3R7WB

Crystal structure of gtr1p-gtr2p complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
314
structure length
294
Chain Sequence
b'MVLLMGVRRCGKSSICKVVFHNMQPLDTLYLESTSNPSLEHFSTLIDLAVMELPGQLNYFEPSYDSERLFKSVGALVYVIDSQDEYINAITNLAMIIEYAYKVNPSINIEVLIHKVDGLSEDFKVDAQRDIMQRTGEELLELGLDGVQVSFYLTSIFDHSIYEAFSRIVQKLIPELSFLENMLDNLIQHSKIEKAFLFDVNSKIYVSTDSNPVDIQMYEVCSEFIDVTIDLFDLYKAELQNVSQLANGVIIYLRQMIRGLALVAIIRPNGTDMESCLTVADYNIDIFKKGLEDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein GTR1
molecule tags Protein transport
source organism Saccharomyces cerevisiae
publication title Crystal structure of the Gtr1p-Gtr2p complex reveals new insights into the amino acid-induced TORC1 activation
pubmed doi rcsb
total genus 57
structure length 294
sequence length 314
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04670 Gtr1_RagA Gtr1/RagA G protein conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.190 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3r7wB02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r7wB01
5LPNA 2XNSA 2W0SA 1TQ4A 3GJ3A 4HAYA 4I1UA 3TQFA 2IYWA 1CRQA 5CIWA 5KTYA 4OQMA 1LF5A 3L2OB 4JLJA 3BK7A 821PA 4KLNA 2W6JD 1Z0DA 1E2FA 4ZV4A 2JLUA 2LKDA 5BQ5A 4KFUA 5BN4A 1S1MA 1N2CE 1C4OA 4B3FX 2G1KA 2RHMA 3RRZA 3PEYA 1BH2A 3LVQE 1YQTA 3ONWA 2HJVA 1K5GA 2GNOA 4QHTA 1ZRHA 2B7BA 2GVDC 4F7WA 4AIIA 1T6NA 2P65A 3F8TA 4UNQA 5GJWC 4BEBA 3AGPA 3OAAA 2X2EA 2B6HA 2VHCA 4M1TA 4XWOA 1FOEB 4NH0A 3EC1A 4V0OA 1KI2A 2G0TA 4Q21A 3WP1B 3THXA 3TSZA 2ZVQX 4PANA 1AK2A 5FL7D 3TMKA 2EWWA 3WMFA 5L3QB 1G7TA 4LUCA 3W9YA 1OV4A 1G8PA 3C5HA 4HUQB 2WIAA 3AVPA 4NU0A 2QM7A 4BFYA 1WCV1 3LRPA 3QKSA 2LKCA 4GOXA 4JS0A 3E1SA 3K1JA 2QI9C 2ATVA 3RC3A 1XB2A 1R2QA 4GZLA 3U4QB 1YZGA 4DT1B 4MH0R 4L9WA 3DPUA 4TT3D 2E1RA 4LPKA 5EXSA 1YZUA 2VYFA 1OXUA 1W7AA 2QGNA 4LYJA 1G5RA 3TLXA 3GD7A 2G83A 4TZ6A 3QNUA 4QOSA 4C2UA 2KWIA 4BECA 2EFGA 2G1JA 3UANA 5FBVB 4NZYA 2QRNA 2IHYA 2GXQA 2Q3HA 1AJEA 1ESMA 5EP3A 3OEEA 1W36C 1P2VA 3DZ8A 1KJYA 2DB3A 4Q01A 4C0BA 4B3GA 4L4UA 1NIPA 3V9PA 3EXAA 2BBWA 2QAJA 4C0AC 3NBZC 3VKHA 4KVAA 2RGAA 4DDUA 5EE1A 2RGDA 2A5FA 2XTZA 4QXAA 4C7OA 5AUNB 2BMJA 2WKPA 3HDTA 2WJYA 1SXJC 3QOFA 2VRWA 1KYIA 3I1FA 5DNYB 1OHHD 1X3SA 1P4SA 2NGRA 1E1QA 1SVSA 4URUR 2DY1A 2QPTA 4DT1A 1UKZA 5JEEA 4IVPA 4AY2A 1H65A 4BWYA 5H68A 3R9IA 4D4LA 5BN5A 3GJXC 2GRJA 1R0WA 1HE8B 4QL3A 2O8CA 1DARA 3GEHA 3QXSA 4IFEA 4MYTA 3F0TA 4XJXA 2P5SA 3TNFA 3FDIA 3CRMA 4LWZA 2R9VA 2W2TA 3ADCA 1XXHA 3W6PA 1ZU4A 5KHOC 1NSTA 3PUYA 2VLIA 4Q4HB 4A0RA 2PZEA 4RCYA 2ZI6A 3MD0A 2QENA 3QSYA 4HYYA 3TW4A 5JS8A 3F5FA 4DIDA 4HUTA 4TMTA 3I73A 4IDOA 1Z8FA 2IF2A 4FMBB 4IW3B 4ZIRA 3SJCA 3UWKA 1DAFA 1XCPA 1YHNA 4BRWA 4LJYA 4Q4HA 2SHKA 3X1YA 2H8KA 1DG3A 1N6PA 4W5WA 3C14C 2DFTA 2AWOA 4M1YA 1ZIPA 4ZO4A 1NNEA 2CNWD 4NMMA 3A37A 3KXIA 1DPFA 2C96A 3PITA 2OG2A 3IGFA 4M9XA 2LWIA 4GFDA 3I62A 3TR5A 4R71A 4QHYA 3A6PC 4PZYA 4TSFD 3P4XA 1NLYA 5GJVC 4NYIR 2IXEA 1KGDA 3AVUA 1J2JA 4D6PA 1IY1A 4Z8XA 4AG5A 3WXMA 3A4NA 3AF3A 2WPDD 1MOZA 2AL7A 5E7JA 1A5TA 3HR7A 3O8CA 2XGJA 2DCUA 2R65A 3IPYA 1GP2A 2CHQA 3VX4A 1N5KA 3VX3A 2ZRNA 4IDHA 5FUYA 2PMKA 3B82A 1EK0A 3KJGA 4G5QA 4QNRA 3VKGA 2GHIA 2QU8A 1XX6A 1KJZA 3OZXA 3BFKA 1TAGA 1E99A 2QPOA 4KBFA 4DCSA 2WVJA 5FL3A 3HJNA 2JLVA 3RDPA 1TU4A 1KHTA 1CRPA 3BB4A 3PEWA 1N0UA 1Z47A 2EFEB 2GCPA 5DH9A 2ZM5A 5D3MB 4Q4AA 4PTLA 2GEVA 1G7SA 4LBWA 2BWJA 3ECCA 3WYAA 2IEZA 2WWWA 5DIFA 3OIYA 5JI3E 2O8FA 2FOLA 1VG1A 5FH9A 1E2QA 1A2KC 1ZCAA 2UZ3A 4OHYA 3IILA 4XD7D 3QF7A 4KCGA 4HB2A 5DLQC 4EUNA 4CYMA 4PC7A 5L3SA 4TL9A 3VR3A 2ORWA 2JLQA 4BPBA 5DI9A 2O0JA 4PAOA 3BXZA 3VNVA 4U00A 3U7HB 1RRFA 3SJAA 4LJ8A 1GIAA 3FB4A 2O8FB 2PX3A 1VMAA 1TF2A 4D25A 2GEUA 4G5SA 2IT1A 4M9SA 3WRYC 4C0QC 1IONA 1EG7A 2VTKA 1UEIA 4JLOA 2AFHE 4DJTA 1RZ3A 2IX3A 1AS2A 2W00A 3QF4A 4POAA 3SYNA 4JVMA 2HXYA 4QM6A 1ZCBA 1ZM3A 1E0AA 2PCJA 1NJFA 1TQDA 3CPEA 4JSYA 3KTAA 1U0JA 2NMVA 2IF0A 4JVSB 1KK2A 3PVSA 4KV9A 3UG7A 2IUSA 2VHTA 1SVIA 1X8JA 3MJHA 4ZI3A 1P72A 1E9EA 4U5XA 3TVTA 4IDNA 1Y63A 2GJ8A 1JR6A 1M34E 1N5IA 2H57A 1P61B 1G7CA 3U7FB 2FA9A 3I32A 2A78A 2BCJQ 3D31A 1ZM9A 3CZPA 1P60A 1AKEA 3FE2A 4QHSA 5AUOB 1ODFA 1R5BA 1N6RA 3NBXX 1KOFA 3BFXA 1U2RA 1P5ZB 2DWOA 4JVLA 2JLSA 4Y0VA 1SVWA 1E79A 2WJVA 5BN3A 1MO6A 3FHTA 4RKEA 1OFIA 4Q1AA 5CDFA 2ORIA 1UAAA 1E2PA 1JXMA 1KK0A 4LX0A 1US8A 1C1YA 1IJEA 4JVNA 4Q02A 4JL8A 5AJXA 5J5CA 5C4GB 2VP6A 3SR0A 2ZU0C 1G8GA 4ZDWA 1NN1A 5AWFC 4AYXA 1E98A 2QRZA 1G4UR 4RZ3A 2JAQA 3EG5A 2ZI5A 5ANRB 2BM0A 2G77B 3OEHD 4V0KA 3GJ4A 1S9DA 1EX7A 1E2JA 1NJGA 3KUDA 1GRRA 4LHVA 3UMRA 1Q12A 1J8YF 2BVNA 5SZKB 1DOAA 1XD2B 2RGNA 4BFWA 1BMFA 2BHRA 3O47A 1SVOA 4BFVA 4D4MA 5KDOA 3NIBA 1N0VC 4Q19A 2J87A 1G3MA 1N6LA 2DFNA 3R9XA 4TL7A 2IEYA 1Q1BA 4PC6A 4BEJA 2G88A 1WQ1R 3ZZ0A 3CPHA 3O8RA 3NDBB 2AK3A 1AM4D 4GSYA 4AKGA 5FOUA 3K70D 1YE8A 4TLEA 3N5CA 4MRRA 2R62A 3U61B 2ZR0A 1TUIA 3ZYCA 3Q72A 1M2OB 3MUFA 2FFBA 2ERXA 1EFRA 3VU9A 3U44A 2ZE6A 4MDEA 1F48A 2CCKA 3GLFB 4GRAA 5SZJA 5IT5A 2V1UA 3DEFA 3AVTA 2J7KA 4KO8A 4ZDIA 3UATA 4F4IA 3QI2A 1CJKC 1HYQA 2P3SA 1K6MA 2DHRA 5KSPA 4EAQA 4B2PA 1FUKA 1YZTA 4AWXA 3RHFA 5C1BA 4HDOB 5G53C 2G6BA 2F3TA 1D9XA 2OT3B 3U5ZB 4KFRA 1TQ6A 4BZQA 2ZS8A 1Z0JA 2V54A 5FUWA 2HCBA 4PZZA 3AP2A 2PZGA 3TGPA 4HLDA 3THYA 1DAEA 1OH6A 4UQOA 3KQHA 4DVGA 4OKSA 5TVKA 1OYYA 2JEOA 3QY0A 4CIDA 4B43A 4Q47A 5F3WB 1GL9B 3B6EA 2BM1A 2RGGA 4V0ME 4ZPXA 4HDQB 3U7GA 421PA 2WWFA 5GJBA 4KYIB 4DLTA 1G64A 1OIVA 4NCNA 2ZI3A 4TYWA 3R9WA 1KI7A 3QXXA 2WIBA 5JCZA 4PSKA 1W1WA 4OQLA 2B8WA 2WPDA 4OHXA 3THXB 1HT2E 3DDCA 4L8GA 1XJCA 3JVUA 4D80A 4HAVA 3BOSA 4WXRA 1OPXA 1IM2A 5F9HA 2XJ9A 2VIIA 3DVLA 4YDSA 3MAAC 3FMFA 3B5JA 3L0SA 4P32A 2FV8A 1N0WA 1RRPA 3BE4A 2DYKA 2D4HA 2D7DA 2CNWA 2VA8A 4QC2A 3FYHA 3REGA 3RS0A 4HATA 2VQSA 1RE0A 4UXHA 3GJ0A 1TQ2A 2A2ZA 3OIWA 1IN5A 4UJ3A 4DLZA 1W46A 1D5CA 1YR8A 4ZDJA 4B2IA 4JYCA 5FL7A 5KSYA 4GZMA 4WAUA 3L8YA 3T1TA 3UPUA 4H1UA 1TADA 3GLGE 1QF9A 3FTQA 4DCNA 2CE2X 5HZHA 1XJQA 4PHGA 5DHFA 2IYZA 3ASZA 3CF0A 4QJ3A 2GCOA 1AQYA 4QGGA 5G3YA 1YR6A 3A1TA 3AP1A 2FEOA 3IEUA 4EPVA 1GG2A 4PO8A 1JECA 5JJLA 1U9IC 3JVVA 2CJWB 4DLUA 3UMSA 1GRQA 2ASEA 4RSGA 1IXZA 3FHCB 1OB2A 1Z2AA 2MMCA 4MRSA 4PO9A 4Q4LA 4IVQA 1TEXA 2QTVB 2HCJB 5JCPA 2CE7A 1H8ED 2CCJA 1Z63A 1HH4A 2XTMA 4B33A 5K8TA 4DLVA 1YZKA 2EFCB 4P31A 1GUAA 5FTJA 4DCVA 2NO7A 4RFSB 4LY6A 4Q9JA 1UEJA 1OF1A 3BB3A 2VP5A 3LWNA 2OCPA 3TVDA 1E94E 3MRSA 3MSXA 3GLIA 2FG5A 1TEVA 1K5DA 1XEFA 1C9KA 3GCGA 3LQQA 4DSNA 4R98A 2O8BB 3RANA 3NHBA 3WMGA 1VYUA 5F2EA 3TUZC 1VG0B 4A9AA 4UJ5A 2FNAA 4B47A 1LY1A 5AJYA 2P2LA 3IO5A 2YOGA 1ZUHA 1XDBA 3ZIAA 4RFVA 4PQYA 4DLRA 4D81A 2X77A 2YC2C 3BWDD 2FFAA 2WOOA 3DZDA 2ZJYA 1LF0A 3KB2A 3KL4A 4YDHB 5HZKA 1JALA 4NDZA 1COWA 3ZJYA 1MV5A 2AXNA 3FGNA 3QEOA 1VYTA 1EFCA 2FFHA 3ZZUA 1LTQA 3WNCA 4B32A 4A36A 1CJTC 1CR4A 1AIPA 3NC0C 4ZCLA 5KU1A 1QG2A 1II9A 2A7QA 2WM9B 3RWOA 3BRWD 5B2ZA 2BMFA 3W90A 1XNJA 3HPQA 3RNLA 2NTYC 4LYAA 4IOJA 3A1UA 1BO6A 1E2EA 1G5TA 2QQEA 2UVQA 3JZMA 3LQRA 4NCKA 3U3KA 1H8HA 4X8HA 1HV8A 1RW4A 3RAPR 3ZVRA 1T8UA 1WDTA 1X6VA 2X8AA 1UDXA 3AB3A 1IXSB 3KXKA 2OLKA 4C3ZA 4P4UA 4RFSA 3T12A 3V4FA 3EWAA 4A6XA 4NYMQ 1OXVA 1G19A 3TAUA 5KYKA 2V3CC 3G0HA 1PLLA 2AHOA 1E9RA 3CNOA 1IY0A 2A5GA 2FPMA 3CX7A 2IS2A 1NVUQ 1W0KA 2ZR9A 2JIZA 4WA7A 1GNRA 3GLIB 1EGAA 2XOKD 2IBMA 4LJ5A 2O8DA 1GNQA 2CJWA 3OHMA 5FOTA 2UZIR 4XTRA 1FP7A 1U8YA 2BDTA 3V00A 4C0HA 1SKQA 2R2AA 3NEYA 4BLTA 1HEIA 2FPKA 2DWQA 3A4LA 1XPOA 3WNBA 3E70C 4OK6A 4HZIA 4C30A 4B76A 4URZR 2CLCX 4GP6A 2NO1A 2AKAB 2FX3A 1S8FA 4KVGA 1WB9A 2GWHA 4CZ2A 5JECA 4CEIB 2C03A 4FN5A 5A0FA 4G5GA 4M1KA 4D0GA 1D2NA 4PSAA 3ZH9B 3CRVA 3FKSA 3ND8A 5DISB 2GJSA 1P2TA 2XZLA 1FP6A 4CEHB 3EARA 1LS1A 2QL6A 4US0R 3H4MA 3THOA 4HAXA 3RS5A 3UWOA 4TMWA 1XZQA 3X1ZA 5CDFE 2XZOA 1Z07A 1JPJA 2YC4C 5CLQA 1E0KA 1XD8A 4I1VA 5FFMA 2CL6X 1ETUA 3BH0A 1UJ2A 2DFKB 2WSSA 2R8RA 1W4CA 2R6DA 5LDDC 4RD3A 5KSOA 2HV8A 1Z0AA 2K5UA 2KJQA 3MWJA 4C0SA 4E22A 3TSOA 4DKXA 3EA0A 2RGNC 1HTWA 2NPFA 1MH1A 1ESNA 2IXGA 2ERYA 3NKVA 1XWIA 4DHEA 1MO5A 2ZRHA 3PUWA 1CJVC 4B3BA 1U94A 1KIMA 3OF5A 1XD9A 3FMOB 3W5IA 5EE5B 3T15A 4NTZA 1II0A 4AURA 4EQ6A 2KBFA 1OJLA 1KAGA 2OEPA 1F2TA 1ZNYA 3S1AB 1EFHA 3DOFA 4OK3A 2ZE8A 2QPAA 3C7KA 4FCWA 4B44A 2PT5A 3D6TB 1GZSA 3B2EA 3U6KA 2RCNA 3ZD7A 2BMDA 2IS1A 2ZSAA 1P3JA 1G17A 3P32A 1KAOA 3RS4A 2F43B 2MSDB 1YVDA 1G9XA 4TLBA 4EPRA 1XXHB 2VP0A 2DPXA 3QPWA 4C7OB 4BLQA 3W8NA 4LBYA 3CWQA 2C77A 1GILA 2QM8A 4ZI2A 1T3HA 2NIPA 1E0SA 3CZQA 3PV0A 4AK9A 1L2TA 3R8FA 1AZSC 2CK3A 3Q7PA 2FN4A 1XEXB 3HR8A 4RD2A 3TW8B 5CB8A 2X1VA 1R8QA 3HYRA 2J1LA 2WKRA 4ZKDA 2X2FA 5HCNA 2R6FA 3A58B 2UKDA 4Z8YA 3K0SA 4ILEA 1KJWA 1IOZA 4BRUA 3GJ5A 1ZYUA 3I8SA 1R10A 1UKVY 1FMLA 1H8EA 1P9NA 2Q21A 4HLQB 1XTSA 4IRUB 4IXMA 4URWR 1EWQA 5JEDA 2GESA 1S0UA 4ABYA 2QG6A 3FFBA 1M8PA 4M9QA 1U90A 3CX6A 3L82B 1MKYA 3KXLA 1W44A 4TQUS 1WRBA 4HI0E 3X1DA 2ZETA 3CIOA 3S1AA 4N1AA 2Q3MA 2VPPA 3AF2A 3BB1A 4G5OA 2GEDA 4LDJA 4M53A 1I4LD 3AKYA 4MRVA 1ANKA 1TNDA 1CULC 4EPYA 4KXFB 1JQLB 4JL6A 3LO5A 4TQ9A 2JDIA 3CR8A 4J0QA 4DBLC 5CITA 4LJAA 2Q9CA 4Q1DA 1KI6B 2BOVA 5CLLA 1XTRA 1JEDA 1ZD1A 3VR2A 4Q03A 4B3CA 4M0LA 5J4HA 4DB2A 4MQBA 1ZU5A 3K0FB 1U0HC 1HT1E 3NVAA 5M04A 4YXWA 1F5NA 1R7RA 4WIAA 1ONBA 4OBEA 5D3QA 5IRCD 3PXGA 3B9PA 1YR9A 2AFIE 1A4RA 4QBFA 2J0UA 3ICQB 2PBRA 3B1VA 4N3NA 3AKDA 3W6NA 4G5RA 2GTPA 4EFMA 1MRNA 5G41A 1NI3A 4BLOA 5HE8A 4BASA 2VP2A 3P20A 1FQJA 1GSIA 4UNPA 1KMHB 1NVVR 1P73A 1E9SA 1KKLA 3HWSA 1HQYE 4BLRA 4ASUD 2OBLA 2A5DA 4XWAA 2EU8A 2YYZA 1CBUA 1G3RA 1N6OA 1P6XA 1N6HA 3I3SR 3CF6R 4DZZA 3X1WA 3IIMA 1DAIA 4EJSA 3I4LA 1N6IA 2AXPA 1OFUX 1Z2CA 5A5GA 1OKKA 5K8LA 2YINC 2QE7D 4ACBA 2XSZA 1YKSA 3LD9A 1PZNA 3C41J 3KJHA 1JEEA 5FUXA 2D06A 2C2HA 1E9FA 4JLKA 4R2IA 3WY9A 2IS6A 3QE0A 2ZS9A 2QMEA 2O8DB 2J0QA 2XTNA 4KAXA 2A30A 1OW3B 3FPAA 3L0PA 3LBHA 1KO7A 3CRRA 4IVRA 4PX9A 2EFDB 4Q7KA 4BE7B 1EFUA 2XSZD 2CL0X 1NVWQ 1VECA 3B7GA 3BD9A 4PHFA 3ZGXA 1ZC3A 2ZTSA 3AVQA 4FINA 4DEXA 4RZUA 5CJPA 3KQLA 1L4UA 4IXNA 4DSTA 4BFZA 4XD7A 3PEUA 4KBGA 1S96A 3AF1A 4F93B 5F9FA 2C04A 4R2HA 5FOWA 3RSLA 4TYYA 1U98A 2GAOA 3VR5A 1XMIA 2ZUCA 3RABA 5L3VA 1S2MA 3TR0A 3SQXA 4HZUA 3IBYA 4RY2A 3AF4A 5TV2A 1Q20A 3QXHA 2ONJA 1KO5A 1MO4A 4BQSA 4F92B 4OHWA 2EYUA 2QBYA 3ZDQA 4XVQA 2ODWA 1Z6GA 1KI9A 4TLAA 3VHLB 3NXSA 2QTHA 4EFNA 2ZJOA 5EE3A 3KZ1E 2FSFA 3EPLA 2WTUA 1CKEA 3Q5EA 2B7CA 3PIRA 4M1SA 4AKEA 3AH8A 2ZI4A 4MKHA 2YWEA 1IXRC 4QNMA 2FE4A 4QRHA 3GJ7A 4QGAA 1PVOA 1GFIA 5C18A 2ZJBA 2V8OA 4XVRA 2XZPA 3TIFA 1SKYB 3WHKA 2GBLC 5DN6D 2L0XA 4UKDA 4B6FA 4ON9A 5ELXA 4NPHA 2Y8EA 2F1IA 1GAJA 4IOKA 1RVDA 1OT3A 3R20A 3K53A 2Z6VA 4JJZA 2E9SA 5EE9A 5FTMA 2REXB 2ZQ5A 3AVYA 4EJSB 1KDOA 1X8LA 2EYQA 3SFVA 1Q0UA 1D2EA 1VCOA 3TQCA 2FDCA 1S4QA 4JLBA 3GJ6A 1JNYA 2C9CA 3VKWA 4MRNA 2G3YA 1JJ7A 3L43A 1NBMD 3GLGA 4LJ7A 2OLJA 4EPXA 5KUTA 3U6BA 3I61A 4IKEA 2QP3A 3SYLA 1NY6A 3IQXA 2YWGA 1M6NA 3NG1A 2GF0A 1W2HA 1RYFA 5CM8B 1KZGB 1XPRA 3R8CA 1OKKD 4DEYA 3TK1A 5J4YA 5JSZA 3BAFA 5FPTA 2ZRKA 2ZRBA 1E0JA 1W4RA 1EX6A 3N2IA 4KODA 3VHXA 2RGEA 5JBQA 3K0CC 3AM1A 3AVXA 3TKLA 1N6KA 4BUJA 2YV5A 1I2DA 4TTPA 1LB1B 4TTQA 2ATXA 2Z43A 4OL0A 2JJ2A 2WWIA 3FMIA 1UBEA 2OM2A 1AS0A 2VSFA 5EUMA 2XAUA 1AA9A 1FNMA 3IPXA 4P0TA 2QP4A 1Z22A 4B2LA 1CEEA 4BGDA 3Q7QA 4YC7A 1EWRA 4PC2A 2FF7A 2FU5C 3CW2A 4NYIQ 1Q22A 3DL0A 4DRZA 1OXSC 1OFHA 2RGXA 1T9HA 2A5YB 2REOA 2OO7A 2ZJ5A 3VMFA 1TPZA 1DBSA 3Q3JB 1H8HD 4MA4A 2QSYA 2B21A 2QSZA 1E1RD 3O8BA 1NVXQ 3BJIC 4M2LA 1A7JA 2JLRA 3EWSA 4RCZA 2YZ2A 3MWYW 3F3YA 1G16A 1VHLA 1U9IA 1OSNA 2YWHA 4JBXA 2P6NA 5JWOA 2J0UB 1JR3E 1P2UA 1KDRA 1ZP6A 2V7QD 4S2EA 3NH6A 2Z4SA 2BKEA 3WBKA 3MCAA 2ZJ8A 2J7PD 4Q00A 1XMVA 3H84A 4IJMA 1F3OA 1PLKA 4JIMA 1NF3A 3RWMB 2AX4A 5JS7A 4A8JC 1WXQA 5EP2A 2YOHA 4LHZA 4D4KA 2WJJA 1VYVA 2GXSA 5BYJA 4AG6A 1Z08A 3ZS9A 2VP9A 2CL7X 2GCNA 2QY9A 5IHPA 5KPJA 2Z83A 1E2DA 2JASA 4IDQA 3W5JA 1GKYA 1ZBDA 1HA3A 2B8TA 5EUQB 2IYLD 1F60A 3E2IA 4A2WA 3LXRA 1KDPA 1O3YA 1GTVA 1I4DD 1SXJE 3EPJA 1S9HA 1XMSA 2AK2A 5D3MA 1XFAA 1SULA 1FTNA 2EWVA 2VHUA 1G3UA 1Z0FA 3QKUA 3RVBA 1QHHB 4V0NA 2ZIAA 5J4LA 2OV2A 3A36A 4ARZA 4D2IA 1NN0A 4YLGA 4DSUA 4FCTA 3LV8A 3KFXA 5FTKA 3WYFA 4A1FA 3NTUA 5HE9A 2WJIA 1NP6A 3QKSB 4GP7A 4A82A 4Q4AB 3QJYA 4JBYA 2ZSFA 3IKJA 3KKQA 2G9NA 3U3JA 1GITA 3KDSE 1IBRA 2WSSD 1XU4A 4LYFA 2ZRDA 4NCJA 4LHWA 3K70C 1OH5A 5FTLA 2JJ1D 5J4VA 1W0KD 1FTSA 1M7HA 3GFPA 2QT1A 5FOXA 2VH5R 3I5XA 1KY3A 2ZS7A 4Q4JB 2JLZA 3TSWA 2OE2A 2V1XA 3T1QA 1AN0A 3GLFA 2F3RA 5JJKA 4Y0AA 2ZPTX 3ADBA 2EW1A 5EXXA 3RLFA 4XIGS 3BERA 3ZVMA 1PV4A 4HUQA 2E87A 4TTRA 3CH5A 4IOMA 3B78A 5KOYA 3EIQA 2GA8A 4PO1A 4AYWA 1Z0KA 2O8EA 2ZSBA 1WA5A 5E95A 2EQBA 4EDHA 4M9ZA 1WE2A 5E7IA 2H17A 5KDLA 1V5WA 3K9LA 2NOAA 4G0NA 1R4AA 2GJ9A 2ZE7A 3H1TA 3M0EA 4PAMA 5CJ2A 2H1LA 2H92A 3GQBA 3HP1A 1X1RA 3PUVA 3WNDA 2GZHA 3BC1A 3SBDA 4A2QA 1E79D 4A0HA 2OILA 2XOKA 5AUPB 3GLGB 4P3YA 2O8BA 3DMDA 1II8A 5FR2A 4B75A 4F91B 3TUJC 2YKGA 3K9GA 1AQUA 2WZQA 1ZNWA 4XVUA 1RYHA 3U3MA 3LFUA 3ZIAD 3KFVA 1G6HA 4GT1A 4QGFA 5CIQA 2A9KA 3ZZTA 4DLXA 2H18A 5A4JA 3W3ZB 3Q5DA 3M4YA 4LPSA 4C0KA 1XJ0A 4TN1A 5CK5A 4Q48A 1OXXK 1BOFA 2GBLA 3SBEA 1RC8A 1G3IA 3EW9A 1OH7A 2IYUA 4OI2A 1CTQA 2ZAMA 5HKKA 1TTTA 5F98A 4LJ9A 3EIEA 1NN3A 5KNCA 3K0CA 1SZPA 1A2BA 2HF9A 2ZAOA 3CF2A 3QQ5A 1NBME 2GKSA 3B60A 2WWYA 3SJZA 4Q1BA 4MGKR 4P33A 5DGXA 2BMEA 2GILA 3CLVA 4YXWD 1UF9A 4B3XA 5JI2E 2I3BA 2VO1A 4NL4H 1W36B 2JGNA 3P26A 4W7SA 2JLYA 2P6RA 1FX0B 4TLDA 2KB0A 4YONB 2RGCA 5J47A 4CEIA 2NPIA 2BC9A 1R0YA 1ZVQA 1VG9B 3AQ4A 3K0FA 4TMVA 2WWHA 4JLAA 1DAHA 4MGYR 2ZEJA 4UXIA 2FJUA 4L16A 1HURA 3SHWA 4IOLA 4TYQA 4URXR 1N5JA 4I1OA 3EZ6A 3WP0A 3LA6A 2ZRAA 1R6BX 2RGBA 4V0MA 1F2UB 1FX0A 3LW7A 1AS3A 3HU1A 1FFHA 4A0FA 5KDDA 4OQNA 2BJVA 2PZFA 3B85A 1JI0A 1V43A 4RD1A 4AI6A 1KSJA 3ZLJA 2REBA 3GMTA 2C99A 1NLZA 5H1YA 3RS2A 1G21E 5E7MA 4JLDA 2XITA 1FW6A 1GNPA 2HF8A 2HXSA 2X19A 2ZU6A 3ADKA 3MFYA 4EKDA 3B9QA 3X1XA 2EVWX 1JR3D 2NO6A 3SJBA 4C9BA 1NG1A 3PUXA 1KK3A 4P4SA 1Y3AA 3GFTA 2IK8A 5FI0B 1GDDA 2ZANA 2BIFA 3QKRA 5JFGA 4MYUA 1E3MA 1LNZA 1W5SA 2CBZA 4ACAA 4TYPA 4TMXA 2OHFA 3OFNA 1R0ZA 2XXAA 1TMKA 1ZM4A 1QHSA 1O87A 1UKYA 5IDVA 5HR5A 4CEJA 3VAAA 1OFTA 1QG4A 3I72A 3AP3A 3KB1A 2PT7A 1FUUA 1VCNA 1IAQA 4C0LA 4OI4A 2HYIC 2GK6A 1DAGA 1MR3F 3W3AA 3LXXA 3OFND 2QMHA 2AD5A 3W6OA 1E2GA 4QBIA 4JSTA 4EQ6B 2C9YA 1JAHA 5FBLB 1XRJA 2QMOA 4GDFA 2O0HA 1T4GA 1YZNA 1LS6A 1L4YA 3FOZA 5AR1A 5AJZA 4JLVA 3TBKA 1U0LA 2A3RA 3VR6A 3QUSA 1Z83A 2W6IA 4KFTA 1Q3HA 4UNRA 1E2KA 1KI4A 1UKEA 1IQPA 2J7PA 5K8IA 4NHOA 1OH8A 2BKUA 1KDTA 1QBKC 5EZ6B 4JT2A 1IN7A 2JJ8A 5DN6A 2CHVA 2XXAB 5GVRA 4D0LB 1FZQA 3FKSD 5BYKA 2IYRA 2ZYTX 4B73A 2ZUBA 3QG5A 1PJRA 2O8CB 4H9GA 1TU3A 2PH1A 3DHWC 4D4JA 1QHGA 4HDCA 5TDHA 2F9MA 2RMKA 4LSGA 4B71A 3C4JA 4A15A 3NWJA 1KY2A 2ORVA 1P9RA 4M1MA 1I2MA 4G01B 1QHHA 4KITB 2A5JA 2GCOB 1E96A 2CMKA 2FGJA 2ZI7A 2W6JA 1X86B 1YU9A 3SE0A 2ZROA 3C15C 2IXFA 2LCFA 4WZBE 2GZAA 3WHLA 4MDFA 1MT0A 3PR1A 3SC3A 2R6GA 4I1SA 4DDWA 5C4MA 3TAHA 1AKYA 1ELOA 4Q18A 2DWPA 2BV3A 1VCMA 4OI0A 1UBCA 1UM8A 5FPHA 4OHVA 521PA 1T8TA 3KJEA 4M22A 5AK0A 5JRJA 3ADDA 3GLHB 4M21A 5DYGA 5LBIA 4FD2A 3SS8A 3GP8A 4HB0A 4QJ5A 4CEJB 1WBBA 2VF8A 4GOKA 4Q9HA 4NE2A 4WBSA 2RB4A 3SOPA 5HKKD 1NVVQ 4HAWA 1S3SA 1UDWA 4HAZA 3CR7A 2HJGA 3K09A 3OIUA 3TUIC 3UK6A 4KHZA 4KU4A 4TL6A 5KPDA 2VSOA 2IYQA 4ITRC 3QENA 2IWHA 4K8OA 4A8JA 4AKHA 3T5GA 4I99A 4JMPA 3KQKA 3BS4A 2MSCB 1XF9A 4HZUB 3TH5A 2QORA 3IEVA 3EX7C 4BFSA 4UNNA 3OAAD 3K8YA 1Z6YA 3PEVA 2JJ2D 1HE1C 1ZC4A 1DEKA 4I81A 1JPNA 3IHWA 2OFXA 4JT4A 1OXTA 3AEZA 2J9RA 2C95A 2O5VA 2PX0A 2GJKA 1TUEA 1RJ9B 3K0EA 3TRFA 3N70A 1I4TD 4ERNA 2MMGA 4FMCF 3THYB 3RS3A 2WSMA 1CR1A 4DSOA 2YJTD 2BBOA 3J81k 2W6ID 1JJVA 4M8NE 4R7ZA 3AF0A 5HCIA 3M6AA 3QKTA 3RS7A 2OBNA 2WWXA 2YVUA 3SU8A 2IS4A 3B13B 1KSGA 4PC1A 4Q7LA 4RJLA 2VHJA 4TL8A 2NQ2C 4OQFA 1Z28A 1QVRA 4PQRA 4Q7JB 4JKIA 3AUXA 1S3GA 3IO3A 2FSGA 1SGWA 1U8AA 5B57C 4ESHA 1AGPA 2I1QA 1Q1QA 3LLMA 5FR1A 2ZJ2A 3ND9A 1YZQA 2R6CA 3NHAA 4HB4A 3UG6A 5C2JB 1IN4A 2AR7A 3LLUA 1Q57A 4PAQA 3ZQJA 2JDID 1R5OA 1E32A 1CR2A 3P4YA 4DLYA 2OCBA 3MGCA 2HT1A 3AUYA 5FOVA 2F1HA 4ASUA 1M7GA 2CXXA 1TF7A 2OUKA 1JAIA 1G8YA 5G40A 5J40A 1TX4B 1KK1A 1LFDB 1KO1A 4NYJQ 4BFUA 3MMPA 1YZLA 1MABA 3QIAA 1KI6A 1UBFA 3PJRA 2HEIA 4P4SB 4C4PA 2HUPA 1Z6AA 1ZD9A 1P2SA 2ZRFA 4X8MA 1XD2A 1NMYA 2WJGA 2VF7A 3EC2A 3GEIA 3Q8XB 2ZI9A 1Z0IA 1II8B 2IYSA 5H70A 621PA 1XTKA 3BH7A 4NYJR 2P6UA 1EESA 5GJCA 4B34A 5L3RA 1PUIA 4RKFA 5BW8A 3U60B 1KKMA 1DAMA 3LNCA 1HUQA 1NLFA 1CP2A 1T5IA 2ZRLA 2VSXA 3ASYA 4HAUA 1VHTA 1YRAA 3E5HA 3OE7D 4DLWA 3ZQ6A 1GKIA 2BCGY 4TSFA 4CDGA 2KBEA 4NBSA 4D26A 2IUUA 3FVQA 4B3DA 3CONA 3LX8A 3Q9LA 5HPYB 1CS4C 1ZW6A 1R0XA 2NG1A 2V7QA 4LBZA 5LD2B 2HYDA 1UFQA 2GVZC 3SDZA 3THWA 1LVGA 2R6AA 1Z5ZA 3U3OA 1RJ9A 5KNDA 3OE7A 4GBMA 3HYTA 4R9UC 3GLFE 1XCGB 1E2HA 4BFTA 5JRZA 1A82A 2P0EA 4DUGD 5L8VA 1SVLA 3X2SA 1LW7A 3IIJA 5CM9C 2ZYWX 1NRJB 1NMXA 1XMJA 3V4RA 4UNSA 2CLDX 4N0EA 5C46F 5IK2A 2FH5B 2HT6A 5FPKA 4BZPA 2F55A 2NO0A 2J3EA 2ODEA 1YJ5A 4LBVA 4QJ4A 1OYWA 1QHIA 4I4LA 1J7KA 5L3SB 1KNXA 1FL9A 1QDEA 2J0SA 2ZUDA 1NY5A 1IN6A 1M7BA 4W5HA 2ZRPA 1KMQA 1GM5A 3GEEA 1F2UA 1RKBA 2G0NA 3QVVA 2GZDA 4DIEA 3DMNA 3PFIA 1E9CA 3I5YA 3QBVA 1FQKA 2QGZA 1US8B 4TWZA 4OI1A 4CT4B 2V4ZA 4TMZA 2IHBA 3K09C 1ZUIA 2XB2A 1NMZA 5CK4A 2P67A 2QROA 4FWIB 5EZ5A 2QBYB 3D8BA 2QQ0A 4K81B 1MO3A 4Q7MB 1VKJA 2Z5FA 2JLWA 5AUQA 5GVSA 1OLOA 2QNRA 5B30A 4LC1A 4PHTA 4TQAA 4D82A 3AVOA 2QEQA 1SHKA 4WOPA 1VPLA 1CJMA 3CO5A 1JQJC 5L3QA 3GLHA 3BIFA 4OQXA 5JMTA 1ZINA 3OEED 3CH4B 4LGMA 4V03A 3KJIA 2IL1A 4JL5A 1E2NA 1G20E 5EXTA 3OIVA 4H1VA 1K8RA 1GKUB 2PL3A 3CKLA 3LVRE 3LDAA 4XTCS 4EIWA 2C98A 5HTKA 4US1R 4CGZA 3PCRB 1G5PA 2CK3D 2NZ8A 2Q9AA 4LI0A 4LV6A 4LV5B 1QHNA 4Z54A 5BXQC 3EPKA 2WOJA 4FW9A 4TT3A 2JJ1A 5KO2A 3Q85A 2J46A 3CPJB 1E1QD 2ZVPX 2OAQ1 3T06B 4OK5A 1OHHA 1P9WA 3EZFA 4A2PA 4LJ4A 1Z3IX 4V02A 1WP9A 1AZTA 4PR0A 1KZ7B 2QTFA 2F1JA 3M1IA 3L0IB 4JLNA 1OIWA 3AVVA 2RAPA 4MKFA 3U2QA 1G8HA 2KSQA 2W58A 1D8TA 3K70B 3U3RA 1F6BA 4N0DA 5TARA 1A1VA 2GDJA 3RC8A 1D9ZA 4BFXA 2CLSA 2J41A 4LHXA 2PJZA 1F2TB 4Q1FA 3SQWA 3SYKA 3B1XA 2J0VA 1XZPA 2Q9BA 2QAGB 3CM0A 1KSHA 1XXHE 4JLPA 4MUAA 4FWTA 2BBTA 2P5TB 1X8KA 2YWFA 2PEYA 3IDQA 4US2R 4DDVA 4O2LA 3IBGA 4IHQA 4MGIR 3HPRA 5JHHB 3DKPA 3KQUA 1JBKA 1ZAKA 4Q1EA 5IF9A 1EFTA 1QVAA 1XP8A 2W2VA 2AKYA 4LZZA 3REFA 4HLUA 4A0GA 4RD0A 3H0KA 1U8ZA 2I1VB 3AKCA 4W5JA 4XWKA 4DDTA 2O8EB 3BFVA 3CB4A 4U02A 2ZSEA 1BS1A 2BEKA 5JSZB 2XEXA 4LCBA 1CR0A 2XJ4A 2QA5A 2OXCA 5E4FA 3ZVNA 4GMDA 2PLFA 3R7WA 5GADl 4QBHA 1Q44A 3CUEF 2GAAA 2JA1A 1J70A 1T0JB 1KNQA 2C5LA 1E9DA 4LJ6A 3U4QA 1Q3TA 4C2TA 3LW8A 5CYOA 3SNHA 4BLPA 2ZYVX 1CIPA 1R5NA 1VIAA 2Z4RA 3IUYA 4ZKEA 4DC9A 2ZXUA 1E1RA 3AGQA 1Z29A 4P4TA 2BBSA 3VTKA 4RD4A 1ZD8A 1E2LA 2WAXA 3T5DA 2VL7A 3LY5A 3WMEA 3KX2A 4M1WA 1UBGA 1XTJA 3W8RA 1T5LA 1ZUNB 1XEWX 4M1OA 2WICA 2OFOA 4KSBA 5TXGA 5EP4A 2WMOB 1E6CA 4X8LA 4NCHA 3ETLA 4KJZA 3HU3A 3AKEA 3FHOA 5JWRA 1P75A 1CLUA 2PLRA 2KI5A 5CB6A 5P21A 3D7MA 2J45A 2JCSA 3K9NA 3C8UA 721PA 2BEJA 2B92A 2O52A 4GPTA 3MLEA 1DO0A 1QRAA 2DFLA 4PPGA 4B6EA 3NBYC 4URYR 3SZRA 1J90A 1L8QA 4B74A 1N6NA 1YRBA 4OJKA 1DAKA 1GL7A 1NL3A 2CEAA 2NZJA 2OSBA 1DS6A 4IEIA 1KI8A 4KSCA 4DXAA 2OESA 2OXRA 3QXCA 4CF7A 3UMFA 1IJFA 1VTKA 4O25A 3A1VA 3SN6A 221PA 4HLCA 4XSHA 1FMJA 3IIKA 1AGRA 4Z1MA 1SHZA 1G1MA 5H8WA 4PPNA 3L8ZA 2Z0MA 5LB2A 1J99A 1NBMA 1PLJA 3SI7A 2ZSDA 1PUJA 3BGWA 2W2XA 3C16C 4NCIA 5B64A 4IFBA 3CNNA 3EZ9A 1IY2A 1KI3A 3KUCA 3A1SA 1NKTA 3H86A 1NKSA 1JXOA 5FOSA 4KLZA 2QMUA 4YMTA 1T3SA 4GI7A 5JWHA 1DO2A 4OHZA 3BORA 1ZJ6A 2AWNA 1VIYA 4Q9KA 3EZ7A 4Z51A 5EQTA 3VNUA 3SFZA 3RRMA 2VP4A 4F4CA 4RZ2A 4TLCA 2YHSA 2ZREA 5DI3B 3P27A 2IYTA 4G1UC 2CCGA 2ZR7A 4E5UA 4FIDA 5JLJA 1KO8A 1G8FA 1WMSA 4EJSC 5SZIA 4GL2A 1W4BA 1W36D 5UKDA 5DHAA 1RRCA 5J4KA 3EA5A 2WAYA 3BBPA 2XNDD 1GOTA 4QBGB 2Q6TA 4PHHA 3QKRB 4ESVA 2IYYA 1BYUA 5FTNA 3TE6A 1XEWY 4A92A 1E69A 1HQCA 2R44A 1SXJD 4Q4JA 4FXPA 1DE0A 1Z06A 3DKVA 4L5BA 4DB4A 2FGKA 2AD1A 1KTVA 2TMKA 3VFDA 5LB4A 2Q3FA 4MGZR 2FFQA 3EASA 3CWZA 2H16A 5JHGB 4LRWA 1BIFA 3H2YA 4NONA 1U99A 4OJQA 1G3QA 1J8MF 4M4SA 4AC9A 2CHGA 4FMCB 4YMWA 5FI1B 4FMDF 2FPLA 1N3BA 1G18A 4RD6A 4X8OA 2QZ4A 2O0KA 1DELA 2HLDD 2OAP1 2N1BA 2C8VA 2ZRJA 3A4MA 4LYHA 3QF4B 1QZXA 4CT5A 3FMPB 1YR7A 3RRYA 3HU2A 3OESA 4JYBA 3MG9A 2D3WA 4LHYA 3PENA 2AN9A 1RPZA 2WMNB 3TJZA 1KSFX 3CRW1 3NDPA 1TF5A 2GK7A 2C9OA 3VR1A 4CRWB 3KKNA 4FI3C 3NC1C 4LC0A 1W0JD 1G41A 3GJ8A 1BKDR 3DOEA 3LBIA 1L7VC 3QPVA 3P1JA 4PPQA 3IQWA 2V9PA 3D3QA 1OB5A 1DADA 4DLSA 2NO9A 1COWD 2WBLC 3B8HA 1T3LA 4K46A 2QN6A 4MKIA 4G3XA 2W83A 4Q66C 1XCMA 4OYHA 3PQCA 2ZYUX 3QBTA 1MRSA 4Q9IA 3LX5A 2F43A 2IC5A 4PFSA 4EPTA 4A8JB 4ZCMA 3T1VA 2KE5A 3ZD6A 5SZHB 2WV9A 1WF3A 1E9AA 2ONKA 4JJKA 4DWJA 1CJUC 2D62A 3I92A 4CVNA 1SQ5A 2YOFA 4HEJA 4E07A 3ZS8A 1U81A 1DVRA 3CX8A 4WZ6A 4CW7A 3EPHA 1EFRD 2GXUA 1D6JA 4D0NA 4TZ0A 1ZM2A 1SKYE 1ZIOA 4YQFA 2ECKA 2QAGA 5TMPA 5DYIA 4ARZB 1M74A 1W5TA 2V6JA 1M1YE 2PCLA 5JZVA 4FMDB 4WZAE 2OZEA 2ZJZA 4O0MA 3IHLA 3VQTA 3R7WB 4Z1MD 3VR4A 1BYIA 5TY0A 2ZRMA 4AYTA 4NYMR 4PQFA 2QUZA 4Q9LA 3B1ZA 1XPUA 4BLSA 2PJRA 2IYVA 4MYHA 1XTQA 1LV7A 3DM5A 3FWYA 3K9HA 3QEJA 4LV8B 1W48A 5KNBA 1E2IA 1VCIA 4DCTA 8OHMA 2WKQA 3EAQA 4B35A 2F6RA 3ZVLA 1S1CA 1CXZA 4U7DA 1CF4A 2JATA 2ZITA 4JBWA 4CEHA 2FSIA 1G4AE 4PZLA 3B1YA 4A4DA 2GETA 1GWNA 1Q1EA 3T61A 2D74A 2OFWA 4TMKA 3BH6A 3T35A 1N25A 4YMVA 5K8UA 2QP9X 2EFHB 1XTIA 3FFAA 4JLMA 4Q1CA 3KKOA 4WW0A 5TB5A 1B23P 1ZM7A 2DR3A 4C0JA 2D7CA 5FBWB 2DBYA 4RVCA 4WVFA 1SVKA 2QAGC 4XOIA 5G3ZA 2ANBA 4KYUA 1MABB 2FWRA 3MWKA 4GMXA 4KI0A 1KI1A 4MRPA 3UIEA 3KTAB 1E4VA 1XBTA 2IUTA 3SEAA 4QM7A 4IDPA 3N2EA 3K0AA 4NKRA 2VEDA 3EZ2A 4YMSA 3U7EB 1RFLA 5B58C 4XSGA 3G82C 2CDNA 2H5EA 2RKOA 4II7A 3O8DA 1TL7C 3MJRA 1G6OA 4UXJA 4L15A 2HDNB 2RHDA 4HB3A 4E03A 5EJEA 5KSZA 4KFSA 1SXJB 5E3HA 1W2GA 1W47A 2MSEB 5DI3A 1E4YA 2F1RA 3CNLA 1JB1A 4PSVA 4HSEA 4GOJA 2GJAA 1P7CA 1E2MA 2ZRIA 1FNNA 1VDZA 3QVUA 2D2FA 2CVFA 2ODNA 5FBQB 1WBDA 4HLUC 4ZDKA 1W4AA 1G7RA 1OIXA 3LAWA 3SHFA 3CRQA 4ZCIA 3GLHE 6Q21A 5JJIA 2PMDA 1SXJA 1Z6TA 3T1OA 4EFLA 1GRNA 3GPLA 2VBCA 5EE0A 2V6IA 5DO9A 3RYTC 2OBMA 2H7VA 1FPMA 5DSZA 3KKMA 1EXMA 4F38A 1HY3A 5FUVA 1NN5A 2FZLA 4QG7A 4AD8A 2IW3A 2FSHA 4S35A 1IN8A 1QHXA 4F4JA 3AVWA 1RIFA 2WWGA 3WRXC 2QT0A 2XX3A 3UXMA 5EP1A 1D2MA 2HLDA 5AJVB 4LOAA 4MKGA 1E9BA 2ODBA 1ZNXA 4O2RA 3OEHA 3DO6A 4RZXA 1T0HB 4DUGA 3JZAA 5AJWA 1NIJA 2FMXA 4B48A 4QGHA 2GF9A 2RH5A 3L0OA 2IWRA 1DTSA 1JR3A 1NSFA 2W0MA 2FEMA 2WHXA 3K0AB 1T91A 4PC3A 1XEXA 3GFOA 3DM9B 5FBRB 5IK2D 2ANCA 4L9SA 2ZE5A 3FKQA 1GVNB 3EIHA 3UKDA 4MYCA 1W0JA 4JZKA 2XB4A 1DG1G 3RRNA 4O3MA 3THWB 4LK2A 3NEJA 3C5CA 3RSOA 3VU9B 2FZ4A 4GNKA 121PA 1Q1ZA 2Q0HA 2XNDA 3MWLA 3CBQA 1G291 4PXAA 3A8TA 2N42A 4JKYA 2QE7A 2IA5A 3GLIE 2VHQA 1P62B 1ZNZA 2OCAA 3NH9A 1W49A 5DE3A 2ZRCA 4URVR 1KO4A 3WYGA 3NBFA 2D2EA 4AKIA 1BMFD 1QHYA 4NP6A 4QFMA 5FPYA 1IHUA 4PPFA 4E09A 3T34A 5EXPA 3QG1A 3QXJA 4BZXA 1B0UA 2J59A 2GXAA 5FPSA 4EPWA 1R8SA 2ZRGA 1CU1A 4DCUA 4QKQA 1X1SA 3U44B 3PUZA 1SVMA 2JIZD 4V0LA 4A6PA 5LD2C 1NG9A 4MUBA 2F7SA 4ZIRB 4WXPA 3LH5A 1OE0A 2C78A 1KMHA 3AV0B 2PEZA 4FCVA 1ZMXA 2JLXA 2J5XA 3ICEA 3PG5A 1Q21A 2IYXA 3A1WA 3I8XA 3W34A 4YMUA 3KQNA 1UPTA 3KKPA 3B1WA 1RRGA 4MITA 3WBJA 1Z6XA 4XH9B 3LBNA 2F9LA 4W9MC 4IEEA 2CVHA 2N46A 4TYNA 2ZJAA 5BWMA 2BJWA 2YNMA 1GL6A 2V55B 5CYPA 4Q5IA 2WJHA 1UADA 3G5UA 3QPUA 2OCYC 2I4IA 1N5LA 1VG8A
chains in the Genus database with same CATH superfamily
3M6HA 1ORRA 3BRMA 2O8NA 2XNSA 3K9BA 5IFLA 5IPFA 4ZMRA 1PO7A 5CIWA 4JLJA 3BK7A 3U3XA 1Y1QA 4B3SB 1R6TA 3DZFA 3OZTA 1IHXA 1V1MB 2OXEA 2VR1A 4LQDA 1RQXA 1E2FA 4QU9A 5E38A 3O9ZA 2PWAA 4MTCA 4N18A 1Z5PA 3PX2A 5FV4A 3PGXA 4Z9BA 2C1ZA 1S1MA 1IIRA 4PZ9A 1X7XA 4RQAA 4PM5A 3GRFA 3KQYA 1E1LA 3LVQE 1W75A 3O91A 2B25A 5KOHB 2GNOA 3A9VA 3DAHA 2B7BA 2G4LA 2I7DA 3DJFA 4O08A 3QPDA 4J2HA 4QHTA 5GJWC 4F7WA 1HQKA 4G3KA 1JIVA 2BGWA 2IXBA 4L1KA 2B6HA 4EF4A 2VHCA 4M1TA 4NOJA 5EUBA 2IZ6A 3V32A 3U09A 3FA2A 1T5DX 4DDHA 3EXHB 3S70A 1GGNA 3WP1B 1P3DA 1BXGB 2ZVQX 3OP4A 4R9RA 1L5MA 5L3QB 1G7TA 1OV4A 5HP4A 4FWBA 1ZNQO 2BGJA 4FNMA 1TI7A 3V7WA 3JQDA 5JFOA 2B61A 3AVPA 4FGLA 4D8WA 1WB6A 4JS0A 2QXTA 1TK9A 1BNCA 4NK3A 3E1SA 3NTVA 3JYLA 2X41A 1UWLA 3K6KA 3PI6A 3R3JA 4GOMD 4EW3A 2XFTA 1XWFA 2H4XA 3IEKA 5AVQA 4IS2A 4TT3D 2A9VA 2ID7A 4JSRA 2NADA 4WKNA 3IBJA 4WCFC 4B80A 5BMVB 3HDGA 1E1CB 5EJ5A 1YJCA 3U80A 3KDAA 2AZXA 3EEBA 1N4OA 1H4TA 3N2KA 3P98A 1LX6A 5AQBA 2WR8A 3L4BA 3Q6NA 3R5JA 3SSAA 5ITWA 4C2UA 1TAQA 1FCOA 1IRIA 3DOIA 4P7GA 3EPRA 4BECA 2GN9A 2HMUA 1QV7A 1R0BA 2FQQA 2H7CA 2R8YA 2CFSA 3BD8A 4WVLA 5ALXA 5EWMB 5EZYF 3PQ5A 1KJ9A 3IP6A 3H0CA 3UANA 4AJLA 5IYZA 1BE8A 2IHYA 4RHYA 2Q3HA 4JR1A 2JCYA 1NVGA 2HGSA 4LXGA 4BMYA 1GAQA 1P29A 4FFBA 2ZJ4A 4ONEA 2AS0A 4PSCA 3S2UA 4ZJZA 1FBTA 1W36C 4Q01A 4KGZA 4L4UA 4LFUA 1NIPA 2EX0A 4XM0A 3PICA 4ZXFA 2BBWA 3V9PA 3NONA 2MR6A 3VKHA 3ULKA 3DO8A 3F1NA 3NRCA 1IYQA 4FM9A 5EE1A 1OD6A 2RGDA 1RE1A 2XTZA 4R2LA 5K3EA 5CFZA 2WKPA 4KNYA 4QY5A 1NMQA 4J90A 3QOFA 3USES 2Z57A 1KYIA 2WKSA 3L3BA 1A7AA 2QG4A 1X3SA 3UPDA 4L7QA 1IUKA 1SVSA 1DFHA 1E1QA 4URUR 2DU8A 4W82A 2HPBA 4D9BA 1UKZA 2XZDA 5IDYA 3RU3A 4MJ7A 4BJ3A 4AY2A 3SQOA 3V1TC 2P2GA 4BNYA 4B4KA 3GLQA 3WLMA 4H7DA 1K88A 1VEUA 2DAPA 1T9AA 2GRJA 4CKBB 3C1AA 2RI1A 2FXVA 3GEHA 4KMMA 3F0TA 2P5SA 2NU6A 4ML3A 3QJ5A 3Q9NA 4Q1VA 3FDIA 4UCQA 4LWZA 3H5IA 2R9VA 4AUKA 4BZZA 3KQTA 3DTIA 1X7YA 1ZU4A 5EMMA 3ANLA 5IBCA 1NSTA 3I1JA 1G5IA 1D06A 1RLJA 2PZEA 1XWWA 2ZI6A 1A5ZA 5D5HA 1BFKA 5G02A 3KPVA 4CCSA 3UFBA 2VTBA 1KDWA 2HU2A 1Y3IA 2XGMA 1JHQA 4Z99A 2WV7A 1DC8A 5I9BA 3WWYA 4MWTA 4HYQA 4IDOA 1Z8FA 5KYWA 3A2LA 2BGLA 1JX6A 1NR5A 3IAAA 4JFRA 3SJCA 3BFGA 2QK4A 1DAFA 1XCPA 3FHLA 4XEHA 4D97A 3IE2A 2CLKB 1JE0A 4OAPA 1R9NA 1AMOA 2RHWA 5EOEA 1ZY2A 3H8VA 1EHCA 1XTBA 3IQZA 2B36A 2G2WA 2D0PB 4ZQGA 1DG3A 3UFXB 3X1YA 3ZTTA 4AULA 4NWIA 5AW1A 4LKRA 2A3UA 2OV5A 2DFTA 5B12A 4M1YA 5AI6A 3U37A 4ZO4A 1SCBA 2GN2A 4YALA 1NNEA 1NQXA 2CNWD 1A9TA 1ZOIA 2VDJA 3PIIA 4YGYA 3KXIA 3PITA 2C96A 3EWNA 2OG2A 2LWIA 5JAMA 5IH3A 4QHYA 1Q7CA 1OYVA 2ZSJA 4MS3A 4KKXB 4PZYA 4TSFD 1QPGA 4OQEA 5A71A 1SKBA 1AXBA 2PKQP 3STTA 3CRNA 3V1NA 1GNSA 4AG5A 3KVOA 3I9LA 1V45E 2EEZA 2PWZA 1MOZA 2PXHA 5ICFA 1AU9A 3TNYA 1X1CA 3R09A 4FKBA 4M37A 1K6EA 4EG8A 3KHSA 3MXQA 2XGJA 3KXPA 4RUKA 2P9VB 1LKZA 4IIFA 4AECA 3G2JA 4JI2B 4DN6A 1QQ5A 2RC5A 3VZSA 4BQFA 2XRNA 3HCWA 4BTLA 2ZRNA 2FWNA 1UCFA 4B9AA 1XJ3A 3VVBA 3RU9A 3GMWA 3B82A 3KJGA 4G5QA 4HDNB 4UHKA 3ZN2A 2XKBA 1H4QA 3O6VA 1JVJA 3A6EA 2DJ5A 3OQ1A 4L3VA 1ZWKA 1CDOA 2G40A 3GEDA 4IIJA 2GYVA 3CLUC 2WUQA 4R3WA 3AFHA 5HNKA 4CNQA 3QBDA 2EXAA 1A9PA 1N0UA 1Z47A 2EFEB 1P4JA 2GCPA 1QCYA 2QRPA 2W48A 3L1KA 2ZM5A 3N8NA 4PTLA 3SSOA 2V1AA 1NNUA 1T3ZA 2BWJA 2VWHA 2YYSA 3AIMA 3C3XA 4RPJA 1O8BA 1EA7A 2HSJA 1ZMRA 1Z74A 1KKUA 3ADPA 3G0IA 4MW7A 4URHA 4OF4A 1XTPA 3ZZ1A 4KCGA 4B7CA 1C0IA 1T24A 1Z45A 4CYMA 1PNRA 3VR3A 4XR4A 5DI9A 1X38A 3M6IA 5IDWA 3VNVA 3U7HB 5U47A 4Y2XA 4M8IA 1YQ9A 3HB1A 2G7ZA 4L0DA 3CX4A 4ZI7B 4GLQA 1PJ8A 2R00C 1VJ5A 2C57A 3ZYTA 5JVDF 1XZBA 1TF2A 1VL0A 1P7ZA 2O3RA 1BJKA 3HU5A 4MQFA 5JAIA 1LLFA 1VP9A 1DC3A 3PR2B 1RZ3A 2P1ZA 1P6UA 2IX3A 1FYXA 3QP4A 2G67A 2W00A 2FG6C 1TEHA 1TT7A 3AERA 3UAZA 3H05A 2GX5A 3DCYA 2Q4DA 3TZQA 4DLAA 5J8XA 2PCJA 2WJ3A 1TQDA 5H02A 3CPEA 4YUWA 4I1PA 3GSGA 1VLZA 4XLZA 4RVUA 1OI7A 2XXJA 3IMEA 2ZYIA 4I3JA 1UQRA 3P97A 4GZ5A 3SM3A 3VR4H 2W27A 2E89A 1C4XA 4UDNA 3VOTA 1Y7TA 3ROMA 3GGCA 1KK2A 2C42A 2AR9A 3I6YA 4ZOCA 1V3TA 2IUSA 3DTEA 1X8JA 2GK3A 2VHTA 3B38A 3MJHA 2H59A 3TVTA 4IDNA 2VQFB 2YL2A 4WQMA 2GJ8A 1L5NA 3ICOA 2X4GA 3E48A 1JR6A 5KAPA 2H57A 3MK31 2TS1A 3WQHA 4A16A 3ED5A 5KEIA 1Z4NA 2FA9A 3QE4A 4KWEA 4G9BA 1LCIA 3EZGA 5EJ6A 2ZBDA 1QC5B 1ZM9A 4NBWA 3CZPA 3EH1A 1VSQA 1P60A 2BEVB 2RGUA 4Y7PA 3LCUA 1AZLA 5DCLA 4RJIA 1R5BA 2AMJA 1N6RA 3VV4A 3I9MA 2IYPA 4X5OA 5CPFA 5AVZA 2UZ1A 2ZJ3A 4EECA 1Q95A 2BCEA 1Y28A 4QYIA 3KTOA 1VB3A 3W6UA 1A9ZA 4RKEA 3V34A 4Q1AA 3AR2A 5CDFA 4BTVA 2Q5CA 2B2XA 1KK0A 1WCYA 4ROSA 5HIAA 3TQQA 1CHDA 2HA6A 4JL8A 4BMXA 3EVZA 4JUDX 2EZUA 1UOEA 5C4GB 3FCXA 4X1YB 1J9ZA 2AEJA 1E98A 2DQKA 4FMPA 2GZRA 2OTCA 4RY0A 4C3OB 1PJQA 1OREA 2FF5A 1EM8A 1X15A 1QVVA 4RLSA 4QDZA 4P6BA 4DW8A 3P01A 1APBA 2CHEA 2YKGA 1DXHA 3OEHD 3CE9A 4QNNA 1S9DA 2C8LA 3KUDA 4COOA 2XCUA 2GYUA 2XQIA 5AESA 4MR9A 4I19A 3ILYA 4GE3A 1OZGA 2BHRA 3I2FA 3BXHA 4TRMA 4EA9A 4YEDA 3VV3A 2ZBGA 1PT6A 2CSUA 1W94A 1WDMA 4RW0A 4UVIA 3D1VA 2QX4A 1TS8A 4LV2A 1QJ4A 3OZDA 4DIMA 5F7XA 1U0BB 2YY5A 2Z08A 4KG7A 4DRXA 3EISA 3R9XA 1Q1BA 2PNFA 4D9KA 1K9SA 1PN3A 1WQ1R 5KTMA 1PTKA 1DJBA 1HDOA 2QR3A 2ZUSA 4IUYA 3CMZA 3V39A 3KVYA 3OQIB 2WAFA 3AYZB 1YE8A 4KPUB 4X1KB 3JYPA 5EESA 4C20A 2EC5A 1L5RA 4HR7A 2XY4A 4MR8A 2ZR0A 1TUIA 2LIVA 1DEXA 3DBAA 3ZYCA 5JSFA 3W8KA 1E6LA 4U3JA 3PD7A 3U44A 4RTLA 4X6TA 3Q0EA 1AG9A 3IV7A 1L8OA 1SQ6A 2ZBFA 4HWPA 4YJGB 2QTAA 3TXXA 5JAHA 4ITUA 1F48A 3T1QB 1MGOA 4YRNA 5A5EA 3AVTA 3L6EA 3M3DA 3CZ9A 4ZDIA 4F4IA 1B4DA 3T4SA 3JWEA 1K6MA 3UMJA 4TV8A 2QT9A 5KSPA 3D9YA 4P38A 1E3LA 5L8MA 2PS3A 4CQLB 3Q2KA 4B2PA 4DBVO 3DBHB 4V3BA 1PGPA 1P1CA 1KE1A 3H9EO 3RHFA 4EHBA 2G6BA 4MVXA 4KUKA 5JSQA 1Y1TA 1O08A 4KFRA 3U5ZB 5T5QA 3QX9A 2G6TA 4JZYA 1IL0A 1C0KA 3G2KA 2B78A 4PGFA 3BGDA 5FUWA 4WZBB 2WD7B 3VAYA 5A3RA 2J48A 4Z6KA 2ZOIA 4HRXA 4D4HA 2PZGA 4R6LA 2P4HX 4HLDA 4IGKA 1EB9A 2TSYB 1GPDG 1JWZA 5EZSA 4DVGA 3KQHA 1K5PA 2GS9A 4W63A 3MCUA 1LSJA 3KSDO 3M1AA 3WB2A 1JFFA 4JYMA 2F1OA 2PGLA 5BVGB 1GL9B 3S0JA 4CU5A 5IUJC 2IZ5A 2O3TA 1J09A 1TM7E 4CDNA 1K06A 3H2SA 4HDQB 3SZGA 4UAUA 3VYVA 4GVPA 421PA 3FWLA 1W63Q 3NR2A 3RV3A 4GL4A 4B7AA 4C4RA 2RBKA 3MFDA 3EDQA 3DW1X 4TYWA 2EX4A 3R9WA 1Y0BA 1LZKA 3QXXA 2WIBA 4IIXA 1PFQA 5IDQA 5JCZA 5MGBA 2J7VA 5DX8A 5KOIA 1TT5B 3RFVA 1YBMA 1HT2E 3D6FA 3BXOA 4ZOEA 2QSJA 4ZVPA 3ZWXA 1EBBA 2XR0A 1CQXA 4D80A 4E5PA 2FW7A 1OPXA 1HLGA 2IU3A 4R1PA 1ZD2P 5B1IA 1C7EA 1HYHA 2EGGA 2X13A 3HLFA 4FDMA 3KJZA 4QUIA 2CMDA 1NI5A 3QNWA 3ROQA 4ZVRA 3FMFA 1T0BA 3B5JA 4P32A 4WK2B 3QUTA 1N0WA 3NDGA 5LKRA 3BE4A 2XA1A 4AJEA 1UBOS 2D4HA 1WOMA 3NNSA 1U9CA 2XNKA 2R6R1 4B3TB 1XTZA 1ONHA 2VA8A 3MYRA 5CVCA 3REGA 3B12A 4RK4A 1K92A 4FHCA 3GVBA 4OLFA 3RS0A 2JS7A 2O5EA 1QZ3A 4HJXA 2VT7A 1SZVA 1IN5A 3ZG8B 4WA8A 1BCSB 3NS7A 5DP1A 4KAJA 4RXMA 3GZ4A 1J97A 4MUJA 2GYYA 3LHKA 1ZH6A 5KOHA 4JYCA 5KWJA 4YS6A 1VRWA 4WOCA 3L8YA 3UPUA 1PD0A 2SCUB 5ALKA 3MEQA 4KQXA 4LGVA 1PEAA 3GNQA 3Q3IA 5T3UA 2V5AA 3SS7X 5HZHA 1P91A 2OB1A 3HZZA 1L7XA 1XDUA 3NIGB 4PHGA 2WGIA 4PWZA 5COBA 4GI5A 3ZXXA 1U2GC 2GCOA 2QRUA 4QGGA 5EGNA 2O7SA 4MQ5A 1TMYA 1K6JA 1PFVA 4JI6B 4IIEA 4R4JA 3FN4A 2V1ZA 3IEUA 4NRDA 3COWA 4FILA 3C7UA 1JECA 2HPVA 4NZ9A 3JVVA 1CQPA 3K1YA 4HNGA 3BRCA 3JD4A 2NUTA 2HBRA 3RUEA 3TB4A 3DZGA 1IXZA 1D2RA 1Z2AA 2AN1A 5HWVA 2WZCA 2Y93A 4JEUA 1SC1A 4BLQA 3TZEA 2IHNA 3I2JA 5A0VA 4I36A 3X1MA 1JHYA 5HIIA 3HM2A 2M2IA 3U9TA 2GHTA 3DBIA 4RGYA 5AM5A 3HVFA 2XTMA 4RF2A 3IHBA 3KQSA 3GTCA 1PZGA 4FFRA 4DCMA 4INZA 1GUAA 4IR7A 1VIDA 1BN6A 5FPPA 4DMMA 4BZQA 2XCIA 4TTJA 1CDEA 3RW9A 5IZCA 3L79A 3U4CA 4DIBA 4EVQA 3BB3A 1ZIDA 2TYSB 2YXDA 2VP5A 2BYTA 3TE8A 5D87A 2OCPA 4NDNE 2WF9A 2K4MA 4LXXA 4TS3A 3SEQA 4IBXA 3ZY4A 2XMPA 1TEVA 1NHGA 1LI7A 1XEFA 5C5IA 1A71A 5REQB 1HMYA 1QIGA 1FP1D 1G28A 3RANA 3PE4A 3RVMA 3A9WA 3W7AA 3KEFA 4LSMA 1LY1A 1O9HA 4O2BB 1UBSB 5AJYA 5JQGB 4JP8A 3WLJA 3T52A 4DPLA 4R9NA 2OLVA 2FQ1A 4PQYA 2HZ5A 1LSUA 1P5JA 2YASA 3M3PA 3R74A 3TN7A 5BOSA 4DM3A 3VI3B 1QYRA 5HZKA 3L01A 2IDKA 4NDZA 2XW6A 2JFQA 5DTEA 4B9EA 1VYTA 3QLTA 1RJWA 3WNCA 4Y98A 3FROA 4BFCA 5K7SA 2PX4A 1H42A 4FD8A 3C43A 1CR4A 4HADA 1AIPA 5KU1A 4WACA 3MFXA 3MTEA 4I55F 1ZL2A 4Z7OB 4LKOA 4TTVA 5DHUA 2H1FA 4K05A 4NABA 4FJ0A 3TLBA 4ZOQI 3U16A 3BRWD 5B2ZA 1R0SA 2BMFA 3SHVA 3KBOA 4CL8A 4Z4HA 3OTOB 3T5BA 3BK2A 3RNLA 3WQQA 1FTQA 1M8JA 2WU1A 4OTZA 2CV1A 1P18A 3L0ZA 1G5TA 4IUBS 4NCKA 3DAFA 4WMLA 4B4ZA 3AEKA 2PHYA 1F06A 3U3KA 1KQPA 3II6X 4J0FA 3NHLA 1OA1A 1HV8A 3F6YA 3NAMA 1RW4A 2LCIA 2Z2LB 4OEHA 2A9RA 2QM0A 4RPIA 2X8AA 3SMQA 4KTVE 4PM6A 1JTDA 3KVRA 4C3ZA 3R5HA 1SK8A 1U1FA 3B36A 2DSNA 1KBQA 4NYMQ 2OP1A 2GBIA 3E03A 4ZYXA 5KYKA 4RMIA 4XWYA 2MJ6A 3G0HA 1N9GB 3CNOA 1E9RA 4M1QA 2FPMA 5EIOA 2ZR9A 3A25A 3AB8A 2ZJ1A 5FEMA 3RAEC 4LJ5A 4D41A 3OHMA 2CJWA 5H16A 1T36B 2UZIR 3D0KA 1FP7A 4E2YA 4Y6LA 1PVVA 4C0HA 1SKQA 1JFLA 5AQAA 3NEYA 3BA1A 1HEIA 5TMDA 4PZAA 2IV3A 3ZDYB 1XPOA 4ZD6A 4U3TA 5EINA 2Y9MB 4JJ4A 5CEEA 1H9CA 1FUIA 4S1TA 2WDPA 3OPRA 2AKAB 1A5BB 3JWPA 3O92A 1E0DA 3EVEA 1HDCA 4GC9A 3BE5A 2PAFA 5DBEX 3S44A 4EK9A 2P9BA 1AKVA 3K35A 4KVGA 3DFZA 2IELA 2VWPA 3B42A 4MS4A 5HGJA 4DTCA 3L1UA 3OZAA 5A0FA 4G5GA 4RGQA 4RH1A 3ZDCA 4M1KA 1CLEA 1D2AA 3ZH9B 1FP4A 3O8QB 1SB9A 3HM9A 4MLCA 3CRVA 3FKSA 4HXGA 3L7MA 5DISB 4J1TA 4CF6A 4CKYA 2XZLA 3OOJA 1T8SA 4WXYB 2J67A 1MEOA 4HN9A 4P58A 4YJHA 1PGQA 3NYIA 2JKRI 3HKDA 2HHHB 3ELDA 2I8LA 3H4MA 3T1NA 3V97A 2Y0BA 3SVTA 3OBBA 3UWOA 2EJBA 4JXVA 5CDFE 3SR4A 3UN1A 3KHKA 1Q50A 2ZJ0A 2CZCA 4QO8A 2P2NA 1EXNA 1J25A 3V1LA 1Z36A 2NWQA 2GDZA 3BH0A 1UJ2A 4IKOA 2DR2A 5E1DA 3DVRX 5HZMA 1W4CA 1L5YA 1YK1A 3FHJA 1YJXA 3BMNA 3NP7A 1EWTA 4RD3A 4YCNA 3AY3A 4DDYA 1OC2A 3R44A 4RULA 2K5UA 2JW5A 2OOSA 3MWJA 1AKQA 1NP3A 1WU7A 1DRJA 1JH8A 1H3FA 1HTWA 2O06A 1MH1A 1ULSA 2RGNC 3EA0A 3MFQA 3NKVA 4PZDA 3IIEA 1ZH2A 1ONGA 4BGUA 4RV4A 5JXHA 2ZRHA 2YN0A 4DYVA 3ZV6A 1U94A 1KIMA 2E4XA 4ZO7A 1W5AA 3PX3A 5EE5B 1Z7YA 4O1IA 2VATA 1E4DA 2KBFA 1SKFA 4MARA 3SJ7A 1JT9A 4P5PA 4ZYUA 1VCHA 2ZTVA 4WV3A 5IU1A 1G1AA 1ZO8A 4OKIA 3S1AB 4A91A 4C87A 4OK3A 1BX1A 1ZRSA 2UDPA 5DEOA 4OHOA 2O7NA 2H0TA 1EJ2A 2D1TA 4WX2B 1CQWA 4FCWA 3N8LA 3CN7A 1OQAA 4LYDA 4H6XA 5DIZA 3WLEA 2CEKA 2W70A 3CIFA 4E1BA 3I52A 3U6KA 2BMDA 2VHWA 2XTJA 3VP2A 5CX4A 1KAOA 4P80A 1MVNA 4EPRA 4N8EA 4XX1A 3OQJA 1X9GA 3QPWA 4ZOAA 4B6OA 2XDQA 5J5VA 1K7FB 3N1UA 2R4QA 3NEAA 1I51A 4Y9SA 1AB6A 1GPJA 16PKA 2C77A 3PHHA 4JJEA 4A2CA 3TB6A 3GPDG 4BNJA 4DZTA 4F06A 1LI4A 1E0SA 4OKPA 3HVHA 4P1ZA 3TEJA 1TKBA 2YV3A 3HZOA 2C59A 1K08A 3H4VA 3WLFA 5J58A 2HT1A 3BLMA 2AR0A 2CK3A 3LF1A 1UKAA 5HF5A 1Q92A 1GQOA 1Q1GA 4HNAA 1NDHA 4IH4A 1VL2A 5ED0A 5BUCA 1N2JA 2ZDGA 4YJFA 3Q3VA 3R3SA 5H3CA 3V5NA 3ZWQA 5T64A 4YOFA 1EVKA 2V7VA 2X2FA 4Z9FA 2EF0A 4PYIA 2QQGA 2X5JO 2Z8YA 3G2LA 3UUGA 3ZCUA 2UKDA 3DBLB 3MT7A 1HNWB 5C31A 1KJWA 1JWPA 1ZXLA 2DLDA 3GJ5A 1ZYUA 3VH1A 3ZD9A 3HXMA 4DOMA 2JI8A 2P7IA 1YE3A 3JQGA 1MWRA 1T5HX 2Q21A 3WIUA 4IRUB 3AI3A 4IXMA 4BCCA 1XRRA 3KWFA 4GW9A 1JHAA 1B6GA 4XVHA 3EGEA 4BEVA 3FFBA 3Q5GA 4FYHA 4ZGWA 5AW3A 1MX5A 2QNIA 3KKKA 5CNIA 2VP3A 2P1DA 3OFKA 4UAJA 1XDGA 3IX8A 1HI9A 1B1CA 1WRBA 4P3OA 2ONYA 3HFSA 4KPUA 4ND2A 4TQUS 1JQEA 4X1KA 3DBRB 3KD3A 3B70A 3VSEA 4JI5B 3WK7A 1R15A 1D0VA 3DDHA 3E53A 1TA9A 2Q3MA 3HVKA 2QLFA 1A88A 3KBBA 3NBUA 4D3ZA 4R1LA 4M53A 1UWPX 1I4LD 3A26A 3PHYA 3ENKA 5T4BA 3GGSA 2PYRA 1V16B 1KJNA 1QTIA 4KXFB 5ENZA 2O2ZA 1MQ8B 3IDFA 3MOSA 4JL6A 4WBNF 5B6JA 1RPAA 1HR0B 2IFTA 3CR8A 5KZMB 1YK0A 1CQZA 3ECAA 3SXPA 1NWZA 4AMVA 1OZFA 5F1PA 2BOVA 3E35A 1XTRA 1JEDA 1GRCA 4LG1A 5CERA 1I9GA 3G0CA 3L7AA 1UJ6A 4FBGA 4Q03A 4M0LA 2IEBA 3AJ9A 3DZIA 3E5RA 3KJFA 3Q3GE 4I55B 2J3TC 3GUHA 4MQBA 1U7WA 1ZU5A 2JIBA 1HYEA 3K0FB 4IVNA 4RK6A 1R7RA 3MT8A 4WIAA 5KYXA 3ECSA 5EPEA 3PXGA 3B9BA 3ICQB 2DFVA 3WDSA 2L2QA 4B2YA 1PHRA 2B8NA 3PD1A 1IBMB 4G5RA 1C3LA 4AFIA 2ZAGA 1YDWA 2Q1SA 5G41A 4HUJA 4HDNA 1J23A 1D09A 1W2WB 1O54A 4JNCA 1CUHA 1EFKA 1VIMA 3P20A 3MKEA 3NUZA 2P9ZA 3IUQA 1NVVR 4FXOA 2OZVA 3IP8A 1E9SA 1IIBA 3U31A 1Y4SA 4HO1X 4WUTA 3WJAA 2ZM8A 4XLTA 2A5DA 2IHKA 3JZIA 1X1AA 1XIVA 1CBUA 1N6OA 1P6XA 2P7HA 2Z3ZA 3QW2A 4EBNA 5IAGA 3SC2A 1T9DA 4KDEA 3X1WA 2A4MA 3GRKA 3T94A 1N6IA 3T9FA 1PW7A 1OFUX 2VDKB 3F6SA 1YWGO 2WD7A 1TYBE 3WQSB 1ZCFA 1USKA 2YINC 5AKGA 1OR8A 4CG3A 2P1RA 4LTNA 3LD9A 5FUXA 1JEEA 2ZB4A 1AD2A 2QX6A 2BMAA 2PXAA 4LQ4A 1V4VA 4MS1B 2QVZX 4P93A 4DE5A 2IS6A 3QE0A 5DJUA 2CLFB 1J2YA 4QXQA 2OYCA 1JLLB 4B4UA 5DWVA 5BNTA 3OOVA 3BTUA 1QAOA 1OASA 2A30A 2XTNA 1QYCA 4KAXA 4ERXA 3LBHA 4J6FA 1Z4QA 4FLFA 4IVRA 1NM5C 9ATCA 5I7OA 1N9ZA 1AKNA 5FAXA 4BE7B 2XSZD 2VZEA 2B5RA 3NHMA 5CLGA 1H8YA 4ZQBA 2BUBA 4UCWA 1HSOA 1A4IA 5IVPA 3DL7A 2FPXA 3D5EA 5DNWA 3ZWPA 2SECE 3BD9A 3I01M 4UTOA 1L1EA 5BO5A 2ZTSA 5JMOA 1JHZA 2XLBA 1T1BA 3AG6A 3FWPA 4FFSA 3G3EA 4RZUA 2X0FA 4FNGA 3KQLA 2YMLA 1PNOA 1MOPA 1HLFA 1L4UA 3ICCA 4IXNA 4AJHA 1YQQA 4DSTA 4L02A 2XF8A 1PWYE 4DIOA 3DAPA 4O1HA 1GGFA 2YFQA 4IIDA 4L2IA 1HNNA 4XRRA 1KJQA 1P5HA 3N2KB 1DTEA 2A1UA 1J0EA 3RABA 5L3VA 4E46A 2EKPA 1NQAO 1UIRA 3IBYA 4EB6B 4ZCTA 1NV8A 1ITZA 3H9UA 4PZPA 3T1RA 1PZOA 3GROA 3QXHA 4HLNA 2PNJA 4BV3A 4OQYA 5I5GA 1AT1A 2W8BB 2QBYA 2RCXA 4XCQA 3MGAA 1CI8A 3DOHA 4IDBA 3PDUA 3OC2A 2ZSHA 3NXSA 5I4IA 1UPAA 3P9ZA 4DNPA 2ZJOA 3RRJA 4PF1A 3SVZA 4KR0A 1JN0A 4M89A 4P83A 2PMEA 1CKEA 4XUDA 4UM9B 3W5VA 5GLCA 4M1SA 4DDKA 4EG4A 1OWOA 3A7DA 3ACCA 2ZI4A 1SPXA 3IJ5A 4JGIA 2WABA 4MKHA 4B3IA 3CVOA 3VRHA 4EG0A 1O2DA 4R54A 2O2DA 2Q2QA 3B3QA 2UZ0A 3E5NA 3KR1A 3PQEA 2OFFA 4O4LA 1B6SA 2NN3C 3HY4A 5J4EA 2HZ7A 5HPIA 2PUCA 4E15A 5C1OA 3G0BA 3OPYA 3USCS 2JCGA 1X42A 2F1IA 1DHTA 1GAJA 4YRSA 1RVDA 3GYBA 3H1AA 3C4QA 3DFIA 4HG2A 4QULA 4R6XA 3IOEA 1V8PA 2XI4A 1PNEA 1NNLA 1V6AA 1NLUA 1ERQA 2XYVA 4WF0A 5EE9A 4UM9D 5DXFA 3BKWA 4YRZA 4ABTA 2JJMA 3R6DA 1Q0UA 4PRLA 3B3AA 1ABFA 1AKTA 4BNTA 4Z7JA 1K4FA 5KSCA 1TZKA 4I3IA 1C9NA 2GF2A 4L7VA 1TE2A 3V8NA 4ZU1X 2QLTA 3VKWA 4MRNA 3MELA 1YF3A 3NIAA 5F64A 1O1YA 1NBMD 1AGNA 3HJRA 4G4SO 2YS7A 2HFKA 3U6BA 3I61A 4QAJA 1OCEA 3LNTA 3QYPA 4N65A 2A2LA 4OLGA 1E20A 1I7NA 2GF0A 2I91A 4HFNA 1E63A 2Q3CA 1OKKD 4X7RA 5J4YA 5JSZA 4I3FA 4YFVA 4PLZA 2ZRBA 4OX9B 3N2IA 2NW6A 2G36A 5FDFA 1TECE 4CM4B 4YINA 3K0CC 4V0SA 3RBAA 1NQWA 3HRKA 1CJBA 2VZLA 3FJOA 3OA0A 5AP9A 4X60A 5FHRA 3TKLA 2Z9CA 1N6KA 1I2CA 3GX1A 1HLDA 3LUBA 3OJ0A 4LRSB 4MI1A 4BJHB 1JILA 1S2GA 1ORDA 3FNGA 2YV5A 4Z2AA 4TTQA 5EWLA 3FMIA 1DDIA 5T6MA 3MMNA 1S2DA 5AVUA 4GOND 2A0KA 3IOMA 1JHOA 2OM2A 4QGSA 1QFMA 2VSFA 4YMGA 4LK3A 1FNMA 1YS6A 2FSUA 3IPXA 3V48A 3G89A 1Z22A 3TRKA 1PJLA 2V5VA 4B88A 1Q15A 1RZVA 3E7FA 5D5PA 4DQUA 2FU5C 2BZGA 4X85A 1AHNA 5BNWA 4DRZA 1KZ4A 3ZE0B 3ENZA 1DV1A 3ZQ4A 4Q6BA 2CXNA 2MHCA 4AUEA 3PXPA 4DV1B 2A5YB 1V96A 3VMFA 4WE3A 1SCKA 4KN8A 3R76A 2EZTA 2J5RA 5KJEA 5GM1A 1E1RD 3FVRA 1NVXQ 3HCDA 3O8BA 4JU8A 3TIGA 3D2BA 4FDLA 4BNHA 5K0FA 3V1YA 2JLRA 1NQ5A 3V2UA 2EX6A 3MWYW 3F3YA 1G16A 2P79A 1KMCA 3QI7A 3UMBA 3SF8A 4A10A 1KEEA 5AI5A 1KS2A 3JQFA 3RC1A 3HN2A 1O94A 2W2NA 4OO3A 1ZP6A 2V7QD 3BIOA 1CYDA 4QB8A 3AGEA 3TG9A 5GLBA 1C8LA 2QVLA 1X7WB 2Z4SA 3NH6A 4S2OA 1MFPA 3CUVA 3TRCA 1CRWG 2J7PD 3M83A 4Q3AA 4IJMA 2CSXA 4O5OA 1IB0A 5JANA 2XF3A 1UFVA 1PLKA 3BGIA 4RK0A 4Z1OA 1FU4A 5J4VA 5JS7A 4R83A 1D2GA 4E08A 1WXHA 4NX2A 5IZ4A 1JZQA 1PR3A 4GS9A 3DYIA 4UUMA 2HJ9A 4MTLA 3RAGA 1G66A 3SKXA 3OOEA 3CVJA 3D7NA 5KIZA 2B5VA 3GFGA 2PD8A 5EOOA 1NW5A 5FORA 1TXGA 1RMYA 4MVYA 4LXIA 1C4WA 4YPOA 2JVKA 1D6NA 3RCBA 5KKCA 1K0FA 5EUQB 3UH0A 2IYLD 5HSGA 3LL7A 4O0PA 1F60A 1RI4A 3E2IA 1DIGA 1YFLA 3VPSA 1SXJE 3DSRA 3PHCA 1XMSA 4X97A 4FQ7A 4MBKA 2EG5A 1KERA 3PE6A 1I2SA 3PWTA 2N1MA 1G3UA 1Z0FA 2V9ZA 1ZVKA 4I5EA 4IICA 4O29A 3MGGA 3HLKA 2Y3IA 4F84A 2OV2A 4ARZA 4U7FA 3UT5B 1AKUA 1Y34E 3KKZA 5JQGF 5IKEA 3RG2A 4OVKA 3NTUA 5HE9A 1YVRA 4EG3A 3UO9A 2WJIA 4R1MA 1YOVB 1NP6A 5BN4B 3KYEA 4YHBA 1RLTA 3WA7A 1OU4A 1ZKDA 2O2EA 3SWWA 5JY6A 2QUIA 1GITA 4NXGA 4BMWA 3BHNA 5I9LA 1XU4A 4LYFA 5IJAA 4DNQA 4MKZA 2UZ4A 2VEOA 2Y67A 4L28A 1MC1A 5CJJA 2QTGA 5BV1A 2BFCB 1ND5A 3TIVA 1M7HA 2OMEA 3MXSA 2QT1A 2VKQA 3EVNA 4Q4JB 3T4UA 5H81A 4RIIA 1AN0A 1SQFA 2F3RA 4EITA 2XGNA 3QFFA 4CR8A 3DE5X 3HI6A 3CJTA 3EMBA 2AG0A 2B2NA 2EW1A 3TMAA 4DYDA 2DC1A 3BERA 1PV4A 2FDXA 4E32A 2XUAA 3OCZA 3ENNA 4TTRA 4IOMA 1RYEA 4BO7A 2ZQAA 1EFVB 3N6RA 4ZC1A 3RTYA 2OO5C 3Q8MA 1R5JA 4TX1A 4KQOA 1ULZA 3KC2A 3T4XA 5TQVA 4A8HA 1WA5A 2CW5A 5AVYA 1Y5NA 5E95A 2QL5A 4EDHA 3NB0A 3G0OA 4BBPA 5TPWB 4OLAA 1I3KA 4NCBA 2XMBA 4RH3A 1Q14A 1JU3A 3TM5A 1IULA 3EQZA 4S05A 1QRRA 3H1TA 1TAHA 3QE2A 4HVCA 2H1LA 3GLTA 3GQBA 2P4SA 1X1RA 3NC8A 4GPAA 4FFVA 2R8OA 2W6MA 1H6AA 3WNDA 2VYVA 2GZHA 1T6YA 1W1UA 3K5WA 4C0LA 1JIXA 4E5VA 3QHYA 1YJAA 2JD2A 2NUPB 2OILA 3OPLA 3HDHA 4IBOA 4LIPD 4MUXA 3NBKA 1TYZA 4P3YA 3BCHA 1II8A 4XWAA 4B75A 3FVVA 4H7PA 2EBFX 2JVIA 2W37A 3DT6A 1MT3A 4IGIA 2OV8A 4I8DA 1JQDA 2WZQA 2WQZA 5B1DA 4ER0A 1RHMA 1ULBA 4UU1A 5IVIA 4GT1A 4QGFA 5E2GA 1RMTA 4L4YA 4H3VA 5CIQA 2PMWB 5AD1A 2R6ZA 2H18A 3TPCA 1QC5A 4YTEA 5A4JA 1U11A 2VYVD 2RJOA 1G8AA 4PPRA 3H5OA 4EUVA 1PWEA 1XPJA 3PDIB 3T3NA 3U4MA 1CIJA 1OXXK 1BOFA 3DNMA 4B09A 2YX1A 3EW9A 5SYAA 1OH7A 1CI9A 2Y8HA 2IYUA 4EI8A 3B48A 5HKKA 1ZMTA 1DFGA 4LJ9A 4L0MA 4IJQA 3R4KA 3RF7A 1RC0A 3EIEA 1F14A 1Q74A 2YW2A 1WIWA 1A2BA 1GSVA 4XUCA 5CH5A 3I45A 3GMSA 3VR3D 1V1RB 4HGQA 4MMYB 1UM9B 3HBMA 3ZW9A 2IYOA 2QL7A 5K3AA 1FSWA 3E9NA 5A4IS 4KNWA 3EXIB 3PDIA 4E3LA 1X94A 3ILHA 2DWCA 5DGXA 5ESRA 3HP4A 1SVUA 1YGYA 3EGOA 3ELUA 4UMEA 3FNQA 4GXTA 2Q99A 3NOOA 3ZLUA 3IDSA 4OUDB 4XQCA 2P9QA 2YWJA 3CH6A 3IODA 1TZJA 1A3CA 2NT4A 2JLYA 1H8MA 1FX0B 3CYFA 3L1JA 3RF6A 1V8FA 4HDRB 2RGCA 1R0YA 4WKPA 1VG9B 3KYQA 3P9QA 3V3TA 4DV6B 1IXKA 3OKPA 3VC7A 2C7OA 3ORRA 5BSMA 2X5XA 4M46A 4TYQA 4LSZA 1N5JA 1ACLA 5IKOA 3TZHA 4URXR 5IS2A 3LA6A 4I9UA 3T7CA 2ZRAA 1PDVA 1SEPA 4MW1A 3UJ7A 5KYUB 1N5RA 4V0MA 4D9GA 3ICYA 1UZUA 2W42A 1AS3A 1FFHA 4NBRA 3D3EA 1QZUA 4CM7A 3AESA 3S8EA 5IC4A 4L9AA 4XX0B 3MR0A 1T6XA