3R8GA

Akr1c3 complex with ibuprofen
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
316
structure length
303
Chain Sequence
b'QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Crystal structures of three classes of non-steroidal anti-inflammatory drugs in complex with aldo-keto reductase 1C3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 116
structure length 303
sequence length 316
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2011-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3r8gA00
5C7HA 2PZNA 3GUGA 4HMNA 5LIUX 2F38A 3Q65A 1R38A 2P5NA 1EF3A 1T41A 4DBWA 4AUBA 1EKOA 3CAQA 1AH0A 1OG6A 5LIKX 3WBWA 1AZ2A 1UR3M 4FAMA 3EB3A 3WBXA 4Q7BA 3ONBA 1PYFA 2R9RA 4EXBA 4WDTA 2BGSA 3G1RA 1T40A 1VBJA 4YVPA 4PUUA 3WCZA 3R6IA 3UFYA 2DUZA 1GVEA 3LNMA 4H7CA 4WRHA 1AFSA 2FZDA 2VDGA 1Z9AA 3M0IA 3EB4A 3LD5A 2INEA 3BV7A 3QKZA 4QX4A 4HBKA 4PUWA 4XVEA 4XAPA 3LN3A 3LQGA 3DN5A 4LAUA 3S3GA 4JTRA 4PR4A 4WDUA 2PDJA 4R9OA 4MHBA 1XF0A 1Z8AA 4FZIA 3UZWA 4XK2A 3R8GA 1IEIA 3R43A 3BUVA 1JEZA 3N6QA 1YE4A 5AZ1A 1S1RA 4YVXA 3GHSA 4IJRA 2PDPA 1HW6A 3UZXA 4I5XA 4JTAA 2WZMA 1S1PA 3LUTA 4JQ4A 2ALRA 4PMJA 4YS1A 2DUXA 3ONCA 3RX3A 3CMFA 2PDKA 2PDMA 4ASTA 4IJCA 4LB3A 3LZ5A 4XO6A 2NVCA 1S2AA 2HVOA 4QXIA 3UZYA 1YNPA 1XGDA 1ZUAX 5LIYX 2J8TA 4G5DA 1ZQ5A 4JQ1A 4PRRA 1J96A 2PDHA 3RX2A 3LEPA 2HE8A 3U2CA 3H7UA 3ERPA 4L1XA 1M9HA 2PD5A 3B3DA 2ACSA 2PD9A 4JTQA 5JH2A 3R94A 5LIWX 2HVNA 1VP5A 3H4GA 3V0SA 5M2FX 4LBRA 2IPGA 3FX4A 2PDLA 2PDFA 4WDXA 1YNQA 2C91A 1US0A 2FGBA 3RX4A 3NTYA 1MI3A 2PEVA 4DBUA 5HNTA 3GHUA 3LQLA 4XZHA 1YE6A 2PDNA 2WZTA 3G5EA 3P2VA 5KETA 4XZLX 4JTCA 3BURA 4ZFCA 3UP8A 2BP1A 1EL3A 3EAUA 4LBSA 2PDCA 1X98A 3UWEA 2IKGA 3CV6A 3CV7A 1Q5MA 1QRQA 1RALA 5HNUA 4LB4A 2PF8A 1FRBA 3UZZA 3R58A 2IKHA 2PDQA 4XZNX 1RY0A 4IGSA 3BCJA 2I16A 4XZMX 4NKCA 5LIXX 5AZ0A 4YU1A 1HQTA 2AGTA 2I17A 5DANA 1AH4A 2A79A 1LWIA 4LAZA 3GHTA 3O0KA 4JTDA 3V0TA 4JIHA 2INZA 3Q67A 1ZGDA 4PRTA 2IQ0A 4RPQA 3VXGA 4QR6A 3GHRA 3CAVA 2IS7A 4Q3MA 2IPJA 4EXAA 1PWMA 2PFHA 2PDWA 1RY8A 3O3RA 3MC5A 2FZ8A 3T42A 3LENA 3M4HA 4GIEA 4GQGA 2ISFA 1Z3NA 2BGQA 4OTKA 1ZSXA 2ACUA 1ADSA 1C9WA 1X96A 4GQ0A 2NVDA 4XVDA 4QBXA 1IHIA 3V0UA 4GA8A 2ACRA 3UG8A 5HA7A 1MRQA 1QWKA 2FZ9A 4L1WA 3H7RA 2PDUA 4DBSA 3CASA 2FVLA 4FA3A 2QXWA 4JIRA 4GACA 2HDJA 3V35A 2IPWA 1K8CA 3M64A 2HEJA 4F40A 2PDYA 1AH3A 2F2KA 3DOPA 4WDWA 2DV0A 3N2TA 2FZBA 2R24A 3LZ3A 4XO7A 3R8HA 2IKJA 3MB9A 1XJBA 4GABA 4WGHA 2CLPA 1Q13A 1A80A 3C3UA 4JQ3A 2IPFA 4JIIX 3UYIA 4JQAA 4XZIA 4GCAA 3WG6A 4H8NA 4FALA 2PDGA 2HV5A 2PDXA 3WBYA 2HE5A 2IQDA 1Z89A 2IKIA 1PZ0A 1LQAA 1SM9A 4YVVA 3LBOA 4JQ2A 1S2CA 2PDBA 2PDIA 3R7MA 1X97A 3F7JA 3UGRA 1EXBA 1PZ1A 3V36A 3COTA 3KRBA 3FJNA 1AZ1A 2ACQA 1PWLA 1MZRA 4ICCX 4WEVX 5JH1A 4DZ5A 3D3FA
chains in the Genus database with same CATH superfamily
3BXWA 4R7WA 5EGRA 4XAGA 2CPUA 2GSEA 4HIBA 3LM7A 2OODA 1BSIA 4AMCA 3T07A 1EF3A 4ACZB 4CD4A 2OGJA 4LRSA 3M07A 4QLLA 3TSBA 3TW9A 3ALFA 3QV7A 5D02A 4TO8A 4O54A 3C2OA 1SR9A 3EB3A 3RLUA 1QBAA 1S5NA 3WBXA 3ONBA 1A50A 4UFLA 2HISA 3G1RA 4HB7A 4PUUA 3OO2A 4HK7A 3UFYA 3SCRA 4F79A 2X42A 2ZE3A 3V1PA 3GVRA 1C7SA 1VQTA 1RCXB 1MVYA 5CC5A 3T4WA 3CWOX 5FOOA 4PULA 5IM51 1F9CA 5EMYA 3NL3A 1HP4A 2W91A 3C52A 4GYJA 2POZA 3TOPA 3W2UA 3DN5A 4BHYA 1V6WA 3AS0A 1P7TA 4X22A 5HUOA 2G95A 1GWJA 2A3LA 2O92A 3AHYA 4MUZA 1HGWA 3WEZA 3G1HA 3AHVA 2X1IA 2Y4SA 3PBUA 3UZWA 1QMLA 2EG6A 4DF2A 1GPWA 4RLIA 4DHGA 1JZ4A 2ADAA 4NVTA 3GYCA 1YKWA 1I2OA 1CXIA 4CNUA 1R2SA 3A3HA 4I8YA 1F61A 3LUTA 1AD1A 4KS0A 4JQ4A 3QY7A 4D6JA 3LTYA 3N17A 3IJ6A 4W9TA 2ISSA 3HZ3A 4ZXOA 4WXZA 3THDA 1MSSA 2P8BA 4US6A 3I68A 1WCGA 1J4EA 2YBVA 4AYSA 3A9IA 4JTEA 3LSCA 4PMQA 1HNYA 1IEQA 3AIRA 4S1FA 1GZJA 5CAKA 3L4ZA 3C61A 4HHPA 3VDHA 3BJFA 3CT7A 2OGYA 3O6DA 1R5YA 2DT0A 1EJWC 3WDRA 5AYBA 4L1XA 3IIVA 1M9HA 4C6IA 3TYDA 1W3LA 5LGXA 3GVVA 3ES8A 4OE7A 1HP5A 1AA1B 1Q6QA 3DAQA 2CHNA 3U48A 1JD7A 1VP5A 4GGHA 1D2KA 1KGXA 1B4EA 3NXFA 3PFMA 3QJAA 3Q4DA 3OYZA 3GAYA 4O0KA 4IMEA 1P48A 1V51A 2FGBA 1MUWA 5C5YA 4JFTA 2AKMA 4Q7IA 1JZ2A 2OQLA 3H54A 1TB3A 3R0KA 1IEWA 3SY8A 1XQLA 5HNTA 3DECA 3GR7A 1SJAA 4RNFA 4KFNA 3ITLA 4AWTA 4O0ZA 5CPTA 4PTNA 1ONWA 4AF0B 2R1NA 5CXPA 1NDYA 4MIMA 1PJ9A 1XIMA 4BJHA 1UR2A 1I60A 3TN5A 4HCHA 2PDCA 4NYUA 4IHCA 3CUHA 1Q5MA 1L8PA 1HF6A 1V4YA 1JFXA 1PTAA 4OZOA 3MO7A 2X2YA 4GXMA 2TAAA 3APTA 2C1GA 2QDDA 4XTIA 4S39A 1A49A 2QMKA 3HM7A 5DLCA 1SO3A 1BTCA 8CGTA 3M43A 3PUOA 1W1B1 4MLRA 4IXHA 3CMGA 3BLFA 2PP0A 3KM8A 2I17A 2PWVA 3NM3A 1HKKA 4ZCWA 1TV3A 4RZBA 3K4DA 1R3RA 3ZQ9A 2W3ZA 4JPGA 4ZO7A 1WBHA 5I79A 2A7RA 3G22A 1LLOA 3UA4A 4MKVA 1M7PA 3AO0A 2VDHA 3SUUA 4HSOA 2VX5A 4Z1YA 1WZKA 3IVTA 3G8RA 3U2EA 4PA8A 3UF9A 3TLLA 2BVDA 3U7VA 1YLVA 1AK5A 2YGYA 3NZRA 3L4VA 1B3WA 2BOFX 2WBKA 1W2VA 1GK8A 1H0GA 3XIMA 4DYKA 4ZQRA 3N6HA 3CQ0A 1WDQA 3G1AA 2YJQA 2Z6JA 4PMZA 3E49A 3AYVA 4ZOCA 1OB0A 4UNLA 3SFKA 4FOKA 3I3EA 1VD6A 3OG3A 1TPFA 4HNNA 4IIFA 2VFEA 1FWIC 4LPCA 4NAEB 1GQKA 1GKQA 4FP1A 3CV2A 1C91A 3Q45A 3PAJA 4X3ZA 4IQEA 4JFWA 4AYGA 2ZRWA 1AH3A 1OYBA 1Q7ZA 2PRHA 4CVUA 4JHOA 4WDWA 3DG6A 1R2RA 2Y6ZA 3N2TA 2KAUC 3S8HA 1A0CA 1Q6CA 1Y5VA 2XN0A 1UWSA 2J24A 2YKKA 1FVPA 1A5UA 3EDEA 4JQAA 2XSXA 2RKXA 4ZQPA 2C0AA 1N8WA 1IYXA 3CT2A 4E4PA 4K6AA 2YFOA 4AHOA 1EJSC 1O4UA 1UA3A 4Z1AA 2X1UA 2XN1A 2QHAA 1TJRA 3B9AA 3BOFA 4DRSA 3QV8A 3FNDA 4N7QA 1BKHA 3WN6A 3CO8A 2HE5A 4H8VA 4O8RA 1M5WA 4LUYA 1QXLA 4E4UA 1W9PA 3VC5A 1J0YA 4B3KA 2QULA 5E9XA 2E8ZA 5G2HA 4JQ2A 4NILA 3BQ5A 2GJLA 1SSDA 5KTLA 3CUJA 1V77A 2P88A 4M56A 1B54A 1JNEA 4CKQA 4P2VA 4Y2WA 3LLDA 2OLHA 3SCQA 3NAVA 4IL0A 1CGXA 1YHTA 4JTJA 4QJ3B 3LHUA 4A3YA 2J62A 3NNTA 4JNMA 3T0CA 4L6HA 1EOKA 1RA5A 2PURA 3AROA 5IBXC 3HPSA 4O4WA 1QW7A 1TJ0A 1TCDA 3OB8A 3RO6A 4B91A 1GOQA 1SFJA 4WQ6A 3WBWA 1IXPA 4QDPA 1FXQA 5E0KA 1HO4A 4EAYA 2FYMA 2O9OA 4DO5A 4C91A 1TV2A 1IWPA 3ZJ6A 1V3KA 2GDQA 4Y8EA 3RRXA 1A5SA 1KFCA 3DXIA 4WRHA 1EBGA 1HZYA 5FEPA 1TKKA 4WHBA 3N11A 3WL1A 4QCFA 1FH7A 1ISVA 2GVJA 2X7VA 5IRPA 2OEKA 1FUYA 4AD1A 1PHQA 1I0BA 4TUFA 4GJIA 3V5OA 3RF9A 4R7JA 1FWHC 1B5TA 4JTRA 3VGFA 3A13A 1JDAA 2QR6A 5AHMA 2C6QA 4FZIA 2DSUA 3UA3A 1AG1O 2BTMA 1JDEA 4O1CA 1E0TA 4IMGA 2CZVA 5HWJA 2XYLA 5I7GA 3VIPA 1VCFA 3A3XA 3MMUA 1V3MA 4AWUA 5D4YA 2WZMA 4REQA 2Y8KA 2GQ3A 1O12A 4LANA 3LX9A 1Q6GA 1IWBA 3E5PA 3M5XA 4X0NA 4RX0A 5KZEA 4HNVA 3P67A 1LL4A 2H3DA 1VJIA 2H3BA 4RE3A 5ABGA 3TZNA 3IIXA 1XKYA 4FX7A 3GXMA 3S2CA 3MANA 4IIEA 1SFLA 4R53A 3UXAA 2QLYA 5DCBA 2E67A 3M46A 4IIBA 5D2XA 4R7OA 3WELA 4IQLA 2WCSA 2W0UA 4NASA 4Q8TA 1UA7A 1J96A 2CBJA 1GORA 1JGMA 1OD8A 2OX1A 5KZMA 4PGLA 4PSRA 3OBKA 4N9DA 1US2A 5DY3A 4K38A 3DFOA 1JRBA 2JGYA 3IRSA 3SY5A 5M5DA 2YX0A 2OT1A 4QE5A 3OP2A 2PDLA 3P82A 4DZHA 1F2JA 4JYDA 1YNYA 1FCUA 1TSIA 2X41A 2YW3A 4GCXA 2I7GA 4LUTA 2GJRA 4WXYA 2V30A 1EDGA 1EP3A 2NSOA 1AQFA 3G5EA 3RM4A 3SGGA 1IR2A 3UP8A 1G1YA 5AHEA 5C9ZA 4NZJA 3ME3A 5JIPA 3NPWA 4XBJA 5G4EA 3GC2A 4RDYA 3S5SA 1R3TA 2JEPA 3IGSA 5EFDA 3O15A 1DJXA 4I7WA 5GNXA 4LB4A 4WLCA 3EWDA 3UZZA 1ONRA 2VM8A 4ROQA 1W5OA 1K77A 3T0BA 3FGCB 1A5KC 3HB9A 4H00A 3E6EA 1QNQA 3CQKA 2OJPA 3N4EA 4H19A 2G3FA 1E0WA 4I9AA 3KRUA 2CKRA 4FK9A 5D03A 5DEZA 1HQTA 4S23A 3LV6A 1R2TA 1VLIA 4FIQA 1TVPA 2AQOA 3KOXA 3TCEA 2WK2A 3UJSA 4J3TA 3EDFA 3NG3A 4UTHA 2X30A 1CW2A 5D9MA 3W3OA 2MUCA 3K8KA 1KLYA 1YEYA 1Q2RA 1WP6A 4QG9A 4WF7A 4RCXA 4KIRA 4A29A 3MMWA 3O7UA 3TC6A 3O3RA 5CEWA 1BF6A 2FFIA 3URAA 7ODCA 5HR6A 3DUGA 4NXKA 5T9BG 4LV4A 1ADSA 2NVDA 4ZQMA 3NQDA 1NF7A 4MM1A 2ACRA 2GL5A 3TLQA 5DXYA 1BFNA 1KFBA 3S1VA 4FS9A 3FJ6A 4C6BA 3TNOA 2J77A 2FIQA 3W7HA 3GTFA 2PCQA 3O63A 3NQFA 4ZMGA 5JU6A 3W71A 3NQMA 4M6VA 3TQPA 4P7QA 5BU6A 4Y96A 1XX1A 3GB6A 2ZDSA 1VRDA 4Y90A 2OCZA 1PZ3A 1QHZA 2IQTA 4NZ4A 2XH0A 2XGZA 1XQKA 3KVMA 5GJPA 4DF0A 4WSKA 4I8DA 4PMXA 1K02A 4LY8A 2PWHA 2CLHA 4ZA0A 1ONEA 1QDSA 4PFMA 5D2TA 1TTPA 1UR4A 3L5MA 3NGFA 4D6DA 1OCNA 3WLHA 4D2JA 4Q8MA 2ZWYA 3VD3A 4RL3A 3S6DA 1JCLA 2PWDA 3AHZA 5A94A 5A6AA 3LHTA 1JZ5A 3WBYA 1EZWA 1GOKA 1FWGC 1BRLA 3FKRA 5BWFA 3BAXA 3AISA 3KDNA 1BYBA 2Z7GA 1SFSA 4YLWA 3KVKA 1FKXA 3V3WA 1S2CA 3GKAA 4JYEA 3C8FA 3F7JA 4QG6A 3AYTA 1HG3A 3QGKC 4L9XA 1PZ1A 1SVDA 5JBDA 1NWSA 5FJIA 1AZ1A 3KP1A 4S3KA 4QCEA 3SN0A 1CXKA 3AICA 3W27A 3NSMA 1C7TA 1HIZA 3BWWA 2DPEA 3AJ7A 2WSKA 1YBQA 2HS8A 1V6TA 5C7HA 4HMNA 3IIZA 3MSDA 3VD7A 3KHDA 4F8XA 1TJPA 3B03A 4W85A 5BRPA 4UUIA 4LEFA 3A9BA 4F3HA 2CC0A 1I4NA 2G37A 3F4VA 5FEXA 1E70M 4HK6A 3KTCA 3LK6A 2JIWA 4FI4A 3V7PA 3N29A 1K8YA 2OSYA 2VEKA 4YHGA 3SW6A 2TSYA 3IIPA 3P61A 5XINA 3KX6A 3IJ8A 2ZX6A 1KQYA 3THUA 3MQTA 4FOUA 3GQYA 3MWAA 1DWIM 1UP0A 3VGDA 2XGIA 1VZWA 2NXGA 2XVNA 1EYEA 2VDGA 1Z9AA 3BLLA 3O06A 4MZYA 4ZL1A 1D8CA 3AXKA 4IPIA 2E1DA 1BQCA 4A05A 1FHUA 2EPLX 2YZ5A 2C79A 1Y0EA 3PZNA 4TV5A 3R8RA 4H6QA 4MMWA 4KMQA 4CQDA 1OSEA 1QNPA 5K4XA 1CT5A 1M04A 3NCOA 1GVRA 2QGHA 1R30A 2C1HA 4V2XA 5AKQA 3QEZA 1EIBA 1KBIA 4YL2A 4IZGA 2GJXA 1QT1A 2CW6A 3DFQA 4QLJA 1U1HA 2ZXAA 4PMDA 1GOXA 3FW6A 1DQXA 3T8LA 3I10A 4WK9A 1UQZA 1EWDA 4IX2A 2YYUA 1A5MC 4V27A 4D6GA 1KM0A 4EOUA 1JCNA 1S39A 3W1AA 4NYYA 4N6FA 5EMLA 2WM1A 3FHQA 3T08A 2JGQA 3HMJG 2PDMA 1R9ZA 2HPIA 4JL2A 2C16A 3NM1A 3IJLA 2ZCGA 3LCFA 4D6HA 1JVNA 4DXVA 4LTSA 3RJXA 1P0KA 4HCDA 1FWDC 3DYPA 1K03A 5FESA 1J2BA 1XYAA 3SUVA 3T2QA 3CIWA 3M0XA 3C0QA 4UZSA 3ZR5A 1OX4A 1E1CB 3ERPA 4ZFMA 5KZ6A 5E9AA 2OOFA 4AZGA 3ZLFA 1GVOA 2G97A 3ZR4A 1THFD 3K8LA 3V0SA 3BCFA 4R85A 3BQ6A 4QROA 2C91A 4PUNA 5D09A 1FWFC 4ZXLA 3SRDA 2CNCA 3TJXA 2OG9A 4MJZA 2ZWZA 3BL3A 2X8RA 3CHDA 4HT3A 1TRDA 6XIAA 1ODUA 4U28A 4C6JA 3PZUA 1XM3A 3P2VA 4HA4A 3W7LA 2HQAA 3IK4A 2ZZ6A 4R88A 3GY1A 1TR1A 1V3HA 5CJ5A 5CPLA 1JJKA 1DV7A 2GK1B 3R25A 2R1MA 3W24A 4LY4A 3EXTA 1I2RA 2EHHA 3R58A 1NFBA 3U8GA 4AC1X 4P8UA 1B3VA 4X63A 3GSMA 5I3FA 2QNEA 4FR1A 5C9UA 3P84A 4Y9NA 1XLGA 4AZBA 3KBVA 3PWIA 1PKYA 4ONVA 3XINA 4I90A 2FVMA 3ARXA 4KCWA 3WF0A 1R86A 2E68A 3GHRA 3OLEA 4LS2A 2OR2A 1Z44A 4A3UA 3WK3A 2BLEA 2ZXDA 2OU4A 1VB9A 2QCCA 4W7WA 1CNVA 2ZUWA 3WLQA 3EPNA 1X8FA 1QJWA 3ECQA 4CEUC 4OTKA 1B1YA 4DO6A 3VGHA 3NYDA 2SFPA 1GZGA 1S5VA 2ZKMX 2OYMA 4ZEPA 4DEFA 1W1YA 3UG8A 1AMYA 2FZ9A 1ZBKA 2PDUA 4UFIA 3GBDA 4O14A 5CC7A 3CASA 4RE0A 1W3HA 2X09A 3C5QA 2W61A 1XCWA 5ECUA 5XIAA 1WV2A 4I5UA 4QGCA 1K8CA 2WC7A 4Z2JA 2DIJA 4E8CA 2FHCA 4G6CA 4J3XA 3WFLA 3N18A 4M1RA 4MGGA 1J93A 5AC6A 4RV8A 1DXEA 3PC0A 5F4SA 2IKJA 3BAJA 3CEPA 1E4MM 1GG0A 4WGHA 3USZA 4PYSA 3MZ2A 1KCLA 5A3HA 3DESA 2WOQA 5HAOA 3GDKA 4C6OA 4DBEA 4Y9OA 3QHNA 1TREA 4K2SA 2A21A 1E6NA 1BGAA 1P6WA 5A6LA 3BW3A 1W1VA 2OKOA 3LPFA 4UMBA 1ITCA 5CCZA 4IGNA 3SN4A 4Z42C 5FEWA 2X40A 4Q8OA 3LCHA 1DP0A 4UFKA 5A8PA 1RPXA 2NWRA 2D0FA 1QI2A 1OCQA 4IG2A 1BD0A 3R7MA 1NSJA 3SGUA 5C70A 5E0CA 3MUIA 4GVFA 3PULA 3GE7A 1E9YB 2JF6A 1A5BA 3AMGA 8TIMA 2C18A 5IHSA 3QMTA 5JH1A 1MRAA 3TH6A 3I7QA 2BVYA 1JNDA 3SCVA 1WX0A 3TYAA 1IR1A 1BQGA 3MYPA 3QTGA 1UIOA 3W7EA 4B5XA 3S2NA 5C9RA 1K1DA 4GUGA 4LYQA 3KZPA 2D2HA 3EDJA 3LHZA 1KB3A 4GI4A 4AWSA 3CAQA 2QPXA 1TTJA 1SJCA 1QR7A 2E0PA 3URBA 3LU2A 4XSMA 5JIWA 5I3GA 1RBAA 1IZJA 1QVBA 3LLXA 3TV8A 4M82A 3AXHA 2R9RA 3ITVA 4EXBA 1JCYA 4HK5A 4OU1A 3KCJA 5DQPA 2DVXA 2I9UA 4RKAA 4CU8A 3FV9A 5A6KA 1U5JA 3JZUA 5A8MA 4HPGA 5D9NA 3QN3A 1OVDA 2PRMA 3WX7A 3SECA 1LL6A 3UW6A 3UT0A 3U4AA 3NDZA 3A5FA 4EXQA 3FDKA 4HBKA 4NI8A 4YXGA 1E9LA 1CYGA 1E73M 2QVNA 2VQUA 4JN8A 1EPVA 2JKEA 1BAGA 4JKKA 4GXPA 4XTDA 1V03A 3W1RA 1F3XA 1XBZA 4D6EA 2QCDB 1XF0A 1XIHA 3PZOA 3QR1A 1DKWA 4KFPA 4RNHA 4FX6M 5GQBA 3RUBL 3SDOA 3MO4A 3WK0A 3D47A 2NXHA 2Y24A 3WIJA 4HA0A 1YE4A 4WY0B 3PBGA 3IV8A 4IJRA 3OTRA 3OODA 4O8AA 2WXDM 3IUHA 3POCA 1P6BA 1DXFA 1RQBA 3TTQA 3GU1A 4V1YA 1E43A 2V5KA 4FLQA 1NDZA 3TQ0A 2OLAA 4HHMA 4TX9A 3DU0A 1F5ZA 1DJWA 8XIMA 1EF2A 5IXEA 1W5NA 1Z69A 3W1UA 4HPJA 4IJCA 1VIWA 4LB3A 1J8VA 4H41A 1DWJM 4E2BA 1VH7A 5G1TA 4KGLA 5DT5A 1UP3A 3QOKA 5CSYA 2OZTA 1XG4A 2LLEA 4LF2A 4F9DA 2QUUA 1O5QA 3OLDA 3F4CA 5AYIA 5REQA 3E2VA 2J13A 1J01A 1XS2A 3DI1A 4L4LA 2HVNA 3JW7A 2OYKA 1JYVA 4BI7A 2WCGA 5CPOA 4HOZA 2Y8UA 2WSQA 1MFUA 1EUNA 1IEXA 2WMHA 5E0FA 3VTRA 2EQDA 1UROA 2BBFA 3M6YA 3S5ZA 1FFRA 2Y70A 3KBNA 4G7FA 2MNRA 2YLAA 3OQ8A 1MMFA 3AHTA 2VURA 3MYOA 4PCPA 3WNNA 4CCEA 1MO0A 4AMAA 4Q8NA 5EYWA 1DIOA 5KZDA 1F6PA 2WV8A 2WZTA 3L4YA 3CUXA 5C2CA 1GOOA 3R0UA 3IANA 4RXFA 1EUAA 4B5WA 1C92A 2JQXA 2EPHA 4XBKA 5CLTA 4C5ZA 1XCFA 3JVAA 2TPSA 3NZGA 4CNNA 1AVAA 3WK2A 4PBEA 1KCXA 1B3ZA 4UTUA 3N2CA 5BOOA 5J5RA 2X1TA 3TW7A 3CQIA 3OHIA 3ZSSA 5AHNA 3OVQA 3G8EA 4D9PA 4QEHA 1XBVA 2P0OA 4YMZA 5LXXA 1LWIA 3I7SA 1ICQA 3V0TA 4AQLA 1G01A 2W4XA 1UZ4A 1D9EA 5ECVA 3H2CA 1ZGDA 4PRTA 2HXUA 4WCJA 2J9XA 3OLGA 3G6LA 4TU1A 4Q3MA 2FH6A 3VKAA 1G94A 1B4KA 3OG2A 3L5AA 4AVNA 3VK5A 1M3UA 3UCQA 3EMQA 3PK7A 3WL0A 3ARWA 4BWLC 2XSBA 4PUJA 3UZJA 1VBHA 3KBSA 1LLWA 4WGXA 3ARZA 1J0HA 1L6WA 1GQLA 1VYSX 2PBGA 4XVDA 4JN6A 3M6DA 4BEQA 3VM5A 2NUXA 2FH8A 2XFYA 2CWXA 4C6PA 3N9KA 1PIIA 1SZRA 3R5EA 3IJQA 3C3NA 4DAFA 3WLTA 1MNSA 3HPFA 4AVOA 1LOQA 3PANA 1WZAA 5J8LA 4TR9A 2P10A 3UJFA 2QJMA 1GJWA 2FZBA 1DJHA 5HDRA 4AD0A 2WVVB 3WQGA 2CYGA 1QBBA 3CM4A 5BXSA 4UR7A 3M0LA 3S9YA 3NEVA 1LQ0A 4JIIX 1RQHA 3K5XA 3PM6A 3AWOA 4PEEA 4KRUA 3OGRA 4JZ5A 1UHVA 4YYCA 1VFMA 1Q6EA 4H8NA 5CPSA 5I5RA 1M7XA 3W74A 1E3ZA 4RNIA 1VGAA 1OCJA 1OK4A 5CH9A 3KFTA 4PZVA 3FS2A 3W84A 8XIAA 1BHGA 3TTYA 3WQVA 5I06A 3CO4A 4W88A 1DQUA 4OQVA 4MY1A 3FN9A 1PTGA 4U31A 4X2PA 3ARSA 2PTWA 1QW8A 1JPIA 2VX6A 3OW1A 4DM1A 3WDHA 3MI2A 3P8IA 2Y1HA 1ZJIA 4L56A 1K7XA 2OWXA 3VKKA 4DLMA 1JZ8A 4OUIA 2J7HA 1PX3A 4ACYA 1V7YA 4GNKB 2UY4A 5A8NA 5CJMA 4ENLA 3SRHA 3DFTA 5BW6A 1E6QM 1Q8AA 2VEGA 2P5NA 3A4WA 2ZQ0A 4NIRA 3QW3A 4U3CA 4HNTA 2OXNA 2Y88A 3ATYA 3BVJA 1R46A 1AZ2A 2V5LA 4M19A 5FJTA 3IJ7A 3NQVA 1VS1A 3A47A 1T40A 4YTSA 3TA9A 2CLKA 3RK8A 3R6IA 3TMQA 1J5TA 2Y85A 4HU8A 2G3MA 4OKDA 3VIKA 3BZGA 1I1WA 3LNMA 4PMYA 1JYWA 4LJ3A 1F3WA 3BG9A 3LRMA 3MA8A 1V7AA 1XIDA 4C7FA 8A3HA 3GFZA 3CPGA 3LD5A 2INEA 1L9WA 4D8ZA 4QISA 1GVIA 4KW2A 4LC6A 2DU2A 2OPJA 5C2GA 1F7BA 3LN3A 2PE4A 2CEQA 2P1FA 1H3GA 2YYTA 4S38A 5DF0A 2BASA 2X05A 2Q02A 1ZFJA 4H7ZA 2XVPA 3EPOA 3MTWA 2TMDA 2J8GA 2FPVA 5EU9A 3DBNA 3BLEA 4CD5A 2V63A 5GNYA 1I8JA 2YCLB 3BGJA 3ABRA 4JS3A 1U83A 2KX9A 3BUVA 4YVXA 4B4HA 1VYRA 5D33A 4TX8A 4JTAA 5AVHA 4WKFA 1KGWA 1LF1A 4ZQNA 2WC4A 3O05A 4JFSA 3RMJA 3CMFA 3EBVA 3VKBA 1V08A 5DMMA 5I23A 1PCKA 1NY1A 3L5LA 3LZ5A 4MPKA 4HGXA 3I4EA 5JBFA 1S2AA 3OZMA 1Q85A 4XAZA 2C0HA 5EBUA 2ISVA 4MNKA 2VCCA 3IGUA 1U30A 2VZTA 1DJGA 2PGEA 3K1DA 3MKCA 1MEHA 3TU9A 1JIBA 4BQ4A 1QWGA 1XDMA 4NZFA 3VDGA 3VOHA 1UWRA 1M01A 1BWKA 2Q09A 4KWOA 4TMBA 3ZSTA 2EEXA 3VIMA 2O4QA 2QAPA 1OX5A 3LXBA 4MG4A 3R4IA 4F4RA 2FMOA 2QCGA 2PTDA 2O7QA 2DZBA 5FL0A 3EEGA 1WYIA 3H22A 6A3HA 1LCOA 2CITA 1DPMA 3B8SA 3ARTA 3NOEA 2Z1WA 2DT2A 1W5QA 1EX1A 2G96A 2VX4A 3LCLA 2F61A 5K4ZA 2PDNA 3PTDA 1R6WA 1L6GA 4BFAA 4JTCA 3ZZ1A 1KD0A 1OCBA 2PMQA 1IEVA 5AOUA 5U4NA 3WSUA 3L9CA 4GYPA 1ECEA 4KRTA 3CK5A 4S3JA 2CESA 4D8AA 2GQAA 1NU5A 2YL6A 3WEMA 1TELA 4JIPA 3TONA 5BOEA 4HP5A 4CQAA 2WHJA 1FRBA 4H9YA 5ABTA 2QS8A 4HZMA 5ABFB 1F8IA 4N2YA 1GKPA 4D8LA 3IJ9A 1EA0A 1NWTA 3VA8A 1EH9A 3U5UA 4C5YA 3R0DA 3UBPC 3BO9A 5DT7A 3VNKA 5HQLA 3DFSA 1DWGM 2D3LA 3WFZA 4I9TA 4URIA 3BAYA 5A1AA 1VHNA 1TPWA 2BXYA 1REQB 4GG9A 4CCDA 2DVTA 3VIJA 4AHQA 3LPPA 4QLKA 1P0NA 2NV1A 1X8CA 4PB5A 3YPIA 1VFTA 3SCTA 4HTYA 5G4WA 3VKDA 4DAIA 5A6MA 3WZ0E 2IS7A 3TJIA 3H6OA 4UQCA 4FOJA 3GR4A 4PMVA 3VYLA 3N25A 1WUEA 2PFHA 3B8UA 4E0CA 4E4FA 2PDWA 4DJFC 3W7PA 2Z7KA 4NZCA 2E6AA 4RZ4A 1DL3A 1SYTA 2ZFAA 2XVKA 1FCBA 3DKJA 4B16A 1XYMA 2E5CA 4GI8A 1W3KA 4E2OA 3SIMA 3LOTA 1EJTC 1PXGA 3U9IA 1CPUA 3TQVA 3S83A 2IW0A 2Y7DA 3MUY1 5H8PA 3H7RA 1ZB5A 1F74A 7REQB 2PSNA 3W7DA 4Z1CA 2CZDA 3QTPA 4LVDA 4U5IA 3V35A 3W1LA 4YJ5A 6ENLA 3HG3A 3MPGA 3JZEA 1TE1A 3BLKA 3S6OA 2PDYA 3W38A 1EQCA 1DE6A 4NXSA 4DJEC 4A21A 4UR8A 1FCQA 4GQBA 4D6IA 4EPBC 3MJYA 5F4XA 1BG4A 2EPKX 2OX4A 3T6CA 1RVGA 1F05A 4DXKA 4U2YA 5HNRA 3C3UA 2ZIDA 3OGVA 2VELA 2DW6A 5PTDA 3GXIA 1ONXA 1WZLA 4UQAA 2TODA 2H8ZA 4OOUA 2YL5A 1CWYA 1RUSA 1G69A 4HA3A 4O1FA 4PTWA 5IFTA 5CJNA 3CGTA 3KTXA 3INPA 5I3DA 1AJ0A 1SSGA 4IFKB 3MSGA 2BVWA 1B2YA 2CU0A 1DTNA 2OQHA 1UWTA 3GH4A 3M5ZA 4X60A 1W32A 1W91A 3WLNA 4E3TA 3PTMA 2CFFA 2KZHA 1QHOA 2VZSA 4H9UA 3TVAA 2YDQA 1XPYA 1A5LC 3APGA 3NO5A 3HG5A 3STCA 1W9VA 1WNOA 1H11A 4FXSA 1JDFA 1UJQA 2ZVRA 5BROA 4DYEA 4AZHA 1SQ7A 4G8TA 4C6KA 2PZNA 1OZQA 4C1NB 3CL8A 3TMLA 1V5XA 4I7VA 4EPEC 1IV8A 4L6DA 4GD0A 4KEVA 4H9VA 2ZZ2A 1CTNA 1UUOA 4W87A 4F0HA 1AH0A 3HFYA 5GJMA 3FYPA 3CQHA 2DH3A 4GE8A 1G7UA 2Z27A 3GKFA 4FAMA 1SR0A 1P6CA 4ZVJA 1OWQA 1LT7A 3B05A 3NIYA 1T8QA 1ADDA 4E2VA 1M68A 1YYAA 3L12A 4P5UA 3EMZA 3NDOA 1JR1A 3GDMA 4PSPA 4RDVA 4FNPA 3D46A 3GNPA 1BWLA 4ZSTA 4GY7A 1RR2A 4M81A 4HJWA 3VZYA 3M0IA 3UXLA 4R34A 1IZCA 1XIEA 3L2IA 3AU6A 1QI4A 1ZS2A 3NGJA 4WVXA 1ZLPA 4GXWA 5MKGA 3NEHA 1AJZA 3BGGA 3SADA 2BNJA 3UJ2A 4Z2LA 1IIGA 1KR1A 1ZY9A 2PRLA 4FLRA 1YTEA 2HNHA 2H8XA 3VD9A 4H8UA 1TA3B 3OGSA 4ZB2A 1E5NA 3L4WA 6PTDA 4KEZA 3VNZA 2F2HA 3DYMA 1XWYA 1ZBWA 1E72M 1YW1A 3GR8A 2Z2AA 4K8HA 1W3TA 4XK2A 3R8GA 3KBWA 4UTWA 3ARRA 4HYVA 4HNLA 3LY0A 4JD4A 4AX7A 3H2NA 1RJRA 4LSBA 3UXIA 3VINA 3DH7A 1RVKA 4N6EA 4UR9A 1ZCCA 3WF1A 4GLEA 3B97A 1AUSL 5KITA 3QFEA 1J0JA 1O95A 2WNZA 4UBPC 3B4YA 3W2KA 5K3VA 4GIAA 5BRBA 4ACZA 3AOFA 5BNKA 1FBAA 2OVLA 1EXPA 4MYAA 2ZC1A 2HVOA 5D2WA 2XZ7A 1OFRA 4ERAA 1E55A 1UMLA 3P3BA 1SZGA 3PZQA 3W7IA 4AZIA 3L4TA 2HTMA 1DHKA 4AZ5A 4QNEA 1OBAA 3W72A 1KFEA 2HE8A 1RK6A 1L6YA 1AW1A 2ZTJA 2BFGA 4IQJA 3SQLA 1IE7C 4W93A 1R47A 4MTVA 4M24A 4UTLA 3QHMA 3WY1A 4AW7A 5D30A 3UWWA 4J5NA 3EDKA 4LBRA 2IPGA 4TIMA 4AZCB 1U5VA 4GFIA 2PDFA 5FACA 1OEPA 3ZYZA 1YNQA 5EL1A 1VPXA 4C7GA 2XFRA 4AEFA 2D2JA 2NQ9A 3ABOA 3K30A 3H12A 1S38A 1E3XA 3PWGA 4CNPA 2GGEA 4YIWA 4Y7EA 4YWIA 3WNOA 3BW2A 3HTWA 1XH2A 1MQPA 2QPUA 1YE6A 3WENA 1A5CA 5KETA 3USBA 3V5FA 4NHVA 3RAOA 3EKZA 1LORA 1UZHA 3QY6A 3NFUA 2INFA 2Y7FA 4ADSA 4JTKA 4XBSA 3U2ZA 3QSRA 1F8MA 4LBSA 3B8VA 3OZOA 3NQ2A 3M5YA 4UNKA 2XPKA 3CV6A 5HINA 1IZKA 3CZEA 4A3RA 2AOSA 4L5ZA 3JS3A 1JZ7A 3NZQA 4C7DA 4LQ1A 4UTFA 5LNRA 3RGTA 3LV5A 4KETA 3SSJA 1UH4A 3WQ6A 1VPQA 4DN1A 1PB0A 1LOSA 2J75A 3CXOA 4C65A 5ENLA 5A6SA 4QE1A 4DJDC 4O1AA 3L68A 1SW3A 2WC3A 3ID7A 2EGZA 2J27A 3BOXA 3TAKA 1ISXA 1EC7A 1PE1A 2B7PA 2IUZA 2OSWA 1Q7MA 1UR9A 2I5QA 1POJA 3SCOA 2PPGA 3GVWA 3M0JA 2J88A 1QPKA 1UQYA 1Q7QA 2QCEA 2WBGA 1Z3NA 1CXHA 2G3IA 3CL7A 4Q8VA 5A6BD 2IXUA 5IFPA 1OFBA 2Z28A 3M0YA 4QS5A 2CLIA 1EJUC 3W26A 3J7HA 4NAFB 3PFRA 1E6SM 2UV8G 3V0UA 4DNMA 3KP0A 4GA8A 2QIIA 2BOGX 5HA7A 7TIMA 3P6LA 1VPYA 1XSIA 2ZUVA 4AF0A 4LH8A 1PV8A 4MJ4A 4QTGA 4ZB0A 2B7QA 4AIBA 1WBJA 3N73A 1LRQA 2AL2B 3C2RA 4YWSA 1V79A 2IMRA 2VEIA 4RXGA 4FNSA 1X6LA 5D05A 4H9ZA 1W17A 4ERGA 5I2UA 1GONA 1NELA 1QFEA 1ISZA 3NDYA 4TOQA 1A80A 5FIPA 3RR1A 4MAZA 2REQB 4XZIA 3EOLA 4ZGYA 5JXQA 2I14A 4PFHA 3G2GA 1JULA 1GCYA 3MP3A 4LW7A 3W83A 3PNUA 3E12A 2ZZ7A 2CLEA 3SJ3A 4NJHA 1H7NA 4KEUA 3TYUA 3RITA 4GNVA 3IVUA 2CZ5A 2QCMA 1ESWA 3BLIA 1KWGA 1B9BA 4CLMA 4GISA 3CTLA 5K2ZA 1H7XA 3LCWA 4DM2A 4Q7NA 2PDIA 4A4AA 1GT8A 3RG6A 1BRLB 3CAKA 1I9CB 1XRFA 4LALA 3RPMA 3ITXA 1W2PA 1EEXA 3HOJA 4H9MA 4UCGA 1JFHA 3M44A 2Z29A 3ZJ7A 2FZNA 5LIUX 2WWDA 4BR1A 4Y9MA 4K3ZA 3MS8A 2WMFA 5ABHA 3OIXA 3KS6A 4W8LA 3VOFA 3EOSA 4NAEA 3POHA 3T2OA 4K39A 1L6FA 4AISA 4N02A 3ES7A 1UR3M 3EX1A 1SFTA 1YDNA 1G4TA 3A23A 3DC0A 3N9RA 1AODA 1B9ZA 3PPHA 4NX5A 3TP4A 1PHWA 4EP8C 2WCAA 1JCJA 1E4NA 5B80A 1MEWA 4NUWA 2FHFA 1JGIA 3UWQA 4ROPA 1GVEA 9RUBA 3R13A 2J7EA 1DHPA 1RCQA 1AQ0A 2FZDA 1LBMA 4JTHA 1UD6A 3N3TA 3S9IA 3WDJA 2PC4A 3H70A 4MWAC 3OVRA 1X39A 2ATSA 4LCRA 1JI1A 3KOYA 1I45A 4A22A 1NJJA 2YA0A 3QPZA 1DOSA 1JCMP 3S3GA 3EKGA 3S2MA 3CUIA 3GDTA 3MCOA 4PR4A 2BDQA 3UERA 1M41A 2E8YA 2A1YA 3GIPA 2G3JA 3OPSA 2V0TA 1Z8AA 3CAWA 5DX7A 1LDCA 4AU0A 4TQTA 4AIOA 4AG0A 1MEIA 1TVLA 4TXEA 1TIMA 4CD7A 3N6QA 4JFVA 3W1TA 4P7LA 3GHSA 3E0FA 5F1VA 1BLIA 1YTKA 1FCVA 3VNIA 4HPHA 3T81A 2FJUB 2OZ3A 2A3AA 1X7FA 3C0JA 4QITA 2VGBA 4PMJA 1LZOA 4JOMA 4XD4A 5SWUA 1R85A 2Y61A 3W7KA 3GO2A 4F2UA 1BSLA 1LOLA 2WSYA 2WSRA 4JIQA 2ZUSA 3W1MA 3B0PA 4Y8FA 3PUEA 1Q6DA 4XO6A 1OF8A 1W3JA 5LYRA 2ANUA 2QIWA 4QSHA 3KUMA 1LT8A 3VM7A 3W00A 3T44A 3MUZ1 3M7WA 2J8TA 2QJNA 4KF1A 1OC5A 2PAJA 2O9RA 2D22A 1V93A 3WQ8A 3ALGA 4QJ4B 1XUZA 4ZO8A 1XFCA 1S5MA 1WPCA 4GGBA 1BVNP 4M7SA 1UH2A 1CXLA 1ZNNA 4MDOA 5F7UA 4IGMA 1FQ0A 3AIVA 3F5LA 3WQFA 3IWPA 4BZYA 4GYPC 3SCUA 5HOSA 4Q22A 1CDGA 1H7OA 3VIFA 3AUOA 5E6YA 4AX6A 2W62A 5CPMA 3M0ZA 2VGFA 3MZNA 3TN3A 3GHUA 4C1KA 4JX6A 1GUVA 3WUEA 3G0XA 2P76A 5BMWA 2AAAA 2HBVA 1VJSA 1A3HA 4EK7A 2FHBA 2Z25A 1GZ1A 5BYWA 2BY2A 1R9YA 2F9RA 4V28A 3F1QA 2F7FA 1I1XA 2BHYA 2VR5A 2BVTA 3L0NA 3BC9A 2VR4A 1S2TA 2XWEA 3PAOA 4Z2GA 1XBYA 3GW3A 4XZNX 1QI3A 1QPQA 5AYXA 4G7EB 1MYRA 4IH3A 2GGJA 1RJPA 1UWUA 2VTFA 3P80A 1TR9A 1H1ZA 4C6LA 1T8XA 4MDPA 4M8UA 3ZFHA 3W6MA 1PYMA 4QDMA 4YNGA 1AH4A 4GPNA 1KO0A 1ZPTA 3DG3A 1P43A 1ZU8A 2ASHA 3GHTA 4KCUA 5I3JA 1VBRA 3S1GA 3G77A 3E0WA 5I3HA 4LWWA 2WMGA 5HMDA 2RDUA 4RK8A 1Q63A 4NI3A 1Q4WA 2HBXA 2XH7A 5LHFA 5AECA 1WA3A 2QDEA 1R0MA 3LTPA 1XV8A 2DT3A 2E77A 4I9MA 1RBOB 3PG9A 4PCFA 3WQEA 1F3EA 4UFMA 4DZAA 1X6UA 3GDRA 2XVLA 2VKZG 3LB0A 4GIEA 1P4CA 4W7VA 4ECLA 3JUGA 1YXYA 1AL8A 1NFGA 4V15A 5C2XA 3P0WA 2RAGA 5K7JA 1H1NA 2PBOA 1X96A 1NQ6A 2YA2A 4GQ0A 4AEEA 2BODX 4HZ8A 2Z4GA 1Y8BA 6REQA 3TWBA 1XGZA 2ZX9A 2RDWA 1IGSA 4DBSA 1KXVA 3R2GA 2QAFA 2ABAA 3CIXA 2DZTA 1SPQA 4J35A 1W1IE 4B4FA 5HQEA 4LAMA 4F40A 3TCSA 4S3FA 1D3HA 4F0SA 3FGCA 2X7WA 1PKLA 3VX1A 4GZJA 2Q71A 3ZVHB 3UCDA 5M17A 3C56A 1FKWA 2WHKA 5DCDA 3W01A 5EB8A 3S9ZA 5CSUA 5CGMA 1Z48A 2CBVA 3N04A 5CSRA 4K1WA 4ZB5A 3ANYA 3KL3A 3FFSA 3WG6A 3DX5A 3QYQA 3NO3A 1K4GA 4FALA 1JPMA 3VZZA 1SU5A 1TJ1A 7A3HA 2FGLA 4RR4A 1GQJA 5H1WA 1GHSA 1EJRC 4UOZA 4XG1A 1PBGA 3ITYA 3VOCA 1HT6A 1S2VA 3AXMA 3H2MA 3LTSA 3HMCA 2NSXA 3GH7A 1X97A 3KW3A 2Z0IA 5CZSA 1SMAA 2YCEA 4NQ1A 3OIHA 1FY6A 2DDXA 4MNLA 3KRBA 1QO2A 3WLRA 3VIOA 2VHLA 3PZ9A 3M0VA 3KLLA 1M7JA 2JE8A 2PA6A 4C6QA 1NH6A 4LU0A 4RW5A 1H5VA 2V8ZA 3C2VA 1H1YA 3W85A 3RR4A 3WD3A 3E38A 3B04A 5D9PA 1R38A 4CGTA 1ZHAA 2ZX5A 4H9XA 3ZT6A 4AUBA 2QDGA 5C55A 5LIKX 2PLJA 2GQ9A 4FNTA 1BYDA 2W9MA 3UWYA 1RLCL 3SY1A 3WQCA 4Q7BA 2D3NA 4WDTA 1N55A 1KFWA 1PUDA 3PZVA 1MXSA 4LV9A 1ZZMA 5LNUA 4MOZA 2NQLA 2H9AA 2ZRVA 4KRZA 1TFVA 2YCIX 1AFSA 3A4JA 2FPYA 1HJUA 3BSHA 2PP3A 1PIFA 3E96A 2Q8LA 5GNZA 1XSKA 4C6NA 1J9YA 3C8NA 4XD3A 5CZ0A 3N34A 1Z32X 3FEQA 3WMCA 1RAKA 4S2BA 3H4XA 4UTWC 4DXXA 3STEA 1J79A 4WD0A 2P3ZA 1W54A 4R9OA 5LNSA 3WJXA 3WD0A 5CGTA 5IHRA 1DORA 5C54A 1HL2A 4FPSA 4C6CA 4N4QA 2BZNA 4UC5A 2RDTA 2XIBA 2PF0A 1U1UA 4BA0A 4I5XA 2QCLA 5KMYA 2JALA 3QZAA 2DZWA 3FLUA 4C1LA 2ZRZA 3W7MA 1F73A 3KLKA 4W5UA 3W7NA 4UTIA 3SBFA 4IMAA 1XD0A 1YPIA 4ASTA 2O7SA 3UZYA 2WVSA 3SQSA 1Y5XA 4MZ1A 4J4KA 4PBGA 1LJYA 1QI0A 3U2CA 1J6PA 5GVJA 3TN4A 4FF7A 2D0HA 1UKOA 4PUDA 3R12A 3F4NA 4O57A 1E4IA 4OV4A 5LIWX 2G5WA 3QY8A 2W6RA 2NUYA 1PAMA 1B3OA 4H1ZA 3WNLA 4Z2KA 3UG3A 4CCCA 4Q6JA 1TG7A 3E02A 2JKAA 3FHAA 4IUOA 2VNCA 4AAJA 1JYXA 1EWEA 3ITCA 4IT1A 4M6UA 1H49A 1UCWA 2WNNA 4CNSA 3W25A 3AC0A 4AY1A 1RLDA 4WKHA 1MWOA 3BGAA 4YN5A 4UTKA 5DMNA 4E8GA 3Q94A 1KFJA 1ZBCA 1I75A 5FF2A 1EB3A 1K9FA 4DWSB 1JD9A 1WKYA 2E5BA 2DIEA 2OELA 5FJUA 1E1FA 4GVIA 3P5YA 2HCVA 4EWND 6CGTA 2QDHA 1JPDX 2V69A 2JFEX 3C6CA 5I07A 2J9YA 3RFAA 2J78A 2QPSA 1KXQA 4R33A 4PEKA 5JQ9A 2J9ZA 1H0IA 5TQLA 3RIKA 5D2YA 3MVTA 4K7YA 4LUJA 2ICSA 1E9IA 2Q3RA 3BAWA 4P61A 4YU1A 4HU3A 2QEZA 2Z00A 1HKVA 1C8XA 1LUCA 5FKYA 2BWGA 3Q67A 3MHFA 3A21A 4ILSA 3PY2A 1OT1A 3VIGA 3BAKA 2YIHA 3WLMA 3QV6A 1E1CA 3GU9A 3QMSA 4MSSA 4IP5A 2FFCA 1VENA 3HU7A 4H6KA 3ZWTA 3EWBX 4UTTA 3DG7A 3IJDA 3UPMA 1ME7A 2WJDA 3RO8A 3T42A 5D9OA 5MF5A 5CG0A 3N2BA 3TFXA 1YTDA 4DVOA 3KOWA 2ISFA 1LP6A 3S47A 4HU4A 5CBJA 1UPPA 3T55A 3W53A 3PVFA 3DHUA 3RLVA 3STGA 3EA2A 3M0KA 3U4FA 3BMVA 3O6YX 4S3GA 4PRWA 1QWKA 2ZX8A 4LFYA 3OA5A 2V9DA 2WAGA 3S46A 4JBRA 4C90A 1RP9A 1XXXA 1EJVC 1NFPA 3C4UA 2V68A 1CI1A 4PBFA 1K6AA 1WDPA 4DI9A 3URNA 4BI6A 5G1MA 1OGSA 3EWXA 1X38A 2HK0A 3GH5A 5A6BA 3R8HA 4XO7A 1DEDA 1H50A 1Z42A 2D73A 2VUYA 1XJBA 3SCWA 2CLPA 2BXZA 1IXOA 3W6LA 2V5JA 2J7GA 3VFLA 4XAFA 1VFOA 1SO5A 1KRCC 4F2BA 4GCAA 4R9XA 3THAA 1TMLA 4O1BA 4DF1A 4CQCA 1MW0A 4IFRA 5DXXA 1EP2A 1CGUA 1C93A 1XGEA 1TZ9A 1XPGA 4W86A 4HMCA 1K3UA 1F6YA 1KLZA 4CN1A 2XN2A 2EAWA 4UQ9A 2DZSA 1KTBA 3EWCA 4QQUA 2FJKA 3UGRA 1NM9A 4GZEA 4BQ5A 4J7RA 4ZQOA 4IFOA 1K7FA 5LNWA 2WLYA 3FJNA 4B92A 1GQIA 1UG6A 4NSBA 3U5YA 2ACQA 1MUMA 4JKLA 4PMOA 3QZEA 5ABEA 1KFKA 1S3TC 4XZBA 3RLHA 1GYNA 2W79A 3M0MA 2QT3A 3GUGA 3APYA 1JQXA 3CLWA 2F38A 5HK4A 1KRMA 1HKWA 5I24A 4AZ7A 5CC3A 2CBIA 4D71A 3BMWA 3FK4A 2BY1A 3S5NA 3S2LA 1HJQA 2PTXA 3RILA 1O68A 4H04A 3PR2A 4M3PA 1UD3A 2W66A 2XZ9A 5BMXA 3DHDA 5AY7A 1DVJA 4UB9A 3VIIA 1VBJA 1VFHA 3W86A 2WANA 3V75A 4JL1A 1YDVA 2Y5SA 4EAMA 1N2VA 4EF9A 4UIOA 3QHOA 1OF6A 4JEQA 2J6VA 2DZXA 2E1WA 3CV1A 3QKZA 4U3AA 2DSKA 2AAMA 1OFOA 4XVEA 2FB2A 1FTXA 1L6SA 4JY9A 1S5WA 4K1GA 2Z24A 4WJXA 1ZAHA 5H8UA 2CHRA 1N82A 3UJEA 3TZFA 3QR3A 3TR9A 3FEMA 1DJYA 3HJEA 4W8AA 3LHWA 4J40A 3HV9A 1QO5A 3SSZA 3UR5A 3NSXA 3UESA 3MV01 3GIQA 3VAVA 1A5AA 3VGBA 3S5YA 4H8HA 4NP7A 3BK0A 4JKMA 1V6XA 1GQNA 1UD8A 1QNOA 4LCSA 1IEIA 3Q2DA 4JYFA 2HRWA 5L9FA 4MWAB 1RD5A 3UY8A 2PDPA 3PJXA 3UZXA 4TVUA 4HHLA 3OZYA 1G0CA 2QVHA 3TTEA 2Z1XA 5TBOA 2R91A 4DELA 3E5BA 1GG1A 1TPVA 2G4FA 1AW2A 2PDKA 4MB3A 3OEXA 2GPTA 4S3BA 4PMUA 5A5WA 5RUBA 3UWUA 3WDQA 1EJXC 1ZUAX 5LIYX 3L2LA 5D8WA 2XINA 4JQ1A 4IQDA 2GZXA 2ZE0A 4X61A 3H7UA 2VYOA 4UNIA 2PLMA 3DYOA 4GUJA 1NDVA 5I0DA 2ACSA 2PD9A 3RU8X 1TTIA 3TQKA 3T0AA 3FAXA 5U7SA 3FX4A 2DIKA 3U0HA 3E0LA 3WNMA 3QLDA 4O53A 1R3YA 3W6YA 3G24A 5M1TA 2CCRA 4E38A 2HVMA 1DIDA 4ZTXA 3RPDA 4LS1A 3TEVA 4B15A 3C2EA 4NX0A 3IV3A 2PEVA 1NVMA 3WLPA 3LCXA 1EBHA 3WBAA 2R14A 4XZ9A 3OYXA 2YL8A 2QCDA 1I6NA 2VMFA 2A3CA 4ZFCA 2VWSA 4KERA 4MB4A 3EAUA 4O10A 3ABZA 3GZ3A 1R3WA 4DUXA 3MWCA 1LWHA 2PWUA 4WY0A 3REQB 2X16A 1W9XA 3P93A 4ZENA 2IKHA 4IISA 1CZ1A 2PDQA 1HVXA 3MJMA 5HATA 1RY0A 4IIHA 2PI6A 2OWWA 1TRIA 4LVGA 2EKCA 4R3UA 1ZAIA 3NQ6A 5FF7A 2AGTA 2QCNA 2A79A 4EANA 1CIUA 3II1A 3IGXA 3WD1A 3HGOA 2I1OA 4A35A 5CZTA 3AWNA 1EO5A 3GTHA 3PUGA 4QJ1A 3TW6A 4RZ6A 2GWGA 2IQ0A 4QR6A 3GXNA 5DO8A 1W37A 3GWQA 4I6VA 1ZJHA 1WDWA 1XDLA 4Q4OA 1FA2A 1FDJA 2FPTA 2F6XA 1Q6LA 4PC8A 2NW0A 1N7KA 5A8OA 1UR8A 4XUYA 4E8DA 1FWNA 1YDOA 5H2ZA 1TIWA 1UZDA 4F9JA 3WDPP 4K68A 2VFHA 2XIMA 4E2DA 1QW9A 2C19A 5FL1A 5DMLA 3P14A 4ZE4A 1MW3A 4L1WA 2QCHA 2B4GA 4PH6A 2WLZA 4Q8QA 3MBFA 3WMSA 1US3A 1WOBA 4WOQA 2GDVA 4PL1A 2I5IA 4M51A 4GIRA 3H23A 4ZSUA 1UKQA 5DRIA 5CPNA 3AMCA 1ZENA 3PS7A 3TTSA 4J2PA 2UY2A 3ORWA 4M6PA 1XIJA 2CHOA 2EBNA 1XDJA 3KXQA 4MLJA 4HVXA 2V3GA 3DFYA 4L9YA 5HQMA 3CIVA 2E3ZA 1UC4A 3VNYA 5EMUA 3HURA 3NQGA 3F03K 1UKSA 3A3WA 2V6AA 1KRAC 2PTZA 3TX9A 2W5FA 2E9BA 3QV9A 4PB4A 4XKYB 4AY8A 3G1XA 3PP7A 1R3QA 3CHEA 5CZJA 4MY8A 2VL4A 4FNUA 5H6HA 1S46A 4AIEA 1R9XA 1PTDA 1ZRQA 1LM1A 4ZOAA 1UBPC 2D0GA 4IGHA 1H61A 2PLCA 1Q2SA 1GOIA 2E9LA 4O12A 3LBOA 3TE9A 1OJXA 1OFEA 2PDBA 2AQWA 2FQIA 4GUFA 3MKKA 3WH6A 2VD9A 1W9DM 3K8MA 3VI2A 1J6OA 3CL6A 3COTA 4OFCA 2WYSA 3HA1A 1PWLA 1P5BA 2A3BA 3PUDA 4IPJA 1A47A 2DW7A 4RDZA 3IAQA 3EXSA 1U1JA 5G5IA 4DUWA 4AY7A 3E2RA 4LXFA 2RUSA 1FXPA 4EX4A 3TWAA 1R7AA 2RHGA 4NY2A 4F0LA 3KDOA 4JTUA 4OBSA 1HJSA 4IIDA 1TYGA 2YW4A 4NZ3A 2R1LA 3SI9A 3LS9A 3S42A 4B5UA 4AD5A 2VRKA 2QV4A 5TF0A 2ZBTA 1FWBC 2DP3A 1DWHM 4FLSA 3NWRA 2XIOA 4Q4MA 1V3IA 1E71M 2WVVA 1TE6A 3SUSA 3N4AA 2E4TA 1CBGA 3EYPA 1XLIA 1Q45A 2E7FA 1K6WA 2ZADA 5GPRA 3VCCA 1ALDA 3AZSA 3LG3A 2J7DA 1O5XA 1GJPA 3ZLHA 3MCNA 1ZAJA 3H2FA 3H2EA 3CZLA 4QRNA 4N9EA 4MVAA 1UR1A 1EEPA 4O1EA 1UB3A 5FD0A 3RCNA 3O9NA 5EKYA 2J25A 1QCWA 3VABA 3W23A 1H63A 2PDJA 5MKGB 3A6OA 1S2UA 1F4HA 5HWMA 1LLZA 1DIKA 1KQZA 1NWUA 3PSVA 1P1XA 1B3XA 4S3DA 3KZSA 1PX8A 4KESA 1S1RA 5AZ1A 1RPKA 3EX2A 1XLJA 2B7NA 3I6TA 1XD1A 4NT0A 4XQ6A 2YCKX 3MU7A 1BGGA 5DFAA 5F1UA 1LRNA 4D6CA 4TVDA 4GYFA 3N4FA 1OZMA 3N3MA 3OA3A 2XG9A 5A6TC 3W1QA 4B5TA 1TWIA 3VVGA 2VRQA 1YNPA 3EOOA 1VHCA 1U22A 2VRJA 1T0OA 4ML4A 1TQXA 1BPLB 1SO6A 1JPKA 3CZGA 3PBYA 3CHCA 4BY3A 2YLLA 2NLIA 1HTIA 3G1FA 1V0MA 1UASA 1WUFA 1GVSA 1XLDA 4GX8A 4QE4A 1AQHA 4FNQA 2WO5A 1I2NA 3FVDA 4DNHA 2HJPA 1PIGA 1SO4A 3UCCA 1VEOA 3OOQA 4OIFA 4GJ1A 1V6YA 4F0KA 1US0A 4WOZA 1TCMA 3QGAC 3CBWA 2WMIB 3BG5A 4CQBA 1XLHA 1UH3A 1VFSA 1UOZA 1UYQA 5I09A 3GTNA 3MBDA 1YX1A 2DEPA 2PODA 3NQBA 3TJ4A 1POKA 3TSMA 1VCVA 1ELSA 1TMHA 3SAZA 1B57A 3VCRA 4QM1A 1JAKA 2E25A 5DCEA 1EL3A 4CU6A 2XFWA 4ZBCA 7PTDA 2YCLA 1XLFA 2QW5A 5FAJA 1CCWB 2BV9A 2IKGA 3VU2A 3VO0A 1RALA 4OHQA 2YXGA 2A6NA 2AGKA 2NLYA 1OIMA 4PTXA 2C15A 3ARPA 3N12A 4JIEA 3BW4A 2ZUTA 4DB7A 3I3BA 4XZMX 5LIXX 3QRHA 4MYXA 2W27A 5EBAA 4DLFA 5J04A 1A4LA 3B9DA 1OC6A 4UTTC 3DENA 4JIHA 3GYEA 1K9DA 4HU0A 3GG0A 4ATLA 3HF3A 3WDIA 2V3DA 3MW7A 3OU8A 3AXXA 1JUKA 3A24A 2Q6ZA 3T05A 3MP5A 3DFNA 2E40A 4TTUA 2ZUMA 2ZOXA 3N14A 1D7FA 1RY8A 1GYLA 5EFFA 2VT0A 3AIWA 4A8RA 3UQNA 1XI3A 1SMDA 1EQPA 1UD2A 1WDDA 5G4HC 1GJUA 2PU1A 1HFBA 4EVZA 1XIGA 4Y6GA 4EWJA 1OD0A 1MRQA 1W5MA 5FI8A 3SGZA 3M16A 2RH9A 1A0DA 2DT1A 3WLKX 5KSWA 1R3SA 3UPBA 5BCAA 2R8WA 2YL9A 3HPZA 4FA3A 4PUKA 3WYZA 2QXWA 2FTPA 4UFJA 4U2ZA 5LKYA 1KR0A 1W8SA 2ZRUA 4S3EA 4M29A 3M64A 3OHMB 3AALA 2DV0A 4RZ5A 3V5CA 3TOYA 3D6NA 3L4XA 1UWAA 4JX4A 4ZOEA 3NJ3A 5ABFA 3STFA 1XYBA 1JF5A 3MB9A 3MV11 1DWAM 2XM1A 3SN1A 2G50A 2PGFA 1UBSA 4L65A 3ITTA 5F4WA 1YPFA 4W4QA 2NX9A 3WK1A 2GYIA 1XICA 3ANVA 1REQA 3C2YA 3URQA 1A53A 4IPPA 4Z2IA 3TROA 2QJGA 4TV6A 4BEUA 3EOUA 2YDRA 1W9UA 3B8IA 3LDVA 4M0XA 2RGLA 4NF7A 3QOMA 4HOXA 1PZ0A 3QBUA 4F48A 4UMCA 3EZ4A 3S0CA 1NP0A 3B8WA 4DJFD 3FYYA 1WXYA 4C6DA 1CENA 3VKJA 1HN1A 2VGGA 3M1ZA 1Q66A 1ZJBA 1F76A 3GDBA 2UY3A 3B06A 3FOKA 5I02A 1M1BA 4TTGA 3UJRA 4GBUA 1DJNA 7XIMA 4JGDA 2XUCA 3AZRA 4HZ7A 3TA6A 1H7RA 4U4MA 2VI0A 3MSYA 2UWFA 3WJZA 1EA9C 2D2GA 3R11A 1X7IA 4KIEA 4GQRA 7REQA 4LRTA 2EO7A 1UIPA 3NR0A 3BARA 2QUVA 1WOAA 5XIMA 4AEOA 2GJNA 5I78A 4DJED 4YCPA 4ZOBA 3CPRA 4IUGA 4D1JA 3G6MA 1PYFA 1XIIA 5HPOA 4ZR8A 3L21A 3B4UA 3QGVA 4KH2A 1JXKA 1GNXA 4J3SA 1V3JA 2G3NA 3LBMA 1XYLA 1XL9A 3VE7A 3WCZA 4FXJA 1H60A 5CKSA 1MW1A 1KM6A 1EC9A 2CBUA 3DC8A 2JEQA 1RQEA 2VJXA 3N13A 2XSAA 3W73A 3VUSA 2VC6A 2VP8A 5E93A 2QUMA 3IGHX 2ZVIA 1IT8A 1VRXA 1FWRA 2UZ9A 4IPLA 3LERA 3NOYA 2GSJA 4XAPA 1JRCA 1D8WA 4B9YA 1H51A 2YR1A 5DY2A 2CKSA 3CH0A 2H90A 4IFKA 4B5NA 3SURA 1GTHA 5T91A 1OINA 3IPWA 1EX5A 4S3AA 2NV2A 3NQCA 3ZJKA 3ITOA 4WSHA 4O18A 1NOUA 2A5HA 4ZODA 3TAOA 3WJYA 3BPWA 4KFOA 1FHLA 3E9AA 4N42A 1IQ8A 4P7RA 1T7LA 2ALDA 1DWFM 4QNWA 2YCJA 3BZJA 1RSCA 1XLMA 3TYCA 4IWWA 3LYEA 4C1NA 3PPCA 1Y7VA 4JX5A 2E6YA 4OVXA 1OADA 3PZGA 1V0LA 2IXVA 4O13A 1UD4A 6TAAA 2G0WA 1EDTA 3BJSA 3RLGA 3ZJ8A 2J6XA 3DFPA 2Y63A 2B7OA 1WB0A 1JYNA 2ZX7A 1TPEA 4H9TA 1RV8A 4TVCA 1HKJA 1KBJA 2OO0A 2DUAA 2VEFA 3O6AA 5AB3A 4YTUA 3T7VA 4D1IA 2BXVA 4JTQA 4GFSA 3KL0A 4J3UA 1D7KA 3QZ6A 2G8ZA 3W2NA 2VWTA 3RCMA 5EY5A 1ITUA 1TX0A 1TQJA 4WDXA 4W5ZA 1JAEA 8RUCA 3GVGA 3CUZA 1RBLA 1X1NA 3RX4A 1V3LA 2WMKA 3RM8A 5FJRA 2UY5A 3EA1A 1ZP4A 4GI6A 3UR8A 1OFPA 2OKTA 4QFUA 1FOBA 1TA3A 2X0YA 2OWCA 2RDXA 4MB5A 5T26A 1IGWA 3Q37A 6XIMA 2BMBA 4WJEA 3ATZA 2Z2BA 1KKOA 3AIEA 1OIFA 3G18A 1ECQA 5HMSA 1UKPA 1KTCA 3ABQA 4I9JA 1XH1A 1WE5A 3TC3A 2R1KA 3VD5A 4W8BA 4PODA 4LS0A 2Y89A 4HMEA 4DO7A 3PNZA 1XRVA 4F66A 2ZXQA 4H4IA 3AFBA 3ICJA 2DZAA 5HPCA 5K9DA 3ZS4A 3CUGA 4QG8A 3TN6A 1MZHA 1KXTA 3CU2A 4GVGA 3WUFA 2WNQA 4B90A 2GDUA 1P0BA 3L0KA 4CCZA 4FXFA 3VFCA 5HMFA 4G1NA 2WM0A 3NL2A 3UVIA 4FF5A 5HBFA 5DRCA 1LG2A 4EXAA 2WQPA 3DZ1A 4WKAA 4DWSD 4HNOA 4BF7A 1SW7A 4U33A 2Q3OA 1G7VA 4JN7A 2PWEA 1IT0A 1GOWA 4LVFA 2PUZA 5AFDA 3LENA 1E56A 2XHYA 3GTIA 4LVBA 5BU9A 4AZCA 2XTKA 4GQGA 1UZ1A 4OBTA 1TPDA 3LCIA 4WIWA 1PL9A 4C6EA 1NP2A 3FSUA 2OMAA 3PBVA 2E6DA 3NL6A 4QP0A 3GVQA 2Z6IA 3WQDA 3F4DA 1NF0A 5BXTA 2VC5A 3LCGA 3MSRA 4MADA 4U10A 1SUXA 1QHPA 1NAL1 3L2MA 1BVWA 1CLKA 4GACA 1ZJAA 2DJLA 2HDJA 6REQB 3QYSA 4AXNA 5HMEA 4M7TA 3AIQA 4JAWA 1ZCOA 1B31A 2AQVA 2YZRA 2VEMA 2NUWA 4O0QA 5FJJA 1QNVA 3G0SA 4OUEA 4P7NA 2VEPA 4M6QA 1Q13A 1QNSA 4KCVA 1G5AA 4JTSA 3EA3A 3GIYA 1QPNA 3UR2A 1G67A 3N2XA 4V33A 4DJDD 4FX8A 2HK1A 3IAPA 3HV8A 1RXOB 2WSPA 5TAOA 3W02A 4XIAA 3MI6A 4K36A 4WR3A 3VGGA 3VNMA 1P7TB 1L8NA 5CAHA 1DJQA 5CSSA 4D72A 4BF9A 4L9ZA 3BLPX 1S3HA 1JUBA 3F5KA 1VEPA 2C1IA 2V2CA 2YBTA 4AD4A 3W1NA 3EPMA 1G4SA 4A2RA 2FZMA 2VZOA 4PE8A 3LI1A 1BXCA 3IUDA 1TWSA 1FP8A 1TMQA 3TDFA 4MZ8A 4ICMA 4LAOA 2B81A 4ADUA 2F6KA 4NAFA 2HWGA 3GG8A 3WF2A 3QMRA 3O1NA 4Q8PA 3Q65A 4LAKA 3AAMA 5IOBA 1YADA 4DWDA 1UWIA 2B0MA 5J5DA 1J10A 1JF6A 2VX7A 2QYGA 2AL2A 9CGTA 4BWLA 1OG6A 1W6TA 4B5SA 4IMFA 4LYKA 3NQ7A 2XH2A 3PJTA 3GRIA 1RH9A 1BXNA 4PMRA 4IL2A 3D5HA 1TV4A 2Z1BA 3IIOA 4EPDC 4ZZ9A 3IRDA 2BGSA 2XJ7A 1V8EA 3CB8A 4L4MA 2GGGA 1MQQA 4L80A 2DZVA 4IIGA 2XU2A 5EMKA 1C8VA 2REQA 2VQTA 3NPUA 4O1DA 3SZ8A 4KWSA 3QPEA 3BV7A 3L65A 4RE4A 3VILA 2H9AB 1XP3A 1TX2A 4TX6A 4Q4SA 2GOKA 5L6UA 3PHAA 2PU0A 3LQGA 2FMNA 1PSCA 5LZLA 3UWZA 1QPOA 1ME8A 4FSAA 4Q33A 1P0DA 3NQAA 2BGNE 3DDMA 1I0DA 3VPLA 4L6OA 3SCPA 2V3FA 3NO1A 3DI0A 1HJXA 4CU7A 5M03A 4E3VA 3GC5A 3E1F1 1HKMA 1WO2A 1JEZA 3LHVA 1C90A 2VD8A 5D37A 4I3GA 1OHLA 3R79A 3TKFA 1S1PA 4UCFA 2OB3A 1O6IA 1RD6A 4YS1A 1W1A1 3W07A 1VAHA 3THQA 3ONCA 3TNBA 3AYRA 3MVIA 3HQ1A 4RW3A 2D20A 3VOJA 2PLKA 5B7YA 3P60A 3I7RA 2OYLA 2YSWA 4GJJA 3CQJA 4LF1A 1KV5A 3TYEA 4INFA 3W82A 3RXZA 4G5DA 1ZQ5A 3EX4A 3SUWA 1FH9A 3WFAA 3PZIA 1MUCA 4IM4A 2R82A 4BK9A 1OGGA 1AD4A 3MT1A 1GPFA 3B3DA 4P8XA 4K8EA 1FWTA 3B0YA 5JH2A 3W76A 4GHRA 1PCWA 1GGOA 3FXGA 4KBXA 1KM1A 3H53A 3H4GA 1VYPX 1MNZA 4A8IA 1EGZA 4C6FA 4F0RA 4MWAD 2ESCA 5G2WA 1K8XA 4GY0A 3TJLA 1ICSA 2ZRYA 1P0EA 4MPQA 2OZ0A 4GKTA 1QATA 4QSFA 3VDCA 1MI3A 6ALDA 2E09A 5KINA 5E5CA 2J74A 5FJOA 3M5VA 5DBTA 2VR2A 3BURA 5FJPA 3UU0A 5TIMA 4YHEA 4Q8UA 2WZIA 3VOIA 2YDAA 2BSLA 3H2OA 4DYJA 2D24A 5CQ1A 1AW5A 1QRQA 3CLMA 4LUSA 2PF8A 2CXEA 1JCTA 4O52A 1IXNA 2QMJA 5BOFA 3N6JA 4US5D 1W0MA 4JFUA 2XGBA 3BCJA 1JG9A 4JTFA 1FHDA 4Z0SA 5HJXA 3MMDA 4JHZA 5T9CE 3LI0A 3HBLA 2XIJA 5DANA 3KAOA 2NVAA 4S2CA 3AI0A 4FR6A 4A2SA 4J3VA 3UR7A 1IT7A 2ZZ3A 3RYSA 2DJXA 3KHJA 1W5PA 3NUKA 3PTKA 2Q01A 2NT1A 1LUCB 2IPJA 3L0GA 4GVHA 3SR7A 4GOAA 2PCEA 3PPGA 4AIUA 3UNTA 3MMTA 4NNBA 3HG4A 4WJ8A 1O94A 3MC5A 3O2LA 4IP7A 1WDRA 1W3IA 5AYYA 1H41A 3V18A 5LSMA 1CLVA 1ML1A 3TR2A 1LYXA 3U57A 1FWJC 1X1ZA 3WLJA 4L4PA 1VLWA 2V2HA 3UY7A 3W2MA 3T09A 1BVZA 4MJMA 4LX4A 2O56A 1YMYA 2I9EA 4OBRA 1Z6KA 5HWNA 3U2OA 3CHFA 4XIMA 1TPB1 1KBLA 1RK5A 2X0HA 1K4HA 2PTYA 4AZ6A 2GWNA 4JIRA 1XLKA 4W89A 2FLIA 3UEQA 3GUWA 3I3DA 1XIFA 1V6UA 3T1GA 1QK2A 4ZQCA 3DOPA 3LPGA 4UQEA 4YTQA 2DH2A 1M6JA 1VBUA 3I6RA 3W81A 1KC7A 2J47A 2R24A 3AJXA 2ZC8A 4G7EA 3ENLA 4I7UA 4IF2A 5CBBA 4H83A 3CZJA 5I03A 4PUMA 4UOJA 3BSGA 5D8ZA 1ZALA 3RPTA 2L5HA 4KWWA 4PMNA 3NURA 3O0FA 4ATDA 1NOFA 4B9ZA 4BQ3A 3R10A 3BDKA 1JQVA 3FA4A 3H7VA 5FSDC 1A3XA 1HUVA 4UMAA 3V16A 2VFFA 3QW4B 1SW0A 1Z89A 3RRAA 3H8AA 3MI3A 4WUIA 1CGTA 2BB0A 1BXBA 3K4AA 1OK6A 5K9XA 2BHUA 2Y5JA 4LC8A 4MFEA 4MY9A 1TJ2A 3KE0A 3W75A 2XIQA 2QUNA 1HJVA 3UYCA 3UD6A 3CMJA 5M3WA 2W67A 3AU2A 3KEHA 4ICCX 4REQB 1V6VA 2C14A 1RZMA 1LTDA 2WW5A 3LM3A 1OQFA 4RE2A 4MAVA 1TZZA 1XKJA 3VKCA 3W7CA 1YDYA 3NZPA 1KW1A 2VZVA 1FWAC 1HJWA 2O55A 4Q4RA 4DJFA 3RM9A 1JZ3A 3QC3A 1DE5A 5F2MA 2PC8A 1BF2A 4DX3A 1WAWA 3T9PA 3PJWA 1LWJA 2OO6A 1C9DA 1E6RA 3F5JA 5D04C 4UOQA 3TTOA 3OBAA 1UUQA 3ZVHA 2H6RA 3VUPA 4UXDA 3GXTA 3T0TA 4H6RA 4ZE5A 4H7CA 3H55A 2ZUNA 4O50A 1WKEA 1Q4NX 4HYWA 3LGEA 3NA8A 3SRKA 3O6CA 4PUWA 3CWHA 1W1TA 3AZTA 3G3DA 3WH9A 3SUTA 2VVSA 1A3WA 3HGRA 4LUTB 5IDZA 4DJEA 3DKLA 3IK2A 3ZT7A 4IMCA 5D32A 3A4AA 3WLLA 4KT2A 3QQWA 1PX4A 4LNYA 3ARUA 2EPOA 1TV5A 2V38A 1QAPA 1H62A 3LRKA 4PTDA 4YTTA 1S2WA 1UP2A 5AN7A 3T2PA 3ITGA 2E28A 2O9PA 1G6CA 2Y5EA 2Y2WA 5CPQA 3P74A 3ZT5A 2E9MA 3RNDA 2WVTA 3VMPA 2PP1A 3FA3A 1KM5A 1MXDA 3VOGA 3T78A 2PGRA 1ITXA 4M5PA 3KWXA 5HXMA 4GH3A 1E1EA 1VEMA 2GLKA 5I3IA 3CWNA 3F4WA 1NWRA 4B5VA 3T8QA 3GNRA 4QXIA 3LA4A 1YXCA 4QHRA 1L2QA 2V5CA 2NQZA 1O5RA 3OQEA 4PUEA 4F2TA 1EJ7L 4EACA 3CYVA 3RX2A 3LEPA 3KOFA 4N9BA 2HXTA 4AD3A 1XCXA 4Z0JA 1EDQA 4EPKA 3KWSA 3C0LA 2EPMX 4M1BA 1LQ2A 3ZWSA 4LCQA 3W7RA 2ZZ1A 4FIRA 5I6SA 1F3TA 3B0XA 3WH7A 1GEHA 3EGJA 4AXKA 4G9PA 2BS9A 3SCNA 3W1XA 4I5RA 2CLOA 1XRSA 1XRTA 1XH0A 2DQXA 3KBJA 3P0XA 4DBUA 3MUAA 4GNJA 3GXDA 2VGIA 1C8QA 1T5AA 2NWSA 3RJYA 4XZLX 1PO9A 3WEOA 3DHFA 3VCNA 3MHUA 4ORIA 1KBBA 2BP1A 3AIBA 3PPFA 1QTWA 4QAWA 1SZFA 3A22A 3C0SA 3GNNA 2NQ5A 5HR7A 1ZTVA 1MDRA 1RCOB 3V4BA 3A12A 4WY0F 2WJZA 2AMXA 1RA0A 5C0QA 4Q4KA 3NPXA 2CLLA 3TSDA 5C7VA 1EC8A 3C86A 3FJ4A 1BWVA 3KBMA 3W7GA 3G1YA 1SJDA 1GVQA 4L4OA 1XLBA 3VZXA 5BWAA 3QC0A 3VNDA 4Z1BA 1FDYA 2JBMA 3K4WA 4BKNA 2A85A 3GBEA 4RPQA 3VXGA 2Z1VA 4J3WA 2CZEA 3H24A 4IX0A 1GOMA 1LG1A 1G4EA 4O4VA 4Z17A 3WMBA 3G1SA 2A3EA 3U3HA 3NYZA 2C71A 1R87A 2AL1A 4Q4PA 4QQ3A 4DQWA 3EMCA 3AMKA 1XG3A 1DXIA 5AC7A 2FZ8A 3K46A 3M4HA 1XLAA 1OGBA 4XD5A 3P62A 2J7CA 3VE9A 3FAWA 3KRSA 2A7PA 2FGZA 4GZ7A 1BKSA 3VMOA 1LRTA 5CG7A 1LL7A 2V5DA 3WNKA 3W7JA 2WKGA 4KPLA 4DO4A 1A0EA 1NTHA 1YBQB 2X1SA 3QXBA 4CEXC 4K37A 3IVSA 4NRRA 4RDWA 4KWVA 4D6FA 1PVNA 4AFYA 2NV9A 1TVNA 1ADOA 3MKVA 3VGEA 4DWSA 7TAAA 1QUMA 2NQJA 1KXHA 4IJBA 3ZO9A 3NVDA 2FDMA 1HGYA 4DI8A 4R27A 2F2KA 1CEOA 5LA0A 1IXQA 3CTTA 3ELFA 3VC6A 2PS2A 1RP8A 2V3EA 2GOUA 3HPAA 3W70A 3LZ3A 2J4GA 4Y9PA 3S6TA 2V81A 4NZ5A 3FY1A 3T40A 3GNOA 3M0HA 4MKSA 4AVFA 4JQ3A 3WJSA 4B2DD 4C60A 3PB2A 1K9EA 3NVTA 3UYIA 4KKXA 2V82A 1VC4A 3EEZA 3M47A 4NG3A 1E5JA 2WKJA 1MDLA 3DFHA 1KNWA 1NIUA 2WPGA 1QU4A 2HV5A 1CGVA 1I2PA 4BF5A 2ODOA 2Y7GA 2DY3A 2IKIA 3H2AA 3IARA 4QEEA 2YBUA 4NZ1A 4OWGA 3G1DA 2JKPA 3MY9A 5A8QA 3MDWA 3WNPA 4XWUA 3MUCA 2YXXA 3W9ZA 1ITQA 3SFWA 3PF3A 2CZFA 1W8GA 4GX9A 1XBXA 1JL8A 2GJXB 4I6KA 1Y5WA 1GVYA 2XISA 4LVAA 3VNLA 2ZDRA 3L23A 4QJ5B 2DSZA 4DJDA 1IIHA 4J2MA 4X2RA 1GW1A 1TWDA 1GVFA 2VZUA 2VOMA 1VJZA 4P7OA 4WEVX 2D2OA 1O66A 2TYSA 4JHMA 5A2CA 4DZ5A 1J11A 2Y0FA 3OVGA 2P3EA 3D3FA 3PZMA 3WUGA 2WZHA 1MXGA 3ZOAA 1R7OA 1SJBA 1M03A 3L66A 1UKTA 4MJ2A 3DERA 4OJYA 1QPRA 3HQPA 5E6ZA 3CPUA 3PB0A 4CUCA 2F8QA 3BICA 3LGDA 3G3MA 4JDYA 2B31A 2A4AA 4V1XA 4GK8A 2FTWA 3AUJA 1XUUA 2XWDA 2DGAA 1VBGA 4GBDA 1PKNA 4JXCA 3Q58A 1L0PA 4HPXA 1TPUA 1OX4B 2VDIA 3T4CA 3SJNA 4C6MA 1H2JA 3HGJA 2VO5A 3AS2A 4HNUA 5H91A 1JDCA 4BQ2A 2Y7EA 3GNXA 5AHFA 4WZHA 1Q8JA 1QASA 2ISDA 2HROA 2WHLA 3GD6A 4NNCA 1CGYA 3EB2A 1KBKA 3S1UA 1W1PA 1XYCA 1KV8A 2TRSA 1UWQA 5E09A 1KRBC 3EWUA 1Q6OA 5JBEA 3OZPA 4WSJA 4GYKA 3CC1A 4DPPA 1N8IA 3EWWA 3KTSA 3N1AA 3EOEA 5LGZA 4H01A 5DBUA 4H7VA 3ARQA 2XM2A 4ICNA 4EIVA 2OTDA 2ZUUA 3E74A 5E70A 4HN8A 3DHPA 3PTQA 4JEJA 2ZXBA 1W3NA 4JNZA 2RGMA 1WXJA 3CEUA 2HMCA 4DY1A 1RHCA 1WKFA 1EGVA 1X1OA 1ISWA 1VIZA 3R43A 2EJAA 1YPXA 3WUBA 2O9TA 2HSAA 1TWZA 1T96A 3W4RA 3B9OA 2ATMA 4CN4A 5C8BB 4L7ZA 4EKJA 3UXDA 2WHMA 2DUXA 1KGUA 4PL2A 1FFQA 5B7ZA 4PTVA 4PN2A 3QPYA 3A4XA 1JDDA 3IACA 4GMEA 3BCDA 4G1KA 1E51A 1HXJA 3W28A 3AHXA 4UZUA 4MF4A 3LHYA 3U6WA 2YDSA 4RPPA 4UQBA 3UXKA 1ISYA 4Z1DA 3AIUA 3HG2A 1XR2A 5G2IA 3SB0A 3TYZA 3GFXA 3SCSA 2YB1A 5CC6A 3NZ1A 1Q6FA 5TNVA 3L7RA 4HMDA 2WJEA 3RU6A 5M2FX 3AMDA 1H7WA 4CNOA 1PDZA 3BV4A 2V67A 1EGMA 4Q6XA 3GXFA 3NTYA 2RJHA 1N8FA 4QIUA 2X2GA 4HKPA 2VENA 2GVGA 1O1HA 4BI5A 4ORMA 1HL8A 1VR6A 2VFDA 3PG8A 3IUIA 2FVKA 4O16A 4NJJA 1OX6A 4A3HA 5AYZA 2FTYA 4RUBA 1B3YA 2CLFA 3BSMA 4TMCA 3MP4A 2ZA2A 3W2LA 3UWEA 1C3FA 4AC7C 5I3KA 3JRKA 5BXRA 1K70A 4MWAA 1EO7A 2QCFA 2JF7A 5HNUA 3VDAA 2WJFA 3DBPA 1YXDA 2DQWA 3GG7A 2QKFA 1I2QA 1KFLA 1EHNA 3M7SA 2O0TA 4GI9A 1J18A 1TPC1 5A8GA 1PDYA 4P8VA 1CGWA 1J12A 3ZVIA 1UJPA 3PSWA 3DCPA 2D69A 3B9EA 2ZICA 5FEZA 1H09A 3GFYA 1JPHA 3D0CA 4JTDA 5AVNA 4PCSA 3A64A 2YPIA 3B0VC 5C71A 4GC4A 1LBFA 3H4WA 3ARVA 1SGJA 4L1GA 1V02A 1J2WA 1Y65A 4GC3A 3S1XA 4A3QA 5JMUA 2G4JA 3CAVA 5BXPA 3VD4A 2P8CA 4AD2A 5FF3A 1CB7B 3WD2A 3S4TA 4HCLA 1KM3A 4US5A 4IOTA 1W56A 1AQMA 1KCZA 3QQ0A 4IG2B 2YA1A 1TUFA 3NL5A 4HSNA 3QM3A 1FWEC 5A95A 2EG7A 1HX0A 3AYSA 4O28A 4IPNB 3RDKA 2OZ8A 2EKGA 5BZAA 2GSHA 2ACUA 1BEUA 1UD5A 2C7FA 4HPNA 1YRRA 4QBXA 1U5HA 2NQHA 2FDSA 5HUPA 2QF7A 1IF2A 4W7UA 5AC5A 2WQDA 1TO3A 3FIGA 1JI2A 4GUIA 2FVLA 1SZEA 4CNTA 2WWCA 3F2DA 1DJZA 5GJNA 4JCMA 3I65A 3KCLA 2HEJA 3REQA 3ANUA 4FEZA 1UPMB 4KQNA 2Q8XA 2RJGA 4E6MA 1E0VA 1GHRA 4GO8A 3G0UA 1PKMA 4XV0A 3E3HA 3NQ8A 4X0VA 2Z1KA 5CLWA 1VKFA 3WQOA 1U33A 2WB5A 4XD6A 2VOTA 1PZ2A 3I6EA 3VDBA 4HJFA 2YOCA 1VFFA 4O19A 3BLOA 4KWUA 4H3DA 3QF0A 5HJYA 3CZ8A 3EX6A 5CZKA 1WQ5A 4QAIA 1E6PA 1K7EA 1NQKA 3UETA 3VMNA 4QS6A 3LGGA 3WQ5A 3MDUA 2IQDA 3EKLA 1LQAA 1EHAA 1KKRA 2ABBA 3CNYA 2VCBA 5LXEA 5HULA 1XIBA 5HJLA 3CUFA 3ZLGA 1CXEA 3GC4A 1HKIA 5D38A 3DIPA 5FA5A 3W7QA 3GLCA 2Y8VA 3VIHA 4FXRA 1D3GA 1MW2A 3SRFA 2QV5A 1XISA 4L61A 4A6GA 2OOGA 4H6EA 1JXJA 3WQ4A 1H5YA 3HGSA 1QNRA 3SIZA 3FDGA 4LGXA 3U7BA 4DBWA 3KL5A 1WZMA