3R94A

Akr1c3 complex with flurbiprofen
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
316
structure length
303
Chain Sequence
b'QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Crystal structures of three classes of non-steroidal anti-inflammatory drugs in complex with aldo-keto reductase 1C3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 118
structure length 303
sequence length 316
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2011-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3r94A00
5LIKX 4L1XA 4XZIA 2HDJA 4AUBA 2HEJA 1HW6A 1C9WA 1ZUAX 3LN3A 3M64A 3WBYA 3G1RA 4IJRA 2I17A 1FRBA 4XVDA 4XVEA 3GHTA 2IKJA 2IPJA 4WGHA 1RY8A 3EB3A 2IKHA 2C91A 3O3RA 2FZ8A 2PDNA 2PDHA 3P2VA 2ACRA 3BCJA 3LQGA 4LBRA 1XF0A 3RX3A 3EB4A 4JIRA 1HQTA 2IKGA 4DBSA 1AH4A 4HBKA 4ICCX 2CLPA 1XGDA 1MZRA 2PF8A 1ZQ5A 3H7UA 2PFHA 4JQ2A 4XZHA 1Z9AA 1T41A 4YS1A 1YNQA 2PDLA 3R8GA 3LZ3A 2PDQA 1XJBA 3MC5A 1Z89A 4GQ0A 2PDPA 2FZBA 4PRTA 1S1PA 2IQ0A 1PZ0A 4JQ4A 4YU1A 1AH0A 1YNPA 4LAZA 4JTAA 3UYIA 2R24A 4JTDA 3GHUA 4H8NA 1YE6A 4R9OA 3S3GA 4XO7A 2HVOA 1AZ1A 3LZ5A 4JTRA 3LUTA 4YVVA 3UZXA 4FA3A 5M2FX 2ACQA 2ACUA 3R6IA 2ACSA 3R8HA 3FJNA 1EF3A 4MHBA 1AFSA 2DUZA 1AH3A 4IJCA 3WBXA 1M9HA 3DOPA 4GABA 4HMNA 4PRRA 5HA7A 4WDWA 2IKIA 1X97A 1T40A 3ONCA 3BV7A 4LB4A 5LIXX 3GHRA 3ONBA 4DBWA 4XZNX 4PUUA 2QXWA 4ASTA 1VP5A 1IHIA 3CMFA 2PD5A 4FZIA 1Q5MA 1QWKA 4XZMX 1K8CA 3UZYA 2NVDA 4NKCA 5DANA 3F7JA 4WDTA 2PDMA 2FZ9A 2WZMA 3V35A 4JIHA 3Q67A 4QX4A 3UZWA 2DV0A 2P5NA 2HE8A 3R58A 4PUWA 3V0UA 2PD9A 4WEVX 4QBXA 1UR3M 1X96A 1PWMA 4GCAA 3D3FA 3UP8A 2PDUA 1GVEA 3LNMA 4H7CA 1JEZA 1SM9A 2PDBA 2PDYA 4WRHA 2F38A 5AZ1A 1ZSXA 3GUGA 3COTA 3KRBA 1EKOA 4G5DA 2BP1A 3FX4A 2HV5A 4JQ3A 3U2CA 2ALRA 4FALA 4LBSA 3RX4A 1Q13A 5HNTA 3Q65A 1EL3A 5JH1A 2F2KA 3N6QA 5LIWX 1US0A 2INEA 3N2TA 3LD5A 4XO6A 1S1RA 2ISFA 4ZFCA 1YE4A 1ADSA 1EXBA 2J8TA 4PR4A 4IGSA 3H4GA 3WG6A 1AZ2A 1R38A 5AZ0A 2PEVA 3WCZA 4RPQA 3NTYA 2HE5A 5LIYX 1LQAA 4LAUA 2R9RA 3UG8A 5JH2A 1Z8AA 1A80A 3LQLA 3R7MA 2PDIA 3UGRA 2WZTA 1S2AA 4L1WA 3T42A 1RY0A 4LB3A 3GHSA 5KETA 1OG6A 3R43A 5C7HA 3LEPA 4OTKA 1X98A 4PMJA 3O0KA 1QRQA 4WDXA 3BURA 5HNUA 3UZZA 2PDXA 1J96A 2BGSA 4JIIX 4JTCA 4QXIA 2NVCA 4JQ1A 1Z3NA 4JTQA 3QKZA 3MB9A 3EAUA 1PYFA 3M0IA 2I16A 2PDWA 3V0SA 3CV6A 2IPFA 4GACA 1LWIA 2PZNA 4EXAA 3CAVA 4DZ5A 3DN5A 2BGQA 3ERPA 1MRQA 2FVLA 3V0TA 3WBWA 2FZDA 3C3UA 3UFYA 4Q7BA 2PDJA 4I5XA 3VXGA 2PDCA 4F40A 4QR6A 1S2CA 2INZA 2IPWA 1PWLA 3UWEA 3R94A 1RALA 3LENA 4FAMA 3M4HA 2FGBA 4GQGA 4EXBA 3CASA 5LIUX 4DBUA 4GIEA 1PZ1A 4XK2A 2A79A 2DUXA 2IS7A 2PDKA 2PDFA 1IEIA 3LBOA 3V36A 4WDUA 1ZGDA 4GA8A 4XAPA 4Q3MA 4JQAA 3BUVA 2PDGA 4XZLX 3H7RA 3G5EA 3B3DA 3CV7A 3RX2A 2AGTA 4YVXA 2IQDA 2HVNA 1MI3A 2VDGA 4YVPA 1VBJA 2IPGA 3CAQA
chains in the Genus database with same CATH superfamily
2DIJA 4B5XA 3TYBA 2PGWA 2PBOA 3DEQA 1Q66A 4HNTA 3QR1A 1A5AA 2E9BA 2ABAA 3HGOA 3M9YA 1OFPA 5CBBA 4MF4A 2OOGA 3KLKA 3CJPA 4BFAA 3WLJA 4B2DA 1GYLA 1Q6OA 4M81A 1VIZA 1GHRA 2IKJA 3QC3A 1VEOA 1S46A 1EPXA 1EEXA 2QMJA 3B0PA 3A24A 4PTWA 3CAWA 2ZUUA 3LHZA 2QDEA 2FZ8A 5LA0A 1FP9A 1XLHA 3EB2A 1QNQA 3EDFA 4LUTB 3E49A 5KTLA 5FEPA 1FWCC 4MWAE 5HUPA 4MFEA 3BOFA 4PB3A 2CCRA 4Q7NA 3H7UA 4V1YA 3CZEA 4UTWA 1YNQA 3LGGA 1E6NA 3DI0A 1F76A 1XC6A 2OELA 1KGWA 5D9OA 4QG9A 4GQ0A 3M0JA 4QNEA 3VUPA 3PP7A 1QASA 3MP3A 3N4AA 2WHJA 1ICQA 2AAMA 4A3RA 2DVTA 3G1HA 4JQ4A 4C6KA 5B7YA 5BROA 1DBTA 2BHUA 2GOUA 3H12A 3BQ5A 2V6AA 5CZSA 1NOFA 1WO2A 4FLOA 1ZLPA 4O4WA 1NFPA 3VDGA 4F79A 1SZNA 2HBVA 4XZBA 3VCNA 2VFDA 1PUDA 1OIMA 1VLIA 3C0JA 3PWGA 1UUQA 3CZJA 4PTMA 4S2BA 3B8WA 2D22A 4LANA 3LV6A 3N4FA 2JFEX 3GIQA 2EPHA 2BFGA 1PKLA 4NY2A 3W1RA 3K1DA 3LA4A 4RZ5A 3ES7A 2QAPA 1VEPA 3N15A 1BVZA 3NZQA 4F9DA 3NQVA 3W2JA 5E9AA 4WDWA 4ZQCA 1NWRA 1T40A 1DHPA 4GISA 3QV8A 3E3HA 3POCA 3QM3A 3WMSA 2XGZA 4PUUA 4WY0B 1IR1A 3TQ0A 1BF2A 1L6WA 5I03A 1F8MA 1HO4A 2WZEA 3GY1A 2WVVB 5TIMA 3VGBA 1JUKA 2R1PA 4LV9A 3ZT7A 2TPSA 2J9ZA 3R58A 1UR1A 3SGGA 3TJIA 1RCOB 3TA9A 1LROA 1UBSA 2O9OA 2DT3A 4QBXA 2V2DA 1NELA 2UZ9A 3D3FA 2FPYA 4OBTA 3W72A 5A8OA 3THCA 1KGUA 4YXGA 5ENLA 3TQPA 4LYQA 2BVYA 3MUAA 2F38A 3URNA 3DG6A 1OFQA 2IUZA 4W8AA 1E5NA 1ICSA 3N34A 1GYMA 4NZFA 3WQPA 3B06A 4MB1A 4G5DA 1W0MA 3IACA 2DW6A 1X6UA 2GLKA 2J74A 3PHAA 5HJYA 3QHMA 2VX4A 1UZ1A 1R3QA 1EL3A 5JH1A 4OUIA 1S39A 3O6YX 1EPVA 3IIPA 3VKCA 1H0IA 1S5VA 1TV5A 5BOFA 1LOQA 4K39A 1HJQA 4GOAA 5E93A 3MCOA 1AG1O 4NUWA 1WDQA 1UIPA 3OZPA 5M17A 3WUGA 2XJ7A 1DJWA 4D71A 4PFMA 4ADSA 3BGJA 2R14A 4IIHA 5A6BA 1OCQA 1N7KA 4PH6A 2AKZA 3CK5A 3T7VA 4ECLA 2Z0IA 3MYOA 4HT3A 2WKLA 1PIIA 1JQVA 3AOFA 1PKNA 3TV8A 4S3JA 5D2VA 5KMYA 4WDXA 1F6YA 4YNGA 3W26A 2CZ5A 2XZ9A 4CNPA 2XN2A 1ITQA 2HNEA 3DH7A 1WYIA 4JTCA 4LC8A 4FX6M 4CD6A 1UHVA 1JNEA 3S1UA 3RITA 1UA3A 1OIFA 1U1HA 4DYEA 2PWVA 3N18A 4JFSA 2AAAA 2YYTA 3LRMA 4HK6A 1IWBA 4GIYA 3E0WA 4W88A 1C7TA 3P5YA 5AYZA 4AYSA 3M1ZA 3FA4A 3B8SA 3BQ6A 3TFXA 1DJHA 5EMLA 1W3LA 1W31A 3TCSA 5C2XA 3C5QA 3SR7A 1KGXA 1VS1A 4G9PA 3LI1A 4QE4A 3MDUA 3KDNA 4C6PA 1RCQA 2H9AA 4AEFA 2WM1A 2X30A 3AI0A 3BW2A 1K9DA 2VQUA 4O13A 3VOHA 2WLZA 4Z17A 1JCMP 2C16A 2DVXA 2QQ6A 1E43A 1Q4WA 3IGXA 1YPFA 1EJSC 3UY7A 4U31A 3UWQA 4URIA 3C86A 3MDWA 4DBEA 3LBOA 2CKRA 1M65A 3B04A 3DC0A 3W7GA 3UT0A 2J7FA 2Z4GA 6REQB 1LG1A 3AISA 4H6EA 3HMCA 3H24A 4B5SA 1GONA 1HVQA 1NY1A 3W9ZA 6TIMA 1RVKA 3FDGA 3W84A 4HOXA 2OB3A 4JHZA 1VHNA 4O10A 1TX0A 3M5ZA 3B8DA 1XSJA 4NAFB 5CPOA 5G1TA 5HMSA 4WJ8A 3WELA 1W5OA 4BJHA 1A5NC 1VCGA 5DMLA 1I2QA 3QY6A 2W66A 2DP3A 3S6OA 1AQHA 1LL4A 2UY3A 4XZWA 4RE2A 4HHHA 5FEXA 2GVLA 2OMAA 4P8WA 1QI0A 4ZTXA 1OFRA 1E9IA 2PGRA 3GH7A 1Z42A 2RHGA 5D05A 1JCLA 1MXGA 3KOYA 3R2GA 2YDRA 3BG5A 3SY8A 3VYLA 3KL0A 5ECVA 1KBIA 3LDVA 1L9WA 5I24A 3LBCA 3S1XA 1IXOA 2JIEA 2F8QA 2WQPA 4C7DA 1KA9F 1BVWA 1GPFA 1TPEA 1SVDA 3LHUA 1CGTA 2TSYA 4PEEA 3RX3A 4IF2A 1HQTA 4JTIA 1AH4A 2Y8KA 4CEUC 3GC4A 4S2CA 2VTFA 1XIHA 1WV2A 3ANVA 2ZWYA 2VGBA 1QHPA 1GT8A 3F5LA 5D8WA 1KRAC 1UKPA 4UOQA 4OT7A 3LS9A 2YFOA 4DJFC 8TIMA 4W89A 2Z6JA 5IXEA 4MNMA 2ZC1A 1RQEA 3ZIZA 5EBUA 3W3OA 2VVNA 5CZTA 3SUWA 1B5TA 1KTCA 2GSEA 2OKOA 2VUNA 1BTMA 5GNYA 3WQFA 1PB0A 1KXTA 4EPKA 4HYRA 3K13A 4BY3A 4LNCA 1HL2A 4JTAA 1A5MC 4Y9PA 2OEKA 4WHBA 3TTYA 3DG3A 1RJPA 4W8LA 1PV8A 2QPXA 3PULA 1U5VA 1E9YB 1YYAA 1AZ1A 3WH8A 4QLJA 1OZMA 2FPTA 4B91A 4XUYA 4S3DA 4YVVA 4QGCA 5A95A 4IMGA 3CUJA 3LHWA 1YTKA 2A6LA 4XKMA 3LPOA 1YDVA 3KZSA 2CZVA 3S1WA 3IAPA 2EF9A 3G24A 3P84A 3DOPA 4UQCA 4GABA 3U4AA 3LMYA 3SCWA 4PL2A 1UMYA 5FAJA 5BYWA 4JOMA 2XVLA 4KFPA 2VD9A 2QF7A 1EA9C 2XDFA 4JTKA 3Q94A 5K9CA 4MUZA 3WF2A 4LB4A 3TWAA 4JDBA 4P7RA 3GU1A 2YOCA 2Q8XA 1BXBA 2F7FA 3RJYA 1GVFA 4B5UA 2ISSA 2VEMA 4HZ6A 1XKJA 1JPKA 3NZRA 2NV2A 3BSMA 5I6SA 4PCPA 2CLOA 4GQQA 3MZ2A 1ESWA 3ES8A 3QR0A 4EPDC 4I7UA 4HNLA 1Z7AA 1H09A 1AW5A 5DMYA 3CEPA 1HJVA 4TVUA 4JN8A 5CC6A 1X6LA 1E9LA 4DO7A 1GVEA 2Y8UA 2J79A 2OQYA 3WH5A 3HBLA 2ZWZA 3S9ZA 4DXKA 1W1TA 1QPQA 3DENA 3WFAA 4Z2GA 2ZTJA 5HR6A 4UC5A 2ZTKA 1MSSA 4J3VA 2F2HA 3U2CA 3M0YA 1MQPA 4XBSA 5LGZA 7REQA 2QJIA 4DWSA 3HMJG 3GR7A 1R2TA 3OLIA 1ODZA 3WN6A 3LD5A 4MY1A 2YIHA 4PCSA 3CZGA 5FSDC 3DECA 3W7DA 2QJJA 1PKMA 4IGSA 5XIAA 3HG3A 2GK1A 1BXNA 3C2FA 4FS9A 3TSDA 2UV8G 3SI9A 2V63A 4JTTA 2XH0A 4GG9A 1XG3A 5CEWA 1QVBA 3IK4A 3WQ8A 1E9ZB 1XRSA 4H6QA 3LQLA 1R87A 2IMRA 2QDDA 4Q4QA 1BEUA 4R27A 1H7OA 1RY0A 4B90A 4JHMA 2Y4SA 3WD3A 2V8ZA 1KBJA 1J0ZA 3CMGA 4OTKA 2Y6ZA 1PX8A 3W23A 1SMDA 3RGTA 3UPWA 3SW6A 1UD8A 1A3WA 3MPGA 4ZOCA 2BVWA 1JCXA 1US3A 1V5XA 3QF0A 1KQZA 1PBGA 2VNCA 2OGYA 3GU9A 1CTNA 1MXSA 3VOJA 1XGZA 3VDCA 3W2MA 4CNNA 2W79A 2YDQA 4NJGA 3W7RA 3WQ4A 4C6JA 4RDVA 3QLLA 3IJLA 1MZHA 3TXZA 2J25A 3V4BA 2VGFA 5JQ9A 4O18A 5GQBA 4AZGA 3OPSA 1DWHM 2BGQA 4M80A 3PTDA 3QKEA 3EX1A 4I9MA 4P7QA 2DZUA 4CVUA 3AWOA 2X42A 2PDJA 2HS8A 2WNQA 2W63A 3IJ7A 4UZSA 5CLWA 3KP1A 1W17A 3KLLA 1SJCA 2NXGA 4L5ZA 4M7TA 2WMGA 2R1LA 3NOYA 4GIAA 1IEXA 3W88A 2HS6A 4IQJA 1F07A 1TCDA 4EXBA 4DBUA 4C7GA 1FXPA 4PMZA 2PLMA 4LVDA 4LV4A 1NOWA 2B81A 3S5YA 3MJMA 1V3JA 3GVRA 4IMDA 3KP0A 2PDGA 3TMQA 3P60A 1PX3A 3CL8A 5E9XA 3T0TA 2CZEA 3APYA 4J2PA 1WOAA 1L8NA 1PAMA 3T40A 4JFWA 5FF2A 3N6JA 3GAKA 3M6YA 3CEUA 3W1QA 3TYDA 1YIXA 4BI6A 1F61A 4AMAA 3BPWA 4FXJA 1RK5A 1KXHA 2WHLA 4L1XA 2ATMA 4MZ1A 1H11A 5ABFB 3QTGA 3CH9A 3STEA 2JF7A 3LN3A 1RBOB 2D0GA 3LPGA 3SAZA 3G1RA 2V5DA 4FXSA 1DIOA 3WK2A 1M7OA 4XKYB 4AG0A 2X09A 1PO9A 1AL7A 5F2GA 2CWXA 4D9PA 3POHA 4I9JA 3KDOA 2X1UA 4YTRA 4ZSUA 3SY5A 2ZE3A 2I9EA 3A3HA 1U30A 1XICA 3LQGA 4LYKA 4B4FA 3WLOA 2C18A 3OVRA 4LW7A 3T1GA 3M07A 6PTDA 4I6KA 1YXDA 3L5LA 3N13A 1XQKA 1NU5A 1RHCA 1OABA 3VINA 4Q8NA 2VFHA 3H7VA 5JIWA 4DM2A 1CLKA 3S2LA 1QR7A 2O0TA 3GAYA 2P8CA 1RBLA 4S3KA 4FO4A 3G1AA 4LF1A 2G3JA 3B0UX 4MYXA 4X61A 1B4KA 2GUUA 1GVQA 3TOYA 3L65A 2G96A 3L21A 2JKPA 1EA0A 4DBDA 3DERA 3N11A 4O17A 2BVDA 5G2IA 3AHVA 3C2VA 3CLMA 2WMIA 1E55A 3K30A 4Y9NA 1F3EA 3AU6A 5HNNA 5E0CA 1KTBA 1OGGA 1EF2A 1ZAJA 4GBDA 3UBPC 1V6WA 4AZ6A 2FTYA 4AWSA 5IBXC 3B97A 1OFEA 1KFJA 3DFOA 4E2BA 4X60A 3G3DA 1FP8A 1Q63A 2O9TA 3DGRA 5I5RA 4ZOBA 1EP1A 2WKGA 4H8VA 1QW7A 2C13A 2ACSA 4D8ZA 1KTNA 3P3BA 3UWYA 1W5PA 3M5XA 2WSYA 2J27A 3T2OA 3FHQA 3WBXA 4C6LA 1PE1A 2VCCA 2CWNA 4E8DA 2OGJA 3N3MA 3DFSA 4NX5A 2G3FA 2IKIA 2RJHA 4AHQA 2A3CA 3CTTA 5I3IA 3GU2A 4LS0A 4PYSA 4DHGA 3WQOA 4LVFA 4XAFA 4JEQA 1UASA 5L9FA 2EKCA 5T26A 1HF6A 4REQA 1K8CA 4I5RA 2XM1A 1KR0A 2FZ9A 1E4NA 4LGXA 5DRIA 2UWFA 3TNOA 2E9LA 1XH0A 4DYKA 5JVLA 3K4DA 4DWSD 2BOGX 3W4RA 4AIEA 1A5OC 2ZX6A 1WCGA 1PDZA 4UTTC 1PWMA 1ZBKA 4GCAA 4CQ8A 1REQB 1UOZA 5K4XA 1YLVA 3LCIA 3CZKA 1TRIA 5D8ZA 4JIEA 3PNZA 1VBHA 3HPXA 4LWWA 1H62A 2PI6A 4D6JA 1CGXA 1TB3A 4D1IA 1M7XA 4X9YA 2C1IA 1D7FA 2BY1A 4QP0A 4OHQA 4D6HA 1P0BA 3EEGA 3F2DA 4O28A 1FVPA 5HATA 1GVOA 4PEKA 1JNDA 3U5YA 1XGEA 4LBUA 5FL1A 1E15A 2OPJA 4AY8A 1WPCA 3AYSA 3WQDA 4JD4A 3MMTA 5IM51 1J9YA 1C7SA 3SZ8A 1U83A 2CIPA 2P3EA 5DXYA 4R85A 3S42A 4GY7A 3W07A 3CT7A 3NJ3A 3WF1A 4JAWA 5TF0A 1DWIM 2J8TA 3RIKA 1YDOA 2A5HA 4H2CA 2BGNE 5IHSA 3CQIA 3C8FA 1SO6A 1JFHA 3SCVA 4AH7A 4FK9A 3MBFA 1LCOA 5KITA 2WZTA 2OWWA 1E6QM 3VM5A 5A8MA 1DWFM 2OKTA 1LRNA 4Q8PA 3V1HA 3NXFA 1TPDA 3I65A 1TREA 3EDJA 3V5FA 1TVPA 4LRSA 3TYZA 2UY2A 1GQIA 3VGHA 3CPUA 4MMWA 1WKDA 2AOSA 4FOUA 4AVFA 1UP3A 4PCTA 1FWIC 3R79A 1FWAC 1G4PA 1RUSA 1W54A 4JTQA 3PR2A 2P50A 4IGNA 4Q8WA 4F48A 1QOXA 3H54A 4TV6A 2QW5A 4QDPA 1L2UA 3M44A 5CBIA 3VKAA 2XSXA 1M7PA 2NT0A 3MSYA 1K3UA 4TU1A 1K9FA 5CPTA 4DAIA 5B7ZA 2ZBTA 1BYDA 1XFCA 3NUKA 4S38A 3UPBA 3S6TA 4WJEA 4Y9MA 1BFNA 4L9YA 3UZJA 3VGEA 4X2RA 2FZDA 2FMOA 4P7NA 4RW3A 4GXWA 3M47A 1PCKA 3S4TA 3TLQA 3LTYA 1DORA 3R94A 3NM1A 1OD0A 2WWDA 2F6KA 2QHAA 1MNZA 2GJNA 2A79A 2I57A 2PDFA 3BAJA 1GW1A 3V36A 4MPQA 2XFFA 3RXZA 4XZLX 3FW6A 4TXEA 1I1WA 3NGJA 2PLKA 3XINA 4IPLA 2PBGA 4GRSA 4ZB0A 3CV7A 5G1YA 4UQAA 1MFVA 3WLKX 1QO2A 2VWTA 2W6RA 4NU7A 1GVIA 1TR9A 2JKEA 1P48A 5AHMA 1QCWA 3HN3A 4HYWA 3FNDA 4D6CA 1OX4A 4EWJA 3IIXA 4GKTA 4DVOA 5K9XA 5G5IA 4EF8A 2DZBA 2ZUSA 1O6IA 2FYMA 3AMLA 3VNDA 3GDBA 2QCNA 2VEPA 1FH7A 1DXFA 1FRBA 3LCXA 5I3KA 3MO7A 1XIGA 1LT8A 3KBWA 5JXQA 3AWNA 3L68A 3MANA 3U3HA 4RV3A 3HA1A 1QNVA 2YFNA 2CHNA 2R8WA 3SM0A 5LSMA 3GXFA 1F5ZA 1E5JA 1L0PA 5CGQA 1CXKA 1TWWA 2J8FA 4GVIA 3JZUA 3ITLA 4LSBA 2QVNA 4MWAA 4AD0A 1J2WA 4TVCA 3W24A 2C3ZA 3GR8A 1BQCA 2IKGA 2E77A 5HWMA 1Q4NX 1W3KA 4GJ1A 3RAOA 1R7OA 3VCCA 2RJGA 3OOQA 2P1FA 1UA7A 4C6CA 4IP7A 1B3WA 1KM0A 3P8JA 4GCXA 4ZXOA 3HJEA 3GFZA 2J9XA 3V18A 4C6FA 4MTVA 4JYFA 2JK2A 1EB3A 3DKJA 2V68A 4PUMA 4N42A 3N2CA 4ICNA 2RH9A 3AMDA 3B40A 1V77A 3TNBA 5J04A 4PRTA 1ADOA 3TMLA 5BXPA 2VC7A 3FDKA 3ITGA 1UJQA 3DHUA 4OBRA 1KR1A 3QW3A 1MNSA 1W9UA 3OIXA 4BHYA 4FOJA 3O6DA 2ZZ1A 2YL5A 1TQJA 3ZLHA 3MHFA 3NQDA 3VIIA 3KHDA 4RV8A 3S3GA 3SUVA 5HMEA 1QHOA 2I1OA 3RCMA 4HHPA 1CLVA 2YCLA 1E40A 5H8MA 1EO5A 1C8XA 2PC4A 3EX2A 5T9CE 3W6LA 3QSRA 2ZXQA 3R8HA 3PAOA 1EUNA 1G69A 1AH3A 5A6TC 4Z0JA 2E9MA 1VFSA 1VFFA 3PZIA 1NH6A 1LRTA 2BXVA 1BXCA 3I6TA 1ME9A 3E12A 1QI4A 1A50A 2VQTA 3W83A 3ONCA 1VR6A 4O11A 3GH4A 1KD0A 3KBMA 2NV1A 1R6WA 4D8LA 2EO7A 4GK8A 2YBTA 4PC8A 1Q5MA 3QY7A 3W25A 2XU2A 4MUPA 2XFWA 1XM3A 1EDTA 2V3EA 7A3HA 3ZOAA 2CPUA 5BRBA 3E0IA 4WDTA 5IFPA 5EBAA 1TPWA 3G1VA 4GE8A 3UZWA 4X22A 2YXOA 3RRAA 1ZBCA 3CXOA 5LNRA 4ZODA 4LUSA 1AK5A 5JBDA 2Z25A 1O4UA 4O54A 4P8UA 2OQHA 4GWEA 4WCJA 1SO5A 4O4VA 4C1NA 3OZOA 4J40A 1DYSA 2WZIA 3C2RA 3PFRA 5AN7A 3GUGA 1OGBA 3COTA 1OADA 4ZQPA 3CIXA 3AS3A 1KV8A 2EG7A 1EKOA 3EKGA 4GO8A 1FY6A 1GWJA 4LBSA 3TE9A 2VFEA 4QJ1A 3R0UA 3Q65A 2B7PA 3URBA 1XISA 3N2TA 2YA0A 1S1RA 2X40A 1K7XA 1W3NA 3OBAA 2PP1A 1WQ5A 1LJYA 4NXSA 3UD6A 4UZUA 2WJDA 2Q09A 1A0EA 3NTYA 1ISWA 5LIYX 4TTGA 1AMYA 3ARTA 3WLTA 3ZFHA 3UA4A 2EQDA 3HPFA 1V03A 3N2OA 3CUHA 1X1OA 1POJA 2CLHA 2H6RA 1WDDA 1OG6A 4H8HA 3PZNA 1VPXA 2A6NA 5A5WA 5H1WA 3PPFA 1JI2A 5KSWA 4AY7A 3SN4A 1Q6DA 2DZTA 3NQAA 3THQA 4CGTA 2ATSA 5A2CA 3ZJKA 4QDWA 2Y2WA 1J96A 4QXIA 3W7NA 2NVCA 2VMFA 2XFRA 3BMWA 1DJYA 3EPMA 4AD4A 1A5UA 5HULA 3LRLA 4ZGYA 3KW3A 3VNJA 2INFA 2IPFA 3SN1A 1EGVA 4RNFA 3H2CA 4O50A 4DZ5A 3KVMA 4RR4A 1EWDA 1EYEA 4W8BA 3TEVA 1R3VA 2FJUB 5I3GA 3NGFA 1YXYA 4A35A 4BWLC 3TUUA 2G4JA 1S2TA 1TIWA 1KRBC 5LNSA 3CYVA 3PJUA 3S1GA 4IICA 1MXDA 1HKWA 1AQMA 3F1QA 4UNIA 1LDCA 2ZFAA 1DTUA 1IGSA 2GJXB 1PDYA 2VR2A 7TAAA 1RR2A 3KWXA 4KH2A 3WDJA 2RUSA 3QHNA 2ZVIA 2BHZA 5F1UA 1ZB5A 1IZJA 1H49A 2ESCA 3BGAA 4Q3MA 1VFLA 5LA1A 4N4QA 5F2MA 2NVAA 3W38A 2Q71A 1TQXA 2AGTA 1RJQA 3KAOA 2BTMA 3TJXA 2OYKA 2IQDA 2EBNA 1E1CA 4JGDA 5AB3A 4FF5A 1TZ7A 2ZUWA 3R13A 1B30A 2C1HA 1TWDA 4OJYA 2PZ0A 5T9BG 2NLIA 1G5AA 1JCTA 5LIKX 4NZ4A 4M1RA 3MMWA 1IT0A 1KLZA 1NF7A 1JDDA 1LQ0A 2ZA2A 5D02A 2ZA3A 3ME3A 3NURA 4HPNA 2RGMA 3WDQA 1V08A 2FH6A 2JALA 2DY3A 2I17A 2GQ9A 4OBSA 3GFXA 1RD5A 1Q6EA 2BLEA 4W5UA 3EXTA 3PUEA 1PL9A 2V3FA 9RUBA 4IXXA 4AWUA 4G8TA 2PLCA 2YB1A 3MVTA 4Q33A 3BXWA 4CKQA 1DWJM 1EDQA 1XLGA 3WBEA 3WQCA 2PTXA 5BXRA 5HBFA 3JR2A 2VFFA 2XIBA 3SCQA 4JFTA 1JPDX 1QI3A 3MS8A 4ZE4A 2R1MA 3VIPA 4W9TA 5JBEA 1V6VA 1VD6A 2EPLX 2PFHA 3W2LA 1RP9A 1GOXA 2WSPA 1DP0A 4LU0A 5LHFA 3B0YA 4WUIA 1TA3B 1EX1A 2J78A 3CNYA 3R8GA 4M6UA 3KOZA 5A3HA 1XJBA 3PANA 5E0KA 4PZVA 1BSIA 4NRSA 3GIPA 2C0AA 4A3YA 1VH7A 2A3BA 1CI1A 1FTXA 3VZZA 1P7TA 4L65A 1ZENA 1I2RA 1YKWA 3QPEA 5DO8A 1B90A 1V02A 4U28A 4IQEA 4C6IA 2C79A 2Y61A 3HQOA 1H7XA 5D4YA 4K6AA 3C0QA 1LF1A 3KOXA 4D6FA 3V5OA 5T8GA 5XINA 1YE6A 4XO7A 4IMEA 1W1PA 1ZU8A 2FLIA 3P82A 5JUVA 5TBOA 1H2JA 1MDRA 2I5GA 4OECA 4DJDC 2ZX9A 2Y7DA 1EHAA 5EFFA 6CGTA 3LM7A 4WY0F 4WK9A 4JX5A 4JDYA 3WENA 1L6FA 3LXBA 1BWLA 3PK7A 1VBUA 3L4YA 2WPGA 3VOGA 1VPYA 4FXRA 2OOFA 4ACYA 1PIGA 3WNKA 3ABQA 5HPOA 4HQVA 3VX1A 4EANA 3KE0A 1Y5VA 4HJFA 4XAZA 4AZHA 1CT5A 3PS7A 4PUNA 4MKSA 3QLDA 4GO9A 1TV7A 4ZA0A 2WC7A 3VC6A 4N02A 4NKCA 3ZVIA 4GXMA 5D03A 1GOOA 1UWIA 2J8GA 2GDQA 1JD9A 2QDGA 2ZADA 1E0TA 5HMDA 5C7VA 1E3ZA 2NQZA 2DSWA 3NAVA 3GG0A 2ZQ0A 3SEPA 3N3TA 3RCYA 1R5YA 1XYMA 1OM0A 3PTMA 4KWWA 4J5NA 1G4SA 1WDRA 1B3YA 1WZKA 3LX9A 4BA0A 1JDAA 3THUA 2ZUVA 4UWMA 2Y62A 3WBAA 2V3GA 4GMEA 4LUIA 3CTLA 1VFTA 4G7FA 5AZ1A 1LWJA 5EKYA 2HTMA 1OHLA 3LCHA 1DIEA 3ENLA 2BODX 1J0HA 1FKWA 1DXIA 3N04A 1VHCA 4FEZA 4K1GA 5DFAA 4NJJA 1NM9A 4E38A 5HJXA 4D6GA 1MUMA 1KWKA 2NQHA 3IIZA 1POKA 4QSFA 4MVAA 4H9ZA 4X0NA 3FJ4A 3BMVA 4JTHA 1GJPA 2WYSA 1Q8AA 4QEEA 4UFLA 1MEHA 4A21A 2PEVA 4M19A 3GUWA 1JG9A 2FZNA 2DDXA 5D9PA 1SW0A 3LHYA 1BD0A 3LCFA 1F3XA 1SGJA 3TN5A 4P7OA 2D2JA 2G37A 1S2UA 3MKVA 5FA5A 3YPIA 4V33A 1QNSA 3PBWA 5AHIA 1XLAA 4MB3A 1VQTA 3R0DA 1US2A 4CLMA 3MWAA 4B3ZA 1BF6A 2E7FA 3NWRA 4DPQA 4DLMA 1FWEC 4A8NA 3U4FA 4W7UA 2BGSA 5H8UA 1CZ1A 4KCTA 1AD4A 4NZ5A 4LUTA 4KBXA 3B0VC 3NEHA 4TOQA 1K8YA 1VJSA 2Q3OA 4PGLA 4PSRA 4UTIA 3TR9A 1RK6A 1EXPA 5HQMA 3W7IA 4PA8A 2WCSA 4LAOA 1GOMA 1LG2A 4H9XA 5CZKA 1XLLA 3TW9A 4EXAA 1TTPA 3UNDA 5JU6A 1KC7A 3DX5A 2G4FA 3AZRA 1C90A 4IPNB 1F74A 1V3MA 2V5KA 1W8GA 3W53A 3OVPA 4ZQRA 3M5YA 1YPXA 1Y5WA 3KRUA 3GRIA 1QW9A 2V30A 4Q7BA 5DT5A 1Y65A 2MANA 4K8EA 4QR6A 1S2CA 3KFTA 2PS2A 4Q4PA 5HUOA 4DJFD 4K3ZA 1XPGA 4IOTA 1B9ZA 1THFD 2JGQA 3CB8A 5LIUX 1VENA 3M0ZA 3K1GA 3T07A 4M6QA 4NJHA 5DELA 3XIMA 2WJZA 3BJTA 3U57A 2OSYA 3SCTA 3BARA 3RX2A 4HPHA 3HOJA 1U5HA 1UZHA 4HU3A 3W37A 2VDGA 3NSNA 4GZJA 1J93A 1N55A 3GG1A 5AYBA 4CQBA 3PUOA 4AAJA 1BGAA 3MUXA 3PSWA 4ZTYA 1AQ0A 3A12A 3VIHA 1TE6A 1WZMA 2TRSA 2ZVRA 2CKSA 2AGKA 4LEQA 3BCFA 3IPWA 1HW6A 3TZFA 1ZUAX 3IARA 4NYUA 4B5NA 1E1FA 3DDMA 3CHEA 3V1PA 1TCMA 3IAQA 4WY0A 5F2IA 1KLYA 3AICA 3OVQA 1A47A 4NZ1A 1M01A 1N8IA 4GNJA 4WGHA 2NQ5A 3NL3A 3EB3A 3FY1A 2WVVA 3LMZA 3IUHA 2ZCGA 2QIWA 2EPNA 4IG2B 2WPBA 3P2VA 1IWAA 3NQBA 3UXAA 1DJGA 4NZJA 5A94A 4G1NA 4GJIA 4EAYA 4CN6A 3PC0A 3PY2A 4HU4A 2WK2A 3ZM8A 2XZ7A 1FHDA 3S9YA 4AWTA 2WNWA 1MMFA 4D2JA 4CN4A 2ZZ4A 2QJGA 3ARSA 1WNOA 2W92A 1YNYA 3B9DA 3S5ZA 2VRJA 2PDQA 1CXLA 4JTJA 1ZBVA 2J77A 3L4UA 5A1AA 2DGAA 1J6PA 1DIDA 2PDPA 2FZBA 4GYPA 4RNIA 3W01A 1S1PA 5KZMA 1B3OA 4Z1AA 2HK1A 3KZPA 3NPVA 3KWSA 4FF7A 1H61A 5DN1A 3B05A 4QCFA 3PZOA 4NZ3A 1AH0A 6XIMA 3ISIX 4OVXA 4EKJA 1G67A 4JX6A 2GVYA 4Q7IA 4IPIA 4JTDA 2Y85A 2ZICA 3GHUA 4H8NA 4UCGA 4H2HA 3WLMA 2C14A 3LGEA 4QRNA 4IUGA 1IT8A 5FL0A 4IX0A 3IJ6A 2XPKA 4C5ZA 3G0SA 4F3HA 1VAHA 3F5KA 2SFPA 3ANYA 3NPXA 4M29A 4PBGA 2X0YA 4PFHA 3GNXA 2ACQA 1Q6LA 4C5YA 4RXGA 2DUZA 2NSOA 3GDRA 5EY5A 4MY9A 1W5MA 4GI4A 3DFHA 3RFAA 2JE8A 3R0KA 1M9HA 3HM7A 3N2BA 1TPC1 1VB9A 3RMEA 8XIMA 1VCVA 4CN1A 1PVNA 2HBXA 1KBLA 4X0VA 4B16A 2D1ZA 1JJKA 3QJAA 2WMJA 2Z7KA 5G4EA 2X7VA 4DI8A 3G1XA 4LQ1A 3FS2A 4K8HA 4Q6JA 1JF6A 3H23A 4CNTA 3URQA 3KBSA 1H7NA 4QJ5B 3G1SA 1TPVA 4O1DA 2PDMA 3NPWA 1XPYA 2WC4A 4BEUA 1AD1A 1UWSA 1YX1A 3DIPA 2QPUA 1KBBA 4O15A 2EG8A 1W5QA 4YTQA 3M0LA 1BQGA 4IP5A 4O1CA 4QFUA 4ZB2A 2UY4A 1PKYA 3N9KA 1HP5A 3HF3A 3SRKA 4R5EA 2KX9A 3OP2A 4DAFA 1GK8A 1JEZA 3EKLA 3F4VA 1WKFA 2C6QA 3UR2A 1E4IA 3DESA 2PP0A 1ZCCA 3URAA 1BG4A 4CVWA 3E2SA 1CGWA 3G2GA 3VC5A 3OHMB 2WBKA 4GUGA 2GDVA 1OCNA 2PRHA 4JQ3A 4OOZA 5I06A 3C6CA 1P5BA 5I2UA 2NX9A 3N9RA 6REQA 1OEPA 3MSGA 3GDKA 2INEA 1ITXA 5K7JA 4CQCA 5BU6A 2X41A 2OXNA 2VZSA 3SCPA 3AU2A 4ZFCA 2XISA 2YCIX 2NUWA 1Q65A 4F8XA 4NAFA 1FA2A 4ZZ9A 4ZVJA 3VTRA 2B7QA 1X7IA 5T91A 3WNPA 3S6DA 2VRQA 3IEBA 1K8ZA 1Z69A 3RG6A 4LTSA 3FYYA 3ZR4A 4XX6A 4LB3A 2D2OA 4HZMA 3WJWA 1O94A 1KRCC 2QCHA 3ARRA 5EA9A 3PUGA 4Y2WA 3IJ9A 3EEZA 4KEMA 4HU8A 4Y9OA 4R53A 1TG7A 4MNLA 4AWEA 5CPSA 4GVFA 3HJZA 1AL8A 3BURA 5HNUA 3GBDA 3W7HA 2VGGA 3VOCA 4ZQOA 2E3ZA 4AF0B 5FOOA 3WF4A 3CIVA 2D0HA 1F8IA 1WDPA 3DI1A 1SYTA 1T5AA 1GCYA 4FOKA 2BX7A 2DZVA 3BGGA 3MSDA 4JCLA 3TW7A 3VK5A 4ATDA 3EX6A 2XVNA 1AA1B 3IIVA 4H6RA 3O9NA 4NYYA 1S2VA 3SECA 3T4WA 3M0VA 4WKFA 1RZMA 1UWRA 3DN5A 3SO7A 3FXGA 4A8RA 5I79A 3PAJA 1JZ6A 1X1ZA 4YCOA 4A3UA 2FVLA 3EA2A 3NL2A 5BCAA 1OBAA 1AW1A 2XTKA 3QYSA 3RU8X 5CPLA 2INZA 1TUFA 3MHGA 4GUHA 1GTHA 3DU0A 1XIIA 1L6SA 3SIMA 1JVNA 1NDYA 3VD3A 3PJTA 4P7LA 3OQEA 4IGHA 4DJEA 4XK2A 3BLEA 2DZWA 1PYMA 3AS1A 2CETA 4JQAA 3BUVA 4JKKA 2CHRA 4NIRA 1BWVA 3O6AA 5D9MA 5I09A 4HA1A 4E2OA 3AS0A 4J3WA 3QVQA 2Q3RA 3TTSA 1XYCA 1XIEA 4Z2IA 5EMUA 5HQLA 5FEZA 3EWXA 3H2FA 4H8UA 1B3XA 1UKSA 2ISWA 1R3RA 2GQ3A 1B2YA 2O56A 1ML1A 2QS8A 5F4SA 4CCDA 1ELSA 3NG3A 5CSUA 4XZIA 2WHKA 1EJWC 3QTPA 1RA5A 3ARVA 3T9PA 2HSAA 3ARUA 4L4OA 2OEJA 1UYQA 4MNKA 3W86A 4WXYA 1YQ2A 4O1BA 1G0CA 1SQ7A 3VVGA 2ZUNA 4C6BA 3ATYA 2J4GA 3LCGA 4W93A 3SQSA 3PBYA 4K7YA 1R0MA 1PSCA 1BYAA 1V6YA 4KT2A 4DF2A 1J6OA 4DM1A 1J79A 3CHVA 3PNUA 1M03A 3MJYA 1GEHA 1PJ9A 1ZNNA 4FLRA 5CPMA 3WFLA 1ITUA 2WOQA 5PTDA 1Y8BA 5DY3A 4HBKA 3HB9A 4JN6A 5LYRA 1WOBA 3ID7A 4BI5A 2CLPA 3OU8A 1UJPA 1KWGA 2XSAA 5FJPA 1MRAA 2D24A 4YS1A 2FKPA 3A4XA 4JZ5A 2GVGA 3GVGA 2EPMX 3WO8A 3SN0A 3LU2A 3VD7A 3O6CA 1R9YA 5G1MA 1VCFA 2OO0A 2NX3A 3RLHA 2H3DA 3LPPA 3GE7A 1T0OA 1I8JA 4MDPA 3DYMA 5FAGA 5CGMA 5A8PA 4H19A 3MTWA 3GDMA 2YZ5A 2Q6ZA 4MDOA 4DYJA 4R33A 4QAIA 1P1MA 4NX0A 5CSSA 4R9OA 3L4VA 2AQWA 2E1DA 3K4AA 4F0RA 1ENUA 1Y0EA 4HPJA 2ZKMX 3GTHA 4AQLA 1IEQA 1GG0A 3VDAA 1W9DM 4LY8A 3HGSA 2QULA 3CU2A 4QS5A 4ZOAA 5BOEA 2EAWA 5BXSA 3SCOA 4PMVA 1PX4A 4HNNA 3ZLGA 4JY9A 4LCSA 4G1KA 5I0DA 1A0DA 3RN6A 1CXIA 4IJBA 1XLJA 4MKNA 2Q8LA 3FLUA 1FOBA 3C0LA 1VYSX 1DJIA 4OOUA 4GUJA 3UGVA 2RFGA 3KVLA 4AY1A 4YWIA 3U9IA 4Z08A 5HK4A 1J0KA 3ABZA 1V3IA 4MAZA 5DRCA 4PMNA 3NSMA 2CFFA 3AXHA 1NSJA 5H8PA 2PA6A 3GQYA 1DJXA 4Q22A 3CAKA 3F7JA 4HD5A 3TC6A 2G3NA 4N0RA 2HZGA 4H41A 1NWUA 1B3ZA 2C0HA 2YXGA 4QLKA 3VE9A 1VFHA 4ZO6A 3AFBA 4DXVA 1Q6QA 2RDXA 3W1PA 4PRWA 4WEVX 4X63A 1UD5A 5HNRA 4JHOA 2DORA 3AAMA 1U5JA 4WSHA 4DWDA 4D1JA 1QPOA 1XRTA 2R1NA 4AB4A 3A9IA 3TWBA 1SR0A 3SJ3A 2A7RA 3VNYA 4K38A 3DKLA 3MV01 3M16A 4K37A 1OFOA 1OINA 4UBPC 4J4KA 1A4MA 1VPQA 3EMQA 5AYIA 4PMDA 1Q13A 9XIMA 5E70A 4E5TA 4KRTA 4XO6A 1YADA 4UTLA 1NFGA 1OFDA 1VBRA 2Q01A 1BGGA 3VGGA 3E96A 2OU4A 2CLFA 1W32A 2BMBA 3QZ6A 2R9RA 4MLJA 4JFUA 4UTWC 5C9XA 1HJXA 4W84A 3HG5A 4BWLA 2FGLA 5ABFA 3WNLA 4RZ6A 3AIWA 3KL3A 3WLNA 4WZHA 1UWUA 4FNQA 3BE7A 5C7HA 5DCBA 3NQ2A 3E2QA 3U2OA 5F2LA 5C9RA 1LUCB 1MEIA 4XKYA 1AQFA 1QWGA 1ZFJA 5C6MA 3PG8A 1W5NA 3STPA 1K70A 2YGYA 3BSGA 3I6RA 1ZAHA 3GW0A 3NQFA 3GTNA 5LA2A 2I7GA 4TQTA 3MB9A 4RDWA 3H2OA 3UA3A 2BY0A 2I16A 1WKYA 3MWCA 4UTMA 3ECQA 3VD9A 4DJED 4F0HA 3GTXA 2E4TA 3I68A 3V0SA 3CV6A 4OGZA 1KKOA 3RJXA 2GJLA 1P6BA 1V0MA 1MW0A 1AUSL 3AIVA 3VZXA 1JAKA 5A2AA 1IYXA 2XVGA 3MT1A 1ZJBA 2TODA 4HK7A 4BZYA 3SIZA 3CH0A 2OLSA 5CJMA 1EWEA 2CXGA 3HIJA 3N4EA 3EDDA 1MUWA 3E0VA 4UQ9A 5CQ1A 1KM6A 3KTSA 4BQ4A 1XYAA 3C61A 3EA3A 3HV8A 1YBQB 3VOFA 1ZTVA 5D04C 3WX7A 3K46A 1RQBA 2YL9A 1ZALA 3N73A 1XWYA 3CBWA 3TK7A 4GIEA 5A6LA 3OB8A 1JYVA 5F7UA 3ZJ8A 4LAKA 7ODCA 4AEOA 2VYOA 3IWPA 3VD4A 4PUJA 5D2TA 2X16A 2I56A 4CD4A 5K2ZA 3WDRA 1XHGA 4A2RA 4YVXA 4YMZA 2V38A 5FJRA 5CKSA 1CB2A 3W7LA 4QHRA 4KCUA 3FVDA 4YVPA 3QHOA 4Z1CA 1XD0A 4DZAA 1IV8A 3BH4A 3F4WA 1PEZA 3L4WA 5B80A 4O14A 4ZSTA 2J88A 5AFDA 3H22A 4W7VA 1LOSA 1MEWA 1S3HA 4QEHA 1X38A 4P61A 3W1XA 4LYPA 4NHVA 3TCEA 2TMDA 1W9BM 1TPH1 1SZGA 4HGXA 1E6RA 4ML4A 4KMQA 1EYWA 1D2KA 3KRSA 1JR1A 3VNMA 3O3RA 4JTSA 3GG7A 4RDYA 2WSKA 1WBHA 4J7RA 1UQYA 3T6CA 4BEQA 3IJDA 4Y9AA 1Q6GA 4ZOEA 4LBRA 2WM0A 4L56A 3EX4A 1TPUA 1NF0A 1E6ZA 2OX1A 3NSXA 1XGDA 1REQA 2JGYA 2PF8A 3M6DA 2QPSA 4CNSA 1J2BA 1H7RA 1V3KA 3G0XA 4JQ2A 2YA1A 5IDZA 4JCMA 2FZMA 3KXQA 1E4LA 3FYOA 1W1A1 3TDFA 1KCXA 3I7SA 4QG8A 3F4CA 2XH7A 3PWAA 4C90A 2VCBA 2BBFA 1ISYA 4ATWA 3ARYA 1FDZA 1KM2A 3TC3A 1QAPA 4OV9A 3L23A 1JYWA 3OA5A 1IWPA 2BXYA 2FB2A 4GQBA 1RD6A 3SCNA 4E6MA 3CUFA 4TR9A 2GWNA 2QUNA 3QQWA 2BY2A 1BRLB 4LAZA 1TPFA 1E3XA 3UYIA 5CJ5A 3GNRA 3V75A 4C6QA 1CGYA 3K8MA 1T96A 4A6GA 3WK1A 2ZZ5A 4HSOA 3GNNA 1S38A 3LK6A 3DGBA 1EH9A 3VCRA 5KZEA 3NNTA 1EJTC 3HGRA 2PWEA 5LGXA 4XAYA 3GXPA 1EGMA 1V6TA 1KCZA 2VFIA 3FOKA 4RL3A 5IHRA 4KCVA 4IHCA 3BLFA 5FESA 4MZ8A 1JI1A 3L4TA 2CXEA 2YL6A 1HVXA 4Q4MA 1XCXA 3R6IA 2FPVA 5I77A 1AFSA 5HMFA 1WZAA 4IFRA 4MFDA 3VNIA 4WR3A 1NTHA 2LLEA 3VO0A 1SSGA 1A5BA 2DT1A 2PWDA 9XIAA 1LT7A 5DBTA 3W28A 2V69A 3UVAA 3SCSA 3BAXA 4C6DA 3ZQ9A 1SW7A 1QPNA 2WJEA 2J62A 3GKAA 2PD5A 4AXNA 3T55A 4J3SA 5CAKA 2A3LA 1GG1A 1ECEA 4RK8A 4HSHA 3FJ6A 4B15A 3HPSA 5DANA 3IJQA 5E0FA 3DBPA 2YKKA 3EOSA 3W2NA 3O8AA 5A6SA 3BZGA 3MVIA 1GKQA 5G2WA 3NA8A 5FF3A 2YSWA 2X2GA 3KTXA 2DZSA 2ALDA 3K2GA 3T78A 3MUIA 2WC3A 2WQDA 2OT1A 3OHIA 3U2EA 1H0GA 3S5NA 2V5CA 2QAFA 3TKFA 2Y63A 4F2BA 5AY7A 2O4MA 4U10A 3A4WA 1UKOA 3TTEA 1H1NA 4IIBA 4H7ZA 3W81A 5D30A 1K02A 1V0NA 4MZYA 3LG3A 3OGVA 2OVLA 3RF9A 5MF5A 3GTIA 4FALA 3I4KA 5AVHA 4HA3A 2BASA 4BQ5A 2P76A 3CM4A 2QIIA 3G77A 5HQEA 4XD3A 3TW6A 4BI7A 4UUIA 3VNZA 2I5IA 3REQB 3WG6A 1TUXA 2QNEA 3GLCA 3OW1A 5G4WA 1H7PA 2ZZ6A 3E2RA 5LHEA 2WWCA 6ALDA 5GVJA 1IF2A 3ZVHB 4ONVA 3UY8A 2QJMA 2V82A 1QATA 1UR0A 1WXJA 1TV4A 2PDIA 4NL1A 2BDQA 4G2DA 3GG8A 3T42A 1K7EA 4DO5A 4I6VA 3TYUA 4L6OA 3UW6A 4M7SA 1E51A 2Z2AA 5HDRA 2PWHA 4QQ3A 3TJ4A 3LNPA 1N8WA 1A5CA 2X7WA 3I7QA 1GPWA 2HVMA 4PMJA 4MLRA 4OWGA 3VFCA 2Y89A 4FLSA 2FIQA 3CO4A 3STFA 2YCEA 2O9RA 3NEVA 1FQ0A 4CU8A 2XM2A 1HXJA 2F6UA 4KFNA 4WSKA 2REQB 1TJ2A 3ABRA 3PWIA 5FJOA 2VI0A 3L2LA 3W1AA 2PCEA 3F2BA 2VX5A 1OGSA 4CQ9A 1EJVC 4DY1A 2PP3A 3D3AA 2D3NA 2I14A 4M3PA 1JUEA 4W5ZA 4JICA 3WJZA 3G18A 1ODUA 1QDSA 2OSXA 3O63A 3W0KA 4Z2KA 1B31A 1MRQA 1NWTA 3H2EA 4TTUA 1JZ8A 3PPCA 2Z1XA 3OYZA 2EJAA 4AD5A 5TNVA 3C3UA 3UWWA 1R46A 4R9XA 3APTA 2PDCA 4F40A 3AMGA 1J0JA 2IPWA 1H5YA 1O95A 3GD6A 3LENA 4U5IA 2NXHA 4HKPA 2PE4A 4GQGA 2QGYA 1U1JA 1QHZA 2CBJA 3RM8A 1BG9A 1ZJAA 3WLSA 1IEIA 3PZMA 1RVGA 2AQVA 1XIDA 1BWKA 4GX9A 1V02E 5BZAA 2GPTA 2JEQA 4EX4A 2XG9A 2E6FA 1V93A 3S5SA 2W91A 1K6AA 4GC4A 2VEGA 1T6MA 1GVRA 4TIMA 2HCVA 1SZRA 1MI3A 3JUGA 4E4FA 3ZR6A 3LI0A 1EX5A 2E6DA 1GVYA 1IZCA 4LVBA 4W85A 3OLDA 1WE5A 5EFDA 1VJZA 4Q8VA 4DJDD 2CNCA 3QQ0A 3CPGA 4P8XA 3BAYA 1CENA 2VFGA 4HK5A 5DF0A 2YB4A 3QPZA 2WB5A 1Q8JA 3W1NA 1M7JA 4GHRA 1F3TA 3WEOA 2J75A 4XVDA 4LCRA 1UOKA 2VEFA 1A5LC 3NQ6A 2IPJA 4AMCA 1VC4A 4JFVA 2IKHA 3RR1A 1EC7A 4DWSC 1JCYA 2VXNA 3L2MA 3EGJA 4JTFA 1PZ2A 1ZAIA 4PODA 1QOQA 2V5BA 2OYLA 1QBAA 2ACRA 3BLDA 3B9OA 5J5RA 4Q8TA 2OT0A 2OG9A 3V16A 3KBVA 2VX7A 4DBSA 2A2IA 1UPMB 5AHEA 5FJJA 4KESA 4YL2A 1H60A 1O5RA 3FXYA 1FH8A 3LBMA 3B9AA 1G01A 1GQJA 2E40A 3WSUA 1XRFA 3W75A 3HTWA 3RLVA 3DYOA 2XFYA 3CWOX 1V0LA 2GFTA 4JR5A 1XW8A 3XISA 5I7GA 1A49A 2PU1A 3E38A 3FHAA 1DIKA 2EKGA 3UNTA 4PBFA 1WX0A 3NQEA 5BW6A 1FH9A 1R47A 3UVIA 1MW1A 1L8PA 2VEIA 1BSLA 1UH2A 2OJPA 4KFOA 3SJNA 3K8KA 1XUUA 2NV9A 2YPIA 2ISDA 1FWHC 1HG3A 1ALDA 1B1YA 4TX9A 2WVSA 2HVOA 5LZLA 1VIWA 4IQLA 3BAWA 5LKYA 1S2WA 4UMAA 4YYFA 2RAGA 3HFYA 1IXNA 3NO1A 4Q8MA 1N8FA 3ZXWA 4U33A 1ADDA 3W70A 2A3AA 4IJCA 1H5VA 1FHLA 3RLUA 3KCLA 1R9ZA 4AZIA 3THAA 3WMBA 4L4MA 4GJJA 4LY4A 5C5YA 4QJ3B 4WX2A 1HT6A 3B9EA 2OTDA 1G7VA 4LPCA 1UR9A 1TRDA 2YLLA 3U6WA 3UXKA 2MNRA 2WCAA 5TQLA 1IHIA 1RBAA 2DT0A 4QLLA 2DIKA 1MW3A 3DG7A 4L64A 5D32A 3EDEA 1V4YA 4MOZA 4AZ7A 1NJJA 3LHTA 4UIOA 3AHYA 4M24A 5I78A 1XYFA 4ERGA 5A8QA 1OC6A 3HPZA 1E0UA 2VDIA 2D2HA 1QT1A 3Q67A 2FFCA 2Y24A 4CCEA 4U4MA 1K8XA 3WJXA 1G6CA 3U2ZA 3A21A 2PD9A 5BU9A 1W1VA 1XP3A 4O53A 2PSNA 2ZX8A 1LLWA 1HTIA 2KAUC 4IL2A 3AYVA 3RUBL 2QLYA 3B9NA 1EUAA 2OSWA 4W87A 4CQDA 2HWGA 4Q4OA 2P10A 2GJXA 3R89A 5A6KA 3TYEA 5HR7A 1P6CA 2OWXA 3OZYA 3FX4A 3UCCA 4NRRA 3GVVA 4RE3A 3U0HA 3CYJA 2F2KA 3P80A 1LWHA 3DFYA 2WNZA 5E6ZA 4H01A 4M82A 4LOCA 4E8GA 2DSZA 3VD5A 3H4GA 2WO5A 1O68A 2FTPA 4L80A 4DUVA 2OCZA 4RPQA 1OVDA 4P8VA 5HOSA 1CEOA 3QFWA 3W1LA 5E1QA 1S5TA 2BWGA 4GIRA 2ISVA 4XIAA 3CT2A 3AUOA 1MVYA 1BHGA 3EA1A 2E1WA 3GVWA 4I3GA 3ITCA 1VYRA 1CGUA 5G2HA 4KRZA 1QI5A 2FB3A 4LXFA 4GGBA 3OBKA 2FH8A 5CSYA 1ZPTA 1OCBA 4CD5A 1LLOA 4M6VA 2E25A 1X1NA 4NVTA 3H53A 1I6NA 2XVPA 4A8LA 4O0KA 4OE7A 1WZLA 4MKVA 4JQ1A 1H50A 4M5PA 3W7KA 1K4GA 3RM9A 4PMOA 5CAHA 1AJ2A 5MHBA 3AROA 1CB7B 1A5KC 2D0FA 3M0IA 1TMQA 1GVSA 3TROA 3OG3A 4AD2A 1UKTA 1JGIA 2VP8A 1E73M 4UFJA 3LOTA 4OU1A 3MUCA 1OC7A 5BMXA 7ENLA 3CAVA 4KGJA 4KWUA 3RO8A 1TA3A 1E6XM 2V3DA 5G4HC 2GDUA 4ZENA 3WD2A 2BVTA 2H8XA 4I90A 2GGJA 1VYPX 5KEZA 3GH5A 3C4UA 2Y70A 1M1BA 4I5XA 1G9HA 4GY1A 3USBA 1TVNA 2WV8A 1BAGA 3W27A 2C1GA 3J7HA 1TJRA 1EHNA 4GY0A 1PWLA 4JTUA 3WF3A 2P0IA 4LRTA 1CX9A 5C8BB 2EPOA 3MBDA 2CLIA 2CLEA 3GM8A 2XIJA 1U2YA 3WL1A 3BAKA 4KKXA 3MY9A 2E6AA 1KFCA 3TZNA 4B9YA 2O92A 4X2PA 1E70M 3RLGA 1LL6A 1TPB1 2W62A 4FIQA 3AIRA 4A22A 3BVJA 2Q02A 4YCPA 5A8NA 2Y8VA 3ZWSA 1R85A 3WLHA 4B4HA 1HL8A 1JDFA 2PTDA 3HURA 1PHQA 1H7WA 2Y0FA 1TJPA 1UC5A 1SJBA 4NQ1A 2HDJA 4IIDA 5EMJA 2HEJA 2P3ZA 1XLMA 3A47A 3KCOA 4HMCA 1C8QA 2ZC8A 3NDZA 3WBYA 5AVNA 3TAOA 3M41A 1EJUC 3L12A 2VRKA 5AYXA 1DKWA 1B0IA 4UTKA 2A3HA 2OR2A 4WKAA 2GJRA 3W74A 4D6DA 2NW0A 4UFKA 4YWSA 1XC4A 1KM3A 1YEYA 3M0HA 4E4UA 3LTSA 1Z6KA 1IT7A 1XSKA 4G7EB 2A85A 5FACA 1LQ2A 2ADAA 1ZQ5A 3CUGA 2Z1VA 2XIIA 5I3HA 1XQLA 4GC3A 1Q3NA 3BL3A 3TTQA 2PWGA 3BW4A 3CQHA 1HL9A 2VUYA 3ALGA 2QCDB 2PTZA 1AJ0A 4K7VA 2IQ0A 3GNOA 3DC8A 3EWZA 4GH3A 1ONRA 1HFBA 3A3XA 4Y8FA 2XIMA 3NQ8A 4DQWA 2RKXA 3HZ3A 4AZBA 3WH7A 2QUMA 1VBGA 4MJ4A 4JYDA 2EG6A 3VGDA 1PZ3A 2X1TA 2Z2UA 3UZXA 1UP2A 5M2FX 3WQWA 3N6HA 1NDWA 3LPFA 4JKLA 2WMFA 4HOZA 4O57A 2DUAA 5FEWA 1F05A 1TJ0A 2E28A 5DMNA 1G1YA 2PU0A 4GNVA 2WNNA 4HCDA 2WSRA 3STCA 3WK0A 5HANA 3VNLA 1A3HA 2QUUA 5AKQA 1K77A 4ZEPA 5HA7A 1BLIA 2WHMA 4NNCA 1X97A 4GH1A 5CSRA 5C55A 4CD7A 2CU0A 2ZDRA 1TWSA 1UQZA 4OZOA 3NYZA 1YDYA 3P14A 3LSBA 2NQLA 1LBFA 3WNNA 3M0MA 3EOOA 4AW7A 4YHEA 3TH6A 4UTJA 1PTDA 3F4DA 1JQXA 1OJXA 4HN8A 1OB0A 3BG9A 4NI3A 5GJMA 2PTWA 4WKHA 1X96A 2NT1A 2ANUA 1ONXA 3E0LA 3JW7A 4RCXA 4S3GA 4WIWA 3NPUA 2P88A 1TTIA 3TLLA 2G3IA 3RRXA 2YW3A 1JRCA 3KVJA 3O0FA 3ALFA 3ZWTA 4Y96A 3UJFA 4YPJA 5FF0A 4NAEB 2X1RA 3VKJA 1V7AA 4IQDA 1XDLA 1TX2A 4WJXA 1XR2A 1MW2A 3PPHA 2OODA 3WQEA 2BP1A 3A9BA 3VIGA 3QC0A 1P4CA 4GFIA 2VZVA 2ALRA 2VKZG 3VKKA 8CGTA 3NVTA 4PTDA 3N6QA 3W22A 5LIWX 4W7WA 4INFA 4J3TA 4MWAC 3FIGA 1LL7A 4IL0A 3FFSA 3N2MA 3T2PA 2FFIA 2X0HA 3WJSA 3U48A 1EXBA 4H6KA 1RXOB 3QMRA 4XV0A 5A6AA 4ZB5A 1S5NA 5HAOA 1QPRA 4GINA 2YXXA 4AYGA 4B92A 4JS3A 1A80A 1W2PA 2Y1HA 4IISA 2W4XA 1QMLA 2YBUA 1GJWA 1F9CA 3UGRA 1EC8A 1ME7A 4JTEA 5D09A 4DB7A 4ERIA 2O55A 2XHYA 1H1YA 4ZFMA 3R43A 3MI6A 4IM4A 4PN2A 3VABA 1VF8A 2QCEA 3G1FA 5FI8A 3D5HA 1RV8A 4ZO7A 3WEMA 3ARWA 3ABSA 2CERA 2ZA1A 3CWNA 1QPKA 3M5VA 4ZBCA 3UXLA 3W76A 6XIAA 4IG2A 4J28A 4GLEA 4ZO9A 2DZXA 2FTWA 5ABHA 5BOOA 4E2DA 1LM1A 3EAUA 1JXJA 1DQUA 4MGGA 3F03K 2VJXA 3OLGA 3GXMA 1SFSA 2PZNA 3SGZA 1J0IA 4NG3A 2YA2A 3MUZ1 3EBVA 1Y5XA 4UMBA 2PTYA 4RXFA 2R94A 3C2OA 1RJRA 2HQAA 3PJWA 4KW2A 1P0NA 3WBWA 1SW3A 2VO5A 3QH2A 4OUEA 5CXPA 4S1FA 4F2TA 4AXKA 4ZE5A 1E4MM 4RDZA 1P1XA 1R2SA 3TN4A 3NQCA 2GQ8A 4K1WA 4F9JA 4UR8A 2PURA 1YTEA 3CASA 1MDLA 4YHGA 1XLIA 3OODA 1L2QA 3DBNA 4DUXA 3UJSA 1I9CB 3APGA 3AXKA 3A5FA 4XAPA 3AHZA 3G5EA 2DW7A 3W7EA 4ACZB 3VUSA 6A3HA 3M0XA 4UOJA 1SZEA 2IXVA 2Y88A 3E0FA 2VX6A 1XDMA 3FGCB 1KFEA 3CL7A 3RCNA 3FK4A 3UESA 1C3FA 4PULA 4FNUA 5L6UA 3TJLA 2PAJA 3WD1A 5REQA 3CAQA 4PMYA 3INPA 4AD3A 1JIBA 4NZCA 5K4ZA 4WD0A 1VGAA 3F5JA 4R34A 2ZRUA 4H9VA 3LSCA 3C0SA 4IIGA 4Z1DA 1FHVA 3DFTA 5AOUA 2Z1BA 5DX7A 4MJMA 4HMDA 2POTA 3WNMA 4D6EA 2IW0A 4QTGA 4XAGA 3LM3A 5MKGB 4L1GA 2ZRWA 2FVMA 1QNOA 5CC3A 1I60A 3G3MA 3UG3A 4TX6A 4C7FA 3GIYA 4TUFA 2HPIA 2C91A 8XIAA 1K7FA 3MI3A 1XCFA 1EP2A 4KQNA 2BOFX 2PDHA 3QW4B 4L9ZA 2O4QA 3P62A 3EB4A 3O06A 4JL1A 1BVNP 3E5PA 3T8LA 1J8VA 4GFSA 1NWSA 4O0ZA 5D2WA 5EU9A 5C9ZA 1W6TA 3KS6A 3Q45A 3RILA 3SB0A 4XB3A 2FHCA 3OYXA 4AHOA 4ORMA 1F6KA 1JXKA 1M6JA 4ICMA 3KHJA 3L2IA 4MB5A 1QXLA 1TE1A 2QJNA 3BLIA 3JRKA 1W9VA 2V67A 4A29A 4NASA 4NJKA 2F61A 1XFBA 4KGLA 3IK2A 1GKPA 4C65A 1EQPA 4N6EA 3AXMA 5GJPA 4YU1A 2FVKA 5XIMA 3PB2A 4Q4KA 4KERA 2FGZA 1V6XA 4B2DD 1GEQA 1K03A 4QSHA 3EOUA 3FV9A 1JZ5A 2BZNA 2GYIA 4UR9A 3NO5A 1I0BA 4LS2A 3W29A 4Q8QA 3AALA 3JZEA 1FX6A 1SSDA 1PHWA 4Q8UA 1TMLA 4XIMA 4DPPA 2J13A 4A3HA 4PTVA 3G1YA 4Z42C 2NQJA 1Q2RA 1B54A 4DO4A 1MO0A 3NZ1A 3UJEA 2A21A 2RGLA 1IEWA 3GK0A 2I5QA 3UU0A 1DEDA 1D3GA 1A5SA 3R5EA 3ZSSA 3NZPA 1R3SA 3G8RA 1TV8A 4Z2JA 2WKJA 1GUVA 4J3XA 4HHLA 1OG0A 1EBHA 2B7OA 1I75A 3QGVA 3ONBA 4AF0A 4BQ2A 4YJ5A 2PRMA 1YW1A 3TP4A 4LUYA 1SMAA 3GW3A 4KWVA 2R82A 4A3QA 4FX7A 3CMFA 1BYCA 4FZIA 1FCBA 3C3NA 3DFPA 3UWUA 3PB0A 1C9DA 1QK0A 3LCWA 2NUXA 4DNMA 3P81A 3S8HA 2VVSA 3V35A 1JPIA 3ITTA 3T4CA 3CZLA 1GNXA 1OSEA 3QGKC 2P5NA 1GHSA 3KRZA 4QIUA 1V79A 3GS6A 1W1YA 1C92A 3RHGA 2C7FA 4CQAA 4GZIA 2XINA 4U5KA 3CHCA 4H7CA 3O16A 2PDBA 4ATLA 1JF5A 1UD3A 4FNSA 4WRHA 2YR1A 2Z28A 4V27A 2VOMA 3A13A 1ZSXA 1DE6A 4JXCA 3WLLA 4PMUA 2WVTA 3U7VA 2G95A 8RUCA 3MO4A 3W71A 4O16A 1KM5A 3P74A 3CIWA 4GI8A 1BKSA 1E72M 4LVAA 4GVGA 3VNKA 3GC2A 3UWVA 1AVAA 4G6CA 2WAGA 2VR5A 4Z2LA 3TN6A 2G3MA 4PUKA 3VMOA 2QCCA 4AHPA 3SADA 3P93A 3UZ5A 4LNYA 4KEZA 1F2JA 1A4LA 2PLJA 4DN1A 1TJ1A 3H55A 1C29A 3W7OA 3CO8A 1NARA 4FNPA 2Y7FA 4HA4A 3WQ6A 2V5JA 1V0KA 1S2AA 4OV4A 1KXQA 3THDA 4AZCB 2NX1A 4DJFA 4WGXA 1RA0A 3FA5A 1TKKA 5CJNA 3A64A 1TZZA 1O5XA 3CPRA 3LRKA 1WXYA 2NQ9A 1K1DA 3O7UA 1GZ1A 2G8ZA 1Q6RA 2WMKA 5A8GA 4LT9A 2Z1WA 2E8ZA 3IRDA 1WP6A 4Z2HA 1GQKA 3VA8A 2XUCA 3HO8A 4O19A 4XD6A 4XUGA 3IS4A 3WUEA 1DTNA 1W2VA 5A6JA 1JDCA 2J9YA 3U5UA 1DQWA 3KS5A 2YX0A 4V15A 4N2YA 1G4EA 1OFAA 3RO6A 1I0DA 4QS6A 3QYQA 3H6OA 5H6HA 4AIBA 3UFYA 3H2NA 1QI2A 4H00A 1J5SA 4FR1A 3P0XA 3UR5A 5A6BD 4I9TA 5DBUA 1V51A 4GKLA 5DQPA 2W61A 2ZDSA 1DJQA 3O05A 3W7JA 2VOTA 4PL1A 4BF9A 1PTAA 1X8FA 4FNRA 4I7WA 1JCJA 2HNHA 4QDMA 1GYNA 3RPMA 3TVAA 1YHTA 4BK9A 5DXXA 4GA8A 1SFTA 4UQDA 2O7SA 4H9MA 4HNOA 1J4EA 3NVDA 2QF8A 1CW2A 3EZ4A 3H8AA 5GPRA 2F84A 1KO0A 3EXSA 3DYPA 2E5CA 3P61A 5CLTA 1R9XA 3G22A 3GO2A 1JYXA 1Z44A 4L9XA 5D33A 1C8YA 3E9AA 3NIYA 4IH3A 5CBJA 2X05A 1QNPA 5BXTA 3QSTA 1P0KA 4J1OA 4QG6A 4CCZA 3AIUA 4ZL1A 3UJ2A 3L5AA 3L66A 1C9WA 3R1ZA 3DCPA 1FWGC 1AW2A 2B31A 2JBMA 1JRBA 2P53A 4XVEA 2A3EA 3GHTA 1RH9A 1UH4A 5BRQA 5AHFA 5C9WA 2C19A 4ILSA 3RMJA 3UG5A 3WFZA 4GPNA 2EPKX 3Q2DA 4Y6GA 4MSSA 2W3ZA 2WANA 3TOPA 1OYCA 1HKMA 4ADTA 4EF9A 2BNJA 3PG9A 1TV3A 3MP5A 4GYFA 1Z48A 4HHMA 1OT1A 4JNMA 1W37A 3QZAA 3LERA 1OC5A 1QK2A 2PDLA 2E68A 3QV6A 3W7MA 3N1AA 1UWTA 3OEXA 4GGHA 3NL6A 4M56A 2ZOXA 4V2XA 3I3DA 4ES4A 5E5CA 4B9ZA 4AZ5A 1ZCOA 2CZDA 1XH2A 3B8UA 1PZ0A 3AMCA 4HN4A 1XIMA 3FJLA 1XCWA 1C91A 2MUCA 5BWFA 3EWCA 1CWYA 3KBNA 4GQRA 4IFKB 4BKNA 1DJNA 2WW5A 1K6WA 5H91A 1GOKA 3UG4A 3RU6A 4N9BA 4UNKA 5EMMA 3KCJA 2YDAA 2UY5A 4IIEA 4DLFA 4MIMA 1CECA 4AFYA 7XIMA 5CZJA 4YLWA 3T08A 5D9NA 4JIQA 5FJIA 2FJKA 1D3HA 3IGSA 2V0TA 1QU4A 4JIPA 4C6OA 2ZRZA 1HIZA 5DMMA 5I07A 2L5HA 3CHDA 1S3TC 1LUCA 1V3HA 1T99A 4HMEA 1M68A 1G94A 3KM8A 2C15A 4JTGA 3ZT5A 5LIXX 1UWQA 4QJ4B 1XLDA 2QXWA 5SWUA 3M7WA 2OZTA 1XSIA 1QWKA 5CCZA 3VIFA 4O8RA 1E0VA 4CCCA 2NVDA 1SFLA 3BANA 2WZMA 2CC0A 1VEMA 3W1UA 3QPYA 5IFTA 2CITA 3AO0A 3NO3A 4KF1A 2WVUA 4HTBA 1UUMA 4HYVA 4QE5A 2J47A 2PDUA 1UD2A 1WUEA 1C93A 3I10A 4GD0A 1SM9A 4EOUA 4AX6A 4EXQA 1I45A 1YBQA 3A3WA 3BK0A 3KRBA 2E5DA 4HPXA 4L6DA 1GOIA 4PBEA 3S2JA 2OZ8A 1GW9A 1EIBA 5AYYA 3TAKA 4J35A 3P0WA 3LCLA 4KEVA 4W4QA 3BZJA 4FXFA 3BLKA 2DZPA 5CC7A 3RNDA 1XXXA 4HVXA 3VGFA 5EYWA 3AJ7A 1X7FA 3P6LA 4AEEA 1DE5A 1JZ3A 5JH2A 3SQLA 4UR7A 4OFCA 4NNBA 4H4IA 1LRQA 3ANUA 1C8VA 3R7MA 3E2VA 2J7DA 4ML9A 4UFHA 3BJSA 4LS1A 3VDHA 4N9DA 3GHSA 5KETA 3O1NA 4H04A 4GYPC 3W73A 3P67A 1FWRA 3LEPA 3EX3A 4L6HA 4BF5A 4HOWA 3MQTA 1MUCA 1QRQA 2BY3A 2CEQA 3N14A 3OG2A 3VAVA 1P0DA 3UXIA 1VZWA 3AC0A 3PJXA 3CUIA 3GNDA 3BDKA 1FWWA 3KBJA 1EJRC 3R12A 4UTUA 1D7KA 3ARXA 2XGIA 3QKZA 1PYFA 4JN7A 3L0KA 1HKKA 2CBVA 1OZQA 3VDBA 2IQTA 1GQNA 1FXQA 2FDSA 3BW3A 5IBXA 2PMQA 3G1DA 4WSJA 1FWSA 1FHUA 5I3DA 2GL5A 2XN0A 3G6MA 1TV2A 2R6OA 3NQMA 5C0QA 3AUJA 4ENLA 2J66A 1RSCA 2YCKX 3W7PA 3A23A 3MZNA 2ZYFA 3AIQA 1EGZA 4MG4A 2Y5JA 3A6OA 3L7RA 1O60A 1JULA 1DXEA 3BCDA 2PUZA 3ARQA 3AJXA 1IQ8A 4XQ6A 1SO3A 4TMCA 1KM1A 2HPMA 4HZ7A 5M1TA 1FKXA 3VIMA 1BRLA 1PZ1A 1R7AA 3HG2A 2V9DA 4WDUA 2QYGA 3MKKA 1SJAA 2EEXA 1XBYA 1W3HA 3H7RA 4YYCA 3ELFA 1O66A 4K2SA 3QEZA 3W6YA 3WH6A 1O5KA 4H3DA 3WLQA 3H21A 2A0NA 5DCEA 3A22A 4KIEA 3SQMA 4UTTA 2QEZA 2W0UA 2ZX7A 3ITOA 4TMBA 3SBFA 4KETA 3LXCA 4AISA 4EIVA 4AX7A 5EPDA 2CESA 4AIOA 2VZTA 4HTYA 5REQB 3QXBA 4GZEA 3O07A 3FKRA 1ZS2A 5JIPA 2W5FA 2XVKA 5A6MA 4AIUA 3S5OA 2OZ0A 2E67A 4FSAA 4ALDA 3S9IA 3KOFA 1M41A 1FCVA 3WMCA 3GB6A 2QZRA 1KNWA 1FWJC 2GOKA 1L6GA 1XDJA 4YIWA 1EFZA 4J3ZA 4N4PA 4GUIA 3II1A 1OK4A 4EK7A 1W3JA 1EQCA 4MB4A 3QOKA 4HP5A 1LP6A 2J7EA 3AXIA 1UPPA 3PZGA 1XLEA 3AYRA 4QITA 1Z9AA 2A1YA 4QM1A 1W9XA 5EMYA 2GGGA 2VZUA 4L61A 2J7BA 3EMCA 1HKJA 2GGHA 3FKKA 3LZ3A 3VIOA 3MC5A 4DRSA 4PSPA 3ZZ1A 1A0CA 3ATZA 3IJ8A 4QE1A 1QUMA 4S23A 1OYBA 4A05A 1LTDA 1MQQA 1UCWA 2HROA 4JX4A 1UZDA 3RPDA 2B7NA 3GNPA 3LV5A 2H9AB 4J27A 2WBGA 1YNPA 3LTPA 1HGYA 1JPMA 4US5A 3O15A 3DXIA 4J9JA 3IVUA 3C56A 5CG7A 4UCFA 2NSXA 4F0KA 5CGTA 4MYAA 4TO8A 3REQA 3LZ5A 1B57A 3WLRA 4L4LA 2OEMA 3ZVHA 3ZT6A 4H7VA 1UP0A 2Z1SA 4XSMA 1OYAA 4A2SA 1RCXB 2QGHA 2Z6IA 3PBUA 1QFEA 4MHBA 2Z29A 5AC6A 4J2MA 1NQKA 3IUIA 1DQXA 3WF0A 4FPSA 3GKFA 4TVDA 4F0MA 4HMNA 3H4XA 1UZ4A 3P5ZA 2GWGA 4QAWA 3EWUA 4LC6A 1Y7VA 4PMQA 3QMTA 3HQ1A 3DUGA 2WLYA 2BHYA 5AC8A 3OLEA 1VKFA 3W2KA 4DJEC 1VP5A 2NZLA 2REQA 3PBVA 1PPIA 1WB0A 1OX6A 2A7PA 1XL9A 3TXVA 1NVMA 5F4XA 3EYPA 2Z26A 4FLQA 1FCUA 4JIHA 4L7ZA 2DJLA 4QX4A 2DV0A 3WYZA 3PTKA 3L67A 1KCKA 3BG3A 2XSBA 2ZZ2A 2WZHA 5D38A 3C2EA 4AD1A 1U33A 4POCA 3ITVA 5I23A 4QQUA 2QJHA 2CW6A 2PDYA 2A7NA 3T05A 3ARPA 5I02A 3PBGA 3D0CA 2GVEA 4FR6A 3QFEA 3GXTA 3MW7A 1QOPA 4RKAA 2ZZ7A 5DEZA 1IIHA 3TQKA 4UFIA 1E71M 4B5TA 1HJSA 1RP8A 9CGTA 3L4XA 3I4EA 3SDOA 1FBAA 3KVKA 2ODOA 3O2LA 1H4PA 1J10A 1EEPA 4PCFA 1JAEA 1FWDC 1Q2SA 1GJUA 3C8NA 2XN1A 4KWSA 1V3LA 3CMJA 1J12A 2XWEA 1DPMA 3PZTA 4LVGA 4GVHA 3WCZA 3MMUA 2AKMA 2Z00A 3TFCA 4UTFA 1EOMA 1LORA 3OO2A 1F4HA 3UG8A 2VWSA 2OZ3A 5BNKA 1XV8A 1OWQA 2GGEA 3E1F1 2CYGA 3UPMA 5LNWA 4IMFA 4RW5A 2XYLA 4C1LA 4HPGA 4GNKB 3QV7A 1XX1A 4ZQNA 3N29A 2D73A 1M53A 1VRDA 3R11A 3BJFA 3QR3A 5M3WA 3AMKA 1X98A 3FEQA 1PS9A 4XTDA 3OGSA 4RJEA 2XGBA 3BLLA 3FA3A 3O0KA 1FWNA 4ZQMA 5I3JA 3WDIA 4NSBA 5H2ZA 1EC9A 4EACA 4ZMGA 4O52A 1EZ2A 2OFJA 1CCWB 4EAMA 1GKRA 4B5VA 3SRDA 3AHTA 3L0NA 1EP3A 2YJQA 1H63A 4ZCWA 1I2PA 4U2YA 1ISXA 3PF3A 4L4PA 3DAQA 5TAOA 2VC6A 4GACA 3WL0A 4Z0SA 3ZS4A 3JVAA 4KRUA 3I7RA 4D8AA 3R10A 4NXKA 2WSQA 1UR4A 2FQIA 4R7JA 3DHPA 4J3UA 2E8YA 1E0XA 5F1VA 3QGAC 3H2MA 1LOLA 3OVGA 1QNRA 3WKZA 1GZGA 5E09A 2HXTA 1SZFA 2EJ1A 2CLKA 4NF7A 3WH9A 1ONEA 1HGWA 3FVMA 1RALA 2NLYA 3WY1A 4OKDA 3AZSA 4I5UA 2E5BA 1P0EA 5AC7A 4K68A 3C2YA 3T81A 3BICA 2TAAA 3IGUA 1E1EA 4S3CA 7REQB 2FHFA 1KM4A 4RLIA 4DWSB 4XD4A 4RNHA 3CHFA 2PGFA 1TWZA 1TIMA 1VLWA 2HVNA 2W9MA 3SFWA 3BC9A 2DVUA 2GK1B 2J6XA 4LX4A 4EE9A 2VURA 1VBJA 2VD8A 3TR2A 3SUSA 4GYJA 1W9PA 3KL5A 3TYAA 3MA8A 4JBRA 4JKMA 1D9EA 3SRHA 4UQBA 1UH3A 1J0YA 1DV7A 3PSVA 1ZJIA 3W87A 1NFBA 4FP1A 3S2MA 3CWHA 2ZXBA 2Q8ZA 1I4NA 5AECA 3WNOA 4A4AA 4WOZA 3CL6A 3I3BA 4N9CA 4IFOA 1ME8A 2PDNA 1M04A 4CU7A 4PUDA 3S83A 4N7QA 5LNUA 2XIOA 2G97A 3AIEA 2OLHA 1LLZA 4US5D 4ICCX 3A5VA 4R7WA 1K9EA 5LNVA 1B3VA 4WXZA 1ZL1A 1DWAM 2CBUA 4EWND 4YTTA 4U2ZA 3QN3A 4XZHA 4XBKA 4M51A 3FAWA 1T41A 2P8BA 4XWUA 1DOSA 1OY0A 2YW4A 1XG4A 2GUYA 3EKZA 1R30A 4ADUA 3W7CA 1SJDA 2J7HA 4F0SA 2G5WA 3GZAA 4YTSA 5A69A 2NXIA 4QNWA 4GYKA 4B3LA 3R4IA 2ZXDA 2QDHA 3MV11 3L9CA 2VGIA 2PCQA 3UQNA 1OQFA 1T8XA 3TX9A 1IE7C 3L5MA 1NP2A 3CLWA 4I7VA 3BLPX 3AXXA 2B4GA 2X0SA 1ISZA 2JQXA 4XBJA 4HJWA 2UBPC 5CPNA 2PB1A 2W67A 3NDYA 4QROA 1N2VA 4S3FA 4JTRA 1TSIA 2X8RA 3FYPA 4GZ7A 5A2BA 3TQVA 4MWAD 4XD5A 3N17A 4RE0A 1K4HA 1ZHAA 2QV5A 1H1ZA 3JS3A 5E6YA 2R91A 1XYLA 1VFUA 1TWIA 3B8VA 2NWSA 3VMPA 5LXEA 1CGVA 3MI2A 1FWTA 2DZAA 4QISA 4IWWA 4H9UA 3FEMA 3NZGA 2XH2A 4GX8A 4PRRA 1Q6CA 2Y5SA 1J11A 5AC5A 1VRXA 4RZBA 2Z27A 2OWCA 4EP8C 1WAUA 3VE7A 3B8TA 3WQGA 3S1VA 5GNZA 4DBWA 1JZ7A 2JF6A 4ASTA 4ZXLA 3AHXA 1XI3A 3CC1A 1Z32X 3ICJA 3SSJA 2EXOA 1W1ZA 2E0PA 3MHUA 4M8UA 3VOIA 3W6MA 4M0XA 2BXZA 2ICSA 3PVFA 2J6VA 4B3KA 1OD8A 1WDWA 4UOZA 5M5DA 4IIFA 2PF0A 1GZJA 3KX6A 4HU0A 4HNCA 1WXZA 2VCAA 1UROA 1ECQA 5GJNA 4C6EA 2QUTA 4Q6XA 4LAMA 1XH1A 2VENA 4UNLA 3SCUA 4IUOA 1W91A 1G7UA 3VKDA 1F6PA 3MYPA 4DZHA 3K4WA 4GUFA 4S39A 4UTHA 5K9DA 1RLCL 1KFBA 3RR4A 3VPLA 3CQKA 1UD6A 4KPLA 3UR8A 2IXUA 5J8LA 5ABTA 4RE4A 1NOUA 1AJZA 4IXHA 3DZ1A 4AU0A 1T7LA 5JBFA 1SUXA 3LB0A 1RLDA 5GNXA 1E0WA 2HV5A 3TSMA 4PMRA 2AL2A 4I8DA 1UMLA 4LYRA 3SRFA 4XISA 4US6A 5FJUA 1E56A 5HNTA 3CV1A 2CZFA 3ZJ6A 4UFMA 3UEQA 3PZVA 2WMIB 1LYXA 2V2CA 2DQWA 1CXHA 1JPHA 1WUFA 2Y7GA 4B5WA 1Q85A 1BYBA 3ORWA 3E5BA 1ADSA 1YE4A 4Q32A 3D46A 4PCNA 2BB0A 3K8LA 5AZ0A 2DSKA 1LQAA 4LAUA 4DF0A 1W3TA 1O12A 1EIXA 1Q45A 1KBKA 3LGDA 3QV9A 1K9TA 1JZ2A 2HRWA 4DNHA 3CQJA 2E09A 3TYCA 1NQ6A 3SURA 2YCJA 1CBGA 4XTIA 2OX4A 4JYEA 1UUOA 2R1KA 3SGUA 2ZE0A 3WZ0E 1ZP4A 3ZO9A 1QW8A 3UZZA 3W1TA 4Y90A 2PDXA 3EWWA 5K3VA 1SR9A 4KCWA 3KOWA 3BOLA 1OT2A 3I3EA 1TVLA 1Z3NA 4HNUA 3MMDA 2YBVA 5J5DA 4REQB 1CNVA 3HQPA 4MJ2A 1HUVA 1W3IA 1GORA 4G7EA 1AODA 1P6WA 4HCHA 4DJDA 3ITYA 1KFLA 4GI9A 1CDGA 2D23A 1U1UA 1L6YA 3WUBA 1UW9A 1P43A 1JDEA 2OQLA 1B9BA 1I2NA 2ZRYA 2D69A 5FIPA 2VR4A 1IXQA 3KEHA 3E02A 1AMKA 2OLAA 3M7SA 1ZZMA 3WDHA 4R7OA 2RDUA 5HPCA 2QCDA 1OCJA 1NP0A 2AMXA 3ZJ7A 4A8IA 2BV9A 3MU7A 4LFYA 3NOEA 5DT7A 4FAMA 1XBXA 3Q58A 1NEYA 2FGBA 3SUTA 4MAVA 3VIJA 5C54A 2ZIDA 2DU2A 2IS7A 3PZUA 3UYCA 2AMGA 3W82A 4RPPA 3RPTA 2HXUA 4HSNA 4IP4A 1UB3A 4O0QA 1SFJA 4MPKA 2O9PA 1ITCA 3N2XA 3MCMA 4DIAA 5EB8A 4S3AA 1KFKA 4F2UA 1FUYA 4BR1A 4U3CA 3A4JA 3NR0A 3LY0A 4HA0A 3W1MA 1HX0A 3EDKA 3H2AA 3BOXA 2QCLA 1D8WA 4N9EA 3NQGA 3GDLA 4GBUA 3OZMA 2ZUTA 3R8RA 4DF1A 2D2GA 4DI9A 1EBGA 1I2OA 4AUBA 4HIBA 4Q4RA 2NUYA 4IMAA 1IEVA 3M64A 1TELA 1S5MA 2VC5A 4AC1X 4NI8A 3BWWA 2VHLA 3MSRA 2YDSA 3B8IA 1TFVA 4TV5A 4FHAA 3ZMRA 4WQ6A 1QBBA 1OFBA 3UXDA 1HO1A 3AYTA 3L0GA 3IV3A 1XLKA 4CUCA 3VFLA 4MNJA 4R3UA 5ABEA 3IVTA 4WF7A 2XH4A 4D72A 1GQLA 1IIGA 1MQRA 4O1EA 3RM4A 1MWOA 1DHKA 5IOBA 3LLDA 5U7SA 1R2RA