3R7WB

Crystal structure of gtr1p-gtr2p complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
314
structure length
294
Chain Sequence
MVLLMGVRRCGKSSICKVVFHNMQPLDTLYLESTSNPSLEHFSTLIDLAVMELPGQLNYFEPSYDSERLFKSVGALVYVIDSQDEYINAITNLAMIIEYAYKVNPSINIEVLIHKVDGLSEDFKVDAQRDIMQRTGEELLELGLDGVQVSFYLTSIFDHSIYEAFSRIVQKLIPELSFLENMLDNLIQHSKIEKAFLFDVNSKIYVSTDSNPVDIQMYEVCSEFIDVTIDLFDLYKAELQNVSQLANGVIIYLRQMIRGLALVAIIRPNGTDMESCLTVADYNIDIFKKGLEDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Gtr1p-Gtr2p complex reveals new insights into the amino acid-induced TORC1 activation
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords GTP-binding protein GTR1
total genus 57
structure length 294
sequence length 314
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04670 Gtr1_RagA Gtr1/RagA G protein conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.190 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3r7wB02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r7wB01
3UKDA 4IVRA 4AG6A 4WXRA 1R0XA 4BZQA 1U8AA 1HH4A 5EP1A 3U61B 2K5UA 3SJBA 1P2TA 3NWJA 1OIXA 2J46A 4QHTA 2WIAA 4HDQB 4TLBA 1JR6A 1G3UA 1U2RA 1J8MF 4NCKA 2ZS7A 4QBGB 5EUQB 5JLJA 5BQ5A 4QJ4A 1CEEA 4CEHA 2BBSA 2Q9CA 4JT2A 2BBTA 5EXPA 1X3SA 4KBFA 1SKQA 3I72A 4IEEA 3FMPB 4G5GA 4V02A 4PFSA 2H8KA 3RLFA 4O25A 2FZLA 2GESA 1KJZA 2ZJ8A 1L7VC 3LBHA 4KFRA 4NP6A 4WW0A 3SHWA 2LKCA 2XB4A 1CR1A 3TUZC 1F2UA 4IXMA 3NC1C 1R6BX 4DLXA 1XB2A 1UKYA 4HUQB 2YZ2A 3IBGA 2ZQ5A 2OSBA 1ZBDA 4TTPA 1G4AE 4WVFA 3R20A 1H8HD 4IDHA 3EPLA 1MO3A 3TVDA 5DN6A 1G3QA 4PHTA 3MWJA 4R2IA 3L0OA 2JLXA 1SXJE 2RGEA 3N5CA 1NVUQ 4URZR 1KAOA 3WMEA 1W4AA 4LSGA 4DUGD 2P6UA 3SI7A 4HAVA 3GLFB 4PSAA 2OE2A 3CH5A 1OH7A 1OW3B 1MRSA 2CJWA 2C5LA 1WE2A 2P2LA 3ZDQA 5AJXA 4OHZA 3K0AA 4BASA 3O8CA 4LJAA 4D4JA 1AGPA 3EARA 1OXSC 3GFOA 3H0KA 3WXMA 4LYHA 1XCPA 2VP4A 4RD2A 4F4IA 3N2EA 3L82B 2DBYA 4DSNA 1XEXA 3TJZA 1XTSA 1Z0DA 4PO9A 4IEIA 2OXCA 1SULA 3U2QA 4LJ4A 2JLUA 3AVWA 4CW7A 3IO5A 5KUTA 3UPUA 4OI1A 4BQSA 3VKGA 2A7QA 1ZUHA 2NQ2C 5CIWA 1KK1A 4B35A 3SJCA 4E09A 2D62A 1NNEA 2ZYVX 4JS0A 4G5RA 3PJRA 2IHBA 5JWOA 1SGWA 1OKKD 5CLLA 2IC5A 5FBRB 3PEYA 1E1QA 3P27A 2W6ID 3CONA 3IDQA 1MO5A 3GCGA 2HXYA 4EPXA 1UAAA 4WZ6A 1GP2A 5HE8A 1IY2A 1YHNA 4AYXA 1HE8B 3MWLA 3C7KA 2D74A 2WMNB 4EKDA 621PA 2Q9AA 3CLVA 4NCIA 2VO1A 1J8YF 2FJUA 4B47A 4WBSA 1LY1A 2DCUA 4FCTA 4DCUA 1OPXA 4PPNA 1CRPA 3D6TB 2PMDA 1TEVA 3SC3A 1SXJA 1E4VA 1XNJA 1IN7A 1ZUNB 3FHCB 4PAQA 3LQQA 3SBDA 2FSGA 3GLGE 1PLLA 3U4QB 1GRQA 1CBUA 1XP8A 2ZUBA 1G8HA 1KMHB 2Z4SA 2BBOA 4GOXA 5IK2A 3R9IA 3X2SA 1G291 3SBEA 2EFEB 4BFZA 2IYQA 2PX3A 4OHVA 3RS0A 4US2R 1CR0A 1HYQA 5IT5A 1SVKA 1HQYE 2R6GA 4KHZA 1XU4A 2W2XA 4JBWA 2QE7D 2PBRA 2DFTA 5H1YA 1E6CA 1SXJD 3DOEA 4LV5B 1JALA 2FFBA 3LLUA 1R0ZA 1TU3A 2QMOA 5L3SB 3LWNA 4AKIA 4DWJA 1VCIA 2VLIA 1JECA 4PAOA 1HV8A 1B23P 1P2UA 4LBZA 3UWKA 3K9NA 3ZVMA 2EFGA 3VX4A 3MLEA 1IBRA 3UXMA 4DXAA 5FTLA 4I1OA 4Q18A 1QZXA 3KQKA 2FU5C 3QXSA 5BN3A 4I1UA 4BGDA 1E2JA 1Z3IX 3ZD6A 3FMOB 3QVUA 2CE7A 3IUYA 3T1QA 1KJYA 3TLXA 1GDDA 1XZQA 3X1DA 2XJ9A 4RZUA 4GI7A 1E2IA 1G17A 2J5XA 5DISB 4Z1MD 1E9BA 3ONWA 4XVUA 1XWIA 4FMCF 1VG1A 1ZC3A 2GETA 3BH7A 3PVSA 2GJKA 1IXRC 5E7MA 1JXMA 1IM2A 2ZI5A 4B3DA 4DCSA 1JPNA 3VAAA 1XPRA 1T3LA 1F2UB 1X8LA 2ZI3A 4BZPA 4DT1B 1FX0B 1VTKA 4BFVA 3WYGA 4N0DA 4B44A 2X2EA 4D2IA 2AKYA 5JHGB 2H17A 4XVRA 1YR8A 3CRRA 4V03A 2JJ8A 3C16C 2GVDC 2IK8A 5K8IA 4EPVA 2BM0A 4PC3A 2ORVA 3SYNA 4YXWD 3ZLJA 3B1YA 1NN5A 3EC1A 1GKUB 2JLZA 2IYRA 4LI0A 3PV0A 5CJPA 5TB5A 4C9BA 2VEDA 1O3YA 4ZKDA 4Z8XA 5H68A 4Q19A 1A4RA 2J9RA 2CCKA 1U0LA 3PUZA 1E98A 4E07A 2XB2A 2VHJA 1MOZA 2NO0A 2OILA 3OE7A 1E32A 2JLYA 2C78A 4OI0A 1UKEA 1F2TB 4LJ6A 4CYMA 3C8UA 2ZYUX 1SVWA 5E7IA 3KTAA 3K09A 1I4LD 3THXA 1XJ0A 2GJ9A 5AUOB 5IHPA 4L16A 4L5BA 4UXIA 3BB4A 1XXHA 5FUXA 2JIZD 4HAZA 2ZR7A 3GJ7A 2J7PA 4NKRA 2JCSA 1G7CA 2BJVA 2XTNA 3CO5A 3GFTA 1WRBA 1BO6A 2OZEA 3IIKA 4IJMA 4OYHA 4TL7A 4AD8A 2IEZA 3Q9LA 3GPLA 1K6MA 4DCTA 2B7CA 4TMVA 5J47A 2F1JA 3NTUA 2P65A 4IW3B 3I5XA 3U4QA 821PA 4CEIA 1T5LA 2J0QA 1N6IA 4DCNA 2I3BA 2JEOA 1ZU4A 4TQ9A 1SKYE 4B6EA 3THYA 4TLCA 1EFRA 2KWIA 3EX7C 4Q1AA 2XNSA 2YC2C 5BYJA 3UANA 4N0EA 3AV0B 3CNOA 4JBYA 1FNMA 1NP6A 1Z63A 4M1YA 3E2IA 1EX6A 2P67A 1HA3A 2PX0A 3V4FA 2GEUA 3OFNA 4NTZA 5FOXA 4TYPA 2VHUA 1W4BA 3AVPA 1GRRA 5EXTA 4EFLA 1Z47A 2CHVA 4NMMA 2R62A 3EZ9A 3LH5A 1IN5A 4MA4A 1RVDA 2QP3A 4D6PA 3I4LA 3E70C 5DHAA 1VHTA 2J45A 4ASUA 1CJUC 4ON9A 2FPLA 3C5HA 3A36A 4OQNA 4LHXA 2VP5A 4KI0A 4B73A 1GL7A 2AWNA 5HR5A 3M4YA 2XITA 1E4YA 3QPWA 5KOYA 1XD2A 2PT7A 2NO9A 4ZDIA 1Z2CA 1G5RA 5J4HA 2HEIA 5FOUA 3AKDA 4C30A 1M7HA 2OLKA 1EWQA 2VSOA 2DYKA 4X8HA 1BIFA 3H2YA 1NKSA 2EWVA 4WA7A 1AS0A 4BLRA 2IYVA 5CB6A 2BMFA 3K53A 4E5UA 4B75A 3QG5A 2ZVPX 3R9WA 3AM1A 1EX7A 3RS7A 1HT2E 1DAFA 3SYLA 1PV4A 3NC0C 4OL0A 3CUEF 2D4HA 1M6NA 2VHTA 3MRSA 3ADKA 4DHEA 2ZJOA 1EFHA 2ZS8A 4UNQA 4A6XA 3I62A 2N46A 1ELOA 3AVUA 4FXPA 4Q02A 4PPGA 1EFRD 5F3WB 1YJ5A 2QPTA 4LK2A 3NH6A 1MKYA 1IY0A 5FPHA 1BMFA 1ZCAA 4AKEA 3T06B 1TAGA 3VMFA 1KI7A 4DT1A 4Q7LA 3B9QA 1IN8A 2X19A 1JNYA 2WZQA 5B57C 4H1VA 2CVFA 2ERXA 3ICQB 2WWYA 2GHIA 4GBMA 5HE9A 2KE5A 3O8RA 3HR8A 4AG5A 3SQWA 2R2AA 5TY0A 1E2EA 4MGKR 4ZIRA 2GK6A 3SS8A 3BB1A 4B71A 1VG0B 1VYTA 2A5FA 2GKSA 4JBXA 4KSCA 2OCAA 4NCNA 1YRAA 3X1XA 1N3BA 1NIJA 3K70C 2GVZC 5J5CA 4E22A 2BC9A 3P32A 5FPTA 1VDZA 4QGAA 3TQCA 3TSWA 2QGNA 3ZQ6A 4NU0A 3CM0A 4B3CA 1TPZA 3QKTA 4K81B 5FOWA 5HCNA 2KBFA 3VU9B 4D4LA 2XOKA 4O2RA 4AYWA 4D81A 3QXJA 5DGXA 4DRZA 3GLGB 3LO5A 4TTRA 2D06A 3KKQA 4KBGA 4L8GA 3RS4A 1GUAA 4TMXA 3NBXX 1DBSA 4C7OA 4IFEA 1W49A 4A2QA 4U5XA 5IDVA 1G3IA 3Q5DA 5JEEA 4MDFA 4TYQA 2CVHA 1ZVQA 1R5BA 2ZRLA 3FKSA 4C3ZA 1E2HA 3ASYA 3TE6A 2B8WA 3AF0A 5LD2C 4NHOA 3BXZA 3L0SA 2FG5A 4M9ZA 4JLMA 5AUQA 2VP6A 1ZM3A 4ITRC 4ZV4A 4KXFB 4M4SA 3BBPA 4P4UA 4KVAA 3KFVA 4B2PA 3IO3A 3BB3A 5G41A 2JJ2A 1U94A 1TX4B 2ZYTX 1AQUA 3BJIC 1KGDA 2E1RA 2ZI4A 3GP8A 1I2MA 2OHFA 5IF9A 3ETLA 2A5GA 5C4MA 1R5OA 3HR7A 1QG4A 3O8BA 1TUEA 3LQRA 2HDNB 3TAHA 2REXB 1KIMA 2WWWA 3CKLA 3MD0A 1COWA 4JLOA 2QMUA 2IUUA 2VHCA 2XSZA 5KPJA 1S3GA 1KI1A 1D5CA 4Z1MA 5TARA 4BFUA 1UKZA 1GOTA 3ZGXA 3TIFA 4XIGS 3LD9A 1Z8FA 4QXAA 2A5DA 3ZS8A 2QROA 3U7GA 1DE0A 1YZKA 3MAAC 2ZRJA 3HP1A 3SEAA 2WHXA 3MJHA 4RY2A 3GJ4A 1NMYA 4Q9HA 5CLQA 5KNBA 3PUVA 3QUSA 4G5SA 3LVQE 4OQMA 1JEDA 1J90A 1K5GA 4D0LB 4OHXA 2QM8A 2Z83A 2DY1A 3CPEA 4C0QC 1XTRA 2IWRA 1YQTA 2CE2X 2ZI7A 2PT5A 3LX8A 5CYOA 1QHGA 3QKRB 4FMBB 4TWZA 1NLZA 3QF4A 4DCVA 1FUKA 5KNDA 1C9KA 3OEHA 2H16A 4MGYR 4PXAA 3AKYA 3FYHA 3RS3A 2V6JA 2G83A 4PX9A 3RYTC 2OAQ1 1NRJB 4FD2A 3OESA 2P5TB 3R7WA 2FPKA 1D9XA 2RGXA 2QTFA 3PUYA 2ZSFA 5DYIA 2V54A 1HEIA 3WMGA 4A92A 1AIPA 5CDFA 1KMQA 3KUDA 4M1KA 5JCPA 4A36A 4NDZA 4HDOB 4JJZA 3OZXA 1AKEA 1QG2A 1QHHB 1ZIOA 4US0R 2R44A 2CNWD 2Q6TA 1OXXK 4LX0A 4PC6A 2QM7A 4ZKEA 3OHMA 1AS2A 4ZPXA 1IN4A 4R71A 2G9NA 1ESNA 3A1UA 3QOFA 5KDDA 2CK3D 5JJIA 1GKYA 4NYIQ 2RH5A 4BRWA 4FWTA 1J2JA 3L43A 3KKPA 2XXAB 1FP7A 4PR0A 3VU9A 4B3BA 4UNRA 2GK7A 3CZQA 3TQFA 2IX3A 3AP2A 1D2NA 1WB9A 4Q4HA 2WWHA 1NBMD 1SVLA 2F7SA 2EWWA 2VH5R 1PJRA 4G0NA 3THYB 1C4OA 2L0XA 3MGCA 5JHHB 3A1SA 2RHMA 3VR6A 2ZJZA 3L8YA 2GJSA 3VR3A 4URYR 2C9YA 1LB1B 2ZJ5A 3FHTA 4JJKA 3NHBA 3LY5A 1OYWA 1N0VC 1RFLA 2EFCB 2OFWA 4UJ3A 2PLFA 1UF9A 5E4FA 4KO8A 4QM6A 4XWOA 2XTMA 1IONA 4UKDA 3AGPA 3B60A 3HYRA 3KUCA 4D0NA 1GL6A 1T3HA 3T35A 4JVSB 1U0JA 3CPHA 4QBHA 4PTLA 1RRCA 1F3OA 1G8FA 1CJKC 1RRPA 2WOJA 5KSPA 5TDHA 5TV2A 1NVWQ 4KSBA 4GOKA 4PZZA 2ASEA 3AF3A 3QEOA 4RKEA 3IEVA 3C4JA 3BS4A 4AI6A 5BXQC 2XGJA 2IL1A 4HLDA 4LYFA 3NDPA 3KXLA 1II0A 1VYVA 2JLVA 2VA8A 2EFHB 1G5TA 2RGCA 1N6HA 3CWZA 4DLVA 1EFCA 1OFHA 2YNMA 3GLHB 1ZNYA 2VPPA 1H8HA 3RWMB 1D2MA 3SNHA 4I1SA 2F43B 1KI8A 1QDEA 2C98A 3AKCA 4S2EA 1DPFA 2FA9A 2ZIAA 4KJZA 3W5IA 5G3YA 1E9FA 5DI3A 3B1XA 5FOTA 4B33A 3LXXA 3RANA 3V9PA 2PZEA 2ZITA 1P75A 1KDRA 2CBZA 1BOFA 4JVLA 2YWEA 4EPYA 2OG2A 4LHVA 3VR4A 2WOOA 1H65A 3MCAA 4ZI3A 1GSIA 1KSJA 3QF7A 2QMHA 2QBYA 2GCOB 1D2EA 1WMSA 1ZM9A 4BLOA 4UXHA 3TVTA 4M21A 3WY9A 2R6DA 2RAPA 4GSYA 2ODWA 4EAQA 1DADA 5EXXA 2NOAA 1Z6XA 2ZRCA 4QM7A 1EG7A 2C03A 3FB4A 1U98A 2ZAOA 2YVUA 3RNLA 1N5IA 5KPDA 1ODFA 2G3YA 4EJSA 1DOAA 2WV9A 4XH9B 3ND8A 3VNUA 1LV7A 4KYUA 4Y0AA 2PEYA 1NL3A 2ZE5A 5SZIA 3NEYA 4TQAA 1YRBA 2PJZA 4LPKA 3U6BA 1IAQA 1SZPA 1W4CA 1G19A 3KX2A 2CL0X 3R8CA 4PC7A 3JZMA 2YOGA 5FBQB 4EIWA 1Y3AA 1M1YE 2YC4C 1E0JA 1N6OA 2ZRBA 2ATXA 2FF7A 2J0UA 4QHYA 4BFXA 2YWFA 1HURA 5G3ZA 1E1QD 1RJ9B 3QXCA 4EUNA 1OKKA 4QNRA 1XPOA 1MABA 2OCBA 1FUUA 3CZPA 2FE4A 5CM9C 3PUXA 1ZUIA 5DSZA 3F8TA 3RRMA 3JVUA 5KTYA 4JLJA 5EQTA 2JLSA 2ZSDA 3IPYA 2OM2A 1IY1A 1ZJ6A 1QBKC 4PQFA 2YWGA 1II9A 3T15A 3QKSA 4CZ2A 4TL6A 2BCGY 5BWMA 1XJCA 3AF1A 3LXRA 2NZJA 3FOZA 2JASA 5FBWB 4R9UC 4URUR 4TSFD 4TLEA 3ZVNA 2YOFA 1D9ZA 1Z0AA 2F1HA 3CW2A 3LLMA 2F43A 3GJ6A 3NBFA 3QENA 3EPKA 3KL4A 2V4ZA 1X8JA 1H8EA 1JJ7A 1NJFA 3THOA 2WKQA 4QGGA 2QENA 1NSFA 2J59A 521PA 4Q9LA 2FWRA 1LF5A 4TYWA 3FKSD 4IOMA 4MH0R 4DDTA 4OI4A 1CJMA 1W1WA 1II8A 1AQYA 3N70A 4HB4A 2QZ4A 2VF7A 1TQ6A 2HJVA 3U3MA 2V7QD 1S9DA 1S4QA 3B82A 2E9SA 2BV3A 4TLAA 4M1SA 5BW8A 2OFXA 3B1ZA 1JEEA 2QP4A 2IS6A 4PAMA 1R0YA 4GP7A 3QPVA 5EE0A 1KKMA 4IVPA 4DSUA 4BPBA 3NIBA 1LS1A 3EW9A 4B3XA 4F7WA 2PH1A 1N5JA 1WBBA 1D6JA 1E96A 3T5DA 1HY3A 1RYHA 2EYUA 2R65A 2O8FB 2B21A 1JPJA 2DWPA 4YMVA 4F4CA 2QI9C 1MV5A 3E5HA 2IS4A 2BKEA 4DLRA 3WNCA 2GEVA 1QHSA 1R7RA 3FGNA 3DZ8A 2FSIA 2N1BA 4AYTA 1T0HB 4F93B 2REBA 3U60B 5FBVB 5EE1A 1Y63A 1ZAKA 4YONB 1LS6A 2GBLA 1VKJA 1XTKA 2YOHA 1NN0A 3W6OA 1E2KA 4JL8A 3QI2A 4OQLA 3GJ5A 1GG2A 1ZW6A 2AK3A 3BAFA 4MRSA 3QEJA 1BH2A 2BMEA 3GLHA 3EWSA 4IDNA 3A37A 4EPTA 2KI5A 5KSOA 1PZNA 2GF0A 4I81A 1CIPA 1S96A 2W83A 3BOSA 3GQBA 4KCGA 2IW3A 2ZXUA 4JLKA 1QF9A 4G3XA 5H8WA 2WWIA 1YR7A 1G7SA 1HUQA 4V0KA 2BBWA 2J0VA 2HUPA 2VF8A 5TMPA 4A9AA 4U7DA 3E1SA 5KSZA 4GOJA 2PLRA 1KTVA 4PHGA 3X1ZA 1OH8A 4OHYA 3QXXA 2ZRDA 1TUIA 1G20E 4QJ3A 2V1UA 2OV2A 2TMKA 2YINC 4RSGA 3ASZA 3SU8A 2CLSA 4FMDF 1FW6A 5K8TA 4Q00A 1DS6A 3LX5A 4V0LA 4KV9A 4PQRA 2ZANA 1OH5A 1RC8A 2IT1A 1F60A 4C2UA 4KFUA 3WYFA 4GP6A 1NKTA 3K0EA 4YMTA 1X1RA 3Q7PA 4Z8YA 5F9HA 1PUJA 1E0KA 1KI3A 4TT3D 1GAJA 3QQ5A 3HU1A 3W90A 2HV8A 4U02A 5J4KA 1OB5A 4RZXA 2WSMA 4XJXA 4QRHA 2RCNA 2CLCX 2UKDA 2DB3A 1T0JB 4FI3C 3ADCA 2BMJA 1I4DD 2Z5FA 4RKFA 2HLDA 1YKSA 5JS7A 1OFIA 2HYIC 2QQEA 4Q4AA 5HKKA 3BFKA 3K9HA 3ADDA 3SDZA 1JQLB 1CRQA 3QJYA 5DI3B 5JCZA 2FDCA 4TZ6A 1ZNWA 1G5PA 1P2SA 1P61B 3KTAB 4Q1DA 1XPUA 3DZDA 1AZSC 2MMGA 2GA8A 4MDEA 2IF2A 1ESMA 1Q1QA 1R8SA 3CF0A 4QBIA 4TL8A 2PZFA 1OXTA 1NVXQ 3TBKA 4JKIA 4N3NA 4ILEA 3WP1B 1YVDA 2G1KA 2IYYA 1FL9A 4M9SA 5JI3E 1IN6A 3N2IA 4O2LA 2A3RA 1DAMA 1Z28A 2Q21A 3KKOA 1BYIA 1U8YA 3U3KA 3W9YA 4II7A 1XCMA 4KVGA 4YDHB 1E2QA 4B76A 4HAWA 1JR3D 2CEAA 3PCRB 1DTSA 3PIRA 4IOLA 3CRW1 3AH8A 5TXGA 3SQXA 4PC1A 2YWHA 1EFTA 4Q1CA 1W0KA 1KDOA 5KYKA 2G6BA 2EVWX 4KITB 2J7PD 4WOPA 2IXEA 3DMDA 1DELA 2JIZA 3FVQA 2ECKA 1OIWA 4JYCA 2QRZA 2IS1A 4P33A 1NVVR 4GDFA 4Q48A 2GAAA 1Z0IA 4RCYA 1VMAA 1KO1A 2EYQA 2VRWA 1GRNA 1K8RA 3T1OA 5LDDC 1F6BA 3VQTA 2NIPA 3UMRA 4QJ5A 3OE7D 3IKJA 4WZBE 2A2ZA 1RE0A 2HCJB 4L15A 4Q7JB 4B2LA 2I1QA 1HQCA 4DIEA 1FMJA 1U90A 1E1RD 1CS4C 5B30A 2IXGA 1LF0A 3P1JA 4Q4LA 4OQFA 5JWRA 4Q9KA 4HDCA 3H1TA 4TL9A 1ONBA 2GXQA 3DMNA 4LC0A 1FP6A 4QNMA 2E87A 3X1WA 2FNAA 1KO8A 3IQXA 4YXWA 2NG1A 1AN0A 2V8OA 3U7FB 4TN1A 4LBWA 3B1VA 2QTVB 4Q4JA 2XZPA 2RKOA 2X1VA 3SOPA 3UIEA 1HT1E 4DSOA 3LAWA 4PHHA 2RGBA 1A1VA 2ZRFA 4BFYA 1HTWA 3PENA 3RRNA 2IYSA 1UKVY 2GCPA 3LW8A 2QAJA 1UM8A 2XNDA 2F55A 1OJLA 4DLZA 2GZDA 1J99A 4RZ2A 2R8RA 1SVSA 1XZPA 3NH9A 3ZD7A 3KFXA 1RJ9A 4BLTA 2NO1A 2JLQA 2JLWA 3CRVA 3SFVA 4KLZA 4JLBA 4CT5A 4TZ0A 1E2FA 4GZMA 1E69A 4ZDWA 3I61A 3UATA 3TSZA 2RGGA 2YHSA 2OESA 4URVR 1ZMXA 4W5WA 3SYKA 3T61A 1N6LA 1T6NA 2F6RA 2QN6A 2ZJYA 1AK2A 1D8TA 1ZNXA 4ABYA 5JMTA 3BFVA 4A8JA 3B9PA 2MSEB 2ZUCA 2FFAA 1CKEA 5GJCA 2DHRA 2GJ8A 2GRJA 4ERNA 5JJKA 4NCJA 1IJEA 3GLFE 1S1CA 721PA 2IYWA 5JSZA 1FX0A 4K8OA 1M2OB 1U9IC 2FPMA 2ORWA 4GZLA 5JEDA 1JR3A 3LRPA 3CIOA 1DAIA 1IOZA 1TU4A 3GLHE 2QE7A 1M8PA 1XD2B 2YV5A 3KQNA 3DDCA 1OV4A 2VSXA 3TGPA 1MO4A 3RVBA 3ZQJA 3SN6A 5JJLA 2C95A 1ZC4A 3W3AA 1P60A 3BRWD 3OIYA 3UG7A 4F92B 3ZZTA 3I1FA 4JYBA 4RD0A 2GWHA 4YMSA 2IUSA 4XTRA 1N6NA 4C0JA 4IXNA 3AP1A 1SVMA 4MGZR 4JMPA 4M9XA 1R4AA 4PQYA 5GVRA 1IQPA 4B6FA 1AKYA 3QY0A 2DWQA 3X1YA 3H86A 5GJVC 4PPFA 3T1VA 1AGRA 4M2LA 3QKSB 1KI4A 3EA0A 2QMEA 3HDTA 4HZUB 4M8NE 2Z6VA 3CF6R 1G1MA 1KK0A 1Q1BA 3EIEA 4FCVA 5GVSA 3I8SA 1JQJC 3PUWA 2B8TA 3PG5A 3MG9A 3TUIC 4C0BA 1K5DA 1M74A 1MABB 4X8MA 2R6FA 2B92A 421PA 2O8FA 2O8CA 2Q0HA 1N2CE 5E95A 2OO7A 1Z07A 2F3RA 2FH5B 2P6NA 1G6OA 3BGWA 4H9GA 3I3SR 2QY9A 2ZM5A 4ZDJA 4QC2A 1L8QA 2R6CA 5DH9A 2JDID 5EZ6B 3U7EB 6Q21A 2PL3A 2ONJA 3VKWA 4DLWA 1KYIA 2W58A 2ODEA 3CH4B 4MRVA 1IXSB 3U3JA 3NKVA 3AKEA 4BLQA 3I92A 4QOSA 5EXSA 3KJGA 3SJZA 5JZVA 5P21A 2ZSEA 1U8ZA 5AK0A 3UWOA 1ZM2A 1ZRHA 3WMFA 2EFDB 4IHQA 1Z22A 2I1VB 5HPYB 1J7KA 2GBLC 1XMSA 3QKUA 4NBSA 1UFQA 4XVQA 3RRZA 1Z0KA 2EW1A 4CRWB 4HUTA 4TMWA 3WNBA 1Q57A 1L4YA 3FKQA 4GMXA 3TR5A 4JSTA 4LYJA 1OSNA 3LFUA 1N0UA 2H18A 4RFSA 3W6PA 2W6JA 2BEKA 5KDLA 2IS2A 1WF3A 4HAYA 3G0HA 1KO5A 5CYPA 1A2KC 3REGA 3F3YA 3K9LA 5A5GA 3VX3A 1M7GA 1L2TA 1MT0A 1VCOA 4LHWA 5UKDA 5CM8B 2BMDA 3VHLB 4HI0E 1OFUX 4UJ5A 1OYYA 3FE2A 4D4KA 1A5TA 3HU2A 3NBYC 1JAIA 4Q1BA 2WAYA 2V1XA 2O8EA 3UMSA 1KDPA 2YKGA 4Q4JB 3FTQA 3LW7A 4NZYA 5FL7A 3D31A 1G6HA 3WP0A 1NN1A 2VBCA 5DN6D 1T4GA 2C77A 3WNDA 3R7WB 2NO7A 5JS8A 4IDQA 1LVGA 2WJIA 1YZTA 1R0WA 1CLUA 3DM5A 4JIMA 3A6PC 5CITA 1R8QA 3WYAA 5ELXA 2QAGA 1SQ5A 3QPUA 2GAOA 2NPIA 5L3RA 4Q7KA 2BVNA 4NYMQ 2SHKA 2H5EA 4LJ7A 1US8B 3W34A 1RRFA 3EZ2A 2G77B 4Y0VA 3CR7A 2CHGA 5FBLB 4FCWA 4C0HA 4CEIB 3U44A 5SZJA 1Q44A 4KLNA 4I4LA 1AJEA 1MRNA 3QKRA 1AM4D 3EG5A 4BECA 1OE0A 1TNDA 2AR7A 4X8OA 2RGNC 2QSYA 3RC3A 2ZRMA 4XSGA 5DNYB 2A78A 5FUVA 5KDOA 3VNVA 4GL2A 3CBQA 3CX7A 1W5TA 2JA1A 2GTPA 2EU8A 3IIMA 4M1TA 1WA5A 4POAA 4QBFA 4A1FA 2XZOA 1M7BA 3LBNA 2J1LA 4OQXA 4B32A 2AN9A 1G9XA 1QVRA 2D7CA 4LJYA 2ZI9A 4DIDA 5HKKD 4XD7A 3RWOA 3SFZA 4Q5IA 3W8NA 4DKXA 1G8YA 3BERA 2HLDD 4DVGA 5D3QA 1SHZA 1JR3E 3GJ0A 1KSFX 2HT1A 2C8VA 2OCYC 4OK6A 4O0MA 3TMKA 3ND9A 2WPDA 1CULC 1CXZA 4F38A 1QHYA 4EJSC 3QNUA 1NLYA 4ASUD 3FDIA 4LV8B 2C96A 1N6PA 2BCJQ 4HLUA 3Q5EA 4P32A 3RS2A 2Z43A 3IHLA 5CIQA 1GZSA 1VCMA 4MITA 1E79A 1CJVC 2ZR0A 2QA5A 1TQ2A 1BS1A 1S3SA 3T5GA 2WWFA 4C0KA 1QHHA 3HWSA 4BFSA 1YZUA 2CL6X 2OAP1 5BN4A 2ZRGA 2XX3A 3TRFA 3GD7A 3U6KA 2CCGA 3VHXA 1W47A 5LD2B 2W00A 1GNQA 3IQWA 3W5JA 3LVRE 3M6AA 2X77A 2V55B 4L9WA 3K0CA 4Q1FA 1DEKA 3CRQA 2ZRAA 5BN5A 1CP2A 1SVIA 2XTZA 2OBLA 3QXHA 2MSDB 3RAPR 5B58C 3RSOA 5D3MA 5C1BA 1KHTA 4R98A 4ZCLA 5HCIA 4DEXA 2QBYB 4TYNA 2RGNA 1XXHE 4PZLA 4QGFA 3BH0A 1TQ4A 1GKIA 4CEHB 1G64A 2RGDA 1UEIA 4GRAA 2HF9A 1I2DA 3I32A 4UNPA 1VPLA 4FINA 3UK6A 1Q0UA 3QBVA 3BORA 2DWOA 1O87A 5LBIA 4ZCMA 2R6AA 2XEXA 1PUIA 3NEJA 1FQKA 2ONKA 4I1VA 3CRMA 2YYZA 3CX8A 3FFAA 3OEEA 4MYCA 4A4DA 1T9HA 5AJVB 3V00A 2CMKA 4TTQA 5G53C 3S1AA 4L9SA 2CDNA 2QRNA 4RFVA 1UDXA 3B1WA 1P73A 1VYUA 1UDWA 4M53A 5DO9A 4YC7A 3RC8A 4RD1A 5DHFA 1Q21A 5FL7D 4ACBA 1E2MA 2JGNA 2GXAA 2IYUA 3BE4A 4TMTA 4BE7B 4CGZA 4B3GA 1KK2A 1YR9A 4OBEA 1S8FA 3KZ1E 1ETUA 2DFNA 4BZXA 5L3VA 1RRGA 2ANBA 1E9EA 2V3CC 5JFGA 1P7CA 5C2JB 4GPTA 4QG7A 2VP2A 5JRZA 3QIAA 4ARZB 4BEJA 1E9AA 1NI3A 3DPUA 2QG6A 4ZO4A 3A1WA 1GFIA 4LHYA 3KQLA 5B2ZA 1W5SA 5FR1A 1E0AA 4EFNA 3AGQA 4ZDKA 1TMKA 2J87A 2CCJA 3PR1A 3AQ4A 4KYIB 2GCOA 3AVXA 1RZ3A 1OHHD 1E2PA 4HZUA 1W36C 3ICEA 2D2EA 4S35A 1NLFA 3SHFA 5F2EA 2XZLA 3GJXC 2ZRHA 5K8LA 2ZRIA 1KKLA 1T91A 2FN4A 1W0JA 2ZEJA 4FWIB 3DL0A 2FZ4A 4PZYA 1NY5A 1XX6A 2ZU6A 1S0UA 3TK1A 2Q3HA 2WIBA 1E9CA 1E9RA 1UJ2A 4LDJA 4P3YA 5AJYA 1TADA 3SZRA 1Z83A 1SKYB 4D4MA 5SZHB 1UBEA 2XNDD 4P4SA 5G40A 4DLTA 1G18A 4NYMR 2CK3A 2N42A 4KODA 1Q1EA 5LPNA 4A8JB 3IILA 5FTKA 1WBDA 1GM5A 4HB3A 1ZM7A 2LKDA 3I8XA 4B2IA 4QFMA 2AD1A 2ZUDA 4US1R 3DOFA 1MR3F 3K0FB 3KXIA 1ZINA 5ANRB 4BFWA 1AZTA 5J4VA 4JKYA 2WICA 2AD5A 2HCBA 3A4MA 3NG1A 1AA9A 4M1WA 5CDFE 4OI2A 3REFA 3K0SA 1RKBA 2ERYA 4IRUB 4EQ6A 5FPSA 4UNSA 3IHWA 1A7JA 1G8PA 2ZI6A 5EZ5A 4MGIR 5C18A 1YU9A 2QU8A 2FFHA 3KJIA 4C2TA 3IPXA 1P2VA 1W46A 4KFSA 1FNNA 2HF8A 4D82A 4AWXA 2ZSAA 2BIFA 2NGRA 2JAQA 3P26A 3L8ZA 4V0MA 2H57A 1AS3A 2FEMA 1ZIPA 1MO6A 3Q3JB 2WJYA 1P3JA 3FMIA 4LV6A 4R2HA 1Q22A 2OCPA 1KJWA 2LWIA 4JL6A 2Z4RA 2XXAA 1NF3A 2FGJA 1M34E 1N5LA 1UBFA 3QG1A 4FIDA 1GNPA 2ZS9A 4JLAA 2J0SA 1GITA 4DBLC 4RZ3A 2RB4A 1R5NA 2JLRA 1RIFA 3OIWA 1U99A 2ZROA 1DARA 5EP4A 3T12A 5JECA 2NO6A 1V43A 5FPYA 3LDAA 3AF4A 4LYAA 5GJWC 5LB2A 3KB1A 3OEED 3ZVRA 4ESVA 4Q7MB 1WP9A 4K46A 3ZH9B 1XTIA 1XEXB 3K1JA 5LB4A 1UBCA 5AUNB 5FTMA 4G01B 4NH0A 5AUPB 1P5ZB 4N1AA 4MKGA 1E99A 1G16A 4HB2A 3HJNA 2HYDA 2IF0A 1TEXA 1WXQA 4FMDB 3RDPA 2XSZD 1COWD 2W2VA 1XMJA 2ATVA 5DLQC 4KFTA 2ODBA 5EUMA 1XFAA 2P0EA 1XD9A 3S1AB 5GADl 2ANCA 4Z54A 2O8DA 1EGAA 4P31A 3B6EA 4CIDA 4EJSB 5FOSA 5J40A 3Q72A 4MRRA 1E3MA 3RABA 1CR4A 3H84A 2W2TA 2VTKA 2QAGC 3GLIB 3KJHA 3QVVA 4MRPA 4UQOA 3B8HA 3CNLA 4DUGA 1II8B 3EAQA 5GJBA 2EQBA 4LCBA 3VR1A 4BUJA 1IXZA 3MMPA 3T34A 1RYFA 2C99A 3BWDD 1HE1C 3A58B 1OB2A 2WWGA 4JL5A 4M1OA 2MSCB 1Z0JA 1W0JD 1CTQA 2ZJ2A 3GMTA 1G3RA 1XTJA 4NE2A 1QHIA 4NL4H 4LUCA 3U3OA 4AKHA 1QHXA 3BFXA 4MYTA 1W48A 4QKQA 3U3RA 3Q8XB 4RCZA 5L8VA 1Q20A 4Q4AB 121PA 1VCNA 1CJTC 1P72A 2JJ1A 3A4NA 3HPRA 4C4PA 5F98A 2W0MA 4BLSA 1N5KA 1G7RA 2DFLA 4MQBA 4XWAA 1N6KA 2IXFA 4HB0A 4BRUA 1DO0A 1KSHA 2ZE7A 1P9NA 2IYXA 2QP9X 4XD7D 3OAAA 1E9SA 5FTNA 1US8A 2A5YB 1X1SA 4MKFA 1W0KD 2FGKA 1GNRA 4EPWA 5FL3A 1KMHA 5JWHA 4GNKA 3U44B 4PO1A 1VG9B 2VSFA 4P0TA 3PITA 2X2FA 1QVAA 4LBVA 2AFHE 3H4MA 2J0UB 3D8BA 1X6VA 1G21E 5CK5A 2A30A 1EFUA 1BMFD 5FR2A 1SHKA 3K9GA 2VP9A 2ZSBA 2R9VA 2QL6A 1LTQA 1TL7C 2QT1A 5EP3A 1ZU5A 2JATA 1P6XA 2O8BB 4C0AC 2O8EB 3IEUA 1CR2A 1JXOA 1Q12A 3V4RA 1Q3TA 2BJWA 4C7OB 1FTSA 4RJLA 2G88A 2WKRA 3G5UA 5FH9A 3A1VA 1KZGB 4MYUA 3ZVLA 1OH6A 1DVRA 1JB1A 2D2FA 4KAXA 1KY2A 2WSSA 2QUZA 2IA5A 3B5JA 2OLJA 3FMFA 2F9LA 3KXKA 1F2TA 1GL9B 4PSKA 4YLGA 2O8DB 4LRWA 4YDSA 5A4JA 2G1JA 1LNZA 2WBLC 4WAUA 4XTCS 3U7HB 1LFDB 3THXB 1DAEA 1VIAA 2XAUA 3D3QA 1G41A 1R2QA 1P9RA 2H92A 4YMUA 4ZIRB 1XDBA 3LA6A 4CF7A 3OIVA 4CDGA 2G0NA 4NCHA 4TMKA 2QEQA 1XMIA 3ECCA 4GT1A 1P62B 4OK5A 5CJ2A 1XEWX 4YMWA 2ZRNA 5TVKA 2C9CA 1UEJA 1EESA 3THWB 3EZFA 4B34A 4PO8A 2QGZA 1KDTA 4TT3A 3ADBA 2WKPA 1QHNA 3LBIA 3GJ8A 3QBTA 4A8JC 3GLGA 1WCV1 4OJKA 4A0RA 2VYFA 4NYJR 1DAHA 1ANKA 1KO7A 1KY3A 4Z51A 2W6JD 2GILA 3MFYA 4MYHA 4RD3A 4RD4A 5KHOC 4Q66C 3U5ZB 2Z0MA 3C15C 1KI9A 4LZZA 1YZNA 3W3ZB 5L3QB 4TSFA 3AVYA 4LJ9A 5DI9A 1DO2A 2FX3A 3ZJYA 3GFPA 2PMKA 4MUBA 1F5NA 4RD6A 2J7KA 3TR0A 2WMOB 4MKIA 3VKHA 2D3WA 2GDJA 1OT3A 1ZD8A 2MMCA 3GLIA 3EPJA 1EXMA 1TTTA 4AC9A 1P9WA 2ZRKA 2WM9B 3EASA 1VECA 2ZRPA 2W0SA 4DJTA 2XOKD 4KU4A 3RRYA 1IJFA 5J4YA 2A5JA 1FZQA 4Q9JA 3HPQA 2WPDD 3W6NA 5FOVA 2C9OA 4LJ8A 3BK7A 2ZVQX 2Q9BA 2AFIE 3L0IB 1A2BA 1KI2A 2JDIA 3B7GA 5JBQA 1JBKA 2ZJAA 2VQSA 1XCGB 1EK0A 3O8DA 5F9FA 2VHQA 4D26A 1G3MA 3NXSA 5AWFC 2QTHA 4AURA 3KKNA 3KJEA 2ZU0C 4URXR 3AVTA 3VFDA 1W7AA 1VIYA 2QT0A 3WRYC 4XWKA 1PLKA 4V0OA 2PZGA 4B74A 3P4XA 3FWYA 2ZJBA 1BKDR 1XJQA 1Z6TA 3Q7QA 2BEJA 4DDWA 2GJAA 2V9PA 4XSHA 2B6HA 2OBMA 2F9MA 2P5SA 3B2EA 5M04A 5JSZB 2CL7X 2GNOA 4TQUS 2WSSD 3OIUA 4Q01A 2FOLA 1JAHA 2REOA 3EZ6A 4IDOA 5DYGA 5HZKA 1MH1A 2PJRA 3EPHA 2WVJA 3LNCA 4WZAE 4EQ6B 4EPRA 1NBME 8OHMA 1FMLA 4DEYA 1NMXA 1S9HA 2PCLA 1GWNA 1W4RA 4FMCB 4JVNA 1NG9A 3RSLA 4A82A 3A4LA 2O8BA 3R8FA 1FTNA 2G0TA 1NN3A 4RVCA 2RGAA 4IOKA 1T8TA 1KK3A 3W8RA 1G7TA 4HLQB 4X8LA 4BLPA 2BKUA 2PCJA 3BH6A 1XTQA 4DSTA 2HJGA 1ZYUA 3SR0A 3OAAD 4ESHA 2DR3A 1YZQA 4M0LA 1OF1A 2GXUA 4LHZA 5FI0B 4UXJA 4A0HA 2JJ1D 2O52A 2LCFA 2OUKA 4HUQA 4QGHA 2GZAA 2IBMA 5DIFA 4AK9A 2IEYA 4F91B 3KQUA 1G4UR 3NVAA 2O8CB 2I4IA 4CEJA 1VG8A 4IDPA 4DB2A 2WAXA 1T5IA 3IGFA 5A0FA 3GEEA 4A2WA 4OHWA 4LOAA 5EE5B 4ZCIA 4CVNA 2OFOA 2XJ4A 3CR8A 2P3SA 4DC9A 2HXSA 3HYTA 2BOVA 4M9QA 5K8UA 1JJVA 3B13B 2WJVA 3J81k 1IHUA 4I99A 3QE0A 2ZYWX 1OLOA 2VIIA 3K8YA 4IVQA 4PC2A 4JLVA 5HZHA 1E0SA 2IYLD 4AKGA 4MUAA 2CJWB 4EDHA 1FOEB 2RMKA 1N25A 4GMDA 5KU1A 2DFKB 5JI2E 3VTKA 1T3SA 4Q21A 1WDTA 2H7VA 3K0AB 1X86B 3KKMA 4Q03A 2GF9A 4HAUA 4XOIA 3K70D 3GLIE 2NPFA 1NBMA 1YR6A 5EE9A 1W36D 3K70B 3ZIAA 4QHSA 2ZETA 221PA 1X8KA 1YE8A 1Z08A 4W7SA 2X8AA 2QSZA 5FTJA 2HT6A 4A0FA 3GEHA 3FPAA 4FW9A 3GJ3A 5DE3A 3G82C 4H1UA 3A1TA 1KI6B 2GEDA 2QORA 4LC1A 3AVQA 2ZE6A 3ZZ0A 5J4LA 5FUWA 2GCNA 3UG6A 4C0SA 1Z5ZA 2O0KA 1XEWY 2RHDA 1G8GA 3TNFA 2AKAB 1DAGA 5FI1B 2CNWA 2AL7A 2BWJA 1Q1ZA 1ZD1A 2Q3MA 3TAUA 5IK2D 5JRJA 2UVQA 2BDTA 4LGMA 3M1IA 4PHFA 3WBJA 1OXUA 4LBYA 4DZZA 3EXAA 1ZP6A 1XRJA 3PEWA 1KAGA 3FFBA 4A2PA 1W36B 3I73A 5H70A 1PVOA 1E2GA 3GEIA 3NBZC 2KSQA 4P4TA 3EZ7A 3BIFA 4JLNA 2PEZA 4BEBA 4ZI2A 4LPSA 4TLDA 4IOJA 4HEJA 4D80A 2IYZA 3KB2A 3C41J 3MUFA 2C2HA 4DLSA 3OEHD 2NTYC 3PFIA 2QNRA 2ORIA 2VP0A 2W6IA 4GFDA 1KNXA 2GXSA 2GZHA 4MRNA 5CK4A 4Q4HB 2AK2A 4HAXA 3QSYA 3IIJA 1QRAA 1U0HC 2V6IA 4WIAA 1BYUA 1DAKA 4A15A 2FMXA 3AEZA 3L2OB 1KNQA 3DM9B 3DHWC 2UZIR 2IUTA 3ZIAD 2WJJA 4Q9IA 2O5VA 1NVVQ 5FFMA 2FSHA 2QQ0A 1TF7A 3DO6A 4Q47A 2WJGA 1U81A 2QAGB 5E3HA 1S2MA 1F48A 4DLUA 4V0ME 4IFBA 3TW8B 2FEOA 4V0NA 5AJWA 1GVNB 3AVVA 1KZ7B 3P4YA 4RFSB 1GIAA 3JVVA 1L4UA 3DEFA 1GILA 2FFQA 1NY6A 2KJQA 1XD8A 4NYJQ 2BM1A 3CX6A 4D0GA 3RS5A 2H1LA 4JLPA 1FQJA 4CT4B 2DPXA 4BWYA 5BYKA 5C46F 3C14C 4OKSA 3R9XA 4F4JA 3EIQA 5IRCD 3I5YA 1E2LA 1Z06A 2QPOA 4R7ZA 1FFHA 1WQ1R 1RW4A 1PLJA 4G5OA 4LWZA 4B3FX 3O47A 3AUYA 2IWHA 1DG1G 1NJGA 3KDSE 3TKLA 1NMZA 3AUXA 3NDBB 2ZE8A 2ZPTX 5C4GB 3PEVA 1TF5A 2JJ2D 3UMFA 1TQDA 4PSVA 3SE0A 4HLUC 4WXPA 3IBYA 2F1RA 2C04A 1Z29A 2NMVA 1XBTA 1E2NA 1NG1A 2IHYA 2ODNA 1OHHA 3CB4A 2O0HA 4NYIR 2UZ3A 1YZGA 3EIHA 1U9IA 1OXVA 1YZLA 2OXRA 5HTKA 3DKVA 4M1MA 2Q3FA 4CEJB 5KNCA 3Q85A 1N0WA 1E9DA 2FSFA 3CNNA 4TMZA 1Z6GA 3NHAA 3F5FA 2OT3B 1E1RA 1P4SA 4W5HA 1KSGA 3BC1A 4M22A 3WRXC 1V5WA 4MKHA 3HU3A 4EFMA 3AVOA 4O3MA 3DKPA 3WBKA 5FUYA 3TSOA 4YQFA 4Q1EA 3TUJC 1LW7A 1FPMA 5D3MB 4E03A 2B7BA 2F3TA 2AWOA 3P20A 4NPHA 1UPTA 3ZZUA 3K0CC 4HSEA 2AHOA 3PEUA 4JZKA 1OIVA 3K09C 5E7JA 2D7DA 3AF2A 3CWQA 1C1YA 1NSTA 4JVMA 3THWA 1KOFA 1XMVA 1DG3A 4LY6A 3BD9A 4AIIA 2IYTA 2WWXA 3SJAA 5KSYA 2CHQA 3GLFA 3JZAA 4ACAA 3M0EA 1N6RA 2NZ8A 1SVOA 1VHLA 5FPKA 4UNNA 5EJEA 3MSXA 4DB4A 2AXNA 4AY2A 2YJTD 3ZYCA 2ZTSA 5EE3A 1B0UA 4QL3A 5L3QA 3ZS9A 4LJ5A 1XF9A 1KI6A 1SXJB 4DDUA 3QF4B 4JSYA 1ZM4A 4JLDA 1RPZA 5KO2A 3D7MA 5CB8A 2P6RA 3MWKA 4C0LA 4TYYA 3A8TA 1J70A 1UBGA 2V7QA 4B43A 3B78A 4HYYA 2ZAMA 1R10A 4PPQA 5AJZA 3EWAA 4L4UA 4PANA 3T1TA 1Z2AA 3CF2A 3C5CA 4P4SB 2FV8A 1UADA 3VR5A 1XXHB 2OEPA 2QPAA 1TF2A 2F1IA 2WJHA 3AB3A 4G5QA 1ZD9A 4OJQA 2BHRA 3RHFA 4DDVA 1H8ED 1OFTA 1W2HA 2A9KA 2J3EA 5B64A 5L3SA 1NIPA 3B85A 1Z0FA 1Z6YA 1E2DA 4A6PA 1GTVA 4J0QA 2CXXA 2OBNA 4HLCA 4HZIA 3WHKA 1Q3HA 4D25A 3KQHA 4URWR 1E94E 2VL7A 2AXPA 2ZR9A 1A82A 3DVLA 1E79D 4OK3A 1CF4A 4B48A 3AP3A 3TW4A 2WTUA 1ZNZA 2CLDX 4ARZA 1KO4A 1CU1A 1Z6AA 3PXGA 4DLYA 3F0TA 1W2GA 1T8UA 3FHOA 3MJRA 4BFTA 3WHLA 1SXJC 1JI0A 1ZCBA 5EP2A 5SZKB 2KBEA 2KB0A 3EA5A 3PQCA 3VR2A 3TH5A 4G1UC 1I4TD 2O0JA 3OFND 1S1MA 4FN5A 4NONA 3MWYW 5AR1A 3L0PA 2Y8EA 1XEFA 1W44A 3K0FA 4U00A 2ZREA 3CPJB 4IKEA 1EWRA 3LV8A 2AX4A 3EC2A 4JT4A 4A0GA 4HATA 4W5JA 3OF5A 4W9MC 2J41A
chains in the Genus database with same CATH superfamily
1LU9A 2J32A 2DBRA 3FNQA 4HRVA 3W2GA 8ABPA 2XKBA 1U8AA 2OLEA 5EP1A 2K5UA 4DM7A 3NBQA 5J2UB 1HT0A 3WGOA 4EBNA 3NWJA 1OIXA 5A02A 2PY6A 5AIBA 4UCQA 2QOEA 2J46A 3NHLA 1F0KA 3ZWDA 4CHGA 3JASA 1CRLA 2WIAA 4NECA 1JR6A 2B02A 1J8MF 1GQSA 2ZS7A 3GV0A 3D5QA 3H99A 4BO3A 4D74A 5JLJA 4YO8A 2OWEA 3PAGA 1C1HA 5LDHA 3R5SA 3IF5A 1SN7A 5EJAA 1N9OA 4N3GA 2V5UA 2FUKA 2QU7A 3N8NA 3PGXA 4MJLA 4B82A 4AJ2A 2CUNA 2FP3A 3Q0IA 1QQAA 3M4XA 1ZR2A 3D0KA 3QYJA 1J9GA 1GUFA 3HEBA 4NABA 3FMPB 3PGVA 4ZVSA 3OPYA 4G5GA 2H8KA 5KNCD 4ESEA 5DJ5A 2VF5X 4J29A 1I3KA 2PYPA 5DEIA 4B7ZA 4KFRA 1O89A 3VH1A 3DHVA 1LLFA 1CR1A 2I6GA 2WMDA 1LC3A 3NC1C 2C4VA 3H9GA 1XB2A 2EARA 4IXMA 4DLXA 1OH5A 3E4CA 5CP8A 1N2XA 2ZQ5A 1OTIA 3R20A 1LVUA 4IDHA 1ECLA 3MPUA 5DN6A 4PHTA 3LUPA 3MMNA 4ENTA 2HR1A 3UN1A 2I87A 3MWJA 3L0OA 1SZCA 3AUAA 3PHHA 3GMWA 5EUAA 1FRVA 5HJ7A 1L5VA 2V59A 4BQQA 3T9AA 4TXJA 1EQUA 1UJ5A 3N5CA 3OECA 1IUOA 1VLVA 1WXFA 1RJDA 3W8EA 2ZT6A 2OO3A 3ZGVA 3UT0A 2B20A 5BOVA 1TJPB 2E8JA 3SI7A 4PSAA 4EY4A 1OH7A 1RT9A 3D2BA 4BX2A 3TD6A 4B3SB 5EIBC 3O3OB 3FMGA 2CJWA 4YN3A 1CZRA 1B1AA 5K3BA 5IHXA 1ODVA 3QP6A 4QUHA 4JODA 4W6QA 3DNFA 1RAIA 3RSFA 4BASA 3O8CA 4U63A 2NW6A 3UE0A 3VI3B 2FWBA 3HBJA 3O88A 1WXIA 4EVQA 3GFOA 4ZANA 5TMPA 2CF6A 4NK5A 2XF8A 4OLAA 3IA7A 4BMNA 4NPAA 1L7QA 3K3CA 3DZIA 5EIWA 3TTVA 2G5TA 5D87A 3K4HA 2Q3LA 4ND8B 2EF0A 4IEIA 2HV1A 3HLCA 3U2QA 1D6NA 1SWVA 3SX0A 1ABBA 2FE1A 5F82A 5KZMB 1SIBE 4AO6A 1NXPA 5GZ1A 4QGBA 3MLBA 2INGX 1SG9A 3IVGA 3KZCA 4TRRA 5CDHA 1JQEA 2A7QA 2NQ2C 4MDHA 5BWOA 4PYKA 4RVOA 3LI2A 5HRCA 5F6AA 5ENZA 2ONYA 5FV7A 1E3WA 2IOFK 2JS7A 3OSZA 3OOJA 5KQMA 1M1NB 3BICA 5IM5A 4U7PB 4AX4A 3PJRA 5CLLA 3F9IA 3PEYA 4MUJA 3P27A 5EPUA 4MWEA 1YPRA 3C4OA 4WTOA 4HAIA 1MO5A 1U0NA 1JTGA 2M6RA 3C7KA 4FYJA 2R79A 3D3JA 3WK4A 4BNYA 2Q9AA 3F1KA 4L6IA 3KDPA 2YX1A 2VO1A 1CEGA 2OP0A 3K2BA 1D1QA 1J8YF 1L1RA 1I30A 1NFQA 2QL9A 4Q9NA 5HFJA 4DW8A 4CTKA 1TYEB 1QP7A 4CUKA 4OH7A 4GD8A 1LH0A 2DWCA 2FR8C 1TEVA 4JLWA 3O9ZA 4FYYA 5PGMA 5AVWA 1H2EA 3L0DA 5HBGA 3SC4A 1GYPA 3JQFC 3I0ZA 5IS1A 4CQLA 3WC4A 1YB7A 2C4UA 1ZUNB 2G17A 3FHCB 3A0RB 3LQQA 1TPYA 4MV9A 4ENWA 4QDOA 2W71A 1PLLA 4KDRA 4J4HA 4DV3B 1GRQA 3NT4A 3CH7A 2Z4SA 3R9IA 4J3FA 3B89A 5I51A 4C30A 4RAOA 4UW9A 4C43A 4BFZA 2IYQA 2ODPA 2PX3A 3K73O 5B12A 1QRUA 2XB9A 3A70A 4US2R 4G0XA 4MBKA 3DFIA 3H3FA 3ETJA 3VSLA 1SU6A 3GLTA 3X1MA 1YRLA 4ZI5A 4Q0IA 4BQRA 1OLXB 3Q07A 1SVKA 2R6GA 4DIOA 2X13A 4V2IA 3NYQA 1ZMTA 4KHZA 4LI3X 3SYMA 5FWNA 5TMBA 5HUJA 3GA5A 2WSYB 4JQSA 4DA8A 1D0VA 2UU9B 2Z2LB 3SEQA 4ARCA 2QE7D 4L76A 3HUOA 1MX5A 2DFTA 3D1VA 4JGRA 4U6QA 2A5LA 2VT3A 4EG7A 3ZG7B 1BH6A 2YKFA 2ZCUA 1T6BY 4L8VA 3G2QA 4M7RA 4E5KA 2CY0A 3E4PA 1JECA 3UWMA 4HJ3A 3S29A 4YRRA 1WCIA 1P2UA 5G1PA 3TX6A 5CDUA 2W6OA 4HNBA 3GI1A 1VSUA 2JI7A 2Q46A 3K9NA 5ERGB 1UP6A 4YJ3F 1IBRA 3UXMA 5GHYA 3ANSA 1P5RA 5KWJA 3WK8A 4CLCA 1DRUA 1FK8A 1CZNA 3FHLA 4Y9DA 2XAAA 4Q18A 3UC9A 3UQZA 4YAGA 2FU5C 3FCUB 3LFVA 3WNVA 5E8RA 4UCWA 3QXSA 5BN3A 4I1UA 1L0FA 4FDUA 4NG2A 2WU1A 1E2JA 4UAGA 1F8FA 2VHXA 1KAMA 3ZD6A 3JQGB 3IUYA 5JZSA 2TECE 5DTSA 2PMBA 2W2OA 3G5TA 1TYDE 2X58A 4ZALA 3TLXA 1GDDA 4D9HA 1Q3KA 3X1DA 2XJ9A 1WX1A 1FW8A 1J2RA 2NM0A 4GI7A 1LSJA 5DISB 4E08A 4D79A 4Z1MD 1ZITA 1YRHA 2I78A 2Q5CA 3ONWA 3ND7A 4I50B 5DI9A 1XWIA 5EIHA 3DCYA 3H1GA 1VG1A 3L8GA 2HUNA 1ZC3A 3E61A 5FFFA 3BH7A 3VAYA 4K26A 2COEA 2IVZA 4R0QA 1PGQA 1W1UA 2HRZA 3MLAA 1EVQA 3UT5B 3HJAA 1Z5NA 1E7RA 3PBSA 1WXGA 1OLSB 1L1EA 1FP4A 2X22A 3L77A 5KVQA 3L6UA 1XPRA 5HMLA 3RS3A 1PSDA 4BJ6A 1I9CA 4B93A 1FFXB 3IT1A 4BFVA 4NZZA 3PHLA 1R6UA 4W1RA 3RAFC 1P7WA 2E5WA 3D4FA 2J07A 2X2EA 1PJQA 1DBPA 3FCSB 2AKYA 1JWPA 3MAGA 5JHGB 5J2TB 2H17A 4WK2B 2Q9MA 1IAVA 1WV1A 1NNUA 3D7NA 3P0RA 4JKOA 1SC4A 3C16C 3C87A 3OD1A 5K8IA 1GXSA 1WYCA 3ICOA 3HZHA 5KC8A 1IJBA 2QRGA 2FN8A 3L6DA 1OI7A 4ZAZA 3RRFA 1NN5A 1WB5A 3SYNA 1M5RA 4L4SA 3P9SA 2VAXA 3TLZA 3A1EA 1PTJC 3ZXYA 4R1NA 3FPWA 1V9CA 3UMJA 2J9RA 2J9ZB 2VRCA 1KVMA 1Q17A 2ZCVA 3KUKA 1J9MA 1RMTA 1JBQA 1U0LA 1MWTA 1EUZA 3ZFZA 1TIBA 1GZHB 3DP7A 4WASA 4E07A 1W85B 1ES5A 2AFVA 1N5DA 4RGQA 4BBJA 2CJPA 3JARB 3MFXA 4N01A 4UEKA 1ZVVA 5K5BA 3OLVA 3F98A 1Z09A 1QPGA 2ZYIA 3L5KA 4LCEA 1T43A 2L0WA 5GHZA 1B8PA 2B8EA 4LJ6A 3RU9A 2X2PA 5LYJA 2VEAA 1SDNA 1SVWA 3EFHA 3OM9A 1XRRA 4INOA 5E7IA 2IJGX 4Y5FA 2MTBA 4UATA 2EP5A 2J9OA 3K09A 2WEKA 2GJ9A 1PE0A 4IFIA 3MUEA 4GLLA 3B53X 3VSEA 1UWCA 4F04A 2XVAA 2JGRA 3ICCA 5A7HA 4UXIA 5JU6A 1SWWA 2GM4A 2VV7A 2AMLA 1N8SA 1KP3A 2I62A 1FB5A 1ZL0A 2FR8A 1X38A 2R1TB 3GJQA 3O7WA 3WIDA 3LUDA 4C6TA 1GPDG 3G1WA 2Q49A 2ZYRA 1QKIA 2BJVA 1CFJA 2XTNA 3PFWO 4CDRA 4IIHA 2OZEA 3IIKA 3JWIA 4TL7A 5J58A 4J1TC 4AD8A 5JXIA 1H1LA 3UHJA 5J43A 1XP5A 4S2UA 1IRIA 3D9YA 1ZD4A 3H4VA 4H3HB 2NUPC 1NURA 5AJGA 3NWBA 3R3UA 4TMVA 2B0CA 3NOTC 2X4LA 3DEYX 5E6RA 2FJ0A 3DV2A 4EF5A 4X65B 3T9BA 9LDBA 4CEIA 4LRTB 4KQ2A 4C21A 4IIUA 4YCDA 1CIJA 3QLTA 5FDFA 5D7NA 1CZLA 1ZU4A 1ZCZA 2A24A 4IDGA 4MNTA 3GEDA 4W6ZA 5CLGA 1NU6A 3T38A 3TM5A 1XJ5A 4NXFA 1QF7A 2QSUA 3PT9A 5JAHA 3EX7C 2GEFA 1GVHA 5A5DA 3ZWXA 5HPFA 1JJBA 4CJXA 4CKWA 3TLEA 1EAMA 2CKDA 1FNMA 1T5OA 1MW8X 3SE7A 1UQUA 3CNHA 3RTCA 1WNTA 2D01A 3E2KA 1B1CA 3C7VA 1OCEA 3IAXA 2H29A 4OPRA 2P67A 2Y4AA 1Y6JA 2H1OA 2AEFA 1EK1A 2Y1LA 3WWCA 1WA9A 5B1HA 3NI9A 4MMNA 3OKAA 2VHUA 3FSGA 1DBQA 3D3KA 4WN9B 3G7UA 1VBFA 4HOIA 3FRIA 3LH5A 3OLQA 4FX5A 3M33A 4YRLA 4D9JA 1RVDA 1LPMA 1X70A 2VUTA 4LTNA 4D6PA 4NCXA 1JZQA 5TPWA 5CVTA 3EXG1 1PGOA 4KXXA 4RY0A 1PK9A 3OLYA 4LDRA 1CJUC 3CPSA 2IIVA 2FPLA 2WD8A 4ON9A 1L0DA 4U7WA 3OICA 2R48A 5LOVF 3C5HA 3A36A 4HMPA 1IXKA 3HWX1 5EHNA 3T4JA 9LDTA 3T4TA 5HDSA 2A88A 2LRHA 4OMFG 5HR5A 4KMMA 5FO0A 2NXJA 1Z4NA 5AW4A 5KOYA 5JH7F 2NU8A 1TZCA 1YR1A 2PUFA 1Z2CA 2BFWA 1T9AA 1L7NA 2AMJA 3H9CA 5FOUA 1ISGA 3AKDA 4XLZA 3SOZA 1YOVA 3V8PA 3U80A 4UU1A 3PXXA 1REQA 4MIYA 3RIXA 3QOWA 3S5JA 2GH1A 3QOXA 4YHBA 2IQIA 3AXTA 3GARA 3MT9A 4DN6A 1ZLYA 5C8YF 2IYVA 3NUGA 2LCQA 1RGZA 2XLNA 1M33A 1RLIA 2I9PA 3HZRA 3SICE 2ZVPX 5AXAA 1EX7A 1Q6YA 2JZCA 2PV7A 3OWOA 4J91A 4RXTA 1T35A 3C3PA 5EPHA 3NM6B 2QW1A 3OZEA 4IIJB 4RZSA 4C6TB 2VPZA 3NC0C 4PYOA 4ZJUA 4JJEA 2R9WA 4LF6B 3HXMA 3ZBTA 5JAUA 2YY5A 1EWYA 2ZJOA 1CY2A 1A97A 1CRZA 1XTTA 4A6XA 3P71T 5FUQA 3WLMA 2JFHA 3T4PA 4WELA 4LRXA 4WK4B 4KWTA 4N9QA 4IXWA 1SZDA 2JHFA 3FLAA 4PPGA 3WVNA 1EFRD 5F3WB 1RBYA 1YJ5A 3QBEA 4MRSA 4ZYVA 3NH6A 3P7NA 1MKYA 2HAEA 3I6MA 1IY0A 2Y2GA 2XCOA 5FPHA 4EHIA 2VUUA 1ZCAA 3EEIA 3T06B 4LNHA 2V9AA 2H2WA 3UMCA 1M6VA 3G2LA 3O0TA 4HX2A 3RC9A 1PT9A 3ADCA 2X19A 1VJDA 1XDWA 2LTAA 4Z3KA 2Q2NA 1H2RS 4H1VA 1Z56C 2NZVG 3IQHX 1EFAA 3ICQB 4PNEA 3F90A 1JSLA 4GBMA 1AQJA 1ADYA 1KGEA 2KE5A 4AZWA 2I71A 3R0QA 4F2GA 3HR8A 3HB1A 2R2AA 4L28A 1H4TA 4OAQA 2RC6A 1V9YA 2P74A 2GK6A 2O14A 4UBJA 1CQPA 1QZTA 1DAPA 3SS8A 3TO5A 1G63A 3GDHA 5H7XA 4RXMA 2VQEB 3X1XA 1BXZA 3CLKA 3FR8A 3E53A 1J42A 1NIJA 2G09A 3EQ2A 3L5OA 4FZ5A 5B53A 3ZCSA 1M76A 3FRJA 5J5CA 2AQIA 2BC9A 3P32A 3UO9A 3PTZA 1VDZA 2W22A 3VOTA 3LIIA 4PN7A 1AKNA 3ZYZA 4K81B 4D4LA 4EHLA 2XNHA 1TZMA 1WIWA 1V41E 3NNDA 4DRYA 3MQ0A 1GPMA 1DGQA 5DGXA 2X3FA 3VPSA 3GLGB 3W5CA 1IBMB 3TWOA 2NT4A 2Z2IA 3H7WA 1XTBA 3PGA1 1HNZB 1GUAA 3FSRA 4LOJA 5HS6A 3A6DA 5KTNA 2O5EA 1XAGA 1QE0A 5IDVA 4PM7A 3VAZA 1XN1A 3BLMA 5EFWA 2C3MA 4UBMA 2CVHA 2ZRLA 1R5BA 3A28A 3UMDA 3FKSA 1RJEA 1MAAA 2Y1GA 1BEZA 2CV1A 3LY9A 3EPRA 2CWDA 3TE6A 2B8WA 4Y18A 5LZ2A 2Q1UA 5KX5B 3HJTA 1GPUA 1YJ8A 3COWA 5DYWA 5AUQA 4PXSA 3RAJA 5JD6A 1XMXA 4ITRC 16PKA 4JXKA 2ZJFA 4EYEA 5ALFA 1PFYA 2DFDA 4GOOD 3BBPA 2HK7A 4B2IA 4BVEA 3KFVA 1QVWA 3BFCA 1EP2B 2EA9A 4QQFA 3SCZA 3BB3A 3WDSA 2J08A 1XJ2A 4Y98A 4OP8A 1AQUA 1VPVA 1M2GA 2FH5A 1OGIA 3LIBA 2WINI 4UTOA 4B2YA 2JH9A 4HNAB 3IDOA 2A5GA 3RKRA 4CQMB 5C4MA 3B20A 4EEZA 1TUEA 4I55F 4YJ2A 5H81A 3WWOA 2UV0E 1DWUA 1A5AB 4TROA 1FQGA 2REXB 3U49A 4UTRA 4JLOA 4AN0A 4YLYA 3IE0A 1Z18A 2NU9A 2YCBA 4MW6A 5KPJA 5IMBA 5K0ZA 1KI1A 3VFHA 1D5CA 4AUEA 5KX5F 4K6CA 4HXGA 5TARA 5L9AA 4RTSA 1OZGA 4PSDA 4JI3B 1VE3A 1NLUA 3LD9A 4YH1A 4K9NA 2M1XA 4IVKA 3DMYA 1ESUA 4K2HA 4PLPA 5JTUA 1DE0A 2PHYA 2LD4A 2WA1A 3DOCA 1OJ7A 2D0OB 2QLNA 3BHIA 1EGVB 2PSFA 2YQZA 3JQ8A 3KOUA 4K28A 4CM9A 3TNYA 1ENOA 1HYGA 1H42A 3SEAA 3MJHA 4P82A 2FXVA 1C7EA 5CHJA 4A8TA 4BNXA 2UUOA 4NE9A 5E4TA 3RROA 1YVEI 5F83A 4TXNA 5DHRA 4WBNF 1MC5A 3HTXA 2WKHA 5L8MA 4JF6A 1X87A 3PUVA 1CUDA 5IARA 5HQ3B 5E2FA 1RIIA 3A2NA 2PXHA 3EQZA 4KWCA 1J90A 4OQMA 4XJSA 3T7JA 3VR6H 3WLEA 4YX9A 1WB4A 2DY1A 2ZQAA 4C0QC 1AURA 1QH0A 1YQTA 1WSDA 1LV8A 2CE2X 1X7YB 4J90A 2V8CA 5ALDA 5I7SA 1QHGA 1KETA 4HP8A 4DPMA 1RHQA 3ITBA 2J0EA 3QF4A 1H2WA 2Y2JA 3A25A 3DB1A 5BYBA 3WWPA 4DCVA 3OE1A 1C9KA 4HLNA 5THQA 4GX0A 2MWMA 1ZI8A 4PN3A 3PU6A 4MGYR 2XXBA 1M66A 1AQLA 4EW1A 1ULSA 3K92A 4P7BA 1PJLA 1NU8A 1VE5A 4MHSA 4O5AA 4XFKA 3RRBA 1YA6A 2WD7B 3OZFA 1IIBA 3ESRA 1H8YA 1ZC2A 4QTZA 4B79A 2F2TA 1GA0A 4FD2A 2B82A 3OESA 4FYKA 4WBNB 1EWTA 1N57A 3PUYA 1ZK3A 3UHAA 4A92A 4LNAA 5DHTA 4Q3BA 1AIPA 3FNIA 1KMQA 4MRAA 4LCLA 3E1GA 4DXHA 4YRGA 2PM8A 1YR2A 2Q2OA 4LIPD 4JXXA 1T2CA 3IQIX 5HPIA 1OT5A 3GO4A 3TPFA 4EW6A 1GPYA 2BHLA 3FOCA 5BY2A 3OC6A 5DNDA 4IZ6A 3HEMA 4NDZA 1V3UA 4JJZA 2BLNA 1GRCA 4UM7A 1ESEA 4LRYC 1QHHB 2B1RA 3PHCA 3DMHA 4HRYA 2R44A 2CNWD 3C7AA 4Z4FA 3L8MA 5FQKA 1GTL1 5CBKA 1KDWA 1E3IA 5AQBA 2PMFA 3VU1A 5FOQA 5KYUB 3MVEA 1FNDA 1RM3A 4OAOA 4K91A 1U0RA 2YNMD 1ESNA 4ZA2A 2G9NA 3A1UA 3LT2A 3PNKA 3QOFA 5DF7A 3T7DA 3T3NA 2CK3D 5JJIA 2VAVA 4FWTA 2F00A 3L7YA 1J2JA 4EMSA 3GWZA 3L43A 4AJLA 1NX6A 3KRTA 1QYVA 2FF5A 3CZQA 1XCBA 3DE5X 3TQFA 2IX3A 4PM8A 1PS9A 3EZGA 1IVSA 3K2NA 3WZ2A 1UBLS 4QOEA 4Q4HA 4RHTA 2WWHA 2DJIA 1NBMD 1UEXC 1SVLA 3EOZA 2K2NA 1P97A 1U9ZA 2MSWA 4G8JA 2BFBB 3MM4A 3LK7A 4GSKA 1E5QA 5JYEA 4F8YA 2R4UA 3JYNA 5JHHB 3A1SA 3G2IA 4J07A 3OPQA 1D6MA 3VR3A 1Y8AA 4FFNA 4URYR 2NQTA 1NV8A 4AY3A 4B8YA 3NPAA 4CKWB 1LB1B 1E60A 4CN9A 3NHBA 1KFKB 3K72B 3LY5A 5EJ9A 1V8DA 1JXQA 3QMVA 2W2LA 4MS1A 2PYIA 2RAVA 1PVDA 2EFCB 2OFWA 4UJ3A 3FDFA 4BX8A 3HYNA 3MGBA 5E4FA 5H4GA 3PC2A 5KVAA 2HQRA 2XTMA 2JGLA 4UKDA 1FS5A 1YDGA 2Z57A 4YCJA 1GPKA 2YN2A 1MFZA 1ES2A 3MWGA 3BKWA 5IDXA 4QU5A 1IEVA 3IP7A 4F9TA 5BO5A 3O95A 1CJKC 1RRPA 1UL1X 1SD1A 1BWQA 2WOJA 3FPCA 1AX9A 3OF3A 2O5RA 4OGLA 3VSDA 2AEEA 4NJMA 2V1AA 2DUNA 3VM6A 1V39A 4MVJE 4PZZA 2ASEA 3AF3A 1G2PA 1IK6A 4RA9B 3UQYS 2P4SA 5JV5A 4AI6A 4D8WA 4DZRA 2ZTLA 4RVUA 2PUCA 1VXRA 3HYCA 4HLDA 3MMXA 4LYFA 3U5ZB 1Y5MA 2R8YA 4DLVA 5ALKA 3WLQA 1XRQA 5DT9A 5J7EA 1AGXA 1HE5A 4BBVA 1K06A 1D2MA 1O54A 4BN5A 4PYJA 3SNHA 1UMKA 1KI8A 1KYXA 3EB9A 2RI1A 2Z3VA 2IDMA 5AM2A 3ZDDA 2FA9A 1J2UA 2EX1A 4QREA 4JGGA 4AQYB 4QRDA 2ZTVA 3VR5H 4QPZA 3AERB 5E6UA 1A4XA 3DEJA 3UDXA 5FOTA 1FFBA 5ECYA 1ORWA 4WI1A 3RANA 2PUJA 1HDOA 2PZEA 1XFQA 1K7YA 3DP9A 3QK7A 4WCFC 4KQEA 1SB9A 1HYHA 3ELWA 2YWEA 4CF3A 3WGNA 3T4LA 1H65A 5BPHA 3MCAA 6AT1A 4WWHA 4R05A 3MT0A 3OU7A 3SEFA 2ZZKA 2XQGA 1D2EA 1N5MA 1WU7A 1YUNA 1ZM9A 2XZTA 2FUG1 3LVFO 3NYWA 3UJ9A 1PQYA 2R6DA 2RAPA 4JASB 4EAQA 1DADA 2Z8ZA 2Y1FA 2FUG6 4WZ5A 4J0IA 4Y9RA 1J09A 4RKQA 3VOAA 4B09A 2GN4A 3G2OA 3NTXA 1NR5A 5J2UA 2ZAOA 1FUEA 2DZDA 2YVUA 2QSJA 4HDSA 4W8GA 1TFUA 2VR1A 4M0KA 4WMCA 3CVJA 2Z95A 4BWIA 1WOMA 3GUYA 3IOMA 3KDAA 3OMWA 4PS1A 3REOA 3VU8A 4F6RB 5HGXA 1DOAA 4LLOB 1LBHA 4XH9B 5IJ9A 3ND8A 5IHVA 4BQNA 4WNAB 1XQXA 2GD2A 3JQFA 3RE1A 3DMRA 1FMTA 3U6BA 1YRBA 2W6NA 5IDQA 5LBRA 1W4CA 1IAQA 1SZPA 1KAEA 2H1HA 3QYAA 2K2QB 3KX2A 4L27A 3TSYA 4LF4B 4R23A 1QQ5A 2A1TS 4JJ8A 4W99A 3JZMA 4EIWA 5FQMA 2OV4A 3M3DA 4UQLA 3U81A 1M1YE 1RADA 2B5VA 2YC4C 2VYCA 2JIOA 1PGPA 2J0UA 1AXRA 4QHYA 2YQ5A 2YWFA 1HURA 5G3ZA 2HDUA 3GR6A 1E1QD 4MUMA 4Y2JA 5D84A 2ZB4A 4C76A 1JI3A 1XPOA 3GJYA 5CB0A 2FW1A 1FUUA 3KCNA 4V1CI 5AQ7A 3UV7A 4BQMA 2FE4A 5CM9C 4C3VA 3E8MA 5J8XA 3F8TA 5DSZA 2HGVA 3TL2A 5EJ5A 5IUJC 5KTYA 3IAHA 3MPOA 3EQUA 4JLJA 3JYOA 2CF5A 4U7JA 4JV5B 2JLSA 4YCMA 4BE9A 2OM2A 3NYRA 2H1SA 5IAOA 4HEHA 1G2QA 2B61A 3ZJ5A 4DQUA 4Y3IA 2X8JB 3ENVA 1DX6A 4G09A 2YWGA 4PQFA 5CVUA 2PA3A 3QKSA 1DFHA 3LNTA 4ERXA 2OHJA 2FJPA 4H35A 4ZRRA 1CUAA 3BQAA 2J9GA 3D4BA 4R9UC 3VP1A 3X2EA 4E2ZA 1K63A 3KT3A 1LK0A 3IP6A 4INJA 3QEMA 1D9ZA 1ECCA 3RXXA 3CR3C 2EJBA 3U09A 1YB5A 4YJ3B 2X0IA 3NBFA 1FVXA 3DCJA 1F5MA 2JAUA 1YSPA 3UAVA 4KKVA 1WY5A 3PC4A 1H8EA 3CWCA 4RKWA 1EH5A 1ND6A 3HUMA 3AERA 4RM3A 3LCCA 1JJ7A 2HHAA 5CGQB 5E6UB 3UGTA 4C08A 3GLSA 3QHQA 5E1DA 5AVUA 3MN1A 1UC4B 4WF0A 2W7TA 3CTMA 1X1EA 2XV1A 1D2GA 1NSFA 5CEFA 2EC5A 4Q9LA 4XCQA 3UCEA 4E2WA 2NX2A 4L9GA 4OD0A 1S01A 4ER0A 4OX9Y 4NS1A 2QPNA 1EHCA 2XW6A 5SY9A 1S5PA 3C3EA 4KGDA 3BXPA 2PS0A 4N65A 2VF7A 3F6RA 3FPFA 4GM4A 2XFTA 2AKEA 2E4ZA 1IUPA 3A3YA 2O3SA 4BGIA 3ZNQA 1AA6A 3ROMA 4TLAA 5BW8A 2OFXA 2PIDA 4KZ6A 5EE0A 4GP7A 1KKMA 4IVPA 4DSUA 2HY7A 5AIAA 3HMQA 4E5YA 4BLWA 5EYPB 1ZBQA 3NIBA 3ORSA 4PG6A 2EKDA 3OC0A 4D46A 4B3XA 4DBVO 4KZ9A 2PH1A 4R68A 1N5JA 1XYVA 2RD2A 4LQCA 1DIOB 1N2ZA 2ZTUA 3EGXA 4ZRDA 5KAMA 5G1OA 2FW6A 4XSVA 2X0EA 5EOVA 2QI9C 4GE3A 3MW8A 3WNCA 1LC0A 1JTFA 3NHUA 3IEXA 1VKRA 2QRPA 3ZV5A 1IG0A 3BDIA 3SC2B 3ZDBA 2WG2A 2RSLA 4RK0A 5FJJA 2FSIA 4JUIA 1KTIA 2N1BA 3ZV6A 2WT9A 2OZKA 3NVKI 1YQ9A 3U60B 1PR9A 1ZAKA 3CLRD 4MYSA 5CCEA 5K0EA 1VKJA 1XTKA 2YOHA 2XR0A 1NXQA 1M2OA 1C7JA 2WVGA 3QI2A 2RGYA 4JL8A 3T1QB 1VFPA 3IVXA 1GG2A 1EJ2A 1ZW6A 3C1OA 3KOMA 3MEQA 4EWLA 2RBGA 5EXEA 1ECJA 3QEJA 2D54A 3C4VA 2YVLA 1OOEA 5D6OA 4L3WA 1BQEA 4EPTA 5JZMA 2K7SA 1X77A 4KK3A 1GU1A 3VU0A 5BR1A 1ODSA 4BWGA 1SQ6A 2P4QA 4P7FA 5JO9A 1BVRA 3HXTA 4ZQHA 3DBLA 4ZGWA 2ZXUA 4JLKA 3COJA 3HCEA 2GLTA 4G3XA 1O4VA 2YZNA 3OZBA 5IH3A 3DDNA 3GB9A 5TNXA 3JX9A 2NN3C 3TQRA 3VDRA 1L7EA 1PR1A 1FJHA 1SIWA 2I2AA 1C9MA 2JFNA 2P40A 4HFNA 5F5LA 1PVOA 1PBNA 3C3MA 4M8IA 2B3TA 1DKLA 5ER6A 1KTVA 4FR5A 2CEKA 3P9RA 4ED9A 10MHA 4NXBA 2ZRDA 5DVAA 1TI7A 1FDVA 4ROTA 4W1QA 1WSBA 3RQSA 1T3TA 3QFFA 2KMLA 3O5AA 3VHXB 3UJ6A 1A95A 3ASZA 3NBAA 3WO1A 1FW6A 2PL9A 4L4RA 1F9EA 2VYNA 5G2OA 5AVVA 1EPUA 1GFSA 2GNPA 4PQRA 5F12A 4XGRA 1SCUB 4DMKA 1TC1A 4GQIA 3SD7A 4KFUA 5BN5B 1C3XA 3ENZA 3K0EA 5HF6A 4YMTA 2PQMA 3AHJA 1FEZA 2PZBA 4MW1A 2B5OA 3CEJA 1G8JA 1KYQA 3EEYA 3H8JA 1ORTA 2NUPB 4FZJA 4QT0A 5J2TF 2IW1A 1BVUA 1KYWA 3W90A 3T4SA 2J3DA 5ICCA 4M76B 1OB5A 4OOEA 4DWWA 2WSMA 2Y4OA 3H97A 2UKDA 2CLCX 3RTEA 4YR9A 1FFAA 2BTFP 5AK6A 4OU5A 3LR5A 4N4AA 3TNJA 4B6FA 4ZARA 5C53B 3IT0A 2HLDA 3NLLA 1LBQA 4G24A 2G8LA 3CSUA 4Q4AA 3PL1A 5KTMA 3ADDA 4S1VA 2RGRA 3SH8A 2XF3A 3DBHB 4MWSA 4G0QA 3GX1A 3ROTA 2E4XA 2X01A 4QEDA 1Z16A 1ZQ1A 3DHYA 5DK4A 2R1VB 2AF4C 3UA3A 3DZDA 4CV0A 1IEWA 2QS9A 3NDJA 1X80B 1K0KA 4R1PA 1FDUA 5DV9A 1IZ8A 1AHHA 2HU5A 2P6OA 4GLQA 1TS7A 3RUHA 4KXLA 2PZFA 1I14A 2F4VB 2GBPA 1MAWA 4MCJA 3WWYA 2YZKA 1QFMA 2Y77A 3TBKA 2QLBA 1I2BA 4B45A 4N3BA 2Z4TA 2RHCA 3WP1B 4DV1B 4PLHA 1L5QA 2WQZA 4MV8A 4JCCA 1XQVA 2V98A 5BMOA 2NTVA 1Q92A 5EJ2A 1O58A 1QF6A 2HK9A 2IHVA 4X64B 3MWEB 4TKLA 2A3RA 1DAMA 4AY4A 4H6WA 1J39A 4HT3B 1AUXA 4F5YA 2OA0A 1EI9A 4JFRA 4MRNA 4M98A 4CM3A 4B76A 4KAJA 4QXRA 3RKSA 1ZMRA 2UVDA 2DLNA 4UTNA 3NTRA 1P3DA 4KLRA 3NBKA 4O4JA 3MJEA 4C7JA 3PCRB 3R0JA 3ADOA 3I04A 4IIVA 3PIRA 4X94A 4V3CA 3IBCA 3SSNA 5M29A 4PGAA 3DHNA 3RSGA 1E7SA 2D5CA 4LS3A 1HE3A 3PBNA 1EFTA 1RLMA 1ADGA 3X2FA 3BY8A 1GLNA 1KDOA 5KYKA 3KSBC 1G42A 5ALNA 1JHPA 3BXEA 3H9EO 3L7MA 3FVQA 3IEMA 2JIPA 4J7AA 5FLXA 1W63Q 4N8DA 4ZYUA 4G4GA 3GGJA 2V74B 2UYCA 4GDFA 3P2YA 4BB5A 4B4OA 5HUHA 3L49A 2YIVX 3OCXA 1HTZA 4WACA 4OVDA 5H3HA 1RPNA 1KO1A 3DZBA 3HYSA 1GRNA 1K8RA 2HPVA 2VUHB 2VGLS 2Z1NA 3NOXA 3VO9A 2QRUA 3WLRA 4DR7B 4Q9DA 3HEAA 4DY6A 4YT8A 1I2WA 3FSEA 5F4ZA 3TOVA 1VGQA 3FYDA 4JUDX 3IKJA 1NUAA 1NQVA 3M2PA 4L8YA 5EL0A 1P33A 2I1QA 1L7DA 2VPQA 2ZP1A 4UFOA 2JRCA 4DIEA 4G5YA 3C0KA 3Q7ZA 2IXGA 1TM5E 1O07A 2VRCD 2XRFA 1E5DA 1MPTA 3R5TA 5JWRA 1JF8A 4HDCA 2AJDA 4TL9A 1EXVA 2BUCA 1XDUA 2W8ZA 3GQBB 1E3UA 1WVGA 4N82A 3PUJA 3IEIA 4BC1A 2GBFA 1C9YA 2ZGVA 3NX4A 1AN0A 4O2BB 3HWRA 4ZEXA 5JDCC 4QOJA 1N2BA 1IG3A 4Q4JA 4YDRA 1JIJA 1HT1E 4V0QA 4Q16A 2O2JA 3UIEA 4IIYA 4WN5A 4RABA 4H7JA 3FH0A 4OVKA 2WD9A 1Q19A 2ZBBA 1JIUA 1LPAB 1R00A 2BFDA 2GCPA 2OKGA 3FTPA 1UM8A 3L7OA 2PA0A 4ZVTA 3S1LA 3ZE6A 3UJHA 1S2GA 4P4NA 4UDNA 4OP1A 3E7FA 3L01A 4DLNA 3CCBA 3MK31 1X15A 4FDLA 4R16A 1GGNA 2R8RA 2Z2KA 4G26A 3RYHA 3NH9A 3ZD7A 1L9XA 3KFXA 3OCJA 1KH3A 2NO1A 2Q5FA 4LCMA 3O38A 2VOJA 3WSWA 3SFVA 1NYMA 1E69A 1UQTA 3SZTA 5EUCA 4EJ0A 4UQIS 1T0BA 3WKEA 2X7XA 2XGSA 1RU3A 2RI0A 2YHSA 1A98A 3OJLA 1B76A 3G0CA 5ULLA 4URVR 3D8NA 4W5WA 2CNBA 3GRJA 3RVKA 5EPOA 3X1ZA 5CH8A 3I01M 1ZNXA 3LY4A 1VHJA 4RS3A 4TT8A 1LWOA 3BFVA 1GV1A 4G97A 3VYWA 1U3VA 3RUCA 3UJ8A 2HW8A 1V48A 4YMLA 3E18A 4AN1A 4HWRA 1MHPA 3G1UA 4K6FA 2QR2A 1YM1A 1JHOA 1Y7PA 1CKEA 2FFAA 2DHRA 2B69A 2GJ8A 3CJQA 1WXHA 4NCJA 3R76A 1H8MA 3BTVA 1O9BA 3BGSA 1KA9H 2IYWA 3QEMB 4IIXA 1FX0A 1BAPA 1QLJA 4C14A 3PUKA 3S2GA 3JTEA 4QQKA 5JC8A 1CUIA 1M2OB 4XX1A 2ORWA 3WGMA 2OR3A 3KBBA 1MO2A 4CL8A 3HADA 1N2IA 1EVEA 2OBFA 3KPYA 1TD1A 1Z7EA 3NHWA 5JEDA 3W4KA 1F38A 1M54A 1YQWA 2G5GX 1IOZA 1B8OA 2D5BA 3DLPX 1DLIA 1X2EA 3VO1A 4PX2A 4AJPA 1OV4A 3JVDA 3TGPA 1GHMA 3KWJA 4DAOA 3RVBA 2UYYA 3ZQJA 1YL5A 1GZ3A 2QVXX 4MP3A 5JJLA 1CF2O 1BD4A 1XLUA 3W77A 4JYZA 3UG7A 1Y6GA 1OTBA 3ZZTA 4RD0A 4ENVA 3PWKA 2IODA 4YMSA 2NU6A 1SHJA 3IDAA 4IXNA 1ST2A 4JMPA 4PQYA 1A9XA 3PBQA 2C42A 4AL4A 3TG9A 1WCIB 5DNEA 4TRJA 4E5DA 1PEKE 1W5BA 2VBIA 3H86A 3HA7A 3WS7A 3MBKA 2PBDP 1XLVA 2X15A 4K1XA 3HJFA 3LF2A 1TLTA 1K1EA 1XALA 3L0YA 3HDTA 1PFLA 2BAGA 4IDBA 4M8NE 5DBFA 1RAGA 3PQ5A 4NICA 4R9NA 2I5PO 2PXXA 4K8RB 4NZOA 3PUWA 4GLFA 1PG5A 3KP1A 1KVLA 5JQGF 1I7DA 1IZZA 1ESZA 3TUIC 4C0BA 1M74A 4X8MA 2R6FA 3WLTA 2ZD8A 2VG8A 1IQ0A 421PA 2C7BA 1M2WA 3D4OA 3JW8A 4YT5A 4H7KA 5CFZA 2VVTA 4JU8A 4JB3A 3T3MB 2FOXA 3BGWA 4X92A 2JAOA 1FCNA 4GOLD 4M36A 5DXAA 3L7DA 1CRWG 2R68A 4ENPA 5DH9A 3W5HA 2JDID 1KU0A 1UBSB 3G79A 4KXWA 1XDDA 3M6LA 2ONJA 2H65A 2W58A 3CH4B 4HQOA 3PUHA 1XJ3A 1W76A 5LJLA 2BLSA 1X1CA 3KJGA 3LUQA 3JD4A