4A2QA 4EUNA 4KPGA 1KBZA 1VE5A 1EGHA 4PSAA 4RTPA 1CNEA 1O6CA 4LBVA 1X0XA 4LXGA 4GP7A 3NBXX 2RJOA 2XUFA 3EOZA 3K9GA 1L7OA 2ZWPA 3QPBA 3H1TA 1XK6A 3BWCA 4XGKA 1Y9ZA 4ZU6X 4FD2A 3HJKA 1CUYA 2G8NA 2O9AA 1PJRA 3N1UA 3ET5A 3Q7RA 3B6JA 4M89A 1LBEA 5TF0A 2XADA 2ZZMA 7REQB 3F5SA 4BU0A 1DELA 1CUCA 3GAAA 3NYRA 2HMWA 3W7VA 1LJUA 4WZ5A 3BWEA 3FBWA 3U3MA 4NWIA 1IXYA 4AI6A 3GGSA 2HPZA 2WWGA 5DM70 3R41A 5EIWA 3AIMA 5JD6A 5JI2E 1T3TA 1SK9A 1THZA 5F23A 4N0DA 2AZ4A 5JEEA 2GLXA 2HWWA 2Y4AA 5BR1A 2CLDX 3BQ8A 1XRNA 3I2IA 1A0KA 3HGMA 4INZA 4ENPA 1ZM9A 2W6ID 2E49A 4X7BA 4RETA 2G4VA 2XKAA 2J41A 1NT2A 5FF9A 4F9EA 4CEHB 3P5BA 7ABPA 2PKEA 4CLHA 3AU9A 5IJ0A 5BN4A 1BHSA 3OE7A 3IVRA 1J2UA 2J3QA 2IKQA 1FEZA 1Q6YA 1W76A 3VU9A 5DX1A 2YMQA 3D0RA 1I6LA 1WXWA 1M75A 5BN1A 1Y5NA 4TT3A 2Z8YA 1Z2NX 1JJ7A 3F6PA 2Y2VA 1WZCA 1TS0A 1R10A 3PXBA 3Q3IA 2PD8A 3IP7A 5J2UA 3LWZA 2IWCA 1NC1A 3M4YA 5DFXA 1QO9A 5HKKD 4R3UC 4YALA 2ZUEA 1FTGA 3VISA 1ZJZA 2CXSA 2JCYA 3N2IA 5CB4B 1Z12A 3GVBA 4OUDA 2C4TA 3UK0A 4NZYA 4D41A 1CXZA 4ND8B 2LPMA 8ATCA 1H6AA 4BPRA 3N0VA 2WJHA 1S89A 5LZ4A 3KQUA 4DSZA 3WK6A 1T5HX 5TGDA 1SKUA 2DB3A 5H83A 3JQGA 4LRQA 5JFTA 2WTAA 3NDPA 1E9BA 3IILA 1V7ZA 4X90A 3DA8A 3ND9A 1FRVA 1P2UA 4BNGA 1MB0A 4EZIA 1FDSA 4YVFA 2P3LA 3LW8A 3E4QA 1U98A 3LQ1A 3COPA 3J7TA 2VF8A 2H1FA 2PUBA 5F51A 4QGSA 5HJEA 5AVWA 4GU5A 2H3EA 1RJWA 5DSTA 1PKXA 2BYTA 4O8ZA 2BR3A 3GAFA 2Z6DA 3FVRA 4UHDA 3B70A 1NV9A 3HV2A 3R9XB 3VNVA 1XELA 3L82B 3T4QA 5H81A 3B3FA 2XA9A 3C48A 3K0CA 5EPEA 1WDTA 3EPJA 2JHCA 2VQFB 3OUZA 1XAIA 3GEMA 3ZIAA 3FCAA 2W4IA 1IOVA 1RAFA 3NOQA 3WBKA 4CMIB 1Z7EA 2JG3A 4FD8A 1RXEA 4Y18A 1TUBA 3QVSA 2QTLA 2I9KA 3PKZA 4DMUB 1NIJA 2ZUBA 4AU1A 1OAAA 1Q21A 2ZUFA 5GGXA 3G8DA 2P8SA 1EM8B 2ZI4A 4HESA 1M2GA 4RANA 4E94A 3GN1A 3CLOA 1UXGA 3RLIA 4AJ9A 2QENA 5A4AA 1X0OA 1RC1A 3HVIA 3DKIA 3IQEA 4UBNA 5CT5A 4GI2A 3BBLA 1OJ5A 3S7QA 5KS2A 3AEKA 1I5RA 1VZ2A 3M6WA 3W4KA 3BMOA 1ZC4A 5BVHB 1L5YA 3PBTA 1ZXBA 3RYCB 3BCSA 4KSYA 4ZI5A 1RJGA 5GLCA 3S0JA 3AHEA 3DAOA 4HB2A 4JODA 3CMZA 5ALKA 2H0RA 1PZFA 5CNMA 2O9JA 4K7JA 1N6HA 4RVSA 4YMHA 3OVMA 3MJ4A 3V1KA 1Z6AA 3OIVA 4TYNA 1SCUA 3QUAA 4KE7A 3S1SA 3H9JA 1JS1X 3NUZA 1SKOB 1W48A 5KNCH 1GSHA 2CLFB 4IIYA 4B8WA 1E7RA 4C5AA 1S7GA 3EJ6A 2R6DA 4KUGA 3CONA 4GQIA 3PXEA 4EA7A 4B9EA 1F2TA 1IN6A 2A6PA 3FTNA 3L4BC 4C7VA 4TL7A 2IODA 2X42A 3IIJA 2WHPA 3RK4A 3D1VA 1W5FA 2V45A 3PEYA 2VDQB 4JXSA 1SD5A 2IELA 1XCLA 4DIBA 4FH4A 5CAEA 3ZV7A 3ZW8A 5E8RA 1D1PA 4OB6A 4A10A 3JQBC 2CJWB 4I4TB 8OHMA 1B26A 4KHPB 3VNUA 3QKWA 3K32A 4RSMA 2QMZA 1X94A 2VT6A 3PGKA 3CRZA 4AS1A 4UDOA 1M2NA 3R8CA 1O3YA 3OE1A 4N39A 3RUPA 2G82A 3HLGA 3LKZA 4MQLA 2DWQA 1O95A 3LEZA 1KDZA 4H7IA 1P44A 3UPDA 3NDJA 3SQLA 1CY2A 1A9QA 1LDGA 4OOFA 2I3ZA 1P17A 3H4TA 3F6EX 3CRNA 3WYDA 4HAZA 4EQ6A 4ZQCB 3AO0B 3W34A 1GRVA 1N5IA 2P91A 1KJJA 1N7IA 1QCZA 2RGBA 4RQUA 3ZJYA 1GZ4A 3PJGA 2QJFA 3CLUD 1CQXA 3VZDA 3K6RA 3IIMA 4CQLB 2J5RA 2UUPA 1ZNWA 3TSCA 3L8MA 1I01A 3KM0A 3OQBA 3LMKA 3N0TA 5ECDA 5E1MA 1K75A 5THKA 1CQZA 5IMBA 4FVTA 4QECA 2PJDA 1KPIA 5J43A 2QLBA 2FPGB 1CR4A 3A4VA 4UHKA 3A1CA 2Q3LA 3BSSA 4J1QA 1MOSA 3VOZA 3GJ6A 5JO9A 3LUBA 4OQXA 5FBHA 3AF1A 2PWZA 4JJ8A 3IQIX 4G3WA 2JATA 4WY8A 4EY7A 1U99A 3AK4A 2NNLD 1JT2A 2GZHA 3LX8A 4X00A 5KZMB 5G4LA 3QELB 1D2GA 4UMEA 4O1IA 4NNOA 1O97D 2A57A 3GRFA 4XR4A 3FVVA 3U61B 9LDBA 1PYDA 4KAFA 3L8HA 1W5AA 3RT9A 5B6IA 1WF3A 1ABEA 1ZCJA 1ND6A 2HWYA 2I4MA 1R27A 4LDZA 3LBHA 1YIDA 3UG6A 3K2NA 1O54A 4Y0OA 4PC6A 4RKWA 4WT7A 4P8RA 4JLDA 4U2BA 1JQEA 1LPOA 3KO8A 1IFXA 1Z34A 3GJQA 4U1RA 2VZ9A 3LL7A 1BZYA 4MLPA 3MWGA 3WMFA 5U1PA 1AOXA 2OGUA 3M1IA 1KK1A 1JV2B 3L7DA 1A04A 2ZIVB 9LDTA 1E3TA 2PS1A 4KVAA 1SHKA 4PF1A 1BAPA 2GTIA 3JWGA 2H07A 3A25A 3G5LA 3AZOA 3TJRA 5F4ZA 4Y7CA 1XSEA 3B5JA 2O7VA 1GZSA 1K1EA 1XCBA 2CNDA 1NRWA 3KB2A 1GEEA 2NVOA 4UQIM 3MF4A 4UEKA 4GC9A 2EG5A 3VP0A 2HDUA 4GWGA 1KAMA 1LPPA 2VNAA 2W2XA 4OBXA 4DB4A 1Q3TA 4BFCA 3I4LA 3WWXA 4ZJZA 3DEYX 3A3JA 3TIXB 1CZHA 4JJ6A 4IDEA 1TUIA 2GBIA 1C1DA 2JCBA 4UU8A 1Q5PA 1J7KA 1UDBA 2DUNA 1KR5A 1WZNA 4UEQA 1T2VA 3D3JA 2ZC4B 1EUQA 3QG5A 2PBDP 3Q6IA 1XQXA 2Z8YM 3NTVA 5TS3A 3EHEA 1AZTA 4JT4A 3NWOA 3R3HA 2B30A 2WI8A 3H5NA 3DAVA 4JITA 1QZZA 1BJRE 4ND5A 1KS2A 2C1XA 3PA6A 4IMJB 2GA9A 4O5AA 1IVNA 5JCOA 4OHBA 2BSXA 3R6DA 4IYJA 1KEZA 4TXMA 3M5WA 2CMFA 3VR3D 2FW8A 4LA4A 3KXLA 2C6WB 1OFIA 5EMHA 2Q45A 2H1CA 5J4LA 2Z09A 3U19A 2GASA 1USVA 4MP8A 2ADOA 3TBFA 2W8BB 2O3QA 1XKZA 3IP8A 3SF8A 4JZKA 4P4NA 2C99A 2WYHA 4ZDJA 3IKTA 3TZEA 2W1TA 2DNSA 4NBLA 3ZHBA 1EI9A 5BMVA 4TTIA 1RAGA 1CUDA 2A30A 2NZJA 4BZXA 2YR0A 1NF2A 4BIMA 3RS5A 3C6YA 3MIIA 3THOA 4TM7A 1T5LA 3NUQA 2YHUA 5H7XA 3ZHSA 4L3VA 2IHBA 4M2LA 1FFDA 4LGVA 2QNRA 3O94A 1M72A 5G3ZA 3UHAA 5FBQB 3MJVA 4F5WA 3IALA 2YS6A 1ZSVA 1B2LA 3F1NA 4CQNA 4B7AA 5IYZF 3A1NA 1HG0A 5FTNA 4BB9A 5L3QA 4H1HA 1YLZA 1LPBB 2QQEA 3NW9A 2VATA 2ZVPX 3F1LA 1CR2A 1J2JA 2R8RA 3HJCA 2QI9F 2IYYA 1X74A 3GFFA 3KBBA 1WPGA 3HUDA 2M6LA 4U2GA 3KKKA 4AY5A 4DV1B 2QYOA 2Y9MB 3HYCA 4RK4A 4JV5B 1UC8A 1GCGA 1RCTE 3OOYA 3MHTA 2PL3A 4TXJA 4NBTA 3UV6A 2EBHX 3Q9UA 4W8OA 2QX8A 5EJ6A 2QTVA 5IVIA 1H8YA 5I7VA 3DV0A 3CKLA 2HV1A 2Z2MB 1R00A 1B6SA 1ZISA 4WOCA 4G0QA 1E3WB 1YU9A 1A8IA 1RP5A 3DF7A 1PGJA 1R64A 5F76A 2QX6A 1E60A 5BN3B 1XTBA 2GS9A 2IY8A 4WOBA 2XB6A 4K6HA 2JZNA 3MFQA 1A5BB 2OXIA 1Z5UA 1ZCAA 4E51A 4QB8A 2G08A 5TQVA 4UMVA 2PRFA 1TPZA 3RS9A 1GFIA 1P31A 4IEEA 1D07A 3RS3A 3NASA 1WHTA 4Z4GA 4L16A 4J0KA 1CS0A 3HK2A 3P52A 3K09C 5JH7B 3UB4A 4L5CA 4JC5A 3WGJA 2H92A 3B1VA 4EI2A 1Q2PA 1JVBA 1E3QA 2WK0A 3OLXA 5TDHA 4JAVC 2AI2A 2XD9A 4OEHA 5F33A 5K0ZA 2FMUA 2VXCA 1U0GA 1P6QA 2IBMA 5FAQA 1JYSA 1NBOA 3EGDC 2ZB3A 2QAJA 3WKEA 4TMWA 5A4JA 3Q72A 4IDCA 2XGSA 1Z07A 4FYWA 3LUCA 4FSXA 4CNBA 1J0AA 4ROSA 2GHIA 2C2YA 3TFWA 5AVTA 3H86A 1LWOA 5EKTA 2ZAMA 4GT1A 3UFXA 3R9KA 3UHFA 3QG1A 3PL5A 2ZANA 3L4JA 3LGSA 1DU4A 2M98A 3ZGAB 3E8SA 2GFQA 4HWRA 3QYJA 4K81B 4YRBA 5IHXA 1HE8B 4DRZA 4DPLA 1Y6FA 2GBLC 2A0WA 1WEHA 3FI9A 2FTKE 5FBKA 2DQZA 3EC1A 4JGRA 1YZNA 2IH5A 4M1YA 3G2ZA 4D8WA 3TXXA 5FI0B 3WFIA 2ISSD 3W3AH 3LKDA 3BJZA 4GZ3A 1KMQA 1CY6A 4DIMA 5TGZA 3OA0A 2FJPA 4BNNA 4QATA 4DV0B 3V5NA 4UU7A 1I4EB 2AOTA 5ALRA 1DZ3A 4TLCA 2UVDA 3WDSA 3CRMA 5DYTA 4HEHA 5IN5A 1PJZA 4HDCA 2QDKA 4N48A 3P0HA 1EXVA 1TVKB 5IKEA 5KTOA 1FJ2A 3N7TA 1RC8A 3QKIA 3RGWS 4OKNA 1JAXA 2GK7A 4CCAA 4JLAA 2PE5A 4G5RA 1MO6A 2FFYA 3HLCA 1HYGA 2WICA 3ZIUA 3AUJB 5CLFA 1NXVA 5D85A 1TEMA 3P09A 1EQUA 3EPKA 1A9ZA 4DV3B 3AJDA 1TOAA 2K7SA 1NVGA 2XKKA 4XVQA 4IHJA 2W2LA 4NPHA 1FP1D 1TCVA 4YJFB 2WVAA 3QITA 4QY5A 3CO0S 4UNIA 1SGWA 2L1MA 4INOA 4YROA 3JU3A 5DZSA 2ONCA 2ZJ7A 4MUGA 3NBLA 5LB4A 3FWLA 3KYIB 2BI4A 2ID9A 2AX4A 3BXFA 4WOKA 4AQ7A 4UARA 1R16A 1KQGA 2IPMA 3PFKA 4DA8A 4JL8A 3OG9A 1EWKA 4I1PA 4MPPA 3M4XA 1RXUA 4N65A 3ZDXB 3INRA 4DOMA 2BGGA 4JU9A 4AY6A 2ZPAA 3G8YA 1D2MA 2R6JA 3ABSB 1XTUA 1OHHD 1LRLA 2GN8A 3WL4A 4BLPA 4RDXA 1WETA 2XNSA 2R1ZA 4LF7B 3THWA 3GVIA 4MHOA 3IUEA 3H4MA 4M1OA 1ZM2A 1Y5MA 3PD1A 1K06A 1GRCA 4D43A 5KJEA 1Z0IA 2BFBA 5DT9A 3OLCX 4DZTA 4P35A 1NR5A 3P9ZA 1QC5A 1XZMA 4FQ7A 2DBVO 1XGJA 5TSDA 2EWWA 2J46A 1DDIA 3TEMA 3KXPA 3F90A 4OD0A 1J8QA 3LHDA 1OH5A 1CUIA 2QGZA 5EMLA 2OV4A 4KAJA 2Y3IA 1YKSA 3AI1A 3T7TA 3ESYA 4BIIA 2KBFA 2PFGA 4LCBA 5JY6A 1OFHA 5JIBA 4DA4A 3E2PA 4TTRA 2DBQA 4GSYA 4H7DA 3UGJA 1ENPA 3GR2A 5I4CA 3SKXA 2C03A 3H2KA 2Q1WA 2Q3HA 3MXSA 3FPSA 4LDJA 1JDSA 4Z49A 2WZQA 1B1AA 1EVYA 1MJ5A 4KODA 3A32A 1Z4NA 1X0VA 3R0IA 4AN1A 3RS8A 5AQ7A 3HJTA 3VOYA 1E6UA 1BW9A 4W99A 2C5GA 3T1QA 3X1YA 4DMHA 1XI2A 3C38A 2OV1A 1NBEA 2V0NA 3U7FB 5J9FA 2G71A 3UMSA 5DTKA 5JU6A 1FMCA 4XD2A 2JH3A 4CG1A 3KKEA 2ZJ9A 3QBDA 1F06A 1GHTA 3QIVA 1SZDA 4EA9A 2QRKA 5LMNB 5KAPA 4NOMA 4V0MA 4OQ0A 3WBJA 2QEQA 1YI0A 5CGSA 5TFQA 2NN3C 4JGBA 4TRNA 5AW9A 1DAOA 4KIFA 1FNBA 4RLHA 5L8VA 2DYKA 3JQ9C 5EZ6B 3N70A 1LQUA 4RX3A 3H1EA 1NMEA 4ARSA 1E7YA 2OXFA 4DDVA 2OBXA 4BQMA 2OV8A 2BEWA 1KEWA 3FZYA 1W63Q 1E2BA 5E2EA 2AT1A 1HRKA 2YFKA 4HRAA 5G18A 2HR1A 3L0DA 3C2QA 5EJGA 1C9JA 3TW4A 3TG9A 1C7FA 1C81A 1AKVA 3I2HA 1GCOA 4GI3A 3ZE7A 2WTMA 5CXUA 1CC1S 4Y67A 4A0QA 4B3FX 1YLPA 1DJLA 1O8BA 4BBVA 1PT6A 2HHCA 2CDRA 2YNMD 4YR7A 2J85A 3LC1O 5FULA 3PDIB 2F6RA 1HFEL 2P6NA 4L5JA 5TJJA 3MMNA 3PF9A 1P80A 2C9DA 1P62B 3A6KA 3JALA 1VHQA 2Q9NA 2PGIA 3AERB 1TD9A 1GSAA 1XU7A 2WVJA 2GPYA 4PS0A 4X3CA 5DGIA 3U3ZA 2CXNA 1PTKA 1OW3B 1RPZA 2ARKA 2OOLA 3KT0A 3A0RA 3T1YB 4BBZA 3KHUA 4B3IA 2VK2A 5EMJA 4R8VA 5LYJA 1XAGA 1HEIA 2HK6A 1TGYA 3GFSA 2Q6IA 3EGDB 2H9IA 1IYOA 1ZM7A 3TFQA 2ECQA 5KYUB 4RS3A 2WLSA 2JHAA 4X6LA 5I8WA 5HDDA 3ETNA 2BLSA 1ISMA 2CK3D 4WKOA 4R4JA 3B5EA 3EPLA 1QOQB 3LOUA 3FN4A 3PBRA 2NM0A 2RGGA 2VK3A 2WK1A 4Q4HB 4U0TA 4U9HS 3WISA 1I3MA 4C3ZA 3DWIA 2VJLA 3M5CA 4QFBA 1UQUA 4PG7A 2NT3A 3I0MA 1SQGA 3FZGA 1U2PA 3Q82A 1ZPDA 5A90A 4IBOA 4HH1A 4QUIA 4HWTA 3HNOA 3RVPA 3ZCRA 5A04A 1ZU4A 2FR1A 4KDCA 1KI6A 2V7PA 4C75A 1WTCA 2GSWA 1P8AA 1W4RA 4PLTA 1MAHA 3A3OA 4B7UA 2R25B 4EO4A 4X1KA 5DU2A 1Y1PA 5CDFE 2R8OA 4FE7A 2PX8A 3JAMA 1PWZA 5CIWA 1YK1A 1LBQA 2FWBA 3FTCA 3FWPA 3OZWA 2QTGA 1OT5A 1HKUA 4I6EA 5JSZA 5JI3E 3R7SA 3MQ0A 4COOA 5HNKA 4HUTA 1UR5A 1IZ9A 4F92B 2H4YA 5I5GA 1NBMD 1CUVA 3V8MA 3CUSA 2Y2KA 4U3JB 3VVLA 4Z0NA 4UHCA 3LCEA 1IZYA 1FQOA 3T1SA 5C46F 5K0JA 5KQSA 1LI0A 4DSTA 4FXPA 3PTLA 4BVKA 2ISCA 2B8EA 5A02A 2C9OA 3QPAA 5GJBA 3G68A 2JI7A 1JAYA 4KXQA 2W3FA 5CR9A 4RD3A 4ZYUA 2OBFA 3KYCA 1BMFD 3L02A 3L0BA 3ISVA 5KQMA 1X1QA 5A0TA 2LW7A 3WB0A 1I4OA 5KYNA 2F90A 5AXBA 3CX4A 3F6BX 1M9NA 2UZ0A 3KJEA 4Q1DA 4E12A 3TM5A 5FEMA 1IUKA 1U04A 1YGPA 2B8NA 4OGGA 3F6YA 1C9MA 1JPVA 2RC5A 4LV6A 1JRLA 1M1XB 3E9DA 1PIWA 1CQJB 3N8KA 4QE3A 3E1KA 4FU0A 2CVOA 2VLIA 3S8YA 2BKEA 4NHOA 1T0UA 4CV0A 1P9NA 3IMFA 1LVUA 2RAPA 4OAQA 1ALQA 1C4KA 4GO1A 1F9EA 2O8BB 3MMHA 1Q83A 2CBXA 4JJFA 4Y9DA 4NMLA 2KI5A 1G9XA 1RWOA 3G89A 2JGDA 3VVBA 1YB6A 4IXTA 5DYIA 2OZLB 3ZH2A 1LRJA 2LIPA 3OJFA 2FR0A 4PXSA 1BULA 5BUSA 5EWJA 4CM9A 4FXOA 2G5TA 2QNIA 4OHMA 4I39A 2JGNA 4I1SA 2Y99A 1KU0A 4GYYA 3KL4A 3X1ZA 1GQRA 3U4QA 4UA6A 2CFOA 3OLOA 4N5HX 1L5HA 2QL6A 5TB5A 3T95A 3EDRA 4CBVA 4RVFA 3AIIA 4L5YA 4U2CA 1AK1A 3IYLW 2KE5A 1C9DB 1E77A 1M1YB 1EVKA 3FNHA 1RAHA 4D0SA 3GJRA 5LA6F 2JFUA 5P8WA 1ZLYA 4HNRA 5EQFA 4BAUA 3BXHA 5JDIA 2FMHA 4F71A 3ESXA 5DYWA 5EPOA 1PL6A 5CD9A 3LV8A 1LPMA 4NK3A 1NYYA 4Q9JA 2Q0XA 1Y9EA 3QUSA 4P92A 1WJGA 2ZI9A 4B3BA 3VTAA 3UT0A 5GJWC 2B34A 4PLPA 1AC5A 1TS8A 3HDQA 1K7EB 1W2GA 1XJCA 3NM6B 1OAKA 1QV9A 4MKRA 3S99A 3UAWA 3O1JC 1R8XA 2HF6A 2BWJA 4NAUA 5KVQA 5JSFA 4UFOA 2VSNA 3OPNA 4J1TC 1X7XA 4WDQA 4IUKA 4H3HB 2CDNA 2DX7A 4NCXA 5G40A 4C76A 2H2AA 2X5XA 4DIUA 4C5BA 2R5NA 3V46A 3OQVA 2HJEA 3LT0A 4U7GA 4IKOA 1KDVA 3HR8A 1COWD 3O8QB 2X0IA 5M34A 4U7PB 3H5IA 1JU4A 4G9BA 4G07A 1BVYF 3TRJA 3I39X 1PUIA 2OBMA 1YCGA 2O05A 4OH0A 2FQ1A 4EPWA 1EVLA 4M60A 5A91A 4CTMA 3G30A 3O26A 3K3DA 3IAXA 4LQCA 1MW9X 1YONA 4AT1A 2PJUA 4HNUA 3G2LA 3GLTA 3KEMA 5ALWA 3D6TB 3R23A 4JU8A 3BZWA 3VYRB 1TKCA 3DPUA 3INTA 2JFFA 2NUPA 1L4KA 2HSZA 2ZQAA 3MMXA 1I51A 4LUCA 4UQPA 4LHSA 5DX8A 3R9WA 3RVRA 1DC5A 2IW1A 1PJQA 3ULFA 3EFEA 3MW8A 3G0CA 5ALZA 1Y42X 2EZUA 2JFPA 4LHEA 3H3JA 1H9BA 1GU1A 4PYMA 2ANBA 1NAIA 3A14A 1C2YA 4EG8A 3K4HA 1NI4A 3CLHA 3WO1A 2FSIA 1O94A 5FDSA 4CQMA 2D4AA 3UXYA 4B88A 2IYQA 1QDEA 5CHUA 1Z6ZA 4D9NA 5IW8A 3ADDA 1XCMA 4ABYA 4BNYA 2CYAA 3FCYA 3FGOA 4QDJA 3P2IA 5G1PA 3C5EA 1E3LA 4NOKA 3LQ4A 4OQMA 5L7YA 5D3MB 2JCHA 1AKRA 5AVXA 4CFYA 2PX0A 2XDMA 2PY6A 4MARA 1LF0A 3HU1A 4MV0A 4R1UA 1ZK2A 4CM4B 5K7SA 2GJSA 3BFXA 1WZUA 3FI0A 1VJ1A 3L4SO 3A7DA 4FP9A 4UULA 5D2CA 1U2GC 3QKTA 4N9WA 2C2BA 4I8DA 1XZJA 4BZQA 1HQYE 1XTPA 4REOA 4R40A 3P71T 1YKGA 1HYQA 1EUCB 5EP2A 3M2TA 1U0EA 4OGFA 5ULLA 1BKSB 5A9RA 2HGZA 2HJGA 1RI5A 1Z4IA 3M2PA 1E62A 1ZJ5A 4JLSA 3HYRA 4OI4A 1ODIA 1SOMA 4ONEA 3QH4A 1EBBA 5EYPA 4YV1A 4K9SA 3Q0IA 3LCMA 3FJYA 4ZWNA 5EA2A 2DKNA 2VQ3A 2VP6A 1PG2A 4L02A 2GTPA 5C32A 5T4EA 2QRVB 4WESA 3H82A 4PYNA 3C39A 1SBYA 4WPGA 1ZUNA 3NS7A 3IOYA 4DDKA 3ONDA 1DIAA 2PCLA 3CW2A 3WGYA 1GQQA 4TN5A 4GX1A 4X69A 2QSZA 1D1TA 4KPFC 1CJBA 4F6RB 3WA6A 1IDN1 1FXWF 1GITA 1KK3A 3M6FA 1XDBA 3MGKA 4S2OA 2CD7A 4NPCA 1CY8A 1ODCA 3IIEA 1EXMA 4IDOA 5IAEA 3PBSA 2C9YA 3CR3C 5FUMA 4FS8A 4C6HA 4L0QA 5IT5A 4KQOA 4UU0A 4XWOA 2EQ5A 3T9FA 3PR6A 3UB9A 2ZJ0A 1X8JA 5DJ5A 1MEEA 1VP9A 4ZVSA 1EXWA 3TS1A 2VJNA 4XCXA 2HA2A 3WFJA 4UNRA 1U28C 2CFCA 2WHXA 1DIGA 1DX9A 2EGUA 3DFKA 3ROFA 2QIOA 3DT9A 2E1RA 5HPYB 3TOVA 4HP4A 4LMBA 2HRDA 2PTHA 2WHRA 2ZBGA 1HLUP 4PX3A 1US8B 3D8TA 1QWSA 5G0UA 3JRNA 4URZR 4DLUA 3DAYA 1TTPB 3QVXA 3JD2A 4UXJA 4BTEA 3O8NA 5DTJA 1K6MA 4N6OA 4J0EA 3COSA 2JA1A 4EMBA 1T8UA 2P9TA 3F71A 1E8DA 4NYMR 4AC9A 2JKFA 3U48A 2Q5HA 2H1RA 3CNOA 4EF6A 2PN1A 2W1RA 5H9WA 3C8HA 1DQSA 3NHWA 1V7PC 4W5WA 1R8QA 4QPPA 4RSGA 1MCZA 2ECFA 1FSYA 4I1OA 4EGFA 4RULA 1F3LA 2GNPA 2HLNA 4IFEA 1I7DA 5JG7A 1PV2A 4ZGBA 3TQTA 4K9QA 3CO5A 2G63A 2WU8A 3DOFA 5DNUA 2GGSA 4N0QA 3VR0A 2B5WA 1XDDA 4KTVE 2OLVA 3KV3O 4RQTA 3ZYTA 5AK5A 3SIRA 5GJCA 3N0XA 1ZMOA 3OLQA 5EJFA 3F9IA 4RL6A 5F1FA 4WMLA 3KHKA 5ALVA 1EKXA 4JXGA 1R88A 2J0UB 4X8MA 1UDRA 1XCJA 4BV9A 4BVJA 4BCBA 1H4SA 5KB3A 3ZHCA 4XIIA 4ZDIA 2ZK7A 1X13A 1JDJA 2FVYA 1D2HA 3OC6A 4ZKDA 1II9A 4Y6PA 3T35A 4C2BA 2YJ6A 5HWWA 3ZHTA 1RXWA 3O1LA 4Y6OA 2C2MA 2YY7A 3GIDA 3LO5A 2CHEA 1K8YB 3W9YA 2GK4A 1IBCA 3GJYA 1DUSA 4PNEA 3WAGA 3DTVD 1OPRA 5BT8A 2FA9A 5ADVA 5JXIA 4QU8A 3W5SA 1Z45A 3E8XA 2D2FA 5JD3A 3PFCA 4WF0A 5HOEA 5KNCA 2BASA 1H2YA 1QP4A 4JK3A 4R84A 3OEHD 3SX4A 3ZQ4A 3DXZA 2QF7A 3ESRA 3LY9A 2ZYUX 4NK5A 4LDAA 1EESA 1UEXC 4QEZA 4W8HA 4J1NA 3MWEB 2YY6A 2JHEA 1L5SA 3EEIA 3LUQA 3GFGA 3O75A 1Z4KA 2REBA 2BGMA 2FPMA 2FUKA 2ZB8A 3T5DA 3VR6D 4HDKB 3DLAA 3SHVA 2C1ZA 1U3CA 3ZQ6A 3ZU6A 3I28A 2P7IA 3D8NA 4UHBA 5IDQA 1HV8A 3MZEA 3A1EA 2QUAA 4F2HA 1S8FA 5L4LA 4EI7A 3P45A 3HBNA 4L15A 2ZXUA 1HE4A 4W1RA 1D09A 2RONA 3IR6A 3WVNA 4DW8A 3NVKI 1CQWA 1YS7A 5KDOA 4WEOA 1NF3A 2ZBUA 3IEIA 4XGNA 1GPNA 2FSSA 3TTYA 1FSZA 4QODA 3LLMA 4QEDA 1OGJA 1J2TA 5E2HA 3OEED 4OPQA 3CAXA 4X25A 2AUNA 3EVDA 4YRTA 2V0UA 3RU7A 5AJTA 2XD4A 4ZPJA 4XRGA 4EQ1A 3FTDA 1JSZA 3P26A 3PFHA 5DXJA 3BB1A 5DTMA 1GDHA 4KXFB 3OQNA 1U2QA 1CUUA 3LYHA 1GILA 3N7AA 1FJGB 3L8EA 5FBWB 2OORA 4O4HA 1YUNA 2NYUA 1ZHOA 1FTNA 4FE3A 4NP6A 3VZPA 4B2YA 3FZNA 1EVIA 3AL3A 3U0BA 4XIFA 4K0WA 1CP2A 3WLQA 4BFYA 3PDJA 1IRIA 3KOOA 5EJ7A 1I14A 3DGFC 5HAQA