3R7WB

Crystal structure of gtr1p-gtr2p complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
314
structure length
294
Chain Sequence
MVLLMGVRRCGKSSICKVVFHNMQPLDTLYLESTSNPSLEHFSTLIDLAVMELPGQLNYFEPSYDSERLFKSVGALVYVIDSQDEYINAITNLAMIIEYAYKVNPSINIEVLIHKVDGLSEDFKVDAQRDIMQRTGEELLELGLDGVQVSFYLTSIFDHSIYEAFSRIVQKLIPELSFLENMLDNLIQHSKIEKAFLFDVNSKIYVSTDSNPVDIQMYEVCSEFIDVTIDLFDLYKAELQNVSQLANGVIIYLRQMIRGLALVAIIRPNGTDMESCLTVADYNIDIFKKGLEDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein GTR1
publication title Crystal structure of the Gtr1p-Gtr2p complex reveals new insights into the amino acid-induced TORC1 activation
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 57
structure length 294
sequence length 314
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04670 Gtr1_RagA Gtr1/RagA G protein conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.190 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3r7wB02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r7wB01
1NP6A 4Q7KA 5DO9A 5FBLB 2FV8A 4A0HA 4LJ6A 2X77A 4RD3A 4Q9JA 2BMJA 2REBA 4Q9HA 4DB4A 1OKKD 2B21A 8OHMA 2VSOA 4L16A 4RKFA 1M1YE 2P6NA 4NH0A 4NYMR 3UIEA 3ZVLA 1KZ7B 2WV9A 4IVPA 2YKGA 5EZ6B 1XEXA 4EJSB 1EK0A 5JSZB 1OH8A 1FZQA 1E9RA 2ZXUA 2E9SA 3X1WA 3GLGA 3X2SA 3THXB 4V0OA 4ZIRB 1KDOA 3N70A 2FPKA 4C30A 5AK0A 3TJZA 1VTKA 1FPMA 5GJWC 2IWHA 4W5WA 1XTRA 3IEUA 1II8B 2IXFA 2VIIA 3AQ4A 1FUKA 3SU8A 4IXNA 1WRBA 3LNCA 3I72A 4LDJA 3AKCA 2YWEA 4LWZA 1ZIPA 4BUJA 2Z6VA 4F7WA 1XTIA 4ASUD 4C2UA 1UBFA 3KKPA 2WJGA 2ZUCA 4M9ZA 2FSGA 3P26A 1KAGA 4CYMA 3BB3A 1NN5A 2QROA 4XSGA 1R2QA 3K9NA 4DKXA 2ORWA 5TV2A 2XZOA 4DLUA 1YQTA 4AYTA 4BRUA 3PG5A 4ON9A 3H4MA 1T0JB 1FL9A 1LS1A 1P2SA 5FOTA 4EPVA 4F91B 5FH9A 5A0FA 3A37A 4QGAA 4D6PA 1KNXA 1DAIA 3AEZA 5FI0B 3KUDA 4MDEA 4R2HA 2IEZA 5GJVC 1WE2A 3SR0A 1YZUA 2OAQ1 2N1BA 3FE2A 3A4MA 3BRWD 3PITA 4GP6A 1W1WA 1JR3D 621PA 1R4AA 2J7PA 1VIYA 2Y8EA 1E4YA 4X8HA 1Z0KA 2WWGA 1IJFA 4I4LA 4TYNA 1E2QA 3ADKA 2DCUA 4DLVA 2AL7A 2I1QA 1E9FA 2IYWA 1P6XA 4PO9A 4QNMA 4YXWA 1SHZA 1KJZA 2SHKA 4FIDA 2W00A 3PUXA 1Z0FA 3WY9A 3RSOA 3DOEA 121PA 3GLHB 4WW0A 3H0KA 1U9IC 5C1BA 4WIAA 1Z29A 4BLSA 4DIDA 4YMUA 1KHTA 2ECKA 3DMDA 4DSUA 1S9HA 1S9DA 2ZETA 1FP7A 2IHYA 1NSTA 2OXRA 4FD2A 5H68A 2ZRMA 2GESA 2ZI5A 3X1YA 2QBYA 1FP6A 3PEYA 1E0AA 3EA5A 4LSGA 1LTQA 3NBXX 2OUKA 3KL4A 1YZTA 5HPYB 4AKIA 2N42A 2QAGA 3D7MA 3OZXA 3A8TA 4ITRC 1KYIA 1XPOA 2NOAA 2LCFA 2JDID 2WJYA 5FTMA 1JR6A 2V6JA 1UEJA 4GZLA 2J7KA 2OXCA 3K0CC 3W5IA 2ZRDA 1HY3A 1GTVA 2D7CA 3I3SR 4MRRA 1GL6A 2F1JA 3S1AA 1SVIA 1G21E 1Q21A 1Z47A 2F43B 2VQSA 4GRAA 4QJ3A 2YWHA 1WQ1R 4KSCA 2H5EA 4QBGB 1OLOA 1YR8A 2ZJYA 5DN6D 1P3JA 1T3SA 2A78A 2BBOA 3BH7A 2WWYA 2V1UA 1H65A 4MYCA 1KY3A 4V03A 5FPHA 1W2HA 2R6CA 3AP2A 4M9XA 1G3QA 4QRHA 2D2EA 4BZPA 5JZVA 2PX3A 2FNAA 3NHBA 4K46A 1IQPA 2O8FB 2WTUA 3CH4B 2IS2A 2F55A 3CPEA 3GJXC 4NE2A 1ZNZA 1RRPA 1GZSA 1G5TA 1XEWX 5DYGA 2FEOA 1IHUA 2R6AA 5JI2E 1S96A 5DSZA 1G4AE 3VU9A 4KCGA 3EW9A 1DTSA 5J4YA 1AN0A 3EZFA 3SHWA 3K70B 3ZDQA 2KI5A 5FFMA 4LYHA 1Z6XA 2VP2A 2BVNA 3CF2A 3AF4A 4HLCA 2WIAA 1M34E 2QL6A 4NYIR 1Q0UA 3L8YA 2FWRA 1HTWA 5C18A 2BV3A 2F3TA 1PZNA 2YC2C 4TLBA 5CIQA 3WRXC 4XWAA 2XB2A 1D9XA 4O0MA 3U2QA 1E0JA 2IYQA 2CCJA 4HAYA 1QF9A 3B2EA 2IYUA 3GJ8A 3O8BA 3T1OA 3TGPA 1VG0B 4MKFA 3I62A 4PC7A 3U3RA 3CO5A 2CK3A 3I1FA 3UG6A 4AD8A 4C7OA 1MT0A 2DR3A 1DEKA 1XMIA 5FR2A 1T91A 2JLRA 2NPFA 2HF9A 4JBWA 2ONKA 3LFUA 3U44B 2VP0A 3P4YA 1SVKA 1KDPA 2IX3A 4RZ2A 2HUPA 2EFHB 2ZAOA 3SYLA 1HYQA 3T1QA 1YRAA 3DDCA 2NO0A 2J3EA 4URUR 3GCGA 2C2HA 1Z0AA 4DT1B 1NNEA 5F9FA 2H7VA 1UBCA 2QQ0A 1GUAA 2YWFA 1Q3TA 4OQLA 1E98A 4YXWD 4LHVA 1NF3A 1E2IA 5HKKA 4M1MA 1N0VC 1OHHA 1HH4A 4EFMA 1G9XA 1DOAA 5FL7D 5KSYA 4KHZA 2WWWA 2ZE6A 1I4TD 4FWIB 1RKBA 4KLNA 3QEOA 4PC1A 1NL3A 2CHGA 2XZLA 3GFOA 5G53C 5DISB 2IYVA 4G0NA 1E2JA 3RYTC 4OYHA 3VFDA 4NPHA 1GFIA 1CEEA 4NYMQ 2O0KA 3ZD7A 4CEIB 2GXAA 4ZPXA 1K5GA 3OFNA 1TTTA 4WVFA 3OIVA 4IOJA 2BOVA 1HUQA 3AUYA 3V00A 5LD2B 2ERYA 4NCJA 3F8TA 5FUXA 3QI2A 2AXPA 3AV0B 5LPNA 3IHLA 2ZE5A 2IEYA 3QG5A 4TL6A 1R8QA 4HB3A 4TLDA 1OT3A 3LA6A 3RLFA 3WMEA 1YZGA 2CE2X 1D8TA 1Z83A 4GOKA 4XSHA 5KYKA 2B6HA 1XD2B 4PPGA 4M4SA 2NMVA 2FEMA 2RGBA 1TQ2A 5JRJA 2X2FA 1D2EA 3KTAB 3CUEF 4KLZA 2ZRJA 4YDSA 1ZP6A 2GZHA 4AYWA 2DWPA 4XTRA 5FPKA 2JLVA 5IRCD 1UKEA 1Z0DA 4U7DA 2ZUBA 2W83A 5TMPA 2O8BA 3GEEA 5L3QA 1AQYA 1YZQA 4TL7A 5D3MA 3AF1A 2GRJA 2X19A 4EPYA 1ZUIA 1N6NA 2I1VB 5DGXA 3KB1A 4EQ6A 2XX3A 1GILA 2AWOA 3TR5A 3J81k 1G5PA 4NCHA 4CT5A 3DZDA 2A2ZA 3U7FB 4PC3A 4N0EA 3QUSA 1OIVA 4LBYA 5FTJA 3TKLA 1KDRA 1XX6A 4II7A 4A0GA 1NVUQ 2WMOB 4Q48A 3ETLA 5DHAA 2ODBA 4R98A 1W47A 3IIKA 3PR1A 5J5CA 4URWR 3WNCA 3KXLA 3KFXA 4P3YA 2CK3D 5IT5A 2JLWA 1V5WA 3GEIA 2YHSA 2AN9A 3GJ7A 4NHOA 2VHJA 3U3JA 2JJ2A 2ZI4A 2KBFA 4F4CA 4D4KA 3MWJA 5KSZA 4CEHA 4B3XA 1E2MA 2CCKA 4EFNA 5G41A 4JL6A 1GWNA 1DAHA 2CLSA 2GJSA 2O52A 1US8A 2UZIR 1IY2A 1UADA 1LY1A 4JLOA 4MGZR 3IO3A 1LW7A 2BBWA 5KDLA 1Z6AA 2WBLC 2OT3B 1GOTA 4NU0A 4B47A 3CX8A 3CH5A 1N6RA 5LB4A 5DNYB 5HZKA 1N6OA 4ZDIA 1DG1G 2W6JD 1RYHA 1NKSA 3BK7A 1SGWA 1NMXA 1OHHD 4C4PA 5HKKD 2IA5A 3H1TA 2OHFA 3TH5A 1UBEA 2WSMA 1LF5A 2AK3A 4OHVA 2PZGA 3TK1A 2OAP1 2CVFA 1NMZA 4V0MA 4IHQA 1M8PA 2DBYA 2OLKA 2QE7D 1G3MA 3GJ4A 4IEEA 1Z08A 1FQKA 3EWAA 1CR1A 5EZ5A 4TT3D 5EXXA 3QKTA 1II9A 2A5GA 3WMGA 1TF7A 4RJLA 3IDQA 2UKDA 1FX0A 3CW2A 4M53A 4DVGA 1YRBA 1UF9A 4TL9A 3T5GA 4ESVA 2PH1A 3WBJA 4CF7A 4M2LA 1NMYA 2D06A 4R7ZA 1BOFA 5L8VA 1NVVR 2MSEB 2GCOB 2WVJA 2IT1A 3LXRA 3C16C 2BCGY 1AQUA 2NO1A 2IYTA 5FPTA 3UPUA 4Z54A 5K8IA 4PHGA 3W90A 2JLUA 2RH5A 1XF9A 3W6PA 3CR7A 2ZR7A 2PZFA 4RD1A 3OESA 4KFRA 4UJ3A 1A4RA 4A92A 5E95A 3GFTA 4QC2A 4UXIA 1NBMA 4QGGA 3U61B 721PA 4H9GA 1BYIA 1RFLA 2CL6X 5EP2A 5K8TA 1MO5A 2OBNA 2O8CB 3NKVA 2ZEJA 2ZYTX 4DCSA 1L2TA 2ZI9A 3ZYCA 3R9WA 3N2EA 4M1WA 5KHOC 3GEHA 2EQBA 4NYIQ 4Q7LA 5FUYA 4S2EA 2J59A 2BBTA 2NTYC 2ZJOA 3TRFA 4Q66C 2MSCB 1G64A 4TQAA 1HE8B 1E9BA 4P33A 3LVQE 4K81B 2XITA 4TTPA 4UXHA 3SZRA 1L4YA 5EP1A 1QHHB 3EC2A 3W6OA 1W5SA 3CONA 3LVRE 2GF9A 2G3YA 3CX7A 1H8EA 1XTJA 3GLFA 1BYUA 4MUBA 1Z5ZA 2BKEA 3DMNA 2KWIA 4NKRA 4RZXA 1E9SA 6Q21A 5LD2C 4G1UC 4Z51A 2F1RA 3TQCA 1NSFA 1TL7C 5TARA 2Q9BA 2GF0A 1UFQA 4AI6A 1EWQA 5C4GB 3KQLA 3JVVA 1SXJA 2GTPA 2ZROA 2XJ9A 4D82A 2VSXA 1ZYUA 4URXR 1CJKC 1OYWA 3BAFA 4LJ5A 2R65A 3L43A 4PSVA 1VG9B 4NCNA 2P67A 2ZREA 1KGDA 3W34A 1RPZA 2JJ2D 4Q4HA 4Q4JA 3SYKA 1KI4A 2GJ8A 1R8SA 1JEDA 2JLQA 2ZRCA 2IBMA 4LJ4A 1X86B 3F5FA 3L8ZA 4LBZA 4XVQA 4ESHA 3QENA 4IDPA 2BWJA 3RS4A 3R7WA 3ZZTA 3EPKA 1NIPA 2H16A 2CL0X 2HXSA 3AVVA 3CX6A 4QFMA 3MJHA 3O8DA 2XXAA 4R2IA 1FTSA 3A6PC 2D4HA 3WXMA 3QKSB 5D3QA 1DO0A 3BIFA 4BFVA 4CEJB 1T5IA 4BEBA 4A1FA 3C41J 2WWHA 3RS2A 2VL7A 4BE7B 3CNOA 3ZQ6A 1TEXA 3A1TA 4H1UA 2KSQA 1OSNA 4PC6A 4HAUA 4P4SA 2PT7A 4IVRA 2FX3A 5CM8B 4JZKA 3U4QA 1P4SA 3RS5A 2QM7A 3K0FB 3ONWA 5C46F 4DLZA 3PJRA 5SZKB 2O8FA 4OHXA 1DS6A 2CE7A 1U8YA 1E1QD 1OXSC 4M21A 1M7HA 3AKYA 3KJHA 2W6IA 4Q1EA 2JAQA 3CIOA 1R5NA 2QPOA 1IONA 3HU1A 1LNZA 4OQNA 2FGJA 3LQQA 1Q22A 4YMTA 5KPJA 3ZS9A 1S1MA 5TY0A 5G3YA 5HE8A 3SJCA 3WP0A 1P7CA 1W46A 5FBVB 4P31A 3OEEA 4HAXA 3AF2A 1BKDR 4B2IA 5L3SB 1E2HA 1P60A 4PQYA 1KMQA 2PCJA 5JEDA 1DADA 4JVMA 4N0DA 2ZRKA 4RVCA 3O47A 2JJ1A 3MMPA 3NH9A 4OQMA 3BFXA 1IAQA 1ZIOA 4X8OA 3CZQA 1A5TA 3FFAA 2OCYC 4Q1CA 1YZNA 1LS6A 2PCLA 2IYYA 3FYHA 3F3YA 4DBLC 3U3KA 4ERNA 1W4BA 2QSZA 3R9XA 3M0EA 4URYR 4LC1A 4DLRA 3AVUA 2Q0HA 3VKGA 2QMHA 4JLMA 1W5TA 1F6BA 1XMVA 1EESA 2YOHA 1VDZA 1ZCAA 3AP1A 4YMSA 3UMFA 4LYAA 3FMFA 5A4JA 3VHLB 2VP5A 4JLPA 1EFCA 3T35A 2Q3MA 4DIEA 4BFUA 1E1RA 2EW1A 4DT1A 1JB1A 2ODWA 3M6AA 5AJXA 5H1YA 1IN8A 5CB8A 2HF8A 2MMCA 3V4RA 1GKIA 2BEJA 3BGWA 3A4NA 2R6GA 1SVWA 4OI0A 3IPYA 3AP3A 4QJ5A 1W0JA 1JR3E 1ZD8A 1BS1A 4AKEA 4EPWA 3VR4A 1F48A 2CMKA 3B8HA 5BN5A 4I1OA 3IKJA 2J0UA 4BFZA 2ZS7A 3TAHA 2HCJB 1SXJD 2P5TB 1UDXA 3LLUA 3E70C 3K0SA 1DVRA 4RD0A 3SI7A 4DSOA 3B1VA 1E2NA 2PJRA 3BXZA 3UK6A 4ACBA 3HPRA 2VEDA 5JBQA 5FTNA 1WXQA 1NI3A 1ZUNB 2VPPA 4EIWA 2IUTA 4LHZA 2XNSA 2G1JA 4LRWA 5BN3A 3RANA 1CRPA 1TNDA 1YZLA 4C3ZA 2PMKA 1NKTA 2I3BA 4LCBA 4MGKR 3TUIC 1KNQA 2YJTD 1KI6A 3CRMA 5JCZA 1OH5A 5FUWA 1XNJA 5E7IA 4DCUA 3T1TA 4TMKA 2C99A 4HYYA 4QBFA 1W44A 4PO8A 1DE0A 1II0A 1NY5A 3TW8B 4TL8A 4EAQA 2JIZA 2WICA 3GJ3A 1NVVQ 3VKWA 1DBSA 3UKDA 1W48A 3THYB 3UWOA 1G4UR 2QT0A 4LK2A 4D4LA 2DB3A 4QBIA 2VP4A 4C0HA 2QPAA 4D80A 4B43A 1P72A 1Q57A 3RRNA 3SJZA 3PIRA 2CJWA 3I5XA 2BC9A 3VX3A 4M9SA 2RGEA 3T15A 4PPFA 2WMNB 2W6ID 4LJ9A 4TLAA 4G5QA 2QAGC 4PQFA 4ZDWA 1AIPA 1IXRC 1WP9A 3TW4A 5M04A 1PJRA 3R9IA 3HDTA 4DWJA 3B85A 1ZU5A 3TLXA 2JCSA 3K9LA 3TQFA 1UKYA 3Q8XB 4HUQB 2QN6A 2B7CA 4Y0VA 3W3ZB 1FTNA 4BQSA 4MDFA 3OEED 1TAGA 3MWLA 1J8YF 4HDOB 3FB4A 4FMCF 5KDOA 3HJNA 421PA 4DCNA 1HQCA 1TU4A 1KI9A 1RIFA 3NDPA 1J7KA 3VAAA 1RRGA 3LV8A 3P32A 3KZ1E 5B2ZA 3ZZ0A 2GETA 2QTHA 1RJ9A 3K1JA 4URZR 5UKDA 2O8EA 4PZLA 4IDHA 1ZINA 1F2UA 4PPNA 821PA 1YHNA 1N0UA 2FE4A 4R9UC 1SVOA 5B58C 3K0AA 3NH6A 3PENA 3CR8A 4A8JB 4QJ4A 5EE0A 3LLMA 1AGRA 1UKZA 1X1RA 1P61B 4UNPA 4ZDJA 2ZU6A 5TDHA 1TF2A 4TMWA 1T8TA 2A5YB 3IHWA 5FOUA 4XOIA 3PV0A 2WKRA 2BKUA 4JLAA 3SHFA 1BO6A 1E1RD 2WM9B 2WKQA 1FOEB 4HB0A 2GEDA 3BC1A 3REFA 3A1UA 1XZQA 3H86A 4IRUB 2VHTA 1W0JD 4MYUA 1TQ6A 2HT6A 2ZRBA 2QRNA 2HJGA 2EFCB 4Q19A 4BZXA 1XPRA 4QM6A 2J45A 3EPLA 2QSYA 4AG6A 1NN0A 2J0QA 1CRQA 2ZJAA 4B48A 4DUGA 1N6PA 2GZDA 3RABA 1O87A 2FZLA 4L8GA 2RKOA 5FOVA 5HE9A 2V54A 4XVRA 3PXGA 1BMFD 3IQWA 2BEKA 1AJEA 1P5ZB 4I1UA 2RGNC 3LWNA 3IO5A 5BXQC 1TUIA 4M0LA 3EZ6A 2OFXA 2BM1A 1VHLA 1DELA 3FTQA 2JA1A 2EVWX 1GITA 3KX2A 3QKRB 1SHKA 2O8DB 4XH9B 4LBWA 3BJIC 1XXHA 1R0XA 2BCJQ 1HEIA 4KO8A 1T4GA 2ZS9A 4MYTA 3E5HA 3W6NA 3VNUA 4NTZA 4DCTA 4Q1FA 1N2CE 3THWB 1ZVQA 3DL0A 4TZ6A 2V7QD 4B74A 1E32A 3GPLA 1B0UA 4RZUA 1CBUA 3RS0A 4RZ3A 1AKYA 3ZJYA 3HP1A 4A6PA 4QNRA 1Q1EA 2RCNA 1QZXA 2HLDA 1MKYA 1YR7A 1J2JA 2ZJ8A 3CPHA 3RDPA 3DPUA 4C0BA 2ZE7A 4LHWA 2R9VA 2JGNA 1ESMA 2XNDA 1FMLA 3K0EA 4MRPA 4OKSA 1SVLA 1G17A 4OL0A 1OB5A 4A82A 3FMPB 3TSOA 1JEEA 4DZZA 1RZ3A 4HLUA 4BLOA 2GAOA 3ZH9B 2ZR9A 2G0TA 3T61A 2XOKA 2IYLD 4D25A 2OESA 2ZRAA 1E99A 3DO6A 1P9WA 3EA0A 2IF0A 5JWRA 1XPUA 1AK2A 1IN4A 1Q12A 3PUYA 1JI0A 2B8TA 3AGQA 4LJYA 4QHSA 3KB2A 1Z2CA 1Z6GA 4D0GA 3NTUA 1RE0A 3FGNA 4KYUA 2F6RA 3AVPA 2AXNA 3B1XA 3C8UA 4RKEA 5FL3A 3GFPA 2FFHA 2J41A 1QHIA 1X8LA 4QOSA 1J8MF 4KAXA 2OSBA 1UKVY 5CDFA 2ZI3A 1WBDA 2Q21A 2W2TA 4DCVA 2D7DA 3BOSA 3BFKA 4ZCLA 4OQFA 1I4DD 1PLLA 1E69A 3NBZC 1G41A 5CJ2A 4QGFA 5DI3A 3BB4A 1PUIA 4US2R 1MV5A 2FF7A 5CLLA 4BFTA 2HYDA 2YV5A 4N3NA 1W7AA 2R44A 2ZRPA 5JS8A 3N5CA 1FQJA 4F93B 4JLNA 2BIFA 1U0HC 3ZVMA 4OI2A 2AX4A 2IYRA 1G7RA 4RD6A 2AK2A 4ACAA 3I8SA 2J9RA 4FMBB 2C8VA 1P2UA 1U99A 4DUGD 1AS2A 1DAGA 1OFUX 3DHWC 4CDGA 1ZMXA 3EWSA 3RC8A 3QPVA 4BFSA 3KUCA 3UMSA 1TQ4A 4QHTA 2DWOA 2XGJA 3HU3A 4O2RA 1R5OA 2FGKA 4LV6A 4Y0AA 4B73A 2RGDA 3B78A 3LX5A 5JI3E 4Q4AB 1TEVA 2GCPA 3SBEA 1T3LA 2J7PD 3QVVA 3QBVA 4ARZA 2V8OA 4A8JC 4DDWA 1E2LA 4DXAA 1CULC 1A2KC 3LY5A 4QKQA 1E0SA 1F2TB 2G6BA 1ONBA 5EXSA 2W0MA 5DH9A 3I61A 3U3MA 4B3CA 1Y63A 1U2RA 4OI1A 1VPLA 3WYFA 2CVHA 3FKQA 4IW3B 5J4KA 2FSFA 1KKLA 1MR3F 2ZSFA 5E7MA 3D31A 1OFIA 5H8WA 4A15A 3MGCA 4CW7A 3BH6A 4HZUB 4L9SA 4DLWA 5JHGB 3D6TB 1VCMA 4IOLA 5DE3A 2NGRA 1E9EA 2HYIC 2NIPA 3QKUA 4BRWA 2LWIA 5C4MA 3KQKA 1S0UA 4QG7A 2HLDD 4Q1AA 1G7TA 1YU9A 3C5CA 4C0LA 3VR2A 1NLZA 2ATXA 1JPJA 3KFVA 1JPNA 3GLIB 1IXZA 2G83A 5K8LA 1DAMA 1B23P 3NXSA 5KNBA 4BLPA 4B3FX 4PXAA 2Z4SA 3BORA 2ZUDA 2ODNA 4AIIA 1QDEA 4GMXA 3B82A 2J87A 2IUUA 3MAAC 5HCNA 4Q21A 1XJQA 3Q5DA 1KSJA 4IXMA 2IL1A 1LB1B 1GNQA 1ZW6A 4LJ8A 1NLFA 5JFGA 4MITA 4FCVA 4V02A 1ZCBA 1N6LA 1MABB 3QVUA 3WRYC 3TE6A 3G0HA 4V0KA 1NLYA 4D0LB 1OPXA 2OE2A 2WJVA 4FXPA 5JEEA 5E3HA 3UANA 5KU1A 2QG6A 4JJZA 5P21A 2H1LA 4GFDA 3EIEA 2VF8A 2BJVA 1P9RA 1VYVA 1FW6A 3RRYA 4TYYA 1KMHA 2XEXA 4FCTA 1MRSA 1E2FA 1VCIA 1XRJA 4LYFA 3QF4B 3O8RA 2IS1A 1XCPA 4BLTA 1ZC4A 4B3BA 2OCPA 3TR0A 2P65A 3MCAA 1CS4C 1YKSA 1YR6A 4AY2A 2G1KA 3IQXA 2QAJA 1U94A 3W5JA 3CRW1 1G6OA 2QPTA 3KJEA 3SOPA 5G3ZA 1LFDB 3LDAA 3SEAA 3B5JA 4JLVA 1CJTC 1P9NA 1IBRA 4A2QA 2P6UA 3R20A 2GCNA 2JLZA 2IC5A 1GM5A 2RHMA 1N25A 5J40A 3DKVA 1SXJC 2QZ4A 2A7QA 1S1CA 2ATVA 3Q85A 4NONA 3TAUA 1GKYA 2ERXA 4A0RA 4JSTA 1CJUC 2CXXA 3PCRB 4TQUS 1KO5A 4ZO4A 4KU4A 5AWFC 2VRWA 2GBLC 2QMUA 5EUQB 4OJKA 1NG9A 4UNSA 3T1VA 4IOMA 4O2LA 5KNCA 5FBRB 3L0PA 2QUZA 3GJ0A 4A9AA 2AKYA 1JQLB 3NVAA 3P20A 3KQUA 4TYPA 3CF6R 1N5IA 1QBKC 4RFSA 2JATA 3Q7PA 1AZTA 2ZPTX 2FSIA 4LHYA 3C14C 3BFVA 3QXCA 4JIMA 4UNRA 1VCNA 2XJ4A 1XEXB 5ANRB 3JZAA 3EAQA 4BZQA 4BFWA 4B6FA 1ZBDA 4HEJA 4MYHA 4BGDA 1KI1A 2OO7A 3GLGB 2NO9A 3DM9B 2K5UA 3A4LA 4EJSA 2OLJA 5JSZA 4LGMA 2J1LA 1KI3A 4F4IA 2KB0A 1KK2A 3U60B 1G8HA 1K8RA 3CM0A 4UQOA 1VIAA 4TYWA 3THXA 1QHSA 4ZIRA 2IYZA 3BERA 3L0IB 3NG1A 1Z0JA 2ZSEA 1Z6YA 4Z8YA 1JJVA 4JLBA 1II8A 2OILA 2P2LA 2XB4A 3D8BA 4O3MA 4F38A 2VHCA 1DG3A 2BDTA 3PQCA 4C0KA 2ZRLA 4TLEA 4Q9KA 1Q1QA 3OFND 3UWKA 4KFUA 2IS6A 2WHXA 1S8FA 3AVTA 2QENA 4E07A 1QVRA 1SQ5A 1UM8A 4A0FA 5KPDA 2VYFA 3VQTA 1JBKA 1ZRHA 2ZQ5A 1T3HA 5JLJA 4LBVA 4G5SA 3T34A 4L4UA 3QQ5A 2PMDA 1KO4A 1R0ZA 2GHIA 4Q1DA 3ADCA 3KQHA 4X8MA 1QHGA 1FNNA 4FI3C 4E09A 5KNDA 2FA9A 3NBFA 2HJVA 1E9DA 1G5RA 4HAWA 2DY1A 2A9KA 1G1MA 2DFLA 2V4ZA 4HB4A 5JJIA 1NY6A 4E22A 2ZJBA 4I1VA 1ETUA 3TMKA 1C1YA 2YNMA 2FFAA 2QP4A 2UZ3A 4DEYA 1SXJE 1U8ZA 1XBTA 3JZMA 2GJKA 4WZBE 4KJZA 3A58B 4AKHA 3RRMA 1N5KA 3O8CA 3CLVA 4DSNA 2ZJ5A 3I8XA 4AURA 4D81A 1HT2E 3B60A 3T12A 4DDVA 2H92A 1T9HA 4GOXA 1AZSC 3GLHA 4GI7A 4HSEA 4LPKA 2RGGA 3FFBA 1IN5A 4M1OA 4Q03A 3I32A 2QBYB 1HT1E 3FKSA 3EPJA 1KAOA 1G20E 2J0VA 2WZQA 2QAGB 4M8NE 5KSPA 1KI8A 3LQRA 1OH7A 1GL7A 2EYQA 1GP2A 4HATA 4BLQA 2HEIA 2QTVB 3CNNA 1PVOA 1O3YA 2D3WA 3WMFA 4B32A 1E96A 5DLQC 4HAZA 3TVDA 5BWMA 3N2IA 1GL9B 4NDZA 2ASEA 2AD5A 5B57C 2NQ2C 4Z8XA 4TZ0A 4CRWB 2CCGA 4PR0A 1KK3A 1W36C 3S1AB 2HXYA 3AUXA 1U0LA 4FMDF 2F1IA 3LW7A 2OM2A 3IEVA 3VR6A 2AFHE 4M9QA 1X8KA 4TN1A 3TUZC 2C96A 3IIJA 1XP8A 3FMOB 5JMTA 1XEWY 2F43A 1BIFA 2ZJ2A 3WYGA 4EDHA 1QHNA 3A1WA 3QY0A 1EFRA 4NCIA 1COWA 2GK6A 4WZ6A 4FWTA 4HDQB 4P4UA 2VBCA 4F4JA 3UMRA 2ODEA 3ASYA 2ZSDA 5IF9A 5JS7A 1Z0IA 5EXPA 3X1DA 1JXMA 4DDTA 4URVR 2ZSAA 1D6JA 3G5UA 1LVGA 2RMKA 5FPYA 2ZI7A 3VU9B 4BLRA 3B9QA 1Z8FA 4Q7JB 1R10A 2YOGA 4MKGA 2HCBA 1KY2A 1NJFA 1QG2A 2ZANA 3ECCA 1MO6A 2WOOA 4H1VA 5GJCA 2DWQA 2O0HA 1G7CA 1VYTA 2GVZC 3OAAA 4GZMA 4PANA 4Q00A 5BW8A 1XFAA 2Q3HA 4ZI2A 1MO3A 3LAWA 4Q4LA 2P0EA 2B7BA 1OW3B 1ZM3A 1RRFA 1DPFA 4WXRA 3GLIE 1NBMD 4JLDA 4A2WA 1D5CA 4C7OB 2FDCA 2C9YA 2VTKA 4JS0A 1I4LD 1E9AA 1DAEA 4DRZA 2FH5B 4UNNA 3C4JA 3HU2A 3R8CA 2ORIA 4XIGS 4XVUA 2NZ8A 1F60A 3PUVA 2CLCX 3AVQA 1TX4B 4JLJA 4Q4AA 3AVOA 2CEAA 3U44A 5ELXA 4K8OA 4HDCA 4LV8B 1Z6TA 4PFSA 3CZPA 2V55B 3U6BA 1WCV1 3K09A 1IY1A 1HQYE 2C5LA 3BD9A 1ZJ6A 3LO5A 3P4XA 2J0SA 2RHDA 1XWIA 1F2TA 1R0WA 3ND8A 4WXPA 5EP3A 1H8ED 3TSZA 1GNRA 1ANKA 5FR1A 1FNMA 4LX0A 3AF3A 2F3RA 4JVSB 4LY6A 4QBHA 4JJKA 2GA8A 5A5GA 2GJAA 1OXXK 4C0JA 5AJZA 4L15A 1PLJA 4B33A 3FKSD 3QG1A 1GG2A 2EFDB 1KSFX 3NIBA 5EE1A 2G77B 2QGZA 1N0WA 3EG5A 1N6HA 1VCOA 2YINC 4PZYA 4OHZA 3ASZA 1C9KA 2EFEB 3A36A 2J46A 3CB4A 2ZE8A 4A2PA 2IYXA 3CRQA 5LB2A 3BH0A 2C95A 1VMAA 4HI0E 4MGYR 4ASUA 4CEIA 4MGIR 4WZAE 3BS4A 4Q47A 3SQWA 4M22A 3U3OA 2QTFA 5FTKA 1KKMA 1EGAA 1KTVA 1ODFA 3BB1A 2F9MA 1EFHA 1GDDA 2IW3A 3VKHA 1KI2A 4W5HA 2A30A 5F9HA 1AKEA 1KZGB 2DPXA 3SJAA 4CIDA 1IXSB 2QY9A 5DIFA 3SDZA 3WP1B 4TWZA 1KOFA 1XD2A 3RWOA 4B6EA 3MJRA 2QNRA 4I1SA 2VH5R 5FTLA 3KTAA 4P32A 1COWD 5SZIA 2ZAMA 4B2PA 4WA7A 3LBNA 3CWQA 3KQNA 5B64A 4IVQA 1ZD1A 5EE3A 3QXJA 3WBKA 5L3QB 1PUJA 1W2GA 5HTKA 1JR3A 4Q02A 1VG1A 3SFVA 3TUJC 5D3MB 2NZJA 4G5GA 2G9NA 1G8FA 2AFIE 3AB3A 3FOZA 2A5FA 3OE7A 5FBQB 1XJ0A 2ANCA 4EQ6B 3EZ7A 1MOZA 3ZVRA 3HYTA 3HR7A 3FDIA 3GLGE 4YMWA 5J47A 1CU1A 3G82C 4HLUC 2WAXA 4G5OA 2V9PA 3K70D 3OAAD 4UNQA 2GVDC 2X8AA 3VR3A 2Q6TA 3KXKA 2RAPA 2O5VA 2CBZA 2G0NA 4RD4A 4UJ5A 1TADA 2NG1A 3U7HB 1W4CA 2JJ1D 2KE5A 2WAYA 5AJWA 1FFHA 1GKUB 3GP8A 3MD0A 521PA 4JLKA 4JMPA 4OHYA 5IK2A 1CXZA 1UEIA 2ZYVX 3EZ9A 4CEHB 3ND9A 3SBDA 3VNVA 2QP9X 3WNBA 4KBFA 2CDNA 1US8B 3QXHA 5AJYA 3VHXA 4WOPA 1M2OB 4FCWA 3TVTA 2FFBA 2QP3A 1OIWA 4NMMA 1GSIA 2WOJA 5F3WB 2IXEA 3MFYA 3EZ2A 4PTLA 4C0SA 1XMSA 4UKDA 2R6DA 4BFYA 2BHRA 1XU4A 3E2IA 3EIQA 4GSYA 4IEIA 4XWKA 4NZYA 1BH2A 5DN6A 3CBQA 2PJZA 3FHOA 4L5BA 1GIAA 2DFNA 1A82A 3F0TA 4G3XA 2RGAA 5TVKA 3SFZA 3NEJA 3HWSA 2Q3FA 4L9WA 3LBHA 2QU8A 1IJEA 1OXTA 2GXUA 1IOZA 2EWWA 4B34A 1GRNA 2JLYA 2O0JA 3NBYC 2WWFA 1CR4A 4PZZA 1M7GA 1Q1BA 2QMOA 1FX0B 1XXHE 5BN4A 4TMTA 1IM2A 2ORVA 3KJGA 4LPSA 4TLCA 2C77A 2IF2A 4M1SA 2IWRA 1XJCA 3MWYW 4OBEA 3EPHA 3Q72A 1Z06A 2WWXA 4IKEA 3EC1A 2FG5A 4US1R 3QSYA 2GEVA 3WHLA 2I4IA 3RC3A 3VTKA 3K53A 2GCOA 2ZRFA 1KO1A 3IUYA 3PUWA 4AYXA 4TMZA 3GMTA 3BE4A 1EFUA 3CWZA 1W36D 1Z28A 1XEFA 2WPDA 3GD7A 4HLQB 2R8RA 3RS7A 3T06B 4BWYA 4OQXA 4P4TA 5F2EA 1LV7A 3NC0C 3B13B 2H18A 4LV5B 1Q1ZA 5EE5B 4ZCMA 2BBSA 1T0HB 4DLTA 3GJ6A 1OF1A 3E1SA 3LBIA 1JECA 2JIZD 4RCZA 1ZM7A 5CJPA 1CIPA 2BJWA 4IFBA 4U5XA 2Z4RA 5CLQA 1T5LA 3QE0A 1WA5A 4LOAA 5GVSA 1E2GA 2O8CA 1YVDA 1UDWA 3AVYA 4B75A 4MQBA 5HZHA 3SYNA 3B1WA 2HV8A 4LC0A 3QPUA 4TTRA 4HUTA 1PLKA 4DLSA 2Z83A 4KODA 3OE7D 4M1TA 5BQ5A 3A1SA 3GLFB 5FOSA 3AKEA 4DSTA 2WJJA 1QHHA 4MKIA 5K8UA 1A7JA 4A6XA 3EIHA 1XDBA 5CDFE 3M1IA 2C9CA 2VF7A 4PQRA 5FL7A 5CYPA 1V43A 2PEYA 5JRZA 4B35A 4DEXA 1XTKA 2REOA 4YONB 1SXJB 5CK4A 2F1HA 3R8FA 2W2XA 4KXFB 2CNWA 4Q7MB 3PUZA 4XD7A 4Z1MA 2YVUA 2JJ8A 1CKEA 1E4VA 4Q4HB 2PLFA 3QPWA 4Q4JB 5IK2D 3RWMB 2TMKA 1XZPA 5CIWA 4Q01A 2C04A 2JASA 5LBIA 3W8RA 5AUNB 3OEHA 3FHTA 4LJAA 1G7SA 3SNHA 4LZZA 1CR2A 3R7WB 1ZU4A 5J4VA 2DFTA 3RHFA 3ZD6A 1E2EA 5FOXA 4GOJA 4RFVA 3BBPA 2FN4A 2WJIA 4DC9A 2XXAB 2VP9A 4MRVA 5CITA 4PAMA 1EX7A 3AVXA 3CRRA 1EWRA 3DVLA 5EUMA 2IS4A 1N5JA 3QKSA 3AM1A 1Q3HA 2P5SA 2WSSA 2XTZA 1QVAA 221PA 2QGNA 5E7JA 4CEJA 3JVUA 4P4SB 4W7SA 1YJ5A 1G291 3MUFA 4JYCA 1U0JA 1HURA 3HR8A 1OV4A 4POAA 3CNLA 2JLXA 1XTQA 3U4QB 3QJYA 2X2EA 1TMKA 4DHEA 1OXVA 3VR1A 3RAPR 1Z2AA 4AC9A 1ZD9A 4KVAA 5JCPA 1WBBA 5KDDA 3K0FA 2R62A 4QGHA 1OXUA 3SC3A 2OCAA 4TSFA 2ZI6A 3KKNA 3MRSA 5JJLA 4JBYA 3I73A 4FW9A 1NIJA 4FMCB 1X8JA 2OZEA 4PSAA 2X1VA 1Z63A 5CK5A 3AGPA 3K9GA 5G40A 3NHAA 3MG9A 3TNFA 1XCGB 3DM5A 4EUNA 1R0YA 4B3GA 2WPDD 2ZRNA 3NC1C 5IHPA 1AS0A 2ZS8A 3B1YA 2GKSA 3NEYA 1QHYA 5L3SA 5JJKA 2V3CC 3C7KA 5AUPB 1CTQA 2OCBA 4GPTA 2REXB 2OV2A 2ZVPX 3QF7A 2FMXA 2WWIA 5H70A 4EJSC 2E1RA 3TIFA 1QRAA 1JALA 4ABYA 1JXOA 2FJUA 2KJQA 3PVSA 2RGNA 4GT1A 2B92A 3ICEA 1Q44A 1S4QA 2VSFA 4QXAA 4KV9A 4I99A 2AHOA 1E3MA 5TB5A 3RRZA 1R6BX 3PEWA 3L0SA 2BMEA 3B9PA 2JLSA 5DYIA 2C9OA 2XSZA 3VMFA 3ADBA 2RB4A 5FPSA 1X1SA 3EASA 3NWJA 1RRCA 1PV4A 2XNDD 1H8HA 3VX4A 1TF5A 1SKYE 2AWNA 2W6JA 4DLYA 1E79A 2N46A 3RS3A 4KSBA 4BPBA 3K9HA 3GQBA 4C2TA 2H17A 1A1VA 1W49A 1ELOA 1DO2A 4F92B 1U9IA 4CT4B 2J0UB 3RVBA 2XOKD 2QE7A 2EWVA 4PHFA 4GBMA 3LX8A 4WBSA 4TT3A 2CNWD 1S3SA 4XD7D 4Z1MD 2OFOA 2PL3A 1KDTA 1GVNB 3IGFA 4DB2A 2XZPA 4D0NA 2FU5C 1D9ZA 4TYQA 3X1ZA 3OEHD 2ZVQX 1E6CA 5C2JB 1YZKA 3ZIAA 1W36B 3OIYA 1KI6B 3LRPA 2EYUA 5GVRA 3K0CA 1OIXA 4LI0A 4ZCIA 1MH1A 4MKHA 1E2PA 1FUUA 4JL8A 2QT1A 2VHUA 3A1VA 3I5YA 4W9MC 3AKDA 3M4YA 1MRNA 4JKIA 1J99A 3W3AA 2WSSD 3D3QA 2VO1A 1F3OA 2AR7A 1N5LA 5F98A 3FHCB 4M1YA 3GJ5A 4AKGA 2IHBA 1YE8A 2E87A 2GXSA 4BEJA 2P6RA 2WKPA 2G88A 1OYYA 3QOFA 3ZZUA 2GWHA 4EPTA 3THYA 2CJWB 4NYJR 3SS8A 3MLEA 1E0KA 4EFLA 1EFTA 3EXAA 1WF3A 2GILA 3W9YA 1AA9A 4TSFD 2B8WA 1KSHA 1TU3A 2NPIA 1JQJC 4US0R 1SKQA 1YR9A 1R7RA 1XD9A 2AKAB 2GK7A 3KKOA 1XD8A 3IIMA 1K5DA 2QORA 4V0ME 4KI0A 1C4OA 2WJHA 1XMJA 4RY2A 4Q9LA 4HUQA 1KO7A 1RW4A 5AUQA 1DAFA 2XTNA 2J5XA 2ZJZA 4LJ7A 5FOWA 1EG7A 2FPLA 4YLGA 3ICQB 4YMVA 1G3RA 4DLXA 4ZDKA 1NVXQ 1CJMA 3CPJB 4IOKA 1RJ9B 1L7VC 1UPTA 3P27A 3AF0A 4J0QA 4OK6A 2O8EB 3U7GA 1F2UB 2ZIAA 4IFEA 1D2NA 2MSDB 1M7BA 3CKLA 4ZI3A 4CVNA 4CGZA 4CZ2A 4ZKEA 3K0AB 2F7SA 3ZGXA 1E94E 2BMFA 4B76A 1KO8A 4JKYA 4M1KA 4W5JA 2D62A 5EE9A 2LKCA 2PBRA 1P73A 4B2LA 3K8YA 2A5DA 2XSZD 4A8JA 2HDNB 1E9CA 2VLIA 5BYKA 5GADl 3CF0A 3OIWA 4MRNA 1E2DA 1NBME 1H8HD 1VYUA 1ZNWA 4OHWA 1CLUA 5LDDC 1E79D 4TTQA 2R6FA 4JVLA 4BECA 2DFKB 4DDUA 2AD1A 3ADDA 3EX7C 3WYAA 3H84A 2OG2A 1U98A 4YC7A 4NBSA 4O25A 3RSLA 3K70C 2GEUA 2FFQA 1ZNYA 2LKDA 1N6KA 2HT1A 4AWXA 1T6NA 5AR1A 1CP2A 3U5ZB 2OBLA 2OBMA 2CL7X 2PX0A 3AVWA 4Q1BA 2Z5FA 1G8GA 2QI9C 4PX9A 5FI1B 5KSOA 4D2IA 3FVQA 1P62B 1RC8A 2PZEA 1M6NA 2OEPA 4GMDA 3LW8A 5DHFA 1E1QA 1OE0A 2C98A 4P0TA 1W4RA 2CLDX 3GLFE 4YQFA 2CHQA 4PHHA 3B7GA 4LHXA 2VHQA 1I2MA 3MWKA 1OJLA 3T5DA 4A36A 3GLHE 4LYJA 4HZIA 3ZIAD 4OK3A 4E5UA 1J70A 1JNYA 2BM0A 1ZM9A 1W0KA 2Q9CA 1XXHB 3K09C 1F5NA 2YZ2A 3Q9LA 4ILEA 4Q9IA 3QKRA 2H8KA 3Q7QA 2O8DA 2D2FA 4AG5A 1R5BA 4KITB 1P2VA 3ZS8A 2QEQA 4KFSA 1Y3AA 1GNPA 3OIUA 4MH0R 3FPAA 1SULA 5CB6A 4LUCA 3ZVNA 3L82B 2BMDA 3SJBA 3THWA 3NDBB 3ZQJA 4JT4A 3TBKA 1ZM2A 2KBEA 2ZSBA 2ZYWX 2ZITA 1EXMA 4JT2A 4RSGA 3PEVA 4JYBA 5CM9C 2C03A 2PEZA 1AGPA 4KBGA 3RNLA 1TPZA 1U81A 1Z3IX 2L0XA 2W58A 5AUOB 4D4JA 1VECA 4E03A 4MA4A 3U6KA 4PAOA 3KDSE 4GP7A 4WAUA 3WHKA 1OFHA 3LXXA 2XAUA 3KKMA 1XCMA 5CYOA 4I81A 3V4FA 4Q18A 2ZU0C 2DHRA 3VR5A 1TUEA 3SQXA 2GXQA 2IUSA 3IBGA 4R71A 4GNKA 2D74A 2EU8A 3UXMA 3KXIA 5J4LA 1KK0A 1G3UA 3DEFA 1Q20A 2F9LA 3Q3JB 1CJVC 2PT5A 2R2AA 3PEUA 3WNDA 4RD2A 5AJVB 2IK8A 4D26A 2IXGA 2YC4C 4QM7A 2RGCA 2GBLA 2YYZA 3C15C 3REGA 5J4HA 1G16A 2W2VA 2QA5A 1U90A 4PC2A 1GRRA 3DKPA 4JSYA 4PHTA 3QIAA 4HLDA 5IDVA 3I4LA 1FMJA 3OHMA 4KYIB 2ANBA 5DI3B 4BASA 5JWOA 5KO2A 3CRVA 3MSXA 2ZRGA 2Q9AA 1S3GA 3DZ8A 5L3RA 4IDQA 1OH6A 1KJWA 2YWGA 4MUAA 3W8NA 2DYKA 1ZNXA 4JBXA 2FPMA 1VHTA 4N1AA 4X8LA 2FZ4A 5EXTA 1JAIA 1NN1A 2YOFA 1G19A 5L3VA 1NN3A 1UJ2A 2QQEA 1XTSA 4TMVA 3TSWA 1KJYA 1M74A 3I92A 1NVWQ 3U7EB 4B3DA 1NG1A 1P2TA 1S2MA 2GDJA 2ZRHA 3Q5EA 1AM4D 2QM8A 1SZPA 3KKQA 1HV8A 3AH8A 4XJXA 2P3SA 2JEOA 4GL2A 1G6HA 2OFWA 4PPQA 1J90A 1EX6A 4B71A 3LD9A 1G18A 1ZUHA 4ARZB 1MO4A 3QBTA 4G5RA 1N3BA 1W0KD 3FWYA 2A3RA 1JAHA 5SZJA 5BYJA 5FBWB 1T8UA 4IDNA 1IY0A 1E2KA 3UG7A 1OKKA 3IBYA 3QXSA 5SZHB 1GAJA 2FSHA 4Q5IA 4NYJQ 4FINA 1WDTA 3C5HA 4MRSA 2UVQA 4EPXA 2GZAA 3PFIA 1Z22A 2ZRIA 4A4DA 3QEJA 4JL5A 5FUVA 1L4UA 1D2MA 3ZLJA 2ONJA 1Z07A 5JECA 2FOLA 4IDOA 4EKDA 4B44A 4PAQA 5JWHA 5HR5A 2NO7A 5E4FA 2IYSA 1K6MA 1G8PA 2H57A 4V0LA 1DARA 1N6IA 1KK1A 1RYFA 4HZUA 5JHHB 4GDFA 4KVGA 3QNUA 4UXJA 3BWDD 2C78A 3HPQA 4NL4H 4TMXA 4G01B 4TQ9A 3THOA 1HE1C 4C0AC 1GRQA 4PSKA 2A5JA 4D4MA 5KTYA 1DAKA 2GNOA 1VG8A 3GLIA 1LF0A 4QHYA 2V1XA 1UBGA 1ZAKA 3QXXA 1TQDA 1W4AA 4JVNA 1U8AA 4XTCS 1I2DA 5DI9A 4S35A 1MABA 4IJMA 1OFTA 3B6EA 1ESNA 3B1ZA 4FN5A 4PO1A 1G8YA 4OK5A 2PLRA 3KJIA 3FMIA 1SKYB 2RGXA 2W0SA 3OF5A 1CF4A 1BMFA 4HAVA 4NP6A 5KOYA 1KMHB 4XWOA 1CR0A 1X3SA 1G3IA 1EFRD 1SVMA 2WIBA 5TXGA 1IN7A 1RVDA 1JJ7A 2O8BB 3X1XA 1L8QA 1KIMA 3V9PA 1A2BA 3QF4A 4OI4A 1WMSA 2GAAA 2ZM5A 2NO6A 3UATA 2ZTSA 4C0QC 2Z43A 2ZR0A 3DOFA 3L2OB 5EQTA 3IILA 3H2YA 4QL3A 4OJQA 1IN6A 3L0OA 4V0NA 4YDHB 1XB2A 5KUTA 2EFGA 4U02A 4DJTA 5HCIA 3P1JA 2V7QA 1KSGA 3SE0A 2QRZA 4AK9A 1VKJA 2MMGA 2Z0MA 1QHXA 1SVSA 3EARA 1ZM4A 4U00A 2CHVA 4BFXA 3LH5A 2VA8A 1X6VA 1AS3A 5EP4A 5B30A 2V6IA 1QG4A 4HB2A 1KI7A 5EJEA 5GJBA 4EPRA 3IPXA 2ZYUX 4KFTA 4ZKDA 2QMEA 1ZC3A 4RCYA 1WB9A 1P75A 2GJ9A 4NCKA 1HA3A 4FMDB 1NRJB 2XTMA 3HYRA 1UAAA 4C9BA 3SN6A 4ZV4A 1NJGA 1OB2A 2VP6A 2JDIA 4RFSB
chains in the Genus database with same CATH superfamily
2W4MA 2X77A 5JCOA 2CMDA 1N9BA 2Y92A 3ZVLA 2AW3A 3JQAB 2G67A 3RHTA 4MUJA 3LY7A 1JI3A 4YHHB 4OMUA 3CLTD 3UW1A 3QVGA 4EHHA 1V1MB 2IXAA 3SU8A 1WRBA 1JLHA 4AQDA 2NQTA 3VP0A 1YQDA 2BZ0A 4IDDA 3D6HA 3IR6A 4I46A 3IHBA 4WK4B 3ZHBA 5LZ8A 5A0FA 2HO5A 4OBXA 5CHMA 4MDEA 1J0CA 4K6MA 3UV3A 1IRXA 3OPLA 1VIYA 1A9RA 2PRKA 1IJFA 4K28A 4DLVA 2I1QA 1SHZA 4FIDA 3RSOA 1UM9B 1N5MA 4YMUA 4UOQA 2ZETA 1W29A 1QS0B 3EGOA 4L28A 2NU9A 2OHJA 5CTNA 4DA8A 1B4DA 2KLBA 2ZXEA 4HNUA 3KLNA 2L2QA 4CHGA 4WZZA 3NDEA 3W5IA 4Y2XA 3I3SR 3UB3A 2VG8A 4CTKA 3BGSA 1KETA 1X7DA 1ERMA 1P77A 1P1KA 1RTTA 4PNZA 2F1OA 1LK5A 2WTUA 1C4XA 2V5UA 2GM9A 5IH3A 2WUDA 5DYGA 5FOQA 1YCHA 4IINA 1PJBA 1DTSA 3ZBTA 3QNMA 2EEPA 2VP2A 2G4LA 3CF2A 3SKYA 1AQLA 1PU2A 4YPFA 3F7TA 5I8WA 1YSPA 1PG5A 2AW5A 2LR0A 1B93A 4GVPA 3UG6A 3I1FA 3I2YX 4NJMB 1DKUA 1T91A 5E2IA 3TQQA 5EOOA 2PS9A 4RZ2A 3GEGA 3AXSA 2Q6KA 4ZZ0A 3ZHQA 2CUKA 1Q3TA 1E98A 2R7LA 3NVKI 1DOAA 2G5PA 3DW0A 4FNMA 2X8JB 1IDOA 2QMYA 3AJ8A 4J3FA 5CJJA 1YK0A 2P2GA 1WSBA 1VMIA 1SM4A 4RE5A 2NMVA 1T4CB 3T54A 2Y0PA 5BSHA 2WG1A 2IELA 3SXJA 2ZRJA 4W5NA 3OT4A 4ZYUA 1Z0DA 3JQ6A 3KETA 1FOFA 4EPYA 4IQFA 4ZMBA 1ZUIA 2AN5A 1DC8A 3KXDA 2QDKA 3U7FB 1ECBA 4HS4A 3PBRA 1WDKA 2JE5A 1DWOA 4YV2A 1OAKA 4GLJA 1JAZA 1JTVA 2D01A 5ALLA 2AN9A 3GJ7A 3FOFC 4FGWA 2I03A 3KU4A 1GWNA 5FWXB 1WAMA 4FXOA 1FLNA 3DBRB 4RMGA 2WBLC 3MR0A 3DGFC 4RSMA 1SGWA 1GA6A 2Q6LA 2B98A 4GHIB 2DBYA 2PRJA 2F64A 3ZG6A 4UFNA 1A9PA 4MJLA 4G56A 3CW2A 3H17A 1IBLB 3WBJA 2J5BA 3LPNA 2D06A 1BDIA 2DP4E 1AXGA 1YZ3A 2IT1A 5HJ5A 1RXIA 3FFWA 4UHUA 1KZ1A 1CP3A 4LXIA 4PHGA 4MLZA 3ETNA 4PVDA 3DKRA 4QOIA 4J4BA 4RHXA 2CL6X 5ESXA 3NIDB 2OBNA 4ME6A 2OL4A 4FN4A 4RHYA 2GM4A 4M1WA 3SLGA 3N6VA 4KPUB 4RNCA 3SKXA 1K63A 5JSFA 2H2AA 5LYYA 3HJBA 5AVVA 4YJHB 3LIFA 5TPWA 1RM5A 1E2UA 4Y1RB 4NKRA 1E9SA 1G28A 3B7WA 1LV8A 1TL7C 3FSEA 1EWQA 3JVVA 2XJ9A 2YDXA 3UPDA 4FYMA 4ALNA 1A27A 1VG9B 3CTMA 3RTEA 4NNJA 3G0DA 5TT1A 4ESHA 2BWJA 3ROPA 1NIPA 2O9JA 4QXQA 1F98A 3AFMA 1EWTA 4O8CA 4FBLA 2WT8A 2CHUA 1UP7A 5SY9A 1TK3A 5BR4A 2F59A 1E1NA 4Z4HA 5CHUA 3CEJA 2YV1A 5THKA 4DLZA 4ZBEA 3AKYA 3QP4A 1E8DA 3MWDB 1QRSA 2A1UB 4OQNA 3VC7A 1O89A 3LQQA 4ENSA 3H3XA 3MS4A 2ZSUA 1YKDA 2FK8A 1KMQA 2NLOA 5EPUA 4EDFA 1FFXA 2JJ1A 3I5AA 1FYDA 2Q1YA 2R8OA 4QWOA 1Q0TA 5B1DA 1UBJS 3LDGA 4OXIA 1ZX1A 1DZIA 2OGWA 2FI1A 3PYLA 3LKZA 1TW2A 1UJ4A 2YOHA 1AGYA 3FVVA 3F5QA 4AZVA 2BTFP 1UKCA 2WGWA 1RI1A 2YXPX 5DP2A 1IN8A 3SQMA 1W0JA 3IH9A 3L6DA 1KH1A 3IKJA 1XTBA 3EQUA 2GN4A 1KOGA 2B5VA 1Z73A 3HPRA 3IF5A 2DTDA 5TQ2B 3ONFA 3SY8A 5EQDA 3PHCA 3LPMA 4OQDA 1KEVA 4X5OA 1QH8B 3G2QA 3T4UA 4HBZA 3UKDA 4FB4A 5EJ6A 1YNOA 1AVTA 3RRNA 4YAIA 3RGWS 3Q87B 2IW1A 3OY7A 1SBQA 2DUNA 1BQ3A 2C4UA 2VJPA 4UBOA 3P9YA 3B42A 5M7EA 4BQSA 3ITDA 1UC9A 1YBMA 4HDOB 3K15A 4DCNA 4O2BB 1AKNA 5BWNA 3O5AA 3K1JA 3R5TA 1H6DA 1ZINA 3UN1A 1F2UA 4O4IA 4XXHA 5IBRA 5IXYA 3ULFA 1A71A 1P61B 2LCQA 4XOIA 1JKJB 3IDSA 5IN4A 3HH8A 3IXLA 4MS1B 1XZQA 2NTVA 1OTIA 1NN0A 4D9IA 2ZJAA 1WJGA 4HH0A 2L82A 3MS6A 3W79A 3L06A 3U26A 2Z9CA 3FGZA 3UUFA 1TS6A 3EZ6A 4H0FA 3VR4H 5U4QA 4TV9A 4FFRA 4WK6A 4RTOA 3HLYA 1U3GA 1XXHA 1RMQA 3TZEA 1N2CE 4HQAA 2V7QD 3CXUA 5C1IA 2Q0QA 3ZHRA 3I2HA 4BOYA 1ZR4A 1FR6A 3RDPA 2G4CA 4HXEB 4WESA 2B20A 3K0EA 3EVTA 4IIDA 2QL5A 4A82A 4GDBA 3LC1O 4HLUA 4B85A 4AZ3A 4CF3A 3QU9A 1PR9A 2G0TA 4DPKA 2W2NA 2Q0SA 3DPIA 2WABA 1BH6A 1Z6GA 1W5EA 1KJIA 2F6RA 4QOSA 1W25A 2Q21A 3ABIA 5EQJB 1G41A 5BSRA 1OC4A 4QUGA 4B0PA 4WYYA 4AMBA 2BIFA 1GA0A 4HRYA 4G4SO 1L3LA 4GE0A 4BV3A 3WFZA 1FSGA 2QLMA 4PO3X 1NI4A 4HN2A 1HOTA 3C8ZA 2VZ9A 4ICIA 2V7VA 2GCPA 2DM6A 4ZOLB 3VH3A 4HGYA 4RPJA 2JGAA 1QIJA 1E6WA 1U2RA 3EVDA 5CNIA 3P8ZA 2W2OA 1ZESA 4HHDA 4A15A 1CEXA 4MEZA 3LT4A 3EQ7A 5EMKA 2G83A 2Y27A 1B23P 4D92A 3TG9A 1UBLS 2DPYA 2H59A 1XJQA 1GCIA 3PHLA 4AY6A 1Z12A 5FWYA 1LRJA 3V5MA 1OI4A 2FSVC 4CUKA 3EIEA 3QWAA 5KKCA 5CXUA 3QF4B 3SYMA 2DQKA 4Z9FA 1HBJA 4BB0A 3NNSA 3PJDA 2EG9A 1CWUA 1IWOA 1HSZA 1E4DA 3U62A 3B6KA 3H2IA 5F7ZA 2P6UA 3HFJA 4KRGA 3DT6A 2RHMA 2ATVA 3E2PA 4OD0A 3BRQA 4B82A 2QMUA 4MW0A 1C7RA 3VKVA 4DRYA 4G81A 2BEVA 1W88A 1X9IA 1CZRA 5C8YA 1ES2A 1KI1A 1DX4A 3CE6A 4EJSA 1KI3A 2KB0A 1VIAA 1XJ5A 1Z2DA 1EK5A 4M8IA 1XKZA 1EM6A 3VJLA 2WSLA 4C0KA 1E2BA 4QOJA 1JU9A 1Q1QA 3SZ3A 1EFDN 4ID3A 1IDN1 4NSNA 1RFGE 4G5SA 5AVEA 2BMWA 3QA9A 2ZJ6A 4L7VA 2QVYX 2H54A 1ST2A 3MINB 4HP4A 4HG2A 3RLIA 3PD1A 3HK2A 3JZMA 3VE3A 3DBLB 1C2TA 2H1OA 3B60A 3ZI7A 1NVKA 3DOOA 1K1EA 4X92A 1V71A 1GEGA 1LJ8A 4YRNA 3ABRB 3I0MA 3X1MA 3HM9A 1O3YA 4JMLA 1ODCA 1ZD5A 3EN0A 4DQVA 2ASEA 5TPZD 4O33A 4CRWB 3S55A 2ROQA 2AFHE 1X8KA 4TOIA 2OLUA 3LT1A 1ISJA 1NVBA 1UJCA 4MVCA 3L7YA 1N9GA 2D1YA 2RBGA 1EFKA 1QX3A 2D1SA 3UH1A 3OCWA 2HH9A 3NGLA 1NJ1A 3PBKA 4PNPA 4E94A 2P5YA 1A88A 5CT6A 3VU9B 3B9QA 2Q3EA 2HCBA 1GQ2A 2ZANA 2V7EA 4LDQA 2HZ7A 1RRFA 3OCCA 4H7KA 3GLIE 3COYA 3ZCZA 3KT6A 2J9ZB 2C31A 1W85A 4KZ4A 5ED0A 2V5VA 1RHUA 2QMQA 2O1SA 2HHAA 3EF1A 1CJFA 4J7AA 3STHA 3ELUA 1SKAA 4WXPA 5DF8A 1ISRA 2JEYA 5HWSA 4KAJA 4L15A 1PLJA 2AZMA 3V7UA 1GG2A 3RSCA 3NIBA 2PYIA 3BLMA 1N0WA 4OJTA 5ERYA 2J46A 3HQ4O 2QTLA 5IZCA 4HDKB 3OC0A 2AT1A 2GPBA 4RETA 3E3AA 1MOQA 2P1DA 2BTOA 2XA2A 2JHAA 4BWVA 3C0KA 3QBEA 1GNVA 4KQJA 2A9RA 4DIMA 4OG2A 1G98A 3IA7A 2CXRA 2CDCA 2CZGA 3UAWA 3FV7A 3Q12A 3F4KA 4EVQA 1TADA 3E3MA 4G84A 1DEOA 1O95D 1O2DA 1KIAA 3EGDB 1FFHA 3CVYA 2Z6AA 2I6TA 1US8B 1Y1RA 2GNPA 4JX8A 5ITWA 3GJTA 1POWA 1TIKA 1JFTA 3CEAA 4IEIA 1XU4A 3OOYA 4KO3S 3CBQA 4L5BA 2DFNA 2VCYA 1VETB 2Q3FA 4CLEA 5ARBA 2PANA 1Q1BA 1U3DA 1PG0A 3K6RA 2H4XA 4M1SA 2IWRA 4OBEA 3QOWA 3MW8A 3KT0A 1X1EA 1BU5A 1MAUA 1VE9A 5KWVA 1OMEA 4GYYA 1I7LA 3R5JA 3JQGB 3PXXA 1USIA 4RGVA 4EY5A 3OJFA 2RK6A 1PLKA 1DRWA 1USWA 3CLOA 2X9NA 2O7NA 1L5OA 4Y3UA 1A7JA 1O03A 1CQJB 4PQRA 4YAWA 1BE1A 1ZJ5A 1CEFA 2Q29A 1N7HA 4K3VA 2F1HA 2QYOA 2NUPC 3U5TA 2Q5EA 3T4SA 2UWXA 4KO1S 2RI1A 1J8VA 1E2EA 1GZ6A 5JUWA 4B40A 2DUWA 1UQRA 4BV9A 4EG6A 3KHSA 3SSAA 3PRKE 1GLVA 5T67A 2GO7A 4Q9NA 4N5HX 4R7GA 2K7SA 1FUYB 1PUXA 3ZWMA 3JATA 2ZR8A 3K0FA 5KEIA 5ALOA 2OCAA 4EUHA 3AY3A 4FMCB 5AKXA 2OZEA 5FQMA 1E3TA 4I55B 3OPYA 3NEYA 4D0SA 2PS3A 2XQGA 4TUYF 5CEFA 4P93A 3U80A 4PCVA 1HDZA 2FPUA 2KJQA 1S4QA 4KAFA 4I99A 1HWYA 2XNDD 1S1YA 3L07A 4XX0A 3HDGA 5BN5B 3GQZA 5HSQA 4N4AA 4IJKA 4WBSA 4BS9A 3VE4A 3CPTA 4TYQA 4YDRA 3OEYA 1YZKA 4LI0A 1H2HA 2C5WB 1EFVB 3FNIA 5E6RA 1Z36A 2EIHA 1VRCA 4F4HA 3WIVA 4HKTA 1U8XX 3CT4A 2I65A 1D2GA 8ADHA 2J5RA 1E0KA 2I71A 4QNNA 3EXAA 1A04A 2HU5A 1J9EA 1PD0A 4X6YA 4QTXA 2WIKA 4R1GA 3PXCX 1H2FA 3H4VA 4XZ3A 3QMWA 5C5CA 5FNVF 4Q9LA 3U7JA 3MJDA 4LMBA 1IHYA 4JVOA 3FJOA 1SUCA 3D9YA 5KTSA 1C0EA 2M6KA 4XM2A 2XCUA 2BSXA 4MLDA 4DUPA 1KPGA 3ZGXA 4TXHA 1V4NA 3OE5A 1RCJA 2H4FA 1TMYA 3K8YA 4RIEA 2XSZD 1YVPA 1ZSNA 3K2NA 2XVXA 3ADDA 3DSRA 2OG2A 3A4IA 4RKRA 3HZOA 4M0EA 4KQHA 2H51A 3ZHVA 2R7NA 3QE2A 1XIVA 1YI1A 1QGOA 2ZQ9A 1OE0A 3PXEA 2DVMA 5T4FA 3ESQA 1QP7A 3ZNOA 4BQNA 3T5DA 3BTVA 3ZIAD 3EWNA 5DXFA 4JI8B 3DTEA 4MUXA 1Z4IA 1R5BA 1RWXA 3IUEA 3BG5A 1Y3AA 3L8MA 4NLLA 4KUEA 5HF8A 1J22A 4CM8A 3OZGA 2JFFA 3N74A 2UU9B 3O8QB 1FC0A 3H42B 3F5DA 3O2SB 3SE7A 4HQNA 2HHJA 1R9MA 3E1GA 2FY8A 2P9HA 3GPCA 3N9IA 2R25B 5DWQA 5IMSA 3UT5A 5I8ZA 5IKEA 3NWPA 2RGCA 2E4ZA 3C15C 2QUHA 1GGEA 1S67L 5FBKA 4CIYA 4WD3A 3DBOB 3LYXA 2ANBA 1PQUA 2ETXA 3GX1A 4ZVLA 4X84A 3REQA 4L4SA 1P33A 2JVKA 2DYKA 1HE3A 4RQUA 1G19A 4KPYA 3URKA 1NN3A 4AB1A 1NVWQ 2UV0E 3PWTA 3DNMA 1JFLA 3IUBA 4DQUA 1HV8A 4BNYA 4WOKA 3BVPA 1CUDA 4LE1A 1QYWA 1ZUHA 2QR2A 3Q9NA 1KZ6A 5FBWB 3I12A 5TGDA 3IBYA 1ZCJA 4DJEC 2WWRA 2ZRIA 3H2SA 3KZNA 3I28A 4IV5A 2BUCA 1XZKA 5LUBA 3O1HB 3RSFA 3NYWA 4MS3A 4NL4H 1O9HA 4MTCA 3PDIB 2H4WA 3MXOA 1ES3A 3NV9A 4OFBA 3AESA 5IASA 1U8AA 1WUJS 1CETA 1JQEA 1T1EA 1ADYA 5EPEA 3N39C 3OF5A 1KMHB 3S99A 4E5VA 4LV2A 1WMSA 4M0PA 1Z68A 1X1DA 4HI4A 2C2ZA 5EG5A 2IODA 4HADA 2ZAYA 2FZGA 1H1TA 1XZNA 1M72A 3TBFA 4PM4A 5K9ZA 3SM9A 5F5LA 4RQBA 5EJEA 2BFCA 2ZYUX 4O29A 1V5FA 3HCAA 2P9QA 5C51B 3KUUA 1NJGA 4Y15A 2JDIA 4Q0MA 4W7HA 2BFOA 3WDLA 4Q9JA 3FPHA 1E3QA 4BB6A 4RKFA 4A7PA 5HMLA 3GEDA 1XEXA 1FPMA 1YCDA 1TD5A 4UCFA 4ZVVA 1J7JA 4JR0A 2EKZA 3IJEB 4UQIS 4R01A 4TWAA 1HK7A 4GKBA 2Q5FA 5KREA 1OX4A 4LOLA 1EWYA 2I4RA 1R5JA 4MUIA 1A98A 2XH9A 4F71A 1Z74A 5FHRA 4AYTA 6YASA 5FOTA 5FH9A 1MGOA 3Q3CA 4IMIB 1M0WA 1SCWA 1T3TA 2X8BA 4GS9A 3DUWA 5EKUA 3KKKA 1XLUA 1P6XA 3D6AA 7ABPA 2FN3A 3FM9A 4B87A 1WSAA 4B0OA 4BLSA 1KHTA 1V9SA 1ZZGA 4FHGA 1QF7A 4OFZA 1F8YA 2F4VB 4AJ1A 2RKWA 4JA2A 3M33A 3V2UA 5KBYA 3HMQA 4DANA 4AF7A 4DAEA 2BBOA 3Q2KA 3KX0X 2R6CA 5L10A 4EA7A 2WB4A 1N2BA 3NGXA 4YRIA 2PL9A 4FR2A 3ZDEA 2AOWA 5JI2E 4BVKA 5GQSA 3BN3A 2FSUA 2BVNA 4N6GA 4EY7A 4CQNA 2QN8A 1WCIB 1CY4A 4QXMA 1D9XA 4WERA 3TGPA 3EE6A 3PU6A 2XPCA 2ONKA 3T95A 1RBMA 3CSUA 3C5EA 1ESIA 2YZ7A 3UPTA 2COKA 1PR4A 3LK7A 1NNEA 2YWFA 1GUAA 3G0IA 4MQEB 4XIYA 3KOYA 3Q88A 3KS9A 2LE0A 4HVLA 5DNDA 2QW0X 2ZYHA 4JLUA 5K4GA 3GCWA 2PDAA 5IDWA 1GFIA 2ABWA 2GHRA 1D04A 2IKQA 1JG2A 3TQHA 5CFQA 1N7IA 2BHTA 3HN2A 1E7MA 1Z6ZA 5C3UA 1QYCA 3CMMA 1XD2B 3GV9A 1QG0A 1YR2A 2Z98A 3AIMA 5HD3A 3LLSA 2JKFA 2BM8A 1GTJ1 4KDEA 2ZMAA 1OFGA 3HVJA 2NO4A 4CPDA 4J76A 5CD1A 2C0CA 4PC3A 3NEAA 5H82A 3IEPA 1V1RA 3O4VA 4ZQIA 5HM6A 2XT0A 2G76A 1XMOB 2I66A 2VHJA 3R3ZA 2B30A 2FWIA 4PFQA 4F4CA 2YTZA 2RJOA 5KTTA 2VC2B 1U3WA 4QDUA 4CTNA 2UXBB 4KG6A 4J3JA 5G4YA 3UT6A 5HKKD 2J3TD 3EEOA 1PR6A 3C24A 5B6JA 5IC4A 3FJYA 4FFOA 4WKCA 5F9MA 4V0MA 1L5WA 3M4ZA 1MEEA 1P8JA 4CDNA 1CR1A 5EVIA 1OR8A 5AW7A 4TL9A 1HMPA 3UAXA 5K3SA 4R3NA 1K57A 2BCGY 5JE8A 1XPJA 4RZSA 4Z54A 3A2MA 3IDZA 2RH5A 3PXPA 1KU6A 1JP7A 5FUBA 1RYNA 5FBHA 4F7DA 3M6WA 2DU8A 2ZI9A 4AM8A 4RGYA 1XHLA 3N2EA 3BMCB 3TNJA 1R6UA 4A6DA 1G64A 3QITA 1DJBA 3LVQE 1XNRB 3QPCA 2HJEA 2G3YA 1XZAA 4JI0B 3AY6A 1I3OA 3NAQA 4RZXA 1ZFNA 3LKVA 4Z51A 1UFQA 3KQLA 1SXJA 2RGRA 2V1BA 2NSLA 1ZYUA 5JXHA 4PINA 4F5WA 4JF4A 1ZK2A 4Q4HA 2OYSA 2M7VA 1CNFA 2ATEA 4DMLA 4JP1A 2ZJ4A 4RPLA 1AQNA 2XNHA 4P35A 3EPKA 2GPTA 5JSQA 3LIAA 5BW5A 3BWXA 5NLLA 5EFWA 4R2JA 3ER9A 1X1CA 3L1UA 3LQFA 1TEXA 4H1UA 1PYGA 2ZCUA 1P4SA 3ONWA 1EK6A 3MZEA 3U4MA 5A0VA 5JNUA 4RVUA 2W6IA 5JR3A 2BH9A 2BF7A 3HU1A 4JYMA 1SUWA 3CEPB 2G6TA 3LZDA 1QB8A 1MQSA 2XCSB 4PCLA 1Q84A 1EUDA 5EWJB 3WWYA 3BEDA 3AHIA 3B8EA 1YA6A 4F3RA 3GNTA 4Q1CA 2RL3A 4DBLC 4I4NA 4DLKA 1PBTA 4NZOA 1IJKA 4E31A 3PJEA 4EL5A 4URYR 4HWOA 1F6BA 5L7WA 1K6IA 5LQCA 4P4GA 3FMFA 5A4JA 3DCYA 2VSYA 2WNSA 4P36A 2BEJA 5I9MA 4OI0A 3DWGA 4XWWA 3B8HA 3D8UA 2HCJB 1GDHA 1JSRA 1RLJA 3BXZA 1KOLA 4HJ6A 5FTNA 1E1CB 4MJXA 4BKQA 4LRWA 2A24B 3K5IA 4WLAA 2DPGA 1ZGCA 2XA7M 2EAUA 4PGAA 4AVYA 4KTVE 2GJ3A 3UWOA 3ERCA 1RZUA 2MJ6A 1CZNA 1C81A 3G2NA 4ARVA 3SHOA 1FYEA 3VX3A 2J30A 2IIVA 2YY6A 2ZM6B 3BIOA 3NHPA 1IXRC 1NQOA 3E4OA 3FRJA 4AN4A 4DE5A 2J80A 1AOXA 1ISSA 2GCGA 5JV5A 3QYJA 2FMUA 1KERA 4H7PA 1PCXA 4PPNA 1N0UA 4BU1A 1Z37A 1SVOA 4LOHA 5B58C 1ZEJA 4FQ8A 4UNPA 1B0ZA 4TMWA 2XDQA 1E59A 3HBLA 1VE6A 2GUGA 5FQIA 1WU7A 3MOIA 4X7MA 5FWDA 1CHNA 3UBTA 1YU6A 2PKCA 5FQOA 3RT1A 5AVUA 4GDMA 4P5EA 4BZXA 1A96A 1DRKA 2XGGA 4PSCA 1FIKA 3VMMA 2O3TA 3PXGA 1GCAA 4ZD6A 4I1UA 4L0LA 1JBQA 3VU1A 1DELA 1DQZA 5IULC 1GITA 3JWPA 5ENZA 4RTMA 2ZB4A 2EERA 2NXCA 4ND2A 1E32A 3QEKA 4RZUA 3RS0A 2YW9A 4FFLA 2C9ZA 2Z08A 2Q62A 3GFRA 4CFYA 4DZZA 2BTEA 3HEMA 3NO4A 2GD2A 2OESA 3FPFA 3WLKX 4NVRA 1ZVMA 3NTUA 1IU9A 1H1LA 1SXIA 3EVAA 5AKIA 1P4JA 1KIFA 2ZI3A 2I99A 3UJAA 4K2AA 2EKBA 1NP7A 1MV5A 4BFTA 2YV5A 5E8RA 3HI4A 2R44A 1NFFA 4JLNA 3LO7A 3GT0A 3FR7A 5I7EA 3OJOA 3T3DA 4MQ5A 1AS2A 1PQYA 2VJAA 3U39A 3AGFA 2ZZNA 5AJHA 1TQ4A 1CY8A 4QUKA 2RHHA 1ENOA 2FGKA 4S3MA 1JHUA 4KKVA 4AJNA 3T9FA 1L5HB 4A8JC 2Y9PB 4EYEA 1A2KC 3LY5A 5KWEA 5DH9A 4GRIA 3TLEA 2YKHA 3AM5A 2D59A 3HGMA 3VPCA 4Q7QA 2ZSFA 3PTZA 2XMCA 4U7FA 5EJMA 4UFPA 2DC1A 3O92A 2VSNA 3D2LA 1VE5A 1KAMA 3BSYA 3M4NA 4WACA 3NT4A 2ZQYA 4J4TA 4UOZA 3PXUA 1OLUA 3N2GB 1UDCA 5H4GA 1GTG1 1GNQA 4U9HS 3ELWA 4G3VA 4H1WA 4B3SB 1PTJA 3EFOA 5DJUA 5DJ5A 3G0HA 2LTAA 1NLYA 1Z2EA 1M2KA 4LS3A 3GI1A 3D1JA 4LVCA 3EH2A 4EETB 5KU7A 4S04A 1VYVA 1NPDA 1JDBB 5FXMA 2IHJA 4B3BA 3MCAA 5B1HA 3IQXA 1WZ2A 1TMGE 1YDMA 4WK2B 1G8KA 2VPWA 4H4EA 2WRZA 5JROA 1IYSA 3PGLA 4JK3A 2Z2KA 1F06A 2BSAA 1U60A 2IGTA 1ZG6A 2F8TA 3GHYA 5KNCA 5KYYB 1DIRA 3D3OA 1RRMA 1K27A 5ABPA 1LT0A 3DO5A 4TM8A 1F9IA 3D0OA 3FUXA 2I4OA 3GK3A 3L04A 4C05A 4Z4QA 4JNCA 4E5KA 4UQOA 1QHSA 1QJ4A 2ILTA 1NE2A 2IYFA 3VR2D 3CVWA 4K0WA 2F3UA 5IFKA 4OHFA 1Q14A 4Q9KA 2W8BB 1QORA 1UM8A 3A2LA 3IWQA 3N1UA 2R9WA 2UVPA 4F11A 5AVOA 1N4OA 1E9DA 2VQEB 1G5RA 1N3LA 4B8ZA 2A9KA 2DFLA 3DT8A 5G4KB 3W1EA 3ESAA 3CUSA 4FILA 4I1VA 1B3RA 1PJLA 2HJWA 3T7JA 2W6CX 4ES6A 4MUKA 1U8ZA 4A16A 2HMUA 1GPYA 2WIJA 3CLVA 4UU7A 2H28A 5AQ7A 2HIMA 4HSEA 2W5UA 4Y9TA 3WGOA 1YLTA 2QN9A 2Q8PA 3JRXA 5IAJA 2G7ZA 3HJUA 5U4XA 1GPMA 2VHXA 1CLEA 5ALMA 5JH7B 2C2WA 4OQEA 5HJ7A 5BRJA 1F2KA 2J09A 1NUHA 1QHNA 3ZZNA 1COWA 3CG0A 4L8LA 1S5PA 2I6QA 3BXHA 4D2OA 4X44A 3HCBA 5IKXA 5DLPA 3C1UA 4FLEA 4MKGA 3PDJA 1MO6A 3VNAA 2Y1EA 2G80A 4WXRA 1ODVA 2YIMA 1M6YA 3FUVA 1JQKA 4ZT2A 3T9BA 4CG2A 2ORIA 3HLWA 1PO7A 4LOKA 3AVQA 4NJEA 4K8OA 4D97A 2DUMA 5KNDH 1ZJ6A 4N40A 1F2TA 2IZ5A 3TSZA 5FR1A 3NWEA 4JVSB 5JJCA 2O7QA 3HZZA 2EBHX 4JJKA 5A5GA 4K9OA 3OIGA 1PGOA 4PXYA 1BXRB 1N6HA 5FEGA 2QSUA 3ND7A 1EI5A 3WLIA 2IYXA 2A35A 3GGGA 5D01A 4RF3A 4HI0E 3ZUGA 4REMA 3V8BA 1KKMA 2J5QA 1F38A 1GDDA 1XAHA 1A7KA 1E1LA 3MCUA 1IJBA 5E9QA 1L4BA 4CIDA 3RBAA 3F3MA 4UZSA 5DGDA 1V7PC 4WINA 3Q7RA 1STOA 3QU2A 1NW6A 5AQAA 3UXHA 3QELB 5EE3A 3NOXA 5IC5A 4G5GA 4BY9E 4H7DA 2YFQA 1ADCA 3JQEA 3ZVRA 3SF8A 5DP1A 3TO5A 4P4NA 1AQIA 1PWCA 4EHJA 3FC7A 4CFZA 5M5BA 3A28A 1SUEA 3FNRA 4J0JA 1XVLA 1Q2PA 3PAGA 4GCZA 3T9EA 2VAPA 4KNWA 4IWYA 2Y71A 4MA5A 4Y6OA 2FFBA 2QP3A 1QV9A 1PL6A 2MTBA 4QUJA 1R15A 3DW3X 3JASB 4DR6B 4XWKA 3RC9A 2V0CA 1GQRA 1IOZA 2VJLA 1M7GA 5BN4A 3F96A 1XI2A 4C7MA 4OP3A 1OYVA 3IX7A 1IAVA 1ZIDA 2N0SA 4H4DA 4TUYA 2OOLA 3PXDA 5LM3A 4HDSB 4UDYX 5EE5B 1XGJA 2NADA 4RCZA 2A4KA 5CVUA 5F64A 1XJWA 1OMOA 4BE9A 1SVUA 4MQBA 3IPAA 3QLJA 4KQKA 2WYUA 1GO2A 1L7QA 1VOTA 1OQAA 3KBOA 1YBAA 3GLFB 1MGPA 1QHHA 1S02A 2A9OA 1RQRA 2PEYA 3VR3D 1XTKA 2REOA 3FNFA 3E7XA 4K8RB 1YDHA 1I0IA 5GMOA 3ZOKA 1J06A 3VPFA 3WO0A 4KRFA 6GPBA 5AW6A 3C6BA 3ESYA 1T10A 3KAPA 4NBLA 1YDFA 5JRDS 3UH0A 5LBIA 1CEGA 5AUNB 2VVTA 3CF4A 4MVJD 1GQQA 3QNWA 4UFOA 1G20B 3PNYA 3RXXA 2P4SA 4JEHA 1FCMA 4K5QA 1SQ6A 1HF3A 3A3NA 1M2WA 5E7JA 5GL9A 3DULA 1G291 3M70A 3STTA 1D2HA 2UDPA 3U0BA 4I38A 1YXMA 3L6EA 2M32A 4RORA 2I2WA 1I7DA 2ZI6A 1WHSB 1FFCA 1NIJA 4TWRA 5FNVA 1Z63A 5CTJA 4ZTZB 5SYNA 3JQ9A 1Y7LA 2ZRNA 1ZJWA 4BCCA 5JYDA 2ZS8A 1K97A 5T8KA 1P2GA 2V5AA 3C7KA 4F8YA 3NYIA 5GZ3A 3ICEA 4QAJA 5ESWA 2X1HA 2GSWA 1E3MA 5IJZA 4OU4A 2JLSA 5CB4F 3EASA 1RXVA 5H16A 3DLHA 1CSEE 4ZT6A 3C5VA 1K6JA 2XRMA 1RWNA 4EO7A 5KKAA 4TT3A 5EWLB 1LBTA 2PL3A 5DV9A 1KE2A 2HBQA 1TLFA 4XR9A 5IVKA 5BN3B 1E6CA 3QY9A 5BQPA 4QGSA 2QPNA 5FI3A 2RGYA 2BL4A 1I5EA 1TE2A 3P2JA 4ZCIA 3NBQA 3M4YA 1MRNA 3C3KA 1U8EA 3D3QA 3TLGB 3P2EA 1IL0A 3AR5A 4PXSA 2FZCA 4NWIA 3A11A 3MLEA 2GSDA 1V3UA 1CR6A 5F1KA 3W9YA 1AA9A 1AZWA 3KSZO 4ZVQA 1SOAA 2CNDA 2XUDA 1L3BA 2FPGA 2F4NA 2FRXA 1RW4A 2ZJZA 1ZVKA 3P5SA 5FOWA 3HLDA 1FP2A 4JC8A 1QONA 4CHTA 3S7ZA 3SC4A 5TRTA 3MWEA 5DM60 1P44A 3KJFA 4DWWA 2I0FA 1KO8A 5EE9A 1L3CA 4MYSA 4JC5A 1U0OC 2QYTA 1E92A 1NBME 5K8VA 2IJGX 4AWXA 1T6NA 2FG7C 1LDEA 4PX9A 1USUA 3NRBA 5FI1B 2D1FA 2XCQA 2OEPA 3QFHA 2CHEA 2HI0A 4V0SA 2J9GA 3P45A 1U2GA 1LWNA 2VJOA 3CJMA 2WF9A 2B0CA 2WTXA 1E3JA 1U8UA 3CFYA 2H8KA 3W3AD 3N3AC 2OCLA 2WFLB 1F8GA 4Y7CA 3P0JA 3L82B 4DA9A 5EVCA 3QLTA 3ZQJA 1FR1A 1ZM2A 5AKJA 3TCKA 3RYFB 4PZ9A 1TYZA 5B1YA 4E03A 1DBVO 3U6KA 4CLRB 4ZHSA 2I9PA 5JISA 2OD9A 5INTA 4M46A 4O0LA 1Q6ZA 1O4WA 4MOWA 3KWFA 1Q7CA 1QQ6A 3KLPX 1KK0A 2B82A 4PFKA 2J9YB 4JGIA 4U2BA 3GCZA 4XX1A 2NSHA 5EJ7A 5C7YA 1XRRA 2QL9A 1PGJA 3BJRA 2X01A 2NVBA 4OHRA 2PWYA 3KV1A 1GZHB 1OX5A 3EIWA 3FZNA 1NVGA 1L5NA 3RC1A 1HOXA 4B3DA 1V25A 1IZ9A 3NTVA 5EIAA 3ZTWA 5K6RA 2P3SA 5ARDA 4GR9A 1FS4A 2VDRB 1T8UA 1IY0A 3OOJA 2XHEA 2FSHA 1WDTA 5D5HA 3LP8A 3ZV5A 2CFTA 1GLGA 2NT3A 4B44A 4BVAA 4UHBA 3ER8A 1DARA 2ZLYA 5BXYA 2WU0A 4C4ZA 5AI9A 3KR0A 3DDOA 1LSSA 1CZKA 4EUVA 3KVRA 2JFOA 4ZO6A 4F2GA 4TN5A 1G3IA 1AU9A 1RC0A 2ZWOA 1L8QA 4EB6A 3CHYA 4FP9A 5HHTA 3F5SA 3LU1A 4IGKA 3WYNA 3DOFA 4V39A 1YC2A 2VDQB 1CQAA 2OMEA 3GJQA 2EFGA 1MZVA 2RGUA 4ZAZA 1V5IA 4P7BA 1CNEA 1X6VA 2JANA 5B30A 3MYRA 1QG4A 3IPXA 2R6HA 3I6YA 1WY7A 3L84A 1UAAA 1FF9A 2VDPB 4KWHA 2VP6A 3L0BA 2IIPA 1M66A 1PV1A 4NYMR 4KP7A 4J07A 4H7HA 5JXGA 5BO5A 5J8XA 4ZAXA 2FPKA 3SS4A 1XTRA 1JL3A 2OY0A 2LP4Y 5JXIA 4ESPA 1FUKA 1U2DA 3UWSA 1ZIPA 1H2YA 1UBFA 2FSGA 3M5DA 2YRFA 1T0JB 2FZEA 4F56A 1T8PA 3G89A 2GLXA 5GOZA 5EJIA 2MINA 2J7PA 4RWEA 5GLCA 4LXHA 4GOGA 3PFFA 4UM7A 3ADKA 1A4UA 5A6SA 4TKMA 4EBNA 2XMGA 1MA3A 1PD1A 2SKEA 1LH0A 1QIGA 2NOAA 3ZNTA 4ZOBA 1L4EA 3KM0A 1QMPA 1HQDA 5F69A 1G21E 4QJ3A 1TVCA 2M6LA 1J20A 5C9ZA 1YR8A 3N8GA 2RI6A 1EWKA 1KY3A 2MSKA 4WE3A 4LCMA 4N5DA 3IP1A 4J91A 1YONA 1DRUA 1ZNZA 4P6ZM 3TECE 1PX2A 2IYPA 1X7WB 3N3BC 1G4AE 1AN0A 3EEHA 5B37A 1KYYA 5KYTA 3L0ZA 1JN0A 1RSZA 2IBTA 5AM0A 3N2KA 3LIPA 4JGPA 4B4KA 4XWAA 2PSJA 2IYUA 3QHYA 5CP8A 3I62A 1DEKA 2AZXA 2IOQA 4JBWA 5G0VA 3U44B 3MCZA 3LO8A 3QYAA 2R5WA 4FZVA 2OO3A 2UUCB 1X7XB 3SC2B 4UUQA 3QA3E 1P2DA 4YXWD 2VWQA 5T6BA 4RWZA 4G1FA 4R38A 2XBLA 4Z0HO 1L1QA 1MFPA 1RHRA 4AJ4A 2G8NA 1KJ9A 3MM4A 1FTYA 3A3YA 4IOJA 4BYGA 3V00A 4S1OA 1X70A 4RTKA 5KYNA 3DD1A 2H2FA 4JR2A 1TQ2A 3SZLA 4AP6A 1AKUA 4C75A 3O94A 5LYJB 5KSCA 1XVAA 1QYIA 1T0BA 3R9KA 4YUWA 2ZUBA 3D8SA 2QD1A 2ACEA 4F46A 1E5QA 5M19A 1YKGA 3KUKA 4J49A 1F6WA 3A3FA 2WU3A 4LOJA 1JLMA 1G5PA 3DTNA 4OJNA 4G0XA 5THQA 3D0QA 4II7A 4IXWA 4IIJF 2JLWA 4LRZE 2YHSA 5D85A 3RS8A 4BJ6A 5JJ5A 2FWAA 5KTNA 1Z4NA 4WGFA 2WT9A 4JL6A 3MF4A 3JR7A 4YDQA 3UDIA 2YX1A 3DEJA 4NU0A 3C30A 2OHFA 2OAP1 3DLTA 3O8OA 2OLKA 2P3LA 4LNAA 2GTHA 2XADA 4DVGA