3R94A

Akr1c3 complex with flurbiprofen
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
316
structure length
303
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of three classes of non-steroidal anti-inflammatory drugs in complex with aldo-keto reductase 1C3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
total genus 118
structure length 303
sequence length 316
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2011-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3r94A00
2PD5A 1XF0A 3NTYA 2DV0A 1AH0A 5LIKX 4JTQA 3BCJA 4GQ0A 1ZSXA 3N6QA 4LB3A 4DZ5A 1MZRA 2WZTA 3M0IA 2PDBA 3MC5A 4I5XA 3LZ3A 3FX4A 3ERPA 4XAPA 2PDQA 4WDUA 2PEVA 3V0UA 2C91A 3R8GA 3GHUA 4LAUA 1EXBA 1MRQA 2BP1A 4OTKA 4LBRA 3LN3A 4FA3A 3COTA 4JTCA 1AZ2A 4JTRA 4JQ4A 2PDIA 5KETA 2R24A 2PDLA 4ASTA 2ACQA 1X98A 1YNPA 2IKIA 3N2TA 4WDTA 4JQ2A 3LENA 2PD9A 5JH1A 1S1PA 5LIYX 2IQDA 2PDXA 4JTAA 2AGTA 1PYFA 4PMJA 2FZ8A 4YVXA 2IPWA 4JTDA 3RX2A 1C9WA 2ALRA 4YVPA 4FAMA 2PDGA 3DN5A 2PDHA 3Q65A 3V0SA 1PWMA 4WDXA 1HW6A 4YS1A 3LEPA 3WCZA 1M9HA 1QRQA 3CV6A 2F2KA 4QR6A 1X96A 4FZIA 3Q67A 2FZ9A 2HEJA 3H7RA 3UP8A 4IGSA 4L1WA 3RX4A 3R6IA 3B3DA 2IQ0A 1YE6A 4GA8A 2IPJA 3UWEA 3CAVA 1LWIA 1T40A 3FJNA 3P2VA 3GHSA 2DUXA 4WEVX 1S2CA 1XGDA 3WBWA 2HE8A 3D3FA 4EXAA 3G1RA 1LQAA 1UR3M 3KRBA 2PFHA 5LIXX 2QXWA 1VBJA 4WGHA 2HVNA 1XJBA 3UZZA 2IS7A 1HQTA 4GIEA 1RALA 3O3RA 1ADSA 4DBSA 4LB4A 3EB3A 3CV7A 4PRRA 4L1XA 2PDUA 4QBXA 4H7CA 1OG6A 1JEZA 3GUGA 4WDWA 4WRHA 4RPQA 4JIRA 2HE5A 1YNQA 4JIHA 3T42A 4JQ3A 3UYIA 4MHBA 1ZGDA 1S2AA 3BURA 4XO6A 4NKCA 3R8HA 4PR4A 3GHTA 4G5DA 1R38A 4IJRA 1AFSA 2PDCA 4EXBA 2ACSA 1PWLA 1SM9A 2FZBA 1K8CA 4Q3MA 1Z9AA 3F7JA 5LIUX 3RX3A 4XVEA 3LD5A 4DBWA 3WBXA 4ICCX 1X97A 2BGQA 3R7MA 2I16A 2WZMA 4YU1A 3H4GA 3LQLA 1QWKA 2PDNA 2FZDA 5HA7A 2PDMA 3LBOA 3MB9A 2HV5A 3R43A 4XO7A 2PDWA 1EL3A 2HVOA 4ZFCA 3GHRA 3EAUA 3UG8A 1EF3A 1Z89A 1T41A 4PUWA 2ACRA 4Q7BA 3UZWA 1ZUAX 3M4HA 4GQGA 3CAQA 3O0KA 2PDFA 3CMFA 4HBKA 4QXIA 2HDJA 3CASA 4IJCA 4F40A 2P5NA 3R94A 1AH3A 1YE4A 4XZNX 3U2CA 2ISFA 5HNUA 2PZNA 3C3UA 1Z8AA 2FVLA 3QKZA 1ZQ5A 2BGSA 1EKOA 1US0A 5C7HA 4LAZA 2F38A 2ACUA 3EB4A 5LIWX 3LNMA 4PRTA 2VDGA 4XZHA 2J8TA 1IEIA 2IKGA 4XVDA 3DOPA 2INZA 4GACA 5M2FX 2IPFA 1PZ0A 3M64A 2DUZA 4XZIA 1VP5A 2PDYA 2R9RA 5DANA 4DBUA 3V0TA 4R9OA 2PDJA 4AUBA 3S3GA 3BUVA 2FGBA 3WBYA 2IPGA 1J96A 3V36A 1GVEA 3H7UA 5AZ1A 1MI3A 1A80A 1Q13A 4YVVA 1IHIA 3V35A 1RY0A 1Q5MA 4LBSA 3BV7A 1RY8A 3R58A 4JIIX 2IKJA 1S1RA 5AZ0A 1FRBA 3LUTA 4JQAA 2PF8A 3ONBA 2PDPA 3WG6A 2IKHA 3LZ5A 3UGRA 2I17A 5HNTA 4XZLX 3VXGA 3G5EA 4GCAA 3UFYA 1AZ1A 2NVCA 3ONCA 2NVDA 4H8NA 4JQ1A 4FALA 1Z3NA 4QX4A 4PUUA 3UZXA 1PZ1A 3UZYA 3LQGA 4HMNA 1AH4A 4XK2A 2CLPA 5JH2A 2PDKA 4GABA 2A79A 2INEA 4XZMX
chains in the Genus database with same CATH superfamily
4F0LA 1W3JA 3C8NA 4GINA 1V0MA 1CX9A 1WXJA 1OQFA 1AH0A 3HQPA 5U7SA 3RR1A 2C18A 1KFEA 3BMWA 1UWUA 2WMFA 1OM0A 4NY2A 3W2KA 1R5YA 3MYPA 1NOUA 3T0AA 5CEWA 3ARVA 3MT1A 4PMUA 4C5YA 5KZDA 4MPQA 3HO8A 1CDGA 4LVFA 1W3LA 2WQPA 3EX1A 1E0XA 5D2YA 3KZSA 2ANUA 2BP1A 4OIFA 5C2GA 3WENA 5I06A 4KRTA 1FWAC 4PMNA 4I6KA 1C90A 3CHFA 4FR1A 1H7WA 4MMWA 4QJ4B 1NWRA 1CI1A 2E6DA 2PWDA 3IUHA 3VD7A 1BG9A 5D30A 4US5A 4LW7A 2ZIDA 2ZRUA 4J3SA 1F8IA 1JUKA 2DT3A 1Q6RA 3TTYA 1ESWA 4GH3A 3LXBA 4S3JA 1G0CA 2PD9A 4Y90A 3E0LA 3ES8A 4Y9PA 5JH1A 2X7WA 3TR2A 4PB3A 4RW3A 5E1QA 3LRMA 1AQFA 1BTMA 1XG4A 1LWHA 2AGTA 4DJEC 1K8YA 4KKXA 3GU1A 3N13A 3GXTA 5CG7A 3TV8A 5DMLA 5BOEA 1FWCC 4RZ4A 4FAMA 2PDGA 2YPIA 4S38A 5IFTA 4GXMA 5LNSA 2Z1KA 3V0SA 3WH7A 1HGYA 4FIRA 4KFPA 2CLLA 3E2RA 3HQNA 4JKKA 2NV9A 4BI5A 5J5DA 4WIWA 1XP3A 2WXDM 2UY3A 2BOEX 4HNNA 3RX4A 4RXGA 2J79A 1TWZA 5HMDA 3CUZA 1MNSA 4K8EA 5EL1A 1IF2A 3DGBA 2NT1A 1E71M 2JEQA 4Q4OA 1TV3A 3P2VA 4JFWA 4KQNA 4EWND 1Q7QA 1UR0A 4FPSA 4H9UA 3FYYA 3VKAA 3AXHA 1PIGA 3ZJ7A 4XAYA 3ARRA 3I3BA 2PPGA 1E3ZA 1UH4A 2CBVA 4Z1DA 4POCA 3WLJA 4KWWA 4M24A 2FH8A 1PJ9A 4AYSA 3N9KA 1RBAA 4TX9A 3IAPA 3CB8A 3N2OA 2ZOXA 4JBRA 4Z0SA 1BRLB 5BCAA 1NH6A 3WEZA 6TIMA 1F6KA 3CZJA 1QVBA 1I60A 1PZ2A 1TRIA 2FVKA 4A3RA 1H49A 4O52A 4IT1A 4J7RA 1H09A 1MUCA 2BXZA 2P50A 3QQ1A 1RLCL 2ACSA 5EYWA 1JAEA 4G1NA 3HMCA 2DZSA 1IZJA 3JZUA 4P7NA 1ZJIA 2G3IA 2ABBA 4DO4A 4UFJA 1XYMA 1EIXA 2WSPA 1W56A 1X97A 1EQPA 4D6CA 4AXKA 1R87A 1TE1A 2NVAA 3PJUA 1SSDA 2HS8A 3SSJA 3TFCA 5TIMA 1OY0A 2W4XA 3DFSA 2HV5A 3A4XA 1AW2A 4R3UA 3WJXA 4UTUA 3NXFA 4LV9A 4QITA 1XS2A 5I00A 1SZEA 1QNVA 2OJPA 3SSZA 5M17A 5IBXA 2WSRA 4E8CA 3UZWA 1OCJA 1EXPA 1DXFA 4NP7A 3DFNA 4TVUA 3MY9A 4YL2A 1N8IA 2DSWA 4QXIA 1QI3A 1Q4NX 5EFDA 2CLHA 3CZKA 1ITUA 2ODOA 4LSBA 1D3CA 5CPLA 4DUVA 4L1GA 3AFBA 3A23A 3OZPA 2VT0A 3FFSA 2EBNA 3MYOA 1KM0A 3FIGA 2CFFA 1NWSA 3WLKX 5FOOA 4DEFA 3W84A 5ENLA 1AG1O 1XIIA 4LVAA 5TQLA 1FOBA 4S2BA 3W2LA 3WQ8A 2QIWA 2G97A 3LGGA 5EMMA 4B3ZA 3CXOA 1CIUA 2WC4A 5LIWX 3HOJA 2NV1A 4ZQNA 4Z1CA 4GVIA 1RCQA 3R13A 1OFAA 4CCZA 2C13A 4O28A 1OF8A 4GACA 2G4JA 2OR2A 3W6MA 4CNNA 2WCAA 2ZZ5A 3M6YA 2ZC1A 1W1IE 3U8GA 2SFPA 4JOMA 4X9SA 2V2HA 4DBUA 4DY1A 2PDJA 3SBFA 4JY9A 2JALA 2ISDA 4YWIA 3RCNA 4QLLA 4CNOA 3E5BA 1KC7A 1UW9A 1MEIA 1JYVA 1ADDA 3H2EA 3TUUA 3ORWA 1OT1A 2R8WA 3SIMA 4AAJA 4MADA 3N2XA 1OJXA 3MTWA 2PE4A 2X09A 1TJ0A 2HISA 4S3BA 1RY0A 3VMPA 3WFZA 4XBKA 1UZ1A 2XSXA 4I7WA 1SZRA 5E0KA 4UMCA 2ZVRA 3MHUA 1KLZA 1OB0A 3MUZ1 5AHEA 3ECQA 1MW1A 5E09A 5LHEA 3PBYA 1PCKA 5DXXA 3W1PA 5AKQA 2Z6JA 3SN0A 3BAXA 2FMOA 1TCDA 3O6CA 3VGGA 5H91A 1P7TB 4I5RA 1G5AA 4DWSA 3H55A 2YSWA 3MUXA 2X1SA 4Y8FA 3NQBA 2FIQA 4DJFC 3TEVA 3T9PA 3M0XA 2CBJA 3MUAA 4UTHA 5D2TA 2Y70A 1GHRA 3THUA 1BYDA 3W2UA 1CZ1A 3S46A 1A0DA 2YCJA 1EBHA 2Z29A 3WZ0E 2AKZA 3SM0A 2A79A 4MY8A 3LOTA 4MJ2A 4NI8A 1UZHA 1CECA 3WNOA 4DJFA 2JGQA 4B5XA 1ITQA 2OEMA 4AC7C 3SEPA 1XM3A 4HQVA 2R82A 3EPOA 1MRAA 2WZTA 3FNDA 5F2GA 4RL3A 5A6KA 2YDRA 2WJEA 1QPQA 5DMNA 2W3ZA 5HK4A 4RDVA 1HL9A 3UWZA 1VB9A 2HZGA 1H0GA 3JW7A 2C1GA 3L7RA 4GXWA 1QHZA 4FP1A 2WJFA 4BI7A 1K7EA 1EEXA 3CQHA 7REQA 3IARA 1E9IA 1PKNA 2XH2A 3T0CA 2EKGA 3QTPA 4UBPC 4YXGA 1M6JA 3MHGA 3N17A 2FYMA 1BAGA 3K46A 5F1UA 1A49A 1UJPA 3WX7A 2ACQA 1FWHC 3ZJ8A 3H26A 3M44A 1KCXA 1YNPA 1CLVA 1I2RA 4RKAA 4IFRA 3ZFHA 3R0UA 3STFA 1TVLA 4F8XA 4UFKA 1Q7ZA 1S1PA 4HB7A 1UP0A 1B3XA 3BAJA 1KR0A 1W1A1 1ISYA 3O2LA 1IXNA 2NQZA 1Q2SA 2O92A 3VOHA 4F9DA 5G2HA 4AZBA 5LNRA 2PDHA 5CC6A 1K4HA 3VCRA 3MKKA 3N3TA 5HQMA 3EX4A 3ZOAA 3BAYA 1RZMA 4TX6A 2WLYA 1U5JA 5EGRA 3CIWA 4BKNA 4QCEA 1JNEA 2XSAA 1EJWC 2PB1A 4I7UA 2VC5A 1E9LA 1V0LA 3IJ6A 3GVGA 3N34A 4E4UA 3VIKA 2Q8LA 1QW7A 4ZQPA 1IWBA 4Z42C 3D3FA 1UR3M 3WD2A 1PVNA 2GVGA 2J7DA 3QVQA 4D8AA 2HVNA 5DRIA 2VRJA 4N6EA 2CESA 4QEEA 4GZIA 1ONEA 2FDMA 3PZ9A 1FWNA 4UR8A 1U1HA 1X8CA 3UERA 1QK2A 3B8WA 1UKSA 1ISZA 1BWLA 1CXLA 2KAUC 5CJ5A 3U3HA 3YPIA 4C6KA 5M5DA 3POHA 4MLJA 3GUGA 2VZSA 2RUSA 2VX4A 5AHFA 3QC3A 3V7PA 1T99A 4W93A 2DZBA 5L9FA 1OFOA 2NX3A 3DC0A 2VFIA 1YYAA 1NTHA 4JTIA 1R38A 2POZA 3ATZA 3PZMA 4JY8A 3E1F1 1UD8A 3NSMA 1XIMA 3TTOA 4U3AA 3RX3A 4N42A 2E6AA 5T9BG 3MCNA 4AHQA 2DQXA 5DEZA 1WO2A 1JZ4A 3EXSA 3KHDA 3O63A 3H4GA 2WWCA 4LXFA 4DF1A 4MUZA 3DC8A 4ROPA 1WKDA 1P6BA 3DHFA 3GG0A 5H6HA 3W1NA 4O18A 3C56A 3CT2A 1P48A 1FH7A 3EWXA 3GH5A 4NT0A 2X7VA 2V38A 4BZYA 1VFOA 4MB4A 4R27A 5DFAA 3TMLA 1DEDA 1KXTA 2DFAA 1S2TA 2HQAA 3FHAA 3EGJA 1TIWA 3SRDA 3SY5A 3U4AA 4TV6A 3VNJA 3TC6A 3TAOA 1VCGA 3E0FA 3UETA 4H9VA 3VAVA 2AQVA 3U2CA 1VRXA 3TW7A 3ZMRA 3PTQA 3LBMA 4QLKA 4XAFA 1YBQA 3AU6A 1LL7A 3WH9A 4RW5A 3QKZA 4WJ8A 4A3UA 4MNMA 3NPVA 4FXRA 2GZXA 2XM1A 3QV7A 2WKGA 1EJ7L 2H9AB 3CL7A 4ZO8A 3FS2A 3APYA 3DIPA 3IVSA 3RM8A 4F9JA 3QF0A 2GJRA 1HJXA 1GONA 4JTSA 2G0WA 3TYBA 1JPIA 3UT0A 5EFFA 3QGVA 8A3HA 4B91A 3KOWA 2YZRA 2WPGA 1EA9C 3IIXA 1R2TA 2UBPC 1FWDC 3WNLA 2V0TA 3QRHA 3ISIX 4RE3A 2D2OA 4AX7A 3CL8A 3S6DA 3WK2A 3LV6A 1LQ2A 4A3QA 1A5BA 2R1MA 3AIWA 2VCBA 3ITCA 4UTFA 4W7WA 5IFPA 1UUQA 1OX4B 4XZ9A 1I1WA 3PB2A 1H1NA 4IM4A 1BHGA 4HK6A 3D46A 2RFGA 1GEHA 3PWAA 1FWGC 3K13A 2NVCA 4AYGA 2DSZA 1M1BA 1JCJA 4GI6A 2WNNA 1W3TA 4DBDA 2A1YA 4ERGA 4JNMA 4Z1AA 3WQCA 1J5TA 3QSTA 2H8XA 3UBPC 2OB3A 5I7GA 2QJNA 2I9EA 6PTDA 1TWDA 2YX0A 1TZ7A 2EPHA 3OVPA 4XTIA 5JH2A 2YYUA 3B0PA 2PWFA 3DERA 3P0WA 4KS0A 4NYYA 1SJBA 2RJHA 4FX8A 3CQJA 1WYIA 3BSHA 4YTQA 2BHUA 4S3KA 2E77A 4JNYA 1E9YB 4UFHA 1F6PA 1YBQB 1OCQA 3AHYA 5CJMA 1MZRA 4LNYA 4QIUA 3NNTA 1GZJA 4LT9A 4UFLA 5I3IA 4IQEA 2XVLA 2MNRA 5A8OA 3EKLA 1PTDA 2TAAA 2GVEA 4JN6A 2W6RA 2BGNE 3DEQA 1EXBA 1JQXA 5CPSA 5C71A 2W63A 1XCFA 1XPGA 1BYCA 5D9OA 2C6QA 4ATLA 4HPGA 4Z2LA 3VKJA 3PNUA 3I6RA 3UWYA 2J62A 2RAGA 4NAEA 2R24A 4UTJA 5D9PA 4AEFA 3DESA 1XYLA 5KITA 1FWWA 3B06A 3VFLA 3NQAA 4N9CA 1ISXA 2IQDA 3I7SA 2PDXA 1EOMA 2E6YA 4OWGA 1Q6DA 3W74A 2VQUA 4Q8MA 1MFUA 3DN5A 1LL6A 1JUBA 3PZTA 2FJKA 1VYRA 2W0UA 1V3KA 5CSSA 5REQB 4C6QA 1DJGA 1HKKA 2DZXA 3W1UA 3GU2A 1FP8A 1IEQA 1M9HA 1O5XA 1QPNA 4O1EA 4ZGYA 1VC4A 2FZ9A 4CD7A 2HEJA 4WD0A 1VGAA 4H00A 1E56A 5HJYA 3B9AA 5D2XA 1JZ5A 1NAL1 4IUGA 4DM1A 2NXGA 4YCOA 1FKWA 1LWIA 1T40A 5HBFA 1ZAJA 3OGRA 1XBVA 3WBWA 4IGHA 1ZALA 3WDIA 4MLRA 2WMKA 4GZJA 3TYDA 3W7RA 5CBBA 4BA0A 1WDPA 1R47A 3PB0A 3UY8A 4WGHA 2ZA2A 3TYCA 4EE9A 1R6WA 3KOZA 5BOFA 4PODA 3PHAA 2OZ0A 3ZR6A 1RALA 4KERA 3M1ZA 3MV01 1PPIA 4B9ZA 2WMIA 1HIZA 4HCHA 4C6PA 3SY8A 1V3HA 1OT2A 5BXSA 3BGGA 4HPHA 4N02A 3RGTA 1JEZA 1NFPA 1JL8A 3BZJA 1T0OA 2G96A 1PX8A 4QE1A 3QQ0A 3CWOX 1PDYA 3UYIA 4LCQA 1DP0A 2XM2A 4PTNA 2XJ7A 4ZMGA 1OX5A 1TV5A 1RBLA 3CU2A 3BAWA 3PN8A 2VR5A 1BSIA 4JR5A 4GH1A 3F2DA 1DIEA 2Z2AA 3SUUA 4WSKA 3IJ7A 3CPUA 4LC6A 3T6CA 1DKWA 1F73A 4Q32A 1AL7A 5D8ZA 2QAFA 2OYMA 2X30A 3S1WA 3A4JA 1DJQA 2JE8A 3O05A 4H1ZA 4LPCA 4LUIA 3TYEA 3UJ2A 1SMAA 1YDOA 3LBOA 3MB9A 1J9YA 2P1FA 1F05A 4LYKA 4DF2A 2ZX7A 1F5ZA 3PPFA 3EA2A 2I7GA 2P3EA 2VL4A 4ZB5A 3UG8A 4PH6A 3BJSA 4GD0A 4IZGA 1XG3A 3KAOA 4QNWA 3MKCA 4J2MA 4O4VA 4EPDC 3FEQA 3VX0A 3FA4A 4QE4A 3APTA 4L9ZA 2Z2UA 5AC6A 2EG8A 5C0QA 2P5NA 4ORMA 1KBBA 4IFKB 1JF6A 2D3NA 1X38A 3OG2A 5CZJA 1JZ2A 4FX7A 3NPUA 4AXNA 1VFUA 3SO7A 3C3UA 3HMJG 2PMQA 3IUIA 2FZMA 2OVLA 2F61A 2G8ZA 1D9EA 4UQDA 3NQDA 5DBUA 1E40A 3L67A 4LUSA 2EJ1A 4UZUA 4IOTA 3CZGA 4XZHA 1ZY9A 4AU0A 5T91A 1IEIA 3G0UA 2OQYA 3N4AA 1O4UA 2OKOA 3UR7A 1C7SA 5BOOA 3H22A 4FLRA 3AMDA 1UZDA 1IQ8A 3LDVA 4GUHA 2VMFA 4TXEA 4QAWA 1WQ5A 2DJXA 4QNEA 3CLWA 3VKKA 1XYCA 3GG1A 1PBGA 3NSNA 3E0VA 2FGBA 4PGLA 2AOSA 4WUIA 2EPOA 1A80A 2VGIA 5D2VA 2DT2A 6TAAA 2TODA 4F0SA 3GNOA 1GQLA 5F2MA 4Z2IA 1H5VA 3MQTA 2ZZ2A 1D8WA 2C14A 5EMJA 3NL2A 3A13A 3ABOA 3IPWA 4AEEA 4F0HA 1HUVA 2HBVA 1UKQA 3EDFA 3V4BA 2E09A 4GYKA 1DJHA 4HU3A 5KTLA 2CLIA 4HPXA 4AD0A 4HKPA 3VNKA 2W62A 4Q4KA 3S5OA 3W1TA 3KOFA 4WY0A 2V3GA 3ZT5A 1GJUA 2J9ZA 1CNVA 3S6TA 1NDZA 2BB0A 4GVHA 4H04A 2E9MA 4O50A 1TTIA 4GCXA 1XFCA 3TTQA 2EG7A 4PULA 1OFBA 3REQA 3AIEA 4IG2B 4AISA 1PDZA 2E4TA 3B0YA 2ZRWA 3GSMA 1M53A 2H9AA 4WSJA 1J79A 1V79A 3VNDA 4TTGA 4JTQA 4H7ZA 1BPLB 3RM4A 1H0IA 2NLYA 3A64A 2OTDA 1FWIC 3M0IA 3PG8A 3JU2A 1JD7A 1W31A 3UVAA 3BGJA 3TH6A 1ZHAA 1NFBA 5CZTA 2FFCA 3MUIA 1KBLA 3WLMA 2V6AA 1WZAA 5CPNA 3W7DA 3AU2A 4P8XA 3C3NA 3LN3A 2GJNA 4KBXA 2JF7A 4U10A 4BK9A 3W83A 1DOSA 2D3LA 3NQ7A 1H7PA 3TP4A 3G8EA 1VPQA 3Q45A 3KBNA 3AHXA 1W54A 2WVVB 4RV8A 4JQ2A 2D0FA 1RPKA 3RRXA 1JPMA 4H9TA 4DLFA 4ACYA 3ANVA 3B4YA 3OGVA 3W6LA 1O1HA 1DE6A 1E9ZB 3PUOA 1IXQA 4JTDA 2VGBA 3KOYA 3NR0A 1ECQA 1SZFA 3NA8A 2H90A 4JX5A 4WK9A 4UOZA 4FXFA 3T0DA 3F5JA 2DJLA 4X0VA 5REQA 1QPOA 1A50A 2I5GA 4J28A 4CCDA 1PYMA 1KM5A 3GG7A 3KCJA 4LALA 4IGSA 1ODUA 4L1WA 3DFYA 3SCOA 2J25A 5G1YA 4EPKA 5A8GA 3B3DA 3EPMA 2QF8A 3TQVA 4Q8OA 1HO1A 1YE6A 3W7PA 1Q6FA 2IPJA 3VIHA 4MOZA 4HK7A 1EZWA 1SR9A 3S9IA 4RV3A 1EUNA 1G4PA 1DBTA 1P1XA 1LRQA 2PWVA 4D6GA 3WQ4A 2OG9A 3TC7A 3AIQA 4B92A 5JXQA 4W85A 3G1YA 4LOCA 3UYCA 4A21A 1NELA 3OQ8A 1SFLA 4QJ1A 3GXPA 3W0KA 2GSEA 5E93A 1QW9A 1FDYA 3GYCA 3O3RA 2VQTA 5M3WA 4EX4A 1Q63A 4LB4A 2D23A 4I9AA 1EX5A 5HMEA 3E96A 2WAGA 4TX8A 5BRBA 3M0YA 3IJLA 4F3HA 3E49A 5A2BA 2E6FA 4F66A 2QPUA 4JIRA 4H9XA 3RAOA 2CXGA 3P84A 2XH0A 1H1ZA 4NKCA 4R85A 4R33A 2BSLA 3GHTA 2Z7GA 2V9DA 4LYQA 1AD4A 4E2OA 3FXGA 5K3VA 4JIPA 5D03A 3SQSA 2FZBA 4JL1A 3B0UX 3O6AA 1OK6A 2J24A 5MF5A 2GWNA 3CUIA 5JU6A 2C3ZA 5I23A 2YKKA 3QFWA 1XDLA 4C6EA 3TCEA 3ZYZA 3HN3A 2GVJA 5AC7A 1QWKA 4PTDA 2E1WA 2FZDA 1QU4A 5BXPA 1E1EA 3W1XA 3BSGA 1MQPA 1RP8A 2BHZA 1JZ3A 4QJ3B 4WKAA 4IPJA 4JEQA 2FFIA 1OFEA 3AHVA 3WF3A 4PUWA 4QDMA 5EMLA 3AJXA 5DCBA 1SSGA 3WDRA 4QHRA 4AMCA 4UTKA 4GQGA 4W86A 1JDDA 1TSIA 1V77A 3MCOA 3L4TA 2G95A 1GHSA 2C1HA 2PDFA 1TE6A 4NNBA 2A3EA 3P3BA 3S5YA 1B9BA 4HD5A 2NV2A 3LHUA 1R86A 4LU0A 3MI6A 4PFMA 4F40A 3KBSA 2Y4SA 1DIKA 2HTMA 2DEPA 4KWOA 1B30A 1Z48A 4GK8A 3I68A 4HNCA 2CLEA 3BQ5A 5C7VA 2OWWA 2DZUA 4JZ5A 4HU4A 3LLDA 1Q3NA 3GBEA 4B5SA 3ZT6A 4H19A 5EPDA 4PUDA 3RYSA 4KEUA 2GK1B 5A1AA 1MXDA 4QDPA 1A3WA 3O6YX 2ACUA 4PCPA 3MWCA 4H6RA 2WM1A 2R1PA 3U57A 5EBAA 3L68A 5IHRA 1V3LA 2VM8A 3BOLA 4DN1A 1C29A 2I56A 1RBOB 4IQLA 1PIIA 1NEYA 2JKAA 5DANA 3XIMA 3WLHA 5G2WA 2J7GA 5HUPA 3IV8A 4Y9MA 2OXNA 2R1NA 4AZGA 1Z44A 3LRKA 3M5VA 5CSUA 3L4YA 2QCCA 1C3FA 4FIQA 3WF4A 4HIBA 3VX1A 5CGMA 1TRDA 2HS6A 1AK5A 2D20A 2Z26A 2PSNA 2HSAA 4ZQCA 3ZVHB 2OPJA 3ARUA 3R58A 3QJAA 1GOQA 4DVOA 1JI1A 1K3UA 4X2RA 3HV8A 4LAMA 4PA8A 4QG6A 2YBTA 3I7RA 1ME7A 1ZP4A 2I17A 4DJEA 5IXEA 3L4VA 3KE0A 3SURA 1M5WA 1ZB5A 3KHJA 3VXGA 2WMIB 3N4FA 3C4UA 7REQB 4XWUA 3OVGA 2XFRA 4KWVA 2TYSA 1H63A 2GGEA 3RITA 1VBRA 2MUCA 5BMWA 1SO5A 4HNUA 4FR6A 1LBMA 2OGJA 2FTWA 1Z41A 1B9ZA 2FTYA 5FL1A 3TC3A 3SGZA 2ZKMX 1QTWA 3S2LA 2Y5EA 1KGXA 4S39A 1XYAA 4Q22A 1VIWA 1EF2A 4WOQA 4GQQA 1JZ8A 1JPHA 1J4EA 3KCOA 1DYSA 4Y96A 2AMXA 3TX9A 1KW1A 3UVIA 1C8VA 3AZTA 2PWGA 3DFOA 1XR2A 3PBGA 4OBRA 3RR4A 2FDSA 1KO0A 1XYBA 3G3MA 1TX2A 3RFAA 3GDTA 3NG3A 4KFOA 1OC5A 3M0ZA 3NOEA 1PE1A 1NP2A 5M03A 3TJXA 3AZSA 2C91A 3RU6A 3SCVA 3VZYA 4RZ5A 5ABEA 1SGJA 3R8GA 3OJGA 3W73A 5G4HC 4WSHA 4WY0F 3R0KA 4A22A 1W5NA 5C6MA 4EANA 1Z42A 5E0CA 2NQHA 4H8VA 3CHCA 1Q6GA 4AHOA 3LG3A 3HPXA 1MW0A 3H21A 1I45A 1DV7A 4IX2A 4Z0JA 1DVJA 3AUJA 2P10A 4DLMA 3E6EA 2QJHA 1NP0A 1YW1A 4IMCA 4C6CA 3QKEA 1EHAA 4AC1X 1DQWA 2PZ0A 4UIOA 1W2PA 1L6WA 1L8NA 3GNNA 4X2PA 2CHRA 1TV2A 3GQYA 6A3HA 2VCCA 4MG4A 3IJIA 3UR8A 1U5HA 1B5TA 5HWMA 4PEKA 5BU9A 5KEZA 3ABSA 2CERA 2P53A 3IK4A 3KLLA 2WQDA 2UY2A 1LOQA 4DYKA 4MWAD 2QR6A 4DB7A 4HT3A 2Y7EA 1DQUA 3Q67A 4LY4A 3UPWA 3GDBA 3QPEA 4W88A 1J0HA 3TMQA 4Q8TA 1QNPA 3MA8A 1HP4A 3GFYA 2ZYFA 4HHLA 3UPBA 1JPDX 4J9JA 4UTIA 3KEHA 3PBWA 3N4EA 3GDKA 1D3HA 4F0KA 4KMQA 2QCMA 3BG9A 1ZL1A 2J8GA 3PTKA 2DZPA 3RLUA 3N9SA 2A5HA 2DGAA 3PAJA 4NNAA 2XDFA 1XSJA 2Y5SA 5LIXX 3AI0A 2HRWA 2YA0A 3ID7A 3ENLA 1E5NA 1MQQA 1R3RA 4MVAA 4UB9A 3NYDA 3VYLA 1NVMA 3P60A 3IVUA 1ISWA 1K8XA 4B5VA 2GSJA 4TV5A 2Q8ZA 5DCDA 4CN4A 2WKJA 1WX0A 1GUVA 4S3FA 4QBXA 4HN8A 2GJXA 4NZ5A 1V0KA 4M5PA 4LQ1A 4RPPA 2FTPA 4WDWA 4MWAE 3C6CA 4AVOA 4CQAA 5CBJA 1J2BA 2QGHA 1YNQA 1EH9A 3SB0A 1K7FA 4H6QA 4MWAC 1LOLA 1Z69A 4PMOA 4U33A 1LDCA 1OYCA 2P0OA 2PWHA 3NAVA 1KTBA 2R94A 1OINA 1O94A 4ZZ9A 4ZQMA 2R14A 1VJIA 4A29A 1R9ZA 2PC4A 1HVXA 1FFQA 1SUXA 3GTFA 3K5XA 5G4EA 2HXTA 1LOSA 2VHLA 1CENA 3W01A 5FSDC 4MWAA 1B4KA 3JRKA 1V3JA 2Z28A 3H2OA 2I5IA 3BW3A 3VIGA 2VEIA 1EHNA 1EC7A 2OOFA 2YR1A 5T9CE 2HNEA 1LP6A 1V3MA 1A5OC 2B0MA 3TA9A 3ZIZA 3L5AA 4C6LA 4KH2A 1A5MC 4B3LA 4L6DA 5D02A 3DYMA 2EGZA 1L9WA 4AZHA 4AVFA 2J7FA 4HPJA 3AHZA 2VYOA 1DXEA 4B5NA 1S5MA 4JN8A 1PHQA 1KM6A 2CU0A 1XUZA 2VR4A 3BANA 5I6SA 2A85A 5H8PA 3IIVA 3LY0A 4O53A 1ZNNA 3UWUA 4LAZA 1UQZA 1XLFA 1ENUA 1XPYA 3QHMA 2ZUVA 1R3SA 3EA1A 1FWEC 3BDKA 1EYEA 3C2FA 4E2DA 4JNZA 2J27A 3ABRA 4PMQA 1DHPA 1N8FA 2IPFA 4TMBA 5SWUA 3CYVA 4ZOEA 4YPJA 2DSVA 4WGXA 4S3AA 3TLLA 4PB4A 3WUBA 4XG1A 3CHVA 1EZ2A 3OHMB 2PA6A 4QSFA 1RSCA 3MUCA 5LGZA 2WNWA 2LLEA 3VDAA 4YVVA 1HJSA 2V81A 1JCLA 3PFMA 3V1HA 1W9XA 4QP0A 5FD0A 4LF1A 4DHGA 1U30A 1Q5MA 1IWAA 4UFMA 1UD4A 3VABA 1P6WA 4AY7A 3RHGA 1J0ZA 4INFA 4B4FA 2PF8A 3PF3A 1TPDA 4P61A 5HWJA 4LUJA 5E0FA 4TVCA 1RA5A 4DJED 3W7NA 3HPFA 4AZCA 4ALDA 1DHKA 3LM3A 3OYZA 4HA0A 4GX9A 1DWIM 1IR1A 4ATDA 2UV8G 2JGYA 4JQ1A 3SZ8A 5LHFA 2PF0A 2ZRZA 4IF2A 4H8UA 2NZLA 5G1TA 1PZ1A 3UXKA 2X1UA 3G1FA 4HMNA 2WOQA 1WAUA 1FWRA 4OQVA 3TVAA 3DU0A 1NM9A 1XYZA 5KINA 3URQA 5K9XA 1PUDA 4EWJA 1NDVA 1BF6A 2BOGX 1AUSL 3NEVA 4UTWC 3THDA 4Q8VA 3G24A 4GQ0A 1UASA 2ZUTA 2YB1A 3R5EA 3BOFA 2REQB 2CZDA 1NJJA 1TQJA 2DH3A 3QV6A 1H7OA 4F2UA 2ON3A 3LCIA 1RJPA 3UG3A 4WDUA 2PEVA 1UWTA 3WIJA 3GU9A 1FX6A 1KFCA 1XH0A 4LAUA 4Y9NA 2CHOA 5A6BA 4CD6A 4W7UA 3MO7A 3KBJA 3VOIA 5JVLA 3KP0A 4HVXA 1HXJA 1UIOA 3F4DA 5IOBA 4XUYA 4PCTA 5FESA 2PCQA 3EWYA 3GXNA 2J77A 4X3ZA 4XB3A 4B2DD 3TIMA 1K03A 4LCSA 4N9DA 3WMBA 2FQIA 5HAOA 2Q09A 1IGSA 3T7VA 3O07A 2HXUA 3WUEA 2WC3A 5BNKA 5LIYX 1BRLA 4JTAA 3LLXA 2F6UA 2E68A 1WKEA 2FZ8A 4YVXA 2IPWA 1W1YA 2VP8A 4B5WA 3I65A 2YGYA 4V1XA 3THAA 1YXDA 2F84A 4XISA 4AWEA 1PWMA 4FOUA 4DZIA 3IJ9A 3ARXA 2UWFA 3VA8A 1YDYA 4H3DA 4KGJA 3I10A 1X1ZA 3BJTA 3NQ2A 1HX0A 4C7FA 1TPFA 5LGXA 2VR2A 3ZO9A 3W02A 1IT7A 3CQ0A 4J3XA 3UXIA 5HPOA 2GDUA 1UIPA 4GFIA 3SCTA 3W22A 4G1KA 4QEHA 3VDHA 1V6VA 4O19A 2Z25A 3G1RA 5C55A 2V2DA 4CEUC 3IRDA 4NSBA 1XLAA 2BLEA 4C7DA 3V1PA 4AIOA 1TJ2A 3SUTA 4PB5A 1U33A 1ADSA 1Y7VA 5AOUA 4ZE5A 3EPNA 2EPKX 1JR1A 3SDOA 1ME9A 2VOTA 3S1UA 4GBDA 1W3HA 3BLKA 3APGA 1FWFC 3W7KA 4NAFB 2QYGA 1X6UA 1LM1A 1GCYA 4RPQA 1V7AA 4YYFA 4TO8A 3UWWA 3G6MA 1OFDA 1FWJC 3SAZA 5LA1A 5AHMA 2PDCA 1TV8A 4D2JA 4E6MA 1GTHA 1ZTVA 4I9JA 4C65A 2GGJA 2J78A 4F4RA 3VUPA 1JRCA 2VX6A 3WMSA 3AYVA 3LCHA 3N11A 2PTWA 4L4LA 3R7MA 5A8QA 3NO5A 1P0KA 2CHNA 3MKVA 2VX5A 3FDKA 3IANA 3EEGA 3KVKA 2BVYA 3HA1A 2WMJA 5HNNA 3EWBX 2BXVA 2WNQA 1LLWA 2QJMA 2EXOA 2NX1A 3W75A 5JIWA 1FFRA 3VGFA 1HKWA 2QUMA 1GVRA 4IPNB 3T81A 1GKRA 4O15A 3PM6A 1XC6A 1BVWA 2G3MA 4LC8A 4CGTA 1O68A 3O0KA 3RIKA 3UA4A 4WVXA 2XFFA 3V5CA 1OFRA 2WHLA 1BFNA 3EZ4A 3CO8A 1TMLA 2ZUSA 1AW1A 3PSVA 3WD0A 4B90A 1XIFA 3DFTA 4XZBA 4AD3A 1H7NA 3LPGA 3F4NA 4LAOA 3EWZA 5FF2A 1QPKA 3NO1A 4GMEA 2ZXBA 4GNVA 1EKOA 2ZRYA 4ZCWA 3OBAA 1YPFA 2VUNA 4NXSA 1Q6OA 1CGUA 4W7VA 2ZE3A 3SCWA 4MB3A 1V02A 1BLIA 3M07A 3LNMA 3VOJA 3TAKA 4IWWA 4K68A 3SRFA 1KGUA 3LTPA 3A4WA 1IV8A 1DPMA 1SFTA 1VP5A 3VE7A 2QJJA 5BZAA 4ZEPA 3B04A 4MY9A 2QUUA 2YL8A 4AEOA 6XIAA 2E7FA 2XPKA 3AYTA 4UCGA 3HQOA 1GVEA 1MXSA 2CNCA 1JIBA 1PTGA 2EQDA 4GQBA 2I9UA 2I5QA 4S1FA 4WOZA 4IPIA 1HTIA 5XIMA 2A3AA 1X39A 1V02E 2P76A 4MSSA 2XTKA 2XIQA 3GE7A 3PUDA 3WQEA 4M6VA 4MJZA 1CWYA 1VAHA 2PTYA 3T2OA 1FRBA 3M7WA 4C90A 3NQVA 2FVMA 3K1DA 1NOWA 1KD0A 3DFPA 3L5MA 3PJTA 5FF7A 4IL0A 4CQ9A 1CTNA 2GPTA 5LNUA 3VM7A 2Y8UA 4KRZA 3IIZA 4M0XA 2XIJA 1U1JA 3ONCA 4S23A 1YNYA 3ZWTA 3PPCA 4FALA 4J40A 4PUUA 3TTEA 3BG3A 4L80A 3OVRA 2G50A 3M6DA 5FEPA 3BLEA 2E5DA 2RDUA 3PPGA 1E1FA 1ZZMA 1O6IA 4P8UA 1YMYA 4O12A 2BY3A 4BF5A 4M6PA 3CTTA 1K77A 3GB6A 1T8XA 3P14A 3RG6A 1J6OA 1UH2A 1I8JA 5TD4A 4IL2A 1EP3A 1FKXA 3WDPP 1YPIA 2FHCA 3PP7A 1V6UA 1BGAA 5BW6A 5I3DA 3LPPA 2E0PA 3LZ3A 2ZICA 1W2VA 2Q02A 3IGUA 1RD6A 4UOJA 1QOQA 4RNJA 5F2LA 1ECEA 3GHUA 3B9EA 1VQTA 4JFTA 3SUSA 2W79A 4TU1A 2HBXA 3SCQA 3PULA 4JTCA 4J2PA 3P93A 2OEKA 4XD4A 1UWRA 3IJ8A 3RNDA 4IMFA 3HURA 5G2IA 4WDTA 3P80A 5D04C 2PWUA 5CXPA 3OA5A 1CYGA 4AIBA 1IE7C 1YTEA 4O11A 4GIYA 4CNSA 5E6ZA 1GVYA 4GYFA 4BEQA 1MEHA 3ALGA 4O13A 1EP2A 5AYIA 4YTRA 3CT7A 1SU5A 1VFLA 4GQRA 2GQ3A 1MZHA 1P43A 1E4IA 2V67A 2VRKA 5CPMA 1HW6A 4HNTA 3LEPA 3OA3A 2PCEA 4PUMA 1R3YA 5AYYA 3MVTA 1QASA 5A6LA 3F4WA 4XKYA 7TAAA 1BKHA 1LUCA 4JTGA 1KFJA 4O8AA 4NILA 3B8DA 2ZADA 4NRSA 2YYTA 3LGEA 5CSYA 1ITCA 1KM1A 3NZGA 4MKNA 4DYJA 1KM2A 3SJNA 1L8PA 3VIIA 2DSKA 1S2VA 3U2EA 3AWNA 5IDIA 2QCLA 1XCWA 2Q3OA 2B7OA 4PBGA 1X1OA 5FIPA 2CWXA 4CVWA 3PY2A 1QUMA 4JTKA 3UZ5A 1O12A 4REQA 2DVUA 4C6OA 1WDQA 1IYXA 3JZEA 4XQ6A 4QROA 3VNMA 3TW6A 1HQTA 4NQ1A 3A9BA 2DUAA 5DLCA 3ZWSA 3S1XA 3FVDA 4W5UA 3WL0A 2YB4A 5BU6A 4DM2A 4YWSA 3AISA 3KM8A 2CLMA 3PZUA 5C9RA 1NF7A 3PANA 1XW8A 4W5ZA 1V5XA 3NL5A 2J9YA 4C6JA 1S46A 5HWNA 2Y7FA 4YTUA 3MBDA 3MO4A 4KRUA 3T40A 3BGAA 5ABGA 1SM9A 4F2TA 5EB8A 3E0IA 3B05A 1D7FA 2VOMA 2RJGA 3KRUA 3UCQA 1PB0A 3O15A 2QULA 4LY8A 4RNFA 4PMYA 4K7YA 2D22A 3MSGA 4UQCA 1K9DA 1A3HA 4JTJA 4BI6A 2G4FA 3SR7A 4GUJA 1YADA 2REQA 1ICSA 3UW6A 4ZFCA 5LA0A 1V03A 4KW2A 3GHRA 1JFHA 3EAUA 3LGDA 4MNLA 3N1AA 1O5QA 2OZ8A 4DPPA 1ZJAA 3NEHA 2Z24A 5CGTA 4WJEA 4KEMA 1HF6A 4A3YA 5ABTA 5HOSA 2PTXA 1KQYA 4HZ6A 5F4XA 3HBLA 1CGTA 1MNZA 4LEQA 1WZLA 3GXFA 1GGOA 3ARWA 2D0HA 3MV11 3WLNA 3EWWA 4MTVA 2XGBA 5C70A 1OD0A 1RJRA 4GYPA 4FXJA 3H4WA 4DO7A 1M68A 3W7IA 1XL9A 5A5WA 1LTDA 1IEWA 4JYDA 2BV9A 2ZRXA 1ODZA 1I2OA 4LUTA 3T44A 3FJ6A 3LS9A 3WLSA 3GTNA 2Y1HA 1QK0A 3GIYA 1ZCOA 4E8GA 5G1MA 1ZQ5A 2BTMA 2YFOA 1REQA 1WOBA 1FQ0A 1XIDA 4FNSA 1W9PA 2C7FA 4LEFA 4BHYA 4CNUA 2J9XA 3KVLA 5JBDA 4DWSD 4LTSA 3FGCB 4OE7A 1J0IA 2YZ5A 4L6HA 2WZIA 1HJVA 2ZZ1A 2XN1A 4AF0B 3CEUA 2X8RA 2Y7DA 2ZZ7A 3AIVA 1VYPX 4UUIA 4M81A 4US6A 3S3GA 1JCNA 2J6VA 3TTSA 3WLIA 2RDWA 4RK8A 4GIAA 1EIBA 1JXKA 2WKLA 4WLCA 1B54A 1B1YA 3QQWA 3V35A 5DX7A 5I79A 1DL3A 1RXOB 1S3TC 3KDNA 3EDEA 4JICA 3P81A 3WQWA 3MVIA 2F8QA 3BV7A 1RY8A 4DJDA 2R1LA 1H5YA 5F1VA 4F0MA 4HGXA 1ZAHA 3CV1A 2GJXB 3QFEA 3LZ5A 1JZ7A 4WY0B 2BASA 5HNTA 2ZTKA 1CLXA 5FF0A 3O0FA 2FB2A 5J5RA 4MJ4A 3G1XA 3TU9A 3LBCA 4NJHA 4H4IA 2NVDA 2ZUNA 1P6CA 5BMXA 2CLFA 1Z3NA 1VPXA 2F2HA 3II1A 1LJYA 5D8WA 4B4HA 1RD5A 4PUNA 3TDFA 1DWJM 4ZO6A 1HKVA 3FHQA 3QW3A 4OU1A 2FPYA 1OGBA 4A8IA 1W9VA 3WO8A 2CETA 3W87A 2DVTA 2RKXA 4CQBA 1XI3A 2NW0A 4MYAA 1X6LA 1W9UA 4LFYA 4M56A 5LIKX 4R34A 3I7QA 4LV4A 2Y8VA 4PYSA 4IIGA 2YLAA 1P0NA 3PZNA 2X1RA 3ARQA 2D0GA 3BL3A 2YCKX 4NAFA 4CN1A 1SMDA 2PDQA 3S83A 5FEZA 1GZ1A 1F4HA 3DFQA 1SW3A 1GEQA 1KM3A 2FHFA 4V2XA 1GVSA 4O17A 1RHCA 5DY3A 3PK7A 4LBRA 3C2OA 3CQIA 3MPGA 2ZC8A 1MQRA 1AW5A 4B16A 1GQKA 3H8AA 1VFHA 3AC0A 3SCRA 4JQ4A 4J4KA 5CKSA 3FLUA 2O9RA 4PC8A 3DHPA 1QNSA 3CWNA 7TIMA 3TWAA 1OADA 1X7FA 1DQXA 1HGWA 3VTRA 3UJSA 4D6DA 5FJUA 1YLVA 1TTPA 3CUHA 3T05A 1VJZA 2GUUA 2QUVA 3DZ1A 3IIPA 4PMJA 2VXNA 3VK5A 2ALRA 3ZLHA 3GBDA 1XWYA 3W1RA 5E9XA 4MY1A 4E4FA 1MWOA 3NDZA 4WR3A 3W29A 4WDXA 4RDWA 1E6XM 3CQKA 1AQHA 4PUJA 1QRQA 3CV6A 2XIOA 3SI9A 2QVHA 2BG5A 4I6VA 2X05A 3K30A 3WJYA 2P0IA 3AOFA 4BY3A 3W1MA 3GHSA 4WEVX 1D2KA 1JJKA 3ZS4A 1DE5A 1VF8A 4MAVA 4GY1A 3AAMA 1PHWA 4UQBA 1E1CA 2J7EA 4QSHA 4Y8EA 2PGEA 3GC2A 1I0DA 3SRKA 3TE9A 1JF5A 1WUFA 1OC6A 2XVPA 1YXYA 3SQMA 3B9DA 1R9YA 3S2CA 3W53A 2A7RA 5C9ZA 2V8ZA 4S3EA 3AMLA 3FEMA 3IJQA 2NUWA 4YMZA 3DI0A 5MKGA 3CUXA 2YCLB 5FJOA 1JI2A 2JIWA 1UWIA 1OFPA 2BHYA 4JIHA 1JXJA 3NL3A 3QZ6A 2ZZ6A 2YCEA 3JVAA 3WH6A 5CJNA 3IACA 3K8KA 2XINA 4FNPA 3VD3A 1K7XA 1AJZA 3VNYA 4ZBCA 3VO0A 6CGTA 3HPZA 1TPVA 1Z9AA 1E1CB 3F7JA 5BXRA 3KCLA 4REQB 3W7GA 2J7HA 2BFGA 3L4XA 4DBWA 5AB3A 3PNZA 3NQCA 3UZJA 2O0TA 3EOEA 4OUIA 3QXBA 5FKYA 3E74A 3DDMA 4ZFMA 2E5CA 3LQLA 3D6NA 4P2VA 4M1RA 1TTQA 2PDNA 2PU0A 3LCWA 3R43A 5LA2A 4XUGA 3WFAA 2QJIA 3NZRA 4HHMA 3CS2A 2EO7A 3LERA 5DELA 5A2AA 3WQVA 3AMKA 1RV8A 2OZ3A 1XLGA 1QWGA 4KWUA 4C6BA 4MDOA 1SZGA 3E12A 3VMOA 3G0SA 1GW9A 4AZ7A 1M41A 4PBEA 3K4AA 2WMGA 3QMRA 1LWJA 3ZSSA 1R9XA 4Q7IA 3CC1A 3HQ1A 3MSRA 4C1LA 1BQCA 5MHBA 3TWBA 3WJWA 3K8LA 4DWSC 1WDWA 4C6IA 5HR6A 2HK0A 1B3YA 3A24A 4UZSA 4JFSA 1F3TA 1WP6A 5D32A 3CV2A 1RK6A 2J7CA 3EB4A 3GR4A 6XIMA 3L2MA 3GX9A 5TNVA 3DG3A 1PCWA 4NZJA 4D6EA 2VWTA 1NOFA 1LG1A 4KCTA 4GOAA 1JCTA 1TR9A 3RO8A 1JGMA 4ERAA 2DUZA 2A7NA 3VNIA 5K7JA 2WHMA 1QCWA 4GO9A 4WF7A 3OZOA 1OIMA 1O7AA 2R9RA 2NWRA 2OEJA 3LPOA 7XIMA 2QDHA 1ZAIA 4AUBA 1JZ6A 1ZU8A 1EGZA 3NQ6A 3OB8A 5I3GA 1KCLA 1KFKA 1V3IA 4IP5A 1Q6CA 3TXVA 1IXPA 2DW6A 1QBBA 3LHVA 2RDXA 1W3KA 2YBVA 1YPXA 3CZ8A 2GOUA 1Q8AA 3A21A 1EEPA 1MI3A 3KBMA 5K4ZA 1XGEA 4JD4A 4E0CA 4O1DA 3RPMA 4BEUA 3VGEA 3T4WA 4GRSA 4UNLA 1PS9A 3E3HA 5GJNA 4AW7A 4K1WA 3LK6A 3T1GA 2GDVA 4KCUA 4FX6M 3GXIA 3QN3A 2J8FA 4GJIA 3QR3A 4DUOA 1JDEA 4LNCA 1LQ0A 2PI6A 3ALFA 1QR7A 2OGYA 2CCRA 3H4XA 1XICA 1YXCA 3LXAA 4JX6A 4IIBA 1VCFA 5I3FA 1UD2A 2QCDB 4OOZA 3WNNA 1UR1A 3HZ3A 5I03A 1G67A 4IIDA 4NJJA 1VD6A 1BG4A 4JYFA 3U5UA 3SCPA 4JX4A 3TA6A 3H54A 3EWDA 3VNZA 3G3DA 2PAJA 3GIQA 2PDKA 4AG0A 3AXKA 3EBVA 2ZA1A 3SECA 3I3EA 4A2RA 2P88A 2V5KA 2Y0FA 3G1AA 3C52A 3NTYA 2ABAA 4NX5A 5I5RA 2GQ8A 3PBVA 4O54A 4KWSA 1PX4A 9CGTA 3HGOA 3OBEA 2XWDA 4NF7A 3UGVA 2B4GA 1LROA 3QBUA 3BH4A 1NDYA 1BXCA 4JTUA 1WUEA 4GHRA 9RUBA 3LTSA 2Z2BA 1TUXA 4CQDA 3CK5A 4XD5A 1LLOA 1XRSA 2Z0IA 4UMBA 6REQA 5LKYA 1TQXA 4PUKA 4CU6A 1CXIA 1U5VA 3MHFA 2OLAA 2O55A 2ZZ4A 4QE5A 3V3WA 3COTA 5CQ1A 4UQEA 2Q01A 1AZ2A 2P8CA 3MP5A 1FWSA 2PDIA 4W89A 5ECVA 1GORA 4MDPA 1G7UA 1KBKA 4AWUA 2PTDA 2DIEA 4UFIA 5D9NA 1CEOA 3BG5A 2IW0A 4K2SA 1TB3A 2Z1XA 2Z1VA 4L7ZA 4NU7A 3CPGA 2VELA 5DQPA 2E5BA 3QR1A 1Z6KA 4HNVA 3GXMA 3CTLA 3VCNA 1JFXA 1IWPA 3ZZ1A 3FKKA 4E8DA 3S47A 4HJWA 2PRHA 1A5LC 3LV5A 4PCNA 4O8RA 2OCZA 1HFBA 1HKIA 3MDUA 2CZVA 2Y7GA 2FPTA 4DXKA 5BWAA 1JDAA 1ZBCA 3P67A 3UP8A 3MJMA 1XHGA 1VCVA 4YYCA 1QAPA 3KXQA 3IEBA 1M01A 3GC5A 3WF0A 1E6QM 3UWEA 2QVNA 5FJRA 3P82A 3CAWA 4MUPA 1OZQA 1XGDA 4PEEA 4ZOBA 1UH3A 1KXQA 3TROA 4ML9A 3EOOA 1QATA 1BQGA 4GWEA 1E3XA 3RCYA 1VS1A 2ZUMA 1R30A 3STEA 1B3ZA 1W5OA 3CIVA 4ONVA 3BMXA 3ZSTA 4LYPA 1OSEA 5JMUA 3RILA 2KX9A 3PBMA 4PRRA 1ZBWA 3A47A 1OIFA 3FV9A 5FEWA 4QLJA 4RR4A 2XIMA 1OG6A 2ZWZA 4WRHA 1KXVA 3B40A 3E9AA 3KUMA 3KP1A 2J47A 3VU2A 2PLJA 2X16A 4AD5A 1XLBA 1ELSA 4I3GA 3T42A 3WUGA 1R3TA 1ZGDA 1S5VA 1Z7AA 1P0EA 4QGCA 2OSWA 3S1VA 2VC7A 4DI9A 3UA3A 4ROQA 3MZNA 3KBWA 4NZ3A 5LNVA 1IT8A 1T96A 4WKFA 1VZWA 4BFAA 3BSMA 3LD5A 3QV9A 1ONWA 4JCMA 1O5KA 4P7QA 3PUEA 1TPEA 3BO9A 2W66A 3TKFA 1CXFA 2XIBA 4GNKB 4YIWA 3CZLA 4HCLA 1GYMA 1E70M 1O5RA 4FF5A 2VFFA 1H50A 5CAHA 1AVAA 4MIMA 5CSRA 1FP9A 4I90A 3B8IA 4X63A 2Q6ZA 1I4NA 2QIIA 1TYGA 4XKYB 2BVDA 4UTTA 1YHTA 3WD1A 1TTJA 1QMLA 4WJXA 5CZKA 1Z89A 3QV8A 4JEJA 1UR8A 1FCQA 2C0HA 4HYWA 3GY1A 4GE8A 4DI8A 2DY3A 2FPVA 4M6QA 2G41A 4DO6A 3T2PA 2XHYA 4DELA 4CVUA 5DO8A 1SPQA 2RH9A 2O9OA 1E0WA 2ZE0A 1H41A 4U28A 1TV4A 1GVOA 1OYBA 1C91A 4HHHA 2DZAA 1WE5A 2VZVA 1XDJA 1BXBA 1QHPA 1VRDA 2FH6A 4QTGA 2BGSA 4U3CA 3NQEA 1E4LA 1SZNA 1UPMB 2PRMA 5DN1A 5EA9A 4QG8A 2YFNA 5HUOA 1CB7B 1E51A 4I9TA 1PO9A 2YDQA 3N18A 1XSKA 4C6DA 2E67A 3ABXA 1KV5A 4G8TA 1QO5A 3V5FA 2Y6ZA 4RZBA 3RLHA 2V82A 4ZVJA 2XVKA 2JKPA 3OLDA 3TQKA 5A6SA 4S3CA 3GLCA 2WYSA 1UKTA 1AA1B 2V3FA 4JYEA 2JK2A 3EX3A 1IEXA 2DQWA 3CYJA 4W8BA 3ABQA 1A47A 1PX3A 3N15A 1L6FA 2JIEA 1XUUA 2XUCA 2FHBA 3PSWA 4URIA 3DHDA 4JKLA 5A6MA 4S2CA 3ZR4A 3U0HA 4CNTA 2IKJA 3PWIA 1TR1A 1VHNA 3PZIA 1CT5A 3WK3A 1AL8A 3WF1A 3NFUA 1HN1A 1Y5VA 5DT7A 2D1ZA 1K9TA 3UCDA 4GGHA 4XBSA 4V27A 2CLOA 1GOKA 3FK4A 2XU2A 1UPPA 3UG4A 3VPLA 5C2CA 1A53A 4N4PA 3L9CA 4HHPA 1DXIA 4MAZA 1EJRC 1QT1A 3S1GA 5H1WA 1EWDA 2NSOA 3KDOA 3TYUA 1AH4A 3I4EA 4J1OA 1XC4A 2R6OA 4GABA 1VEOA 1PZ0A 1CXHA 2INEA 1FHDA 3VIOA 3GNDA 4A3HA 1YTDA 4DPQA 1HVQA 7ODCA 1E72M 1PAMA 1QI2A 4HNOA 2V2CA 1FHUA 1LZOA 1XQLA 3L65A 1ZSXA 3N19B 3VE9A 2WMHA 4PTMA 3WNMA 4DJDD 3EOLA 3PC0A 4Y6GA 1J6PA 1XLKA 2GLKA 1M7OA 1W1TA 3CHDA 4MM1A 4K7VA 2QS8A 4OGZA 1QNOA 4AQLA 2J88A 2IXVA 1SW7A 3WSUA 1F76A 4N7QA 2F7FA 5CPTA 4AFYA 5E70A 4AZIA 3BVJA 3ITYA 3NXLA 5K9DA 3U48A 3BICA 2QW5A 1TUFA 1L2UA 3UESA 2WJDA 4P8WA 4L4PA 2OU4A 4KIRA 4BQ2A 2H3BA 4JTLA 3Q2DA 5C54A 3VGBA 4LVBA 4GYPC 1KFWA 1B3OA 3MJYA 3NDOA 2PLCA 5HR7A 2BODX 4MNKA 2WK2A 2E40A 4FF7A 3TJIA 3BW4A 5BXTA 5AVHA 1TWIA 3DI1A 4Q6XA 4DNHA 2L5HA 3MSYA 1SJDA 3UF9A 3USZA 2VFHA 5IBXC 2O56A 4MWAB 4ZOCA 3TJ4A 5C8BB 2Z1SA 1U22A 3O06A 1V93A 5G4WA 1W32A 2V30A 1S2CA 1XSIA 3W28A 1JGIA 1KA9F 4D8ZA 3GVRA 3VDGA 3B8VA 2PFHA 2QCEA 2AAAA 1XJBA 5A8PA 3L0KA 2NT0A 1TX0A 1CGYA 4J27A 4DAFA 1UB3A 1V6TA 3N6HA 4L1XA 1EX1A 5BWFA 2VEGA 5GJPA 1RVGA 1KRAC 3GW0A 4OFCA 3TN3A 1VENA 2UY5A 5F4WA 2WBGA 4M7TA 1H51A 2ZXDA 4XO6A 4Q6JA 3C2RA 3B4UA 3QYQA 4H83A 3D47A 5DXYA 5A94A 2GFTA 1K6AA 5TBOA 2O4QA 1HL8A 2X1IA 4C1KA 2NXHA 2QUTA 5CLTA 3VD9A 3FVMA 3VZXA 1UA7A 1UD5A 1N55A 4YTTA 2CWNA 3R79A 4XVEA 4ZTYA 1C8QA 2QEZA 3HF3A 1WOAA 3SW6A 3GNPA 3KTSA 3WLRA 2FJUB 3LYEA 1J18A 1QOPA 1T6MA 2WC7A 4MNJA 1UP2A 1A5AA 1LRNA 2GOKA 4YTSA 1UR4A 1O66A 3WF2A 1XRFA 1WNOA 2PDMA 6ALDA 1ITXA 4MJMA 3NQMA 4QISA 1OCBA 5KZMA 3C86A 3BW2A 3WY1A 1FXPA 3AXIA 1JD9A 1EJTC 3LXCA 3IWPA 3H53A 3IIOA 1H3GA 1MMFA 1RQEA 4UNKA 1VBHA 5D09A 1A5CA 1BYAA 3CMFA 2XN0A 3VIJA 1M04A 1E6PA 3BLIA 3ZLGA 3C2YA 4TMCA 1WAWA 3N3MA 1YE4A 3KL0A 3CM4A 1PSCA 8CGTA 4Q4MA 4JAWA 3QLDA 4JTHA 1Q6QA 1KQZA 2OKTA 4OHQA 4WKHA 1GWJA 3N73A 3EX6A 3CEPA 2ZVIA 5AVNA 2ISSA 2E3ZA 3QW4B 1WV2A 5HANA 1C7TA 4F79A 4HOWA 1KKRA 4TUFA 2XGZA 3WDJA 1UMYA 3WK1A 2OX1A 1QO2A 3BPWA 4MZ1A 3W70A 2YLLA 4IX0A 4XVDA 3P0XA 3NIYA 4PMRA 1VYSX 2W5FA 4CD8A 1Y65A 1KGWA 2VTFA 1ZENA 1JCYA 1G7VA 3FSTA 4JGDA 4RNIA 1V7YA 4R88A 3QHNA 4US5D 2IMRA 3E38A 3Q37A 1I75A 4AVNA 3FJLA 4GI4A 1SR0A 3V36A 3ARYA 2ATMA 1UKOA 3TW9A 4K8GA 2OSXA 1W1PA 3OOQA 1J12A 3L2IA 4KETA 1GOMA 4O57A 2TPSA 5HQLA 3G1SA 1G4SA 1C9DA 3AMGA 4TOQA 4HPNA 4OJYA 2ZUWA 1CB2A 4AIUA 3LUTA 3DKLA 1HL2A 3N14A 1TA3A 4JDBA 1EDGA 3PPHA 3W24A 1DJWA 1MVYA 2IKHA 1YIXA 3LM7A 1ZS2A 4TIMA 3ITTA 4UMAA 3A5VA 3QZEA 1KBJA 1KFLA 1JCMP 3OLIA 2Y62A 4HMCA 3V16A 2DIJA 2ZZ3A 2A3LA 4M82A 2Y24A 3B0VC 3CAKA 3ANUA 2VWSA 3G77A 3UXDA 4A2SA 2EKCA 4J3VA 3WEMA 1W37A 2PBOA 1KTNA 1XIBA 3R12A 7PTDA 3W07A 1CXKA 3ZVIA 1J10A 3Q94A 1ZP3A 1W8GA 2CEQA 2QV4A 3NURA 1NU5A 2AMGA 3HPSA 3UCCA 3GK0A 1IZKA 1R46A 4DJDC 1R7AA 3CZEA 2VD8A 2WVSA 3FA3A 2FB3A 3MMTA 1SVDA 4J3WA 3KL3A 4YCPA 2DSUA 1XCXA 3N29A 4NZCA 2OYKA 1KWGA 1EGMA 4DXVA 1OGSA 2J13A 1XINA 3TNBA 3CLMA 3V0UA 3NVTA 1TZ9A 5E6YA 4X60A 4OBSA 1W1ZA 3L0GA 4Q8UA 2J4GA 3F4VA 3I4KA 4GZ7A 4LUSB 1GOIA 2MANA 3H6OA 4LYRA 3THCA 4JTRA 3TQPA 4N9BA 1EB3A 4CD5A 3OIXA 3WQGA 2BWGA 4ZE4A 4FHAA 3QPYA 4LANA 2G3FA 4MFEA 4UXDA 5BRQA 3GDLA 4WHBA 2QDEA 7CGTA 3W71A 2AGKA 3WNPA 1J11A 2B81A 4J3ZA 2WZEA 1BWKA 3PZVA 4H6KA 4BR1A 4IQDA 3U4FA 3LMZA 2IQTA 2D24A 2KZHA 1MW3A 2ZXQA 4LWWA 3N2MA 5AY7A 1VIZA 3C0SA 3W81A 1RLDA 4XD6A 3KZPA 1GKQA 2X1TA 1XIGA 3N6JA 2V5LA 2B7PA 3UR5A 2ZX6A 2C19A 2YXOA 1W1B1 3U2ZA 1FY6A 1LUCB 2F2KA 3N25A 4D9PA 3ZR5A 3HPAA 4C5ZA 3NPWA 5GNYA 3AZRA 4U2ZA 4R5EA 4GVGA 1XLLA 4GA8A 3BMVA 3WLOA 3HG4A 3QR0A 3R0DA 5K2ZA 1EJSC 4WX2A 3I6EA 4LH8A 1TVNA 1DJNA 3FJNA 1B31A 3VOFA 1SW0A 1RJQA 3T4CA 1E55A 3G22A 1N8WA 2PP0A 1ZRQA 3OU8A 1EUAA 1TZZA 1VH7A 4Y2WA 1M65A 2OYLA 4DAIA 4KFNA 3UZZA 3OW1A 2ISWA 3TR9A 3KL5A 2W9MA 4ICMA 2RDTA 2PGRA 1I2NA 3BXWA 4N0RA 3MDWA 2WHJA 2QDDA 2PP1A 2XZ7A 3IGXA 3M5ZA 3S5SA 3VOCA 4F0RA 4LS0A 4FNQA 1K6WA 4BWLA 1QOXA 1S2UA 5FL0A 4PCSA 3NGFA 1FTXA 1BVZA 4LS2A 3PG9A 4E2BA 5AC8A 2VVNA 4LVGA 2HVMA 5CZSA 2QHAA 3VD5A 3W25A 4G5DA 4PMXA 2HCVA 4UR7A 3WDHA 4EXBA 3G1HA 1RH9A 5HNRA 2E25A 1LT8A 5LIUX 2XN2A 1Q65A 4NHVA 3UEQA 3FYPA 2BXYA 3LPFA 2V69A 4W8LA 4NJIA 1PKYA 2X0YA 3MANA 1SYTA 4MYXA 1GW1A 3QEZA 5JIPA 2FLIA 2O9TA 4LRSA 1C92A 3ITVA 1IZCA 3VGHA 3T0BA 3TYAA 5LNWA 1MW2A 3EX2A 3NSXA 4NIRA 4MGGA 3H12A 4FS9A 3SCSA 4BQ5A 3F2BA 3PWGA 3L21A 1W9BM 3W7LA 2ALDA 3HGSA 4NZ4A 3NOYA 4IXHA 3D5HA 4UTMA 3VOGA 2ACRA 3GNRA 2Y8KA 3FOKA 4ZO9A 1J0YA 1RA0A 5D37A 3TSDA 2Q71A 3AXMA 4UTLA 3REQB 4LJ3A 3SFKA 4XIAA 1UZ4A 5I2UA 3A4AA 4PL2A 3MMDA 1XFBA 3R94A 4IICA 1TMQA 1TG7A 3B0XA 1GVIA 3SY1A 2RHGA 3QY7A 4GVFA 1XIJA 3BJFA 2EF9A 3RCMA 2OT0A 3IGHX 4BQ4A 1I1XA 1QBAA 2Y88A 3G6LA 2G3JA 3A6OA 1FH9A 1N82A 2GJPA 4RE4A 1TWWA 5DMYA 3URBA 2F38A 4D6JA 1GPFA 2EEXA 2UZ9A 1XISA 4ERIA 4I7VA 2J8TA 2QCNA 3HV9A 1WA3A 1FH8A 3KVMA 3UJRA 5GVJA 3E02A 4AB4A 1MEWA 3MWAA 1E4MM 1EC8A 3M64A 4XZIA 2VO5A 4B2DA 3BCDA 4DZAA 4KEZA 2Z4GA 1NSJA 4GKLA 4Q33A 2FKPA 1OZMA 3AWOA 2W92A 2XYLA 1P7TA 4UR9A 1OD8A 2NXIA 4I9MA 1IIHA 4G7EB 2CITA 3CHEA 5G5IA 1B57A 5GNZA 3V18A 3W7QA 5A2CA 2W61A 3O16A 2V68A 3FJ4A 2OZTA 3S4TA 4EP8C 4P7LA 3GG8A 2PWEA 4HU8A 1E4NA 4F2BA 4LBSA 4UTWA 1WCGA 3WBEA 2VKZG 3AHTA 4GKTA 5LYRA 3GW3A 1POKA 4JQAA 3QY6A 1I2QA 4H9MA 3I3DA 2PDPA 8RUCA 4JS3A 2J7BA 1B3WA 1VJSA 1KLYA 3NDYA 4QG9A 3TXZA 4PSPA 4KESA 3LSCA 5IRPA 2DDXA 4JPGA 4K8HA 2ZWYA 4H8NA 4GLEA 1E15A 3M43A 5DCEA 1E0UA 3UZXA 3ES7A 2GGIA 5AC5A 3W1LA 3W7OA 4A6GA 1GG0A 3WQOA 2GVYA 4AZ6A 3TCSA 3GKFA 3HM7A 3ZT7A 1ZLPA 3WLLA 1MXGA 1I9CB 1T5AA 2GGGA 4OV9A 1AODA 4FLQA 5BROA 1HP5A 3V5OA 2DIKA 2AQOA 2ZBTA 1VBGA 2J74A 1GQNA 4G56A 4NNCA 4ZB0A 3BAKA 3LCXA 2G37A 4AX6A 3DCPA 5A6AA 5HATA 1IXOA 3U9IA 3CBWA 1FCUA 3GVWA 2PP3A 4LB3A 3KOXA 3T07A 1Q6EA 3D3AA 4WXYA 3DYOA 3ERPA 5GPRA 4AD4A 1HJUA 4O0ZA 4J3UA 4Z17A 1MFVA 2VEMA 2GK1A 2OMAA 3W1QA 4OTKA 3A3HA 3ANYA 2ICSA 2VFDA 1DIOA 3LU2A 1EJVC 2XFYA 4NX0A 1UMLA 3NO3A 4EXQA 3DBPA 4IUOA 2DU2A 1VEPA 3M0KA 5KETA 4ASTA 5ECUA 3MW7A 3W7MA 1F4AA 1G01A 3R25A 3CUGA 4C6MA 1XLHA 5MKGB 2BVWA 3B9OA 2NLIA 3VKCA 3TN5A 1XV8A 3SN4A 5C9UA 4U31A 1V51A 3WN6A 3ZLFA 4UOQA 1EOKA 1Y5WA 3S42A 3WYZA 1QXLA 1CGWA 4YHGA 3TSMA 4DRSA 3M9YA 5J04A 4H01A 3RK8A 2WM0A 2BDQA 1UYQA 3KWSA 3WQ5A 3SGGA 1GQIA 1X96A 1LF1A 1TPH1 2WO5A 1VR6A 2VX7A 2O4MA 3DYPA 3R6IA 4CEXC 1UBSA 2WW5A 1RCOB 1MDLA 2H8ZA 3CB3A 2C0AA 2C15A 5C2XA 1W3NA 3VNLA 3CAVA 4HZMA 2ZDSA 4M51A 1RAKA 4EXAA 2UY4A 3K2GA 3NZ1A 4R53A 2WANA 3WLQA 3W7HA 1VPYA 1DJIA 3WEOA 4FSAA 4M80A 2J66A 3BLLA 4RNHA 1W91A 1VKFA 2XGIA 4RZ6A 3F03K 2Y2WA 3DG6A 3TQ0A 2BMBA 3MZ2A 3IAQA 2OT1A 4EOUA 1B4EA 2EAWA 4XD3A 3QZAA 1QI0A 1GNXA 2WSQA 4JL2A 4E38A 3NWRA 3WH8A 3EKGA 3W1AA 5I09A 4NUWA 1UKPA 3AIRA 2V63A 4IXXA 4ZSTA 3LSBA 2HE5A 3WFLA 1S2AA 3ZM8A 1FA2A 4JFUA 5D33A 1FVPA 1XLJA 2VFEA 4Z2JA 3P7YA 3R11A 4ICNA 4Q3MA 4MZYA 2BY0A 4M6UA 4ZXLA 3CMJA 4ATWA 2CLKA 2RGMA 1OFQA 4HMDA 1RQBA 3DGRA 4Z1YA 3B03A 2O7SA 3TK7A 1RCXB 4JKMA 1J01A 2I16A 3WUFA 2F6KA 3WQFA 2XG9A 1QHOA 5FACA 4B5UA 2CKRA 4X0NA 4TTUA 3HJZA 3OO2A 4O10A 2PDWA 4BCEA 1EL3A 4PRWA 2WHKA 3MI2A 3GTHA 1R0MA 5FEXA 5LXXA 4PL1A 2O7QA 1EF3A 2XH4A 4PFHA 1VFFA 1J5SA 1KBIA 1KRBC 3W38A 5E9AA 3KX6A 2VZTA 1T8QA 4A05A 1UUMA 1S5NA 4Y9AA 5A6BD 1MO0A 5GQBA 3S9YA 4CQ8A 3EDJA 3VVGA 1VFSA 1HO4A 3BTNA 1X7IA 2DZTA 4P8VA 3VM5A 4QAIA 3P8IA 4GNJA 3XINA 1TREA 2PZNA 3OLGA 3U7VA 3AMCA 4V33A 4JIQA 1NARA 6REQB 2OQHA 4LUYA 3GIPA 1KR1A 3WBAA 1P0DA 1E6ZA 2Y63A 3UD6A 3LA4A 4EIVA 1G94A 1PKMA 3MSDA 1A0EA 2E9BA 3ZJ6A 3HIJA 3PVFA 1MDRA 3DOPA 1LBFA 1QI4A 4DBEA 3G8RA 4D6HA 3QTGA 2PDYA 3N12A 4IGMA 3BC9A 3QYSA 3G2GA 5DT5A 2HK1A 1RVKA 4MKSA 1KCKA 2QPSA 4XAZA 1ONXA 4A35A 2I14A 1OG0A 4RJEA 4HSOA 5LXEA 1J93A 4V15A 5I77A 4AWSA 4CU7A 5HPCA 4HZ7A 3ARTA 4CD4A 4GXPA 2P8BA 4HN4A 4PZVA 4M1BA 2AKMA 1GTEA 3BCFA 1FWBC 1SO6A 2WVVA 4B15A 1XKYA 3FGCA 5K4XA 1F9CA 1NIUA 3QM3A 3IRSA 2DW7A 5GNXA 2FGLA 2VJXA 4XZLX 2PRLA 2HMCA 3GNXA 5A69A 1VFTA 1F7BA 4LGXA 5FCZA 4A8RA 4D1JA 3GD6A 3H7VA 1XX1A 3P74A 3T2QA 3RUBL 3VGDA 2OO0A 4H2CA 4YNGA 4JHOA 4Z2GA 2Y61A 3WL1A 4K36A 1BSLA 3GR7A 1E0VA 4IP7A 4OZOA 4E3VA 2DH2A 1JCXA 2FZNA 4XZMX 2Q3RA 4H9YA 3B97A 3CMGA 1XF0A 4PUEA 1RP9A 4LF2A 2GVLA 3IGSA 2BBFA 3VINA 1F6YA 1OC7A 2A2IA 3BCJA 4AF0A 3OHIA 4AIEA 2BX7A 3BLPX 5DMMA 5FI8A 1Q4WA 3LHYA 2YBUA 2OOGA 4I5XA 2CYGA 1GVQA 1K02A 3BZGA 2XVNA 1BEUA 3WJSA 1E43A 1G4TA 1CBGA 3EWCA 4ES4A 3N2CA 2Z6IA 3SUWA 2Z1WA 4Y9OA 1F8MA 3BK0A 4NXKA 2QDGA 2GQ9A 3L12A 1DJXA 3AQUA 2BY1A 1Q45A 1OBAA 2HROA 7ENLA 1U1UA 1WZKA 3RDKA 1ONRA 1X98A 4C1NA 5D9MA 5FF3A 4Q7NA 3BV4A 3BLOA 5I3HA 3THQA 5HXMA 4A8LA 2HPMA 4N2YA 4PN2A 4PTVA 2PBGA 1FHLA 4NYUA 3DKJA 3VDCA 3N9RA 1JUEA 2PU1A 2RGLA 5H8UA 2ISVA 1YTKA 5HINA 2QMKA 1F2JA 1NY1A 3SN1A 4F48A 1B0IA 1EQCA 2E8YA 3M41A 4IIHA 5J8LA 3GAKA 1TKKA 4YS1A 1DIDA 1GG1A 3DFHA 3K4WA 5HMFA 3GTXA 4G7FA 1JDFA 1ISVA 4PTWA 3H7RA 3PTDA 2R1KA 1IGWA 4Z08A 2IQ0A 1BVNP 2YW3A 2OSYA 4HCDA 3G1DA 2OFJA 4IP4A 1EGVA 2AAMA 3FAXA 2DUXA 3FW6A 1XBYA 1C93A 3F5KA 1TJ1A 2C79A 4S3GA 3O6DA 3OODA 4O0QA 2H3DA 2D69A 1LQAA 5DF0A 3KWXA 1KXHA 1OWQA 2ZFAA 1Q2RA 5EMUA 3R4IA 2QXWA 3LCLA 2WJZA 1XLEA 4NVTA 4O1FA 3EKZA 3QC0A 2IS7A 5D2WA 1S3HA 3CH9A 2NUYA 3GDRA 4XZWA 5AC4A 2PDUA 2CBUA 4IFOA 4PMVA 3QOMA 2BVTA 1I0BA 3NM3A 2ZUUA 3QOKA 1XDMA 4PCFA 3ARZA 4ZSUA 3VD4A 2YCIX 2A3CA 3BURA 3WQPA 5H2ZA 4M19A 4H8HA 1TIMA 4GGBA 4HJFA 4IJRA 1G6CA 2O9PA 1IT0A 3A9IA 1K4GA 1CPUA 2F9RA 3AO0A 4G9PA 5A6TC 3N2BA 2Y85A 1W5MA 1WKFA 4H41A 4K37A 3C61A 3URAA 3O7UA 2F6XA 1UC5A 3BLFA 2BZNA 3CL6A 3FXYA 1GYLA 1EJXC 3OP2A 4WXZA 2BOFX 1YEYA 4YU1A 2VEPA 3QMSA 4ML4A 2QLYA 2V5DA 4IPPA 4GBUA 3CNYA 1NDWA 3KBVA 3QPZA 3K8MA 1NWUA 4HA3A 3OLEA 4BJHA 4FNUA 3P62A 1VLWA 4RX0A 4GY0A 1K9EA 4YHEA 5A95A 3MP4A 1EWEA 3MS8A 2QKFA 3LTYA 3S6OA 2QJGA 1GPWA 1L0PA 4H9ZA 2D73A 3UXAA 1GK8A 1WBJA 1OX4A 3PJXA 1ZJHA 2YXGA 3EDDA 1EJUC 1UOZA 2VGFA 5CGQA 3CASA 3ZVHA 3LHWA 3V75A 3UXLA 1LT7A 2JEPA 3U2OA 2VC6A 3KRZA 2WVTA 2ISFA 1XH1A 5HDRA 5AYZA 1TCMA 1PTAA 4R7WA 5HMSA 3STPA 5BRPA 2DZVA 1TV7A 3RPTA 3F2CA 2QCDA 3EOSA 3URNA 4NL1A 1S39A 2CZFA 1NWTA 2PODA 2HJPA 3UWVA 1A3XA 5C7HA 5C9WA 3OGSA 3HGRA 2A3BA 4EVZA 2FMNA 3PS7A 3OQEA 2GJLA 5JQ9A 4R7JA 2IKGA 3S2JA 2W67A 1V0NA 1OYAA 3GRIA 1EC9A 1H62A 2INZA 3UPMA 5EY5A 1A5SA 1QW8A 3M5XA 5HJLA 4K3ZA 3QH2A 3N04A 3AS3A 2EG6A 1H11A 4L4OA 4C91A 1DORA 3V0TA 4M3PA 3OIHA 3BLDA 3M0HA 1BTCA 3EOUA 5C9XA 3WBYA 3H2NA 5F2IA 4HSNA 2IPGA 2PUZA 3W00A 3NYZA 2Z7KA 4AD1A 3CUFA 4TVDA 3TN6A 1RPXA 4D72A 2EJAA 4IPLA 3ZQ9A 3ITLA 2AL2A 9XIAA 1M03A 2D2HA 4I8YA 3JUGA 3QMTA 1EP1A 5C5YA 2VI0A 1P4CA 3BQ6A 3H70A 2GQAA 2AL2B 4CLMA 4ZQOA 1PL9A 8XIMA 1ZFJA 1CLKA 3F1QA 1PXGA 2WCGA 4HYVA 5CC7A 4LVDA 4UNIA 4U2YA 3U7BA 2A3HA 2Z1BA 3W3OA 3RMEA 4JTFA 1R8LA 3WG6A 3A3WA 3FN9A 3UQNA 5CAKA 1UD3A 3PUGA 3UFYA 1EDQA 1OEPA 5LZLA 1HNYA 3B8UA 3NCOA 4UQAA 4BWLC 2VGGA 1H7XA 1JAKA 4O1CA 3PJWA 4KPLA 1UBPC 4RLIA 2EPLX 5JBFA 1JULA 4TQTA 2YXXA 4AY8A 3HU7A 2GUBA 4LS1A 3PZOA 4K6AA 4HU0A 4UC5A 2H6RA 5B80A 4X61A 5RUBA 5A8MA 5DBTA 4PSRA 2X40A 4XAGA 3WK0A 1S5WA 2A0NA 1JQVA 2YJQA 1ME8A 1JG9A 5CBIA 1ZPTA 8XIAA 4DZ5A 3H23A 3MC5A 3A5FA 3GFXA 3FX4A 1Q85A 3PR2A 4C60A 3AS1A 3GWQA 5ABFB 2XZ9A 2D2JA 4FOKA 3FY1A 2P3ZA 1AMYA 1JPKA 1KV8A 2VEKA 3CIXA 2YIHA 3RU8X 4LUTB 4GISA 4FA3A 3F5LA 4EPBC 3AS0A 4FLSA 3VC5A 3L5LA 5I3KA 2VCAA 1KWKA 4I5UA 1F61A 3P5ZA 1BXNA 2PDLA 1E5JA 2VC9A 3AIBA 1EPVA 2DP3A 3HFTA 9XIMA 4CCCA 3RLGA 2YL5A 2YW4A 1SJCA 2IKIA 3NPXA 1Y5XA 3C5QA 4XTDA 1L6GA 3PTMA 4JCLA 1O60A 1GYNA 3GXDA 1LL4A 1XBXA 3LHTA 1EA0A 4YJ5A 3RRAA 2CXEA 1PYFA 4DIAA 4NASA 1YDVA 3VMNA 2WVUA 1C9WA 4YVPA 1F3XA 5ABFA 4EPEC 4KGLA 3RPDA 4AWTA 1WBHA 1A4LA 3MP3A 2CBIA 1JDCA 2WLZA 3IV3A 3ITOA 3AICA 5H8MA 2VURA 1GOWA 4GX8A 2VRQA 3MU7A 4OUEA 3WCZA 4M7SA 4UQ9A 5EMYA 6ENLA 1EBGA 3W2JA 4DQWA 4IJBA 3M0MA 2BS9A 1UD6A 1XQKA 4L61A 1V6YA 2QUNA 3W88A 1E6SM 4L6OA 3MI3A 3GH7A 2CW6A 3GM8A 1OHLA 3NZQA 2HE8A 3GH4A 5CLWA 1HJQA 2E8ZA 4ADUA 3ARSA 2DVXA 3C8FA 2C71A 4P7RA 2VNCA 5T26A 4BS0A 3POCA 4EACA 2AQWA 1VBJA 1M7PA 4MB1A 4ZTXA 2IUZA 1R2RA 2YCLA 3UY7A 1KRCC 1EFZA 1UWSA 1GVFA 5FSEC 3GC4A 3EWUA 2WBKA 2WZHA 1R3QA 3TONA 1WXYA 3MMWA 4ZQRA 4GFSA 1XBZA 3CV7A 2OO6A 4GUFA 5KSWA 4AMAA 3P5YA 3VILA 4WQ6A 1UG6A 3S2NA 2GSHA 4Z1BA 3ITGA 3HGJA 4JQ3A 3NZPA 4MFDA 4GC3A 4C7GA 3IK2A 4D8LA 4PR4A 5E5CA 3FA5A 4NZ1A 3J7HA 4D6FA 1AFSA 5K9CA 2E9LA 2XWEA 1PWLA 4O0KA 7A3HA 2J6XA 4AD2A 1UR2A 4XSLA 5D38A 1RK5A 1JVNA 2JQXA 3TZNA 1H2JA 4LAKA 4OECA 4QQ3A 4GY7A 4ICCX 1K9FA 3QLLA 4HP5A 4KCWA 3EXTA 1BWVA 1I2PA 2WZMA 3DG7A 1UROA 2INFA 4GG9A 1WDDA 4FO4A 5M1TA 4GYJA 2XFWA 4M8UA 2OWXA 3F4CA 1VFMA 2QMJA 2ZTJA 3T8QA 4FNTA 3GZAA 1NQKA 3EA3A 1B3VA 1GOXA 3VIFA 1AQ0A 1T41A 4Q7BA 4QRNA 3FKRA 1R3VA 1UJQA 3IJDA 3KS6A 4JTTA 4HBKA 3OPSA 1GJPA 1HJWA 5EKYA 5F4SA 4AZCB 1PIFA 4AY1A 4IJCA 1P5BA 1ICPA 4DO5A 1AH3A 3E2VA 1E73M 1XLCA 4ZA0A 5F7UA 3KTXA 1A4MA 1HG3A 5HNUA 4FMVA 4I8DA 3TSBA 5IDZA 2EPMX 3EDKA 3RXZA 1WXZA 3M0VA 3M47A 3LCFA 3KLKA 2YA2A 1BGGA 5D4YA 1XKJA 2VD9A 3SJ3A 2X2GA 4FB7A 1W5PA 4B5TA 4HOZA 1BKSA 3A22A 2NQ5A 4ZODA 3G18A 3JS3A 4DWDA 4PRTA 4A8NA 5D05A 2VDGA 1J2WA 1BYBA 2DZWA 4HA4A 3EEZA 2NSXA 3B8TA 4K38A 2QAPA 2EHHA 3LHZA 4B3KA 5M2FX 3R1ZA 1DJYA 4U5IA 1OABA 3AIUA 4W87A 4RDZA 3SCUA 3HG2A 1TPC1 1JYXA 5FA5A 3CJPA 1DTUA 3NM1A 1XD0A 2A21A 3DH7A 4FK9A 3UNDA 3E0WA 2YA1A 1UOKA 3NQ8A 4H6EA 1MUWA 3VKBA 3NQGA 2ONEA 3SRHA 1Q13A 1IHIA 2WB5A 1Q8JA 4GC4A 3W27A 3W26A 3HJEA 4CUCA 4EAYA 2VENA 4JIIX 4JXCA 4YN5A 1UHVA 4YLWA 2Z27A 4Q8WA 4ZOAA 2OLSA 1Z32X 1UCWA 3TYZA 3AYSA 4PTXA 4XSMA 3TFXA 4W9TA 5CZ0A 5CG0A 2VDIA 4O1BA 1F74A 4GCAA 3M16A 3L2LA 1FDJA 5CPQA 3JR2A 4Q4RA 1OX6A 4IMDA 2V5JA 4GUGA 3E2QA 1W8SA 5FF4A 3RLVA 5I24A 3NUKA 3USBA 2ZX5A 2NX9A 2W91A 3E2SA 4XK2A 3BARA 1J0JA 2QNEA 3NQFA 4QM1A 4KCVA 3W85A 3CO4A 3KVJA 1V8EA 4PMDA 2WPBA 3L4UA 2JF6A 3HG3A 1XD1A 4P5UA 4QDWA 5AHNA 5EMKA 2BNJA 1D8CA 2B31A 2WWDA 3N6QA 1W9DM 3ZJKA 4D1IA 1UUOA 3WNKA 4O16A 1GQJA 1SFJA 1W1VA 4EKJA 2PDBA 3GKAA 1A5UA 3DUGA 3H2AA 1R7OA 5JUVA 3OBKA 1W5QA 3T8LA 1D7KA 4OKDA 1V08A 1V6XA 5IHSA 1XLMA 3UU0A 3STGA 3L4ZA 3MBFA 3EYPA 4CN6A 4GPNA 1S38A 1NF0A 1MRQA 3SCNA 4PBFA 4W8AA 2VEFA 1DWAM 4E5TA 5FJJA 4IQJA 1G9HA 1KCZA 3BWWA 3L4WA 1PV8A 1FWTA 2DORA 4NI3A 3W9ZA 3IS4A 1KKOA 2FGZA 3ITXA 4GUIA 3UNTA 4BQ3A 1M3UA 4NAEB 4E3TA 4IMEA 2VDHA 4DF0A 3LENA 3Q58A 2X0HA 1JRBA 3RN6A