3R9FA

Crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with coenzyme a and glutamyl sulfamoyl adenosine (esa)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
180
structure length
180
Chain Sequence
DVSLTPSGIKVNDEITLLYPALKYAEELYLLINQNKINFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYKTKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccE protein
publication title Structural Basis for Microcin C7 Inactivation by the MccE Acetyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 56
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3r9fA00
3BLNA 2WPXA 3VWDA 1MK4A 2R8VA 1PU9A 3B8GA 2WPWA 2BL1A 1GHEA 4MY3A 3TOBA 3UY5A 1XE4A 4NEXA 1YGHA 4HNXB 2KCWA 4KVOE 1Z9UA 3TOAA 1NSLA 4DNCA 4H6UA 4AVAA 3QAHA 2R7HA 4AG9A 2GANA 4UA3A 1S60A 1B6BA 4ONUA 4QBJA 5ISVA 1RXTA 4NSQA 1YREA 4UWIA 2F5IA 3R96A 3V8IA 4B5OA 3I9SA 3EO4A 3GKRA 5IB0A 2G0BA 2G3TA 1S7KA 3DSBA 3P2HA 1J4JA 2QIRA 1XF8A 1BOBA 5C88A 2A4NA 5DWMA 3D2MA 2Y0MA 4CAXA 2I00A 1I12A 2I79A 2ZW5A 4H6ZA 4Y49B 2QECA 4CAWA 1XMTA 2OH1A 3TCVA 2OU2A 4H89A 2EUIA 3GYAA 2CNSA 2REFA 3G3SA 2Z11A 4E8OA 4YRHA 3LODA 4ORFA 1L0CA 1MJ9A 3TO7A 2FSRA 3EFAA 4KOYA 2PR1A 1M1DA 1M4GA 2OZGA 3F0AA 1ON0A 1QSOA 1KZFA 3JVNA 2VI7A 1S3ZA 4QVTA 4AG7A 3N7ZA 3RYOA 1MJBA 2PDOA 3W6XA 3P2FA 1UFHA 1OZPA 3EC4A 2PSWA 1N71A 2R98A 1CJWA 1XEBA 3JUWA 4NF1A 4ZBGA 1U6MA 3DDDA 4QC6A 3H4QA 2B3VA 4JJXA 4OLLA 3PZJA 4CRYB 3FIXA 3FB3A 5F48A 2FIAA 4HNYB 4GS4A 4B5PB 3MGDA 4X5KA 3R1KA 4XNHC 2G3AA 4RI1A 2C27A 3D3SA 2PQ8A 1I1DA 2OZHA 3FYNA 4HKFA 4R3LA 2FT0A 2BEIA 4Y49C 3VWEA 4UWJA 4R9MA 3FRMA 4NCZA 2JDCA 3R9FA 3BJ8A 2Z10A 2PR8A 4MI4A 5J8CA 5EBVA 1M44A 1XIXA 4II9A 4JWPA 2B5GA 2Z0ZA 2OZUA 4J3GA 3TE4A 2IL4A 4AVBA 3DR6A 2FL4A 4CAVA 3GY9A 4U9YA 1YLEA 4KOUA 3S6GA 3TO6A 4LX9A 3PGPA 4B5PA 3E0KA 2P6GA 3FXTA 2VZZA 4JXQA 4KUAA 4XPDC 4U5YA 4RS2A 3OWCA 2P6EA 2NMTA 1YVKA 4MY0A 4QB9A 1Z4EA 1QSNA 3FBUA 3D2PA 5J8FA 3R9EA 2P6FA 1K4JA 1P4NA 4KOVA 3CXSA 2ATRA 2R1IA 4OADA 3CXPA 2BSWA 1IIDA 4JD6A 3C26A 4MJ8A 1B87A 2H5MA 2P0WA 2QMLA 4AVCA 1QSMA 4YFJA 2K5TA 3EY5A 4KVXA 3S6FA 1NE9A 2VXKA 2ZXVA 2FCKA 4PK3A 4PK2A 1IICA 4MHDA 3R9GA 2FXFA 4KLWA 5HH1A 5F46A 2B5GB 4CRZB 4I49A 4HNWB 2RC4A 3R95A 1YX0A 1M4IA 3K9UA 5KTAA 1SQHA 4IF5A 2B4BA 3TO9A 1VKCA 1S7FA 4EVYA 1KUYA 3T90A 2GIVA 2AE6A 2JLMA 4XPKA 4F6AA 4QUSA 3D8PA 3S6KA 2ZW7A 2D4OA 3PP9A 2O28A 3F5BA 3QB8A 2B3UA 4KUBA 2CNTA 4NXYA 3TT2A 2B4DA 5KTDA 2D4PA 1LRZA 5DWNA 1WK4A 4KOSA 2B58A 2ZW4A 2X7BA 3CXQA 2Q4YA 5C82A 4YGOA 2J8MA 4FD5A 3S6HA 3FNCA 2PC1A 1Y9WA 2J8RA 4KOXA 1QSRA 4CS0B 1IB1E 5JQ4A 1YK3A 3WR7A 2ZPAA 4KORA 5F47A 2VBQA 1YVOA 4KOTA 1Q2YA 2HUZA 5GCNA 3IWGA 4M3SA 4KVME 1S5KA 1V0CA 5JPHA 1S7LA 1Y9KA 4FD4A 3IGRA 3I3GA 2FIWA 3ZZIA 3ZJ0A 4UBRA 1NMTA 2J8NA 2VQYA 1P0HA 2VZYA 1R57A 3TFYA 4L8AA 2HV2A 1CM0A 1KUXA 2FS5A 5HMNA 2PRBA 4XNHB 5KTCA 2CNMA 3F8KA 4E2AA 2VEZA 4M85A 2ARHA 1Q2DA 4R57A 1FY7A 2Q7BA 2EVNA 5EC4A 4AB7A 4IUSA 1M4DA 4R87A 4K30A 2FE7A 4L89A 3SXNA 5F49A 2Q04A 4JLYA 3T9YA 5IX3A 4E0AA 3NE7A 1RO5A 1WWZA 1Y7RA 4OAEA 1TIQA 3TTHA 2OB0A 5CNPA 4KZTA 2B4DB 4BMHA 4XPLA 4MBUA 5E96A 4PV6A 1PUAA 2Q0YA 4KOWA 1IYLA 2DXQA 4KLVA 2CY2A 4F0YA 3SHPA 4PSXA 3DNSA 5FVJA 1VHSA 4XPDB 3EXNA 2JEVA 2JDDA 4LUAA 3W91A 2AJ6A 1S7NA 3G8WA 2Q4VA 1YR0A 3SXOA 5IV0A 2Q44A 1KUVA 3LD2A 3W6SA 1BO4A 4FD7A 2ZW6A 2REEA 3KKWA 1MJAA 4FD6A 1Z4RA 4PSWA 2GE3A 1Q2CA 1IYKA 1I21A 3DR8A 5H86A 5H84A 3BJ7A 2HQYA 4R3KA 4U9ZA 4JXRA 1QSTA 5I0CA 2BUEA
chains in the Genus database with same CATH superfamily
3BLNA 2WPXA 3VWDA 2GFQA 1MK4A 2R8VA 3D67A 4A39A 1TKHA 1M4LA 1PU9A 2CTCA 2Q4ZA 2ZEOA 3B8GA 3TC8A 4B6ZA 2WPWA 5AG6A 3CT9A 3QNVA 4MCPA 4MCRA 2BL1A 2Z3KA 1GHEA 4MY3A 1Y7EA 2PJ1A 4TWEA 4P4IA 3TOBA 3UY5A 2ZOFA 1XE4A 4IAVA 4NEXA 3WC5A 1YGHA 1ELMP 5THWA 2O4HA 1XMBA 4HNXB 2KCWA 4KVOE 1Z9UA 5LYIA 1NSLA 3TOAA 3WC6A 4DNCA 4H6UA 3KI9A 2BO9A 4AVAA 3QAHA 4IK2A 5D29A 1YLOA 4B13A 2R7HA 4AG9A 2C6GA 5J1QA 4DYOA 2GANA 4UA3A 5I4MA 3BI0A 1S60A 1B6BA 2PJAA 4ONUA 4QBJA 4EWTA 1X12A 5ISVA 1RXTA 2PJ5A 3PFEA 1CP7A 4MFLA 4NSQA 4KSFA 4Q38A 2V8VA 4CYOA 1YREA 4UWIA 1YW4A 2F5IA 4MFQA 4R7MA 3R96A 3V8IA 3IJ3A 4B5OA 3ISXA 1X10A 3I9SA 4JYWA 3EO4A 3GKRA 2IMOA 4WWVA 5IB0A 2G0BA 2EO8A 1S7KA 1Z8LA 2G3TA 3B3WA 1IOIA 1J4JA 1XF8A 2QIRA 2Z3LA 3IC1A 3P2HA 1BOBA 5AG5A 4ZX9A 4JZ0A 5C88A 2Z3OA 4LQ6A 3PB9X 2A4NA 1JQGA 2DPTA 2Q7SA 4G1PA 3D2MA 2Y0MA 5DWMA 4CAXA 2I00A 1I12A 2I79A 2ZW5A 1F57A 3B3SA 4H6ZA 4Y49B 3CZXA 8CPAA 2QECA 2V8GA 1ZG9A 4P4JA 5JM6A 1CBXA 3PFOA 1TKJA 1XFOA 5K8NA 4NJQA 4NFRA 1XMTA 4CAWA 1LCPA 4P10A 4PXBA 5G20A 2OH1A 2XEIA 3JRUA 3TCVA 5LYDA 2PJ6A 2OU2A 1FNOA 3SI1A 4H89A 2EUIA 4DJLA 3GYAA 4OC3A 2CNSA 2REFA 4KSIA 4OC4A 3G3SA 4BBHA 2C1CA 3IFEA 2CTBA 2Z11A 3PB7X 4E8OA 4MCSA 4B12A 3KR5A 4YRHA 4CYNA 2AFWA 3LODA 4ZY0A 4ORFA 1L0CA 2VL1A 4B14A 1MJ9A 3KASA 2PJ4A 3TO7A 4A33A 2FSRA 1IOFA 2YNCC 3EFAA 4KOYA 2PR1A 4A37A 2Q51A 5CBMA 2ABZA 1OBRA 1M1DA 1M4GA 1YSJA 2OZGA 4PQAA 3F0AA 1ON0A 4A38A 1AYEA 3FF3A 1QSOA 1KZFA 5D8NA 3RO0A 3JVNA 2VI7A 1S3ZA 3B2YA 4AXVA 4QVTA 2BCOA 3NH5A 4M6GA 4AG7A 3N7ZA 5K8MA 3RYOA 3VARA 4UCNA 4B10A 1MJBA 2GLFA 1CP6A 2PDOA 3H8GA 2PIYA 3W6XA 4X3RA 3P2FA 2IQ6A 2AFSA 1UFHA 4EFDA 1YMEA 4CAEA 1OZPA 3EC4A 4OC1A 3FJUA 2ZEFA 2PSWA 4GM5A 1N71A 1ZLHA 2R98A 1CJWA 1XEBA 3JUWA 4H2KA 4NF1A 4ZBGA 1U6MA 5LRGA 3DDDA 4KSAA 4QC6A 4OMEA 3MRUA 2WSAA 3H4QA 2B3VA 4JJXA 2C6CA 4P4EA 1LFWA 4OLLA 3BXMA 3PZJA 1VGYA 4CRYB 4PPZA 1XBUA 2ZEDA 1ZO0A 3FIXA 2QJ8A 3FB3A 5F48A 6CPAA 1TKFA 2FIAA 4HNYB 4GS4A 4LQGA 3VH9A 1BPNA 4B5PB 1XRYA 3MGDA 4X5KA 1IY7A 4CPAA 3R1KA 1Y0RA 4XNHC 2G3AA 4RI1A 2C27A 3D3SA 2ZOGA 2V8DA 5EMIA 1BLLE 2PQ8A 4ONWA 1I1DA 3I1UA 1HDUA 3IWWA 3KGQA 4P45A 2OZHA 3FYNA 4HKFA 4R3LA 2PJ7A 2FT0A 2BEIA 4R76A 4Y49C 3VWEA 2AFOA 4UWJA 4A32A 4F9VA 4R9MA 3FRMA 3GIUA 2ZEMA 4NCZA 4OP4A 2JDCA 3R9FA 3BJ8A 2Z10A 2JBJA 2PR8A 2G9DA 4MI4A 5J8CA 5EBVA 1M44A 2CXAA 2QYVA 1XIXA 3PB6X 5IB9A 3S9LA 2XEJA 4A94A 4II9A 4ZI6A 4JWPA 4RN7A 2B5GA 2Z0ZA 3FVLA 5HVFA 1Z2LA 3S9NA 1KWMA 1YQEA 2OZUA 4J3GA 2DPSA 5AGEA 3RBUA 4NGSA 3B3CA 3TE4A 2IL4A 4AVBA 2J9AA 3DR6A 2FL4A 4CAVA 3WABA 1A2ZA 1JWQA 2QVPA 4C2YA 3GY9A 3SI0A 3FH4A 1AUGA 3ISZA 5G1ZA 3IU2A 4U9YA 5JGFA 1YLEA 4KOUA 4O23A 4MCQA 3S6GA 4LX9A 1BAVA 3TO6A 5JH9A 3PGPA 4B5PA 2I3CA 3E0KA 2P6GA 3FXTA 3NH4A 5ELYA 1TF8A 4A31A 2VZZA 4JXQA 4X8IA 4ZY1A 3WC7A 3PBEA 4KUAA 3IIBA 4WJBA 2IJZA 4U5YA 4XPDC 4CGPA 3RNZA 4RS2A 3OWCA 2P6EA 2NMTA 4DUKA 1YVKA 2HC9A 2WZNA 4MY0A 4QB9A 1Z4EA 1QSNA 3FBUA 3D2PA 5J8FA 3R9EA 2P6FA 3RZAA 1K4JA 5H86A 2AFMA 1P4NA 2JEWA 3HLPA 4PXEA 4C2XA 4KOVA 2Z3NA 3FX6A 3CXSA 2ATRA 4UFWA 3RAMA 4IHMA 2R1IA 4OADA 2CF4A 4B11A 3CXPA 2PJ2A 4Z65A 5HXDA 1Z8XA 3SJXA 3BI1A 2DF5A 3D7FA 1PCAA 1Z5RA 2BSWA 1IIDA 1IU8A 1PYTB 2XEGA 4JD6A 3C26A 1CPXA 4MXUA 4MJ8A 3CPAA 1AMPA 1Z8TA 3PBBA 4UIBA 3H8FA 1B87A 2F7VA 2H5MA 5G22A 2P0WA 3B35A 1LAMA 4A30A 4NGQA 2QMLA 2EWBA 3D66A 4AVCA 1QSMA 4YFJA 1QMUA 3FECA 4FBEA 4Q7AA 2K5TA 3K2KA 3EY5A 3DGVA 4KVXA 3S6FA 1NE9A 2AFXA 2YNDA 3LACA 4GXHA 2VXKA 3SJEA 4C2ZA 1IGBA 3JTKA 1ARMA 2FCKA 2ZXVA 4PK3A 4PK2A 1IICA 3KZWA 3NE8A 4MHDA 4PXCA 2FXFA 3R9GA 4NGMA 4KLWA 2ZELA 2PIZA 3BHXA 1BPMA 1DTDA 5HH1A 4BINA 1XOVA 2PVWA 2EK8A 7CPAA 2ZEGA 2B5GB 4CRZB 5F46A 3KR4A 3VATA 3KQZA 2V8HA 1H8LA 3D4UA 4HNWB 4I49A 2RC4A 2WYRA 1YX0A 3R95A 1TF9A 4RUHA 1M4IA 2NYQA 4P4FA 3IU1A 4C68A 3N5FA 3K9UA 4UFXA 1SQHA 5KTAA 4IF5A 2B4BA 3TO9A 2GLJA 2ODFA 3B7IA 1VKCA 1S7FA 4EVYA 1KUYA 1LAPA 3T90A 2GIVA 4UIAA 1XJOA 2Z3PA 4OC5A 5AG4A 2AE6A 2JLMA 1Z8WA 4XPKA 3V38A 5K8OA 4F6AA 4QUSA 3D8PA 3PB4X 3CDXA 2GU2A 1ELLP 3GB0A 3S6KA 2ZW7A 2D4OA 5LYFA 3PP9A 2O28A 3F5BA 3PRTA 1Y0YA 2RFHA 3QB8A 4NGNA 4C7IA 2B3UA 2YGWA 5A27A 2PCUA 3FMCA 1CG2A 2Q43A 4UEEA 5G21A 3SJGA 2EBJA 4KUBA 2CNTA 4NXYA 1UWYA 3TT2A 3KHXA 4X2TA 2B4DA 5KTDA 1ZLIA 2O53A 2D4PA 1LRZA 1CX8A 1F2OA 1WK4A 1Q7LA 4MHNA 5DWNA 4NGTA 1CPSA 4KOSA 2B58A 2ZW4A 5HVHA 2ZENA 2X7BA 3CXQA 1HEEA 2ZEEA 3PEIA 2Q4YA 4YWYA 5C82A 4YGOA 2PJ0A 2J8MA 4F8ZA 4FD5A 3S6HA 3FNCA 2PC1A 1Y9WA 2J8RA 3H8EA 4KOXA 1QSRA 4A95A 4CS0B 1LOKA 1IB1E 5JQ4A 1YK3A 1HDQA 4P6YA 4ZY2A 1LANA 1FT7A 4CAFA 4FAIA 3WR7A 2ZPAA 5LYLA 4CYPA 4KORA 4M6IA 3L2NA 5F47A 5CPAA 2VBQA 1YVOA 3KQXA 4KOTA 4W9YA 1Q2YA 4CGOA 2FVGA 1RTQA 4CYQA 2HUZA 5GCNA 3IWGA 4FUUA 4A2ZA 4F0XA 4M3SA 4YU9A 3S9MA 4KVME 1S5KA 4F9UA 1V0CA 2BOAA 4K3NA 3SI2A 1S7LA 1Y9KA 4FD4A 5JPHA 3IGRA 3I3GA 2FIWA 3GUXA 3ZZIA 3ZJ0A 4UBRA 2YNEA 1NMTA 2WUUA 2J8NA 4MHZA 2VQYA 4HPSA 1P0HA 2VZYA 4OC2A 1R57A 3TFYA 2EK9A 4NJRA 2PE3A 2HV2A 1CM0A 4L8AA 2PJBA 4NGPA 4MFPA 1KUXA 2FS5A 4MFJA 4OIDA 5HMNA 1TXRA 4UEFA 2PRBA 4XNHB 2OOTA 5A28A 2HB6A 3IWEA 3TX8A 4M6HA 2YNCA 2CNMA 3F8KA 5KTCA 1GYTA 2NSMA 2PVVA 4E2AA 2VEZA 2AFZA 2ANPA 3LWUA 4M85A 4EMEA 1ZG7A 2ARHA 2JBKA 1VIXA 4UFVA 3V7ZA 1Q2DA 4R57A 1FY7A 3A9LA 2Q7BA 2EVNA 5LRJA 5EC4A 4AB7A 4IUSA 4P4BA 5BWAB 1M4DA 1QQ9A 3DLJA 4R87A 3KHZA 3D7DA 3HUVA 4K30A 2FE7A 1EE3P 4OIWA 2Z3MA 4L89A 5K8PA 3SXNA 5F49A 2Q04A 4JLYA 1ARLA 3T9YA 5IX3A 4E0AA 4UCPA 3NE7A 1RO5A 4MFKA 2PJ3A 3H5ZA 1WWZA 1Y7RA 4OAEA 1TIQA 1VHEA 3TTHA 3SJFA 4ZX8A 4ZGYB 2OB0A 3KL9A 4KZTA 5CNPA 2PRQA 2B4DB 3LMSA 3B3TA 4XPLA 4UF4A 4BMHA 3B3VA 5LRKA 2CIJA 4MBUA 5E96A 4ZYQA 4CGNA 1ZG8A 1R43A 4PV6A 1PUAA 4MRIA 3T8WA 2DEAA 2Q0YA 2AFUA 2PJ9A 2ZEPA 3FEEA 1IYLA 4KOWA 2DXQA 4MMOA 4OKOA 4KLVA 2F8HA 2CY2A 4F0YA 1VHOA 3CPXA 4PSXA 3SHPA 4KS9A 3DNSA 3DSBA 4MFZA 1VHSA 5FVJA 4PXDA 4XPDB 4OC0A 3EXNA 2JEVA 2C6PA 2JDDA 3D68A 3GLJA 3IEHA 4P44A 2OR4A 4LUAA 3W91A 2AJ6A 1S7NA 2V77A 2Q4VA 1YR0A 2PJCA 3G8WA 1R3NA 3SXOA 4C7HA 2POKA 5IV0A 2Q44A 3QAYA 1KUVA 5DS0A 3LD2A 4MHYA 4CGLA 5F09A 2ZEHA 1BO4A 3D7HA 4R6TA 3W6SA 4UCMA 4NGRA 4CGMA 4FD7A 4UEZA 4BD9A 2ZW6A 1YW6A 3D7GA 1DE4C 2PJ8A 2REEA 1MJAA 3IO1A 3K9TA 1Z4RA 3KKWA 4FD6A 3NA6A 2RB7A 3MN8A 4TNUA 3PB8X 4PSWA 3NH8A 2GE3A 4R8FA 4Q36A 2GREA 4P4DA 5I0CA 3FEDA 1NSAA 1Q2CA 2XEFA 1IYKA 4MHPA 5HVGA 1I21A 3DR8A 1F2PA 3NFZA 3BJ7A 5AG7A 2HQYA 4R3KA 4FWUA 4JXRA 1QSTA 4U9ZA 5H84A 3WT4A 2BUEA
chains in the Genus database with same CATH topology
3BLNA 2WPXA 3VWDA 1MK4A 2R8VA 1PU9A 3B8GA 2WPWA 5AG6A 2BL1A 2Z3KA 1GHEA 4MY3A 3TOBA 3UY5A 1XE4A 4NEXA 1YGHA 4HNXB 2KCWA 4KVOE 1Z9UA 3TOAA 1NSLA 4DNCA 4H6UA 4AVAA 3QAHA 4B13A 2R7HA 4AG9A 2GANA 4UA3A 1S60A 1B6BA 4ONUA 4QBJA 5ISVA 1RXTA 4MFLA 4NSQA 4KSFA 4Q38A 4CYOA 1YREA 4UWIA 2F5IA 4MFQA 3R96A 3V8IA 4B5OA 3I9SA 3EO4A 3GKRA 5IB0A 2G0BA 2G3TA 1S7KA 3DSBA 3P2HA 1J4JA 2QIRA 1XF8A 5AG5A 2Z3LA 1BOBA 5C88A 2Z3OA 2A4NA 2DPTA 5DWMA 3D2MA 2Y0MA 4CAXA 2I00A 1I12A 2I79A 2ZW5A 4H6ZA 4Y49B 2QECA 4CAWA 1XMTA 5G20A 2OH1A 3TCVA 2OU2A 4H89A 2EUIA 3GYAA 2CNSA 2REFA 3G3SA 4BBHA 2Z11A 4E8OA 4B12A 4CYNA 4YRHA 3LODA 4ORFA 1L0CA 4B14A 1MJ9A 3TO7A 4A33A 2FSRA 2YNCC 3EFAA 4KOYA 2PR1A 1M1DA 1M4GA 2OZGA 3F0AA 1ON0A 1QSOA 1KZFA 3JVNA 2VI7A 1S3ZA 4QVTA 4AG7A 3N7ZA 3RYOA 4UCNA 4B10A 1MJBA 2PDOA 3W6XA 3P2FA 1UFHA 4CAEA 1OZPA 3EC4A 2PSWA 1N71A 2R98A 1CJWA 1XEBA 3JUWA 4NF1A 4ZBGA 1U6MA 3DDDA 4KSAA 4QC6A 2WSAA 3H4QA 2B3VA 4JJXA 4OLLA 3PZJA 4CRYB 1ZO0A 3FIXA 3FB3A 5F48A 2FIAA 4HNYB 4GS4A 4B5PB 3MGDA 4X5KA 3R1KA 4XNHC 2G3AA 4RI1A 2C27A 3D3SA 2PQ8A 1I1DA 2OZHA 3FYNA 4HKFA 4R3LA 2FT0A 2BEIA 4Y49C 3VWEA 4A32A 4UWJA 4R9MA 3FRMA 4NCZA 2JDCA 3R9FA 3BJ8A 2Z10A 2PR8A 4MI4A 5J8CA 5EBVA 1M44A 2CXAA 1XIXA 4II9A 4JWPA 2B5GA 2Z0ZA 2OZUA 4J3GA 2DPSA 5AGEA 3TE4A 2IL4A 4AVBA 3DR6A 2FL4A 4CAVA 4C2YA 3GY9A 5G1ZA 3IU2A 4U9YA 1YLEA 4KOUA 3S6GA 3TO6A 4LX9A 3PGPA 4B5PA 3E0KA 2P6GA 3FXTA 4A31A 2VZZA 4JXQA 4KUAA 4XPDC 4U5YA 4CGPA 4RS2A 3OWCA 2P6EA 2NMTA 1YVKA 4MY0A 4QB9A 1Z4EA 1QSNA 3FBUA 3D2PA 5J8FA 3R9EA 2P6FA 1K4JA 1P4NA 4C2XA 4KOVA 2Z3NA 4UFWA 3CXSA 2ATRA 2R1IA 4OADA 4B11A 3CXPA 2BSWA 1IIDA 4JD6A 3C26A 4MJ8A 1B87A 2H5MA 5G22A 2P0WA 4A30A 2QMLA 4AVCA 1QSMA 4YFJA 2K5TA 3EY5A 4KVXA 3S6FA 1NE9A 2YNDA 2VXKA 4C2ZA 3JTKA 2ZXVA 2FCKA 4PK3A 4PK2A 1IICA 4MHDA 3R9GA 2FXFA 4KLWA 5HH1A 5F46A 2B5GB 4CRZB 4I49A 4HNWB 2RC4A 3R95A 1YX0A 1M4IA 3IU1A 4C68A 3K9UA 4UFXA 1SQHA 5KTAA 4IF5A 2B4BA 3TO9A 1VKCA 1S7FA 4EVYA 1KUYA 3T90A 2GIVA 2Z3PA 5AG4A 2AE6A 2JLMA 4XPKA 4F6AA 4QUSA 3D8PA 3S6KA 2ZW7A 2D4OA 3PP9A 2O28A 3F5BA 3QB8A 4C7IA 2B3UA 2YGWA 5A27A 5G21A 4KUBA 2CNTA 4NXYA 3TT2A 2B4DA 5KTDA 2D4PA 1LRZA 5DWNA 1WK4A 4KOSA 2B58A 2ZW4A 2X7BA 3CXQA 2Q4YA 5C82A 4YGOA 2J8MA 4FD5A 3S6HA 3FNCA 2PC1A 1Y9WA 2J8RA 4KOXA 1QSRA 4A95A 4CS0B 1IB1E 5JQ4A 1YK3A 4CAFA 3WR7A 2ZPAA 4CYPA 4KORA 5F47A 2VBQA 1YVOA 4KOTA 1Q2YA 4CGOA 4CYQA 2HUZA 5GCNA 3IWGA 4A2ZA 4F0XA 4M3SA 4KVME 1S5KA 1V0CA 5JPHA 1S7LA 1Y9KA 4FD4A 3IGRA 3I3GA 2FIWA 3ZZIA 3ZJ0A 4UBRA 2YNEA 1NMTA 2WUUA 2J8NA 2VQYA 1P0HA 2VZYA 1R57A 3TFYA 4L8AA 2HV2A 1CM0A 4MFPA 1KUXA 2FS5A 4MFJA 5HMNA 2PRBA 4XNHB 5A28A 3IWEA 2YNCA 2CNMA 3F8KA 5KTCA 4E2AA 2VEZA 4M85A 2ARHA 4UFVA 1Q2DA 4R57A 1FY7A 3A9LA 2Q7BA 2EVNA 5EC4A 4AB7A 4IUSA 5BWAB 1M4DA 4R87A 4K30A 2FE7A 2Z3MA 4L89A 3SXNA 5F49A 2Q04A 4JLYA 3T9YA 5IX3A 4E0AA 4UCPA 3NE7A 1RO5A 4MFKA 3H5ZA 1WWZA 1Y7RA 4OAEA 1TIQA 3TTHA 4ZGYB 2OB0A 5CNPA 4KZTA 2B4DB 4BMHA 4XPLA 4MBUA 5E96A 4CGNA 4PV6A 1PUAA 2Q0YA 4KOWA 1IYLA 2DXQA 4KLVA 2CY2A 4F0YA 3SHPA 4PSXA 4KS9A 3DNSA 4MFZA 1VHSA 5FVJA 4XPDB 3EXNA 2JEVA 2JDDA 4LUAA 3W91A 2AJ6A 1S7NA 3G8WA 2Q4VA 1YR0A 3SXOA 4C7HA 5IV0A 2Q44A 1KUVA 3LD2A 4CGLA 3W6SA 1BO4A 4UCMA 4CGMA 4FD7A 2ZW6A 2REEA 3KKWA 1MJAA 4FD6A 1Z4RA 4PSWA 2GE3A 4Q36A 1Q2CA 1IYKA 1I21A 3DR8A 5AG7A 5H84A 3BJ7A 5H86A 2HQYA 4R3KA 4U9ZA 4JXRA 1QSTA 5I0CA 2BUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BLN A;  2WPX A;  3VWD A;  1MK4 A;  2R8V A;  1PU9 A;  3B8G A;  2WPW A;  2BL1 A;  1GHE A;  4MY3 A;  3TOB A;  3UY5 A;  1XE4 A;  4NEX A;  1YGH A;  4HNX B;  2KCW A;  4KVO E;  1Z9U A;  3TOA A;  1NSL A;  4DNC A;  4H6U A;  4AVA A;  3QAH A;  2R7H A;  4AG9 A;  2GAN A;  4UA3 A;  1S60 A;  1B6B A;  4ONU A;  4QBJ A;  5ISV A;  1RXT A;  4NSQ A;  1YRE A;  4UWI A;  2F5I A;  3R96 A;  3V8I A;  4B5O A;  3I9S A;  3EO4 A;  3GKR A;  5IB0 A;  2G0B A;  2G3T A;  1S7K A;  3DSB A;  3P2H A;  1J4J A;  2QIR A;  1XF8 A;  1BOB A;  5C88 A;  2A4N A;  5DWM A;  3D2M A;  2Y0M A;  4CAX A;  2I00 A;  1I12 A;  2I79 A;  2ZW5 A;  4H6Z A;  4Y49 B;  2QEC A;  4CAW A;  1XMT A;  2OH1 A;  3TCV A;  2OU2 A;  4H89 A;  2EUI A;  3GYA A;  2CNS A;  2REF A;  3G3S A;  2Z11 A;  4E8O A;  4YRH A;  3LOD A;  4ORF A;  1L0C A;  1MJ9 A;  3TO7 A;  2FSR A;  3EFA A;  4KOY A;  2PR1 A;  1M1D A;  1M4G A;  2OZG A;  3F0A A;  1ON0 A;  1QSO A;  1KZF A;  3JVN A;  2VI7 A;  1S3Z A;  4QVT A;  4AG7 A;  3N7Z A;  3RYO A;  1MJB A;  2PDO A;  3W6X A;  3P2F A;  1UFH A;  1OZP A;  3EC4 A;  2PSW A;  1N71 A;  2R98 A;  1CJW A;  1XEB A;  3JUW A;  4NF1 A;  4ZBG A;  1U6M A;  3DDD A;  4QC6 A;  3H4Q A;  2B3V A;  4JJX A;  4OLL A;  3PZJ A;  4CRY B;  3FIX A;  3FB3 A;  5F48 A;  2FIA A;  4HNY B;  4GS4 A;  4B5P B;  3MGD A;  4X5K A;  3R1K A;  4XNH C;  2G3A A;  4RI1 A;  2C27 A;  3D3S A;  2PQ8 A;  1I1D A;  2OZH A;  3FYN A;  4HKF A;  4R3L A;  2FT0 A;  2BEI A;  4Y49 C;  3VWE A;  4UWJ A;  4R9M A;  3FRM A;  4NCZ A;  2JDC A;  3R9F A;  3BJ8 A;  2Z10 A;  2PR8 A;  4MI4 A;  5J8C A;  5EBV A;  1M44 A;  1XIX A;  4II9 A;  4JWP A;  2B5G A;  2Z0Z A;  2OZU A;  4J3G A;  3TE4 A;  2IL4 A;  4AVB A;  3DR6 A;  2FL4 A;  4CAV A;  3GY9 A;  4U9Y A;  1YLE A;  4KOU A;  3S6G A;  3TO6 A;  4LX9 A;  3PGP A;  4B5P A;  3E0K A;  2P6G A;  3FXT A;  2VZZ A;  4JXQ A;  4KUA A;  4XPD C;  4U5Y A;  4RS2 A;  3OWC A;  2P6E A;  2NMT A;  1YVK A;  4MY0 A;  4QB9 A;  1Z4E A;  1QSN A;  3FBU A;  3D2P A;  5J8F A;  3R9E A;  2P6F A;  1K4J A;  1P4N A;  4KOV A;  3CXS A;  2ATR A;  2R1I A;  4OAD A;  3CXP A;  2BSW A;  1IID A;  4JD6 A;  3C26 A;  4MJ8 A;  1B87 A;  2H5M A;  2P0W A;  2QML A;  4AVC A;  1QSM A;  4YFJ A;  2K5T A;  3EY5 A;  4KVX A;  3S6F A;  1NE9 A;  2VXK A;  2ZXV A;  2FCK A;  4PK3 A;  4PK2 A;  1IIC A;  4MHD A;  3R9G A;  2FXF A;  4KLW A;  5HH1 A;  5F46 A;  2B5G B;  4CRZ B;  4I49 A;  4HNW B;  2RC4 A;  3R95 A;  1YX0 A;  1M4I A;  3K9U A;  5KTA A;  1SQH A;  4IF5 A;  2B4B A;  3TO9 A;  1VKC A;  1S7F A;  4EVY A;  1KUY A;  3T90 A;  2GIV A;  2AE6 A;  2JLM A;  4XPK A;  4F6A A;  4QUS A;  3D8P A;  3S6K A;  2ZW7 A;  2D4O A;  3PP9 A;  2O28 A;  3F5B A;  3QB8 A;  2B3U A;  4KUB A;  2CNT A;  4NXY A;  3TT2 A;  2B4D A;  5KTD A;  2D4P A;  1LRZ A;  5DWN A;  1WK4 A;  4KOS A;  2B58 A;  2ZW4 A;  2X7B A;  3CXQ A;  2Q4Y A;  5C82 A;  4YGO A;  2J8M A;  4FD5 A;  3S6H A;  3FNC A;  2PC1 A;  1Y9W A;  2J8R A;  4KOX A;  1QSR A;  4CS0 B;  1IB1 E;  5JQ4 A;  1YK3 A;  3WR7 A;  2ZPA A;  4KOR A;  5F47 A;  2VBQ A;  1YVO A;  4KOT A;  1Q2Y A;  2HUZ A;  5GCN A;  3IWG A;  4M3S A;  4KVM E;  1S5K A;  1V0C A;  5JPH A;  1S7L A;  1Y9K A;  4FD4 A;  3IGR A;  3I3G A;  2FIW A;  3ZZI A;  3ZJ0 A;  4UBR A;  1NMT A;  2J8N A;  2VQY A;  1P0H A;  2VZY A;  1R57 A;  3TFY A;  4L8A A;  2HV2 A;  1CM0 A;  1KUX A;  2FS5 A;  5HMN A;  2PRB A;  4XNH B;  5KTC A;  2CNM A;  3F8K A;  4E2A A;  2VEZ A;  4M85 A;  2ARH A;  1Q2D A;  4R57 A;  1FY7 A;  2Q7B A;  2EVN A;  5EC4 A;  4AB7 A;  4IUS A;  1M4D A;  4R87 A;  4K30 A;  2FE7 A;  4L89 A;  3SXN A;  5F49 A;  2Q04 A;  4JLY A;  3T9Y A;  5IX3 A;  4E0A A;  3NE7 A;  1RO5 A;  1WWZ A;  1Y7R A;  4OAE A;  1TIQ A;  3TTH A;  2OB0 A;  5CNP A;  4KZT A;  2B4D B;  4BMH A;  4XPL A;  4MBU A;  5E96 A;  4PV6 A;  1PUA A;  2Q0Y A;  4KOW A;  1IYL A;  2DXQ A;  4KLV A;  2CY2 A;  4F0Y A;  3SHP A;  4PSX A;  3DNS A;  5FVJ A;  1VHS A;  4XPD B;  3EXN A;  2JEV A;  2JDD A;  4LUA A;  3W91 A;  2AJ6 A;  1S7N A;  3G8W A;  2Q4V A;  1YR0 A;  3SXO A;  5IV0 A;  2Q44 A;  1KUV A;  3LD2 A;  3W6S A;  1BO4 A;  4FD7 A;  2ZW6 A;  2REE A;  3KKW A;  1MJA A;  4FD6 A;  1Z4R A;  4PSW A;  2GE3 A;  1Q2C A;  1IYK A;  1I21 A;  3DR8 A;  5H86 A;  5H84 A;  3BJ7 A;  2HQY A;  4R3K A;  4U9Z A;  4JXR A;  1QST A;  5I0C A;  2BUE A; 
#chains in the Genus database with same CATH topology
 3BLN A;  2WPX A;  3VWD A;  2GFQ A;  1MK4 A;  2R8V A;  3D67 A;  4A39 A;  1TKH A;  1M4L A;  1PU9 A;  2CTC A;  2Q4Z A;  2ZEO A;  3B8G A;  3TC8 A;  4B6Z A;  2WPW A;  5AG6 A;  3CT9 A;  3QNV A;  4MCP A;  4MCR A;  2BL1 A;  2Z3K A;  1GHE A;  4MY3 A;  1Y7E A;  2PJ1 A;  4TWE A;  4P4I A;  3TOB A;  3UY5 A;  2ZOF A;  1XE4 A;  4IAV A;  4NEX A;  3WC5 A;  1YGH A;  1ELM P;  5THW A;  2O4H A;  1XMB A;  4HNX B;  2KCW A;  4KVO E;  1Z9U A;  5LYI A;  1NSL A;  3TOA A;  3WC6 A;  4DNC A;  4H6U A;  3KI9 A;  2BO9 A;  4AVA A;  3QAH A;  4IK2 A;  5D29 A;  1YLO A;  4B13 A;  2R7H A;  4AG9 A;  2C6G A;  5J1Q A;  4DYO A;  2GAN A;  4UA3 A;  5I4M A;  3BI0 A;  1S60 A;  1B6B A;  2PJA A;  4ONU A;  4QBJ A;  4EWT A;  1X12 A;  5ISV A;  1RXT A;  2PJ5 A;  3PFE A;  1CP7 A;  4MFL A;  4NSQ A;  4KSF A;  4Q38 A;  2V8V A;  4CYO A;  1YRE A;  4UWI A;  1YW4 A;  2F5I A;  4MFQ A;  4R7M A;  3R96 A;  3V8I A;  3IJ3 A;  4B5O A;  3ISX A;  1X10 A;  3I9S A;  4JYW A;  3EO4 A;  3GKR A;  2IMO A;  4WWV A;  5IB0 A;  2G0B A;  2EO8 A;  1S7K A;  1Z8L A;  2G3T A;  3B3W A;  1IOI A;  1J4J A;  1XF8 A;  2QIR A;  2Z3L A;  3IC1 A;  3P2H A;  1BOB A;  5AG5 A;  4ZX9 A;  4JZ0 A;  5C88 A;  2Z3O A;  4LQ6 A;  3PB9 X;  2A4N A;  1JQG A;  2DPT A;  2Q7S A;  4G1P A;  3D2M A;  2Y0M A;  5DWM A;  4CAX A;  2I00 A;  1I12 A;  2I79 A;  2ZW5 A;  1F57 A;  3B3S A;  4H6Z A;  4Y49 B;  3CZX A;  8CPA A;  2QEC A;  2V8G A;  1ZG9 A;  4P4J A;  5JM6 A;  1CBX A;  3PFO A;  1TKJ A;  1XFO A;  5K8N A;  4NJQ A;  4NFR A;  1XMT A;  4CAW A;  1LCP A;  4P10 A;  4PXB A;  5G20 A;  2OH1 A;  2XEI A;  3JRU A;  3TCV A;  5LYD A;  2PJ6 A;  2OU2 A;  1FNO A;  3SI1 A;  4H89 A;  2EUI A;  4DJL A;  3GYA A;  4OC3 A;  2CNS A;  2REF A;  4KSI A;  4OC4 A;  3G3S A;  4BBH A;  2C1C A;  3IFE A;  2CTB A;  2Z11 A;  3PB7 X;  4E8O A;  4MCS A;  4B12 A;  3KR5 A;  4YRH A;  4CYN A;  2AFW A;  3LOD A;  4ZY0 A;  4ORF A;  1L0C A;  2VL1 A;  4B14 A;  1MJ9 A;  3KAS A;  2PJ4 A;  3TO7 A;  4A33 A;  2FSR A;  1IOF A;  2YNC C;  3EFA A;  4KOY A;  2PR1 A;  4A37 A;  2Q51 A;  5CBM A;  2ABZ A;  1OBR A;  1M1D A;  1M4G A;  1YSJ A;  2OZG A;  4PQA A;  3F0A A;  1ON0 A;  4A38 A;  1AYE A;  3FF3 A;  1QSO A;  1KZF A;  5D8N A;  3RO0 A;  3JVN A;  2VI7 A;  1S3Z A;  3B2Y A;  4AXV A;  4QVT A;  2BCO A;  3NH5 A;  4M6G A;  4AG7 A;  3N7Z A;  5K8M A;  3RYO A;  3VAR A;  4UCN A;  4B10 A;  1MJB A;  2GLF A;  1CP6 A;  2PDO A;  3H8G A;  2PIY A;  3W6X A;  4X3R A;  3P2F A;  2IQ6 A;  2AFS A;  1UFH A;  4EFD A;  1YME A;  4CAE A;  1OZP A;  3EC4 A;  4OC1 A;  3FJU A;  2ZEF A;  2PSW A;  4GM5 A;  1N71 A;  1ZLH A;  2R98 A;  1CJW A;  1XEB A;  3JUW A;  4H2K A;  4NF1 A;  4ZBG A;  1U6M A;  5LRG A;  3DDD A;  4KSA A;  4QC6 A;  4OME A;  3MRU A;  2WSA A;  3H4Q A;  2B3V A;  4JJX A;  2C6C A;  4P4E A;  1LFW A;  4OLL A;  3BXM A;  3PZJ A;  1VGY A;  4CRY B;  4PPZ A;  1XBU A;  2ZED A;  1ZO0 A;  3FIX A;  2QJ8 A;  3FB3 A;  5F48 A;  6CPA A;  1TKF A;  2FIA A;  4HNY B;  4GS4 A;  4LQG A;  3VH9 A;  1BPN A;  4B5P B;  1XRY A;  3MGD A;  4X5K A;  1IY7 A;  4CPA A;  3R1K A;  1Y0R A;  4XNH C;  2G3A A;  4RI1 A;  2C27 A;  3D3S A;  2ZOG A;  2V8D A;  5EMI A;  1BLL E;  2PQ8 A;  4ONW A;  1I1D A;  3I1U A;  1HDU A;  3IWW A;  3KGQ A;  4P45 A;  2OZH A;  3FYN A;  4HKF A;  4R3L A;  2PJ7 A;  2FT0 A;  2BEI A;  4R76 A;  4Y49 C;  3VWE A;  2AFO A;  4UWJ A;  4A32 A;  4F9V A;  4R9M A;  3FRM A;  3GIU A;  2ZEM A;  4NCZ A;  4OP4 A;  2JDC A;  3R9F A;  3BJ8 A;  2Z10 A;  2JBJ A;  2PR8 A;  2G9D A;  4MI4 A;  5J8C A;  5EBV A;  1M44 A;  2CXA A;  2QYV A;  1XIX A;  3PB6 X;  5IB9 A;  3S9L A;  2XEJ A;  4A94 A;  4II9 A;  4ZI6 A;  4JWP A;  4RN7 A;  2B5G A;  2Z0Z A;  3FVL A;  5HVF A;  1Z2L A;  3S9N A;  1KWM A;  1YQE A;  2OZU A;  4J3G A;  2DPS A;  5AGE A;  3RBU A;  4NGS A;  3B3C A;  3TE4 A;  2IL4 A;  4AVB A;  2J9A A;  3DR6 A;  2FL4 A;  4CAV A;  3WAB A;  1A2Z A;  1JWQ A;  2QVP A;  4C2Y A;  3GY9 A;  3SI0 A;  3FH4 A;  1AUG A;  3ISZ A;  5G1Z A;  3IU2 A;  4U9Y A;  5JGF A;  1YLE A;  4KOU A;  4O23 A;  4MCQ A;  3S6G A;  4LX9 A;  1BAV A;  3TO6 A;  5JH9 A;  3PGP A;  4B5P A;  2I3C A;  3E0K A;  2P6G A;  3FXT A;  3NH4 A;  5ELY A;  1TF8 A;  4A31 A;  2VZZ A;  4JXQ A;  4X8I A;  4ZY1 A;  3WC7 A;  3PBE A;  4KUA A;  3IIB A;  4WJB A;  2IJZ A;  4U5Y A;  4XPD C;  4CGP A;  3RNZ A;  4RS2 A;  3OWC A;  2P6E A;  2NMT A;  4DUK A;  1YVK A;  2HC9 A;  2WZN A;  4MY0 A;  4QB9 A;  1Z4E A;  1QSN A;  3FBU A;  3D2P A;  5J8F A;  3R9E A;  2P6F A;  3RZA A;  1K4J A;  5H86 A;  2AFM A;  1P4N A;  2JEW A;  3HLP A;  4PXE A;  4C2X A;  4KOV A;  2Z3N A;  3FX6 A;  3CXS A;  2ATR A;  4UFW A;  3RAM A;  4IHM A;  2R1I A;  4OAD A;  2CF4 A;  4B11 A;  3CXP A;  2PJ2 A;  4Z65 A;  5HXD A;  1Z8X A;  3SJX A;  3BI1 A;  2DF5 A;  3D7F A;  1PCA A;  1Z5R A;  2BSW A;  1IID A;  1IU8 A;  1PYT B;  2XEG A;  4JD6 A;  3C26 A;  1CPX A;  4MXU A;  4MJ8 A;  3CPA A;  1AMP A;  1Z8T A;  3PBB A;  4UIB A;  3H8F A;  1B87 A;  2F7V A;  2H5M A;  5G22 A;  2P0W A;  3B35 A;  1LAM A;  4A30 A;  4NGQ A;  2QML A;  2EWB A;  3D66 A;  4AVC A;  1QSM A;  4YFJ A;  1QMU A;  3FEC A;  4FBE A;  4Q7A A;  2K5T A;  3K2K A;  3EY5 A;  3DGV A;  4KVX A;  3S6F A;  1NE9 A;  2AFX A;  2YND A;  3LAC A;  4GXH A;  2VXK A;  3SJE A;  4C2Z A;  1IGB A;  3JTK A;  1ARM A;  2FCK A;  2ZXV A;  4PK3 A;  4PK2 A;  1IIC A;  3KZW A;  3NE8 A;  4MHD A;  4PXC A;  2FXF A;  3R9G A;  4NGM A;  4KLW A;  2ZEL A;  2PIZ A;  3BHX A;  1BPM A;  1DTD A;  5HH1 A;  4BIN A;  1XOV A;  2PVW A;  2EK8 A;  7CPA A;  2ZEG A;  2B5G B;  4CRZ B;  5F46 A;  3KR4 A;  3VAT A;  3KQZ A;  2V8H A;  1H8L A;  3D4U A;  4HNW B;  4I49 A;  2RC4 A;  2WYR A;  1YX0 A;  3R95 A;  1TF9 A;  4RUH A;  1M4I A;  2NYQ A;  4P4F A;  3IU1 A;  4C68 A;  3N5F A;  3K9U A;  4UFX A;  1SQH A;  5KTA A;  4IF5 A;  2B4B A;  3TO9 A;  2GLJ A;  2ODF A;  3B7I A;  1VKC A;  1S7F A;  4EVY A;  1KUY A;  1LAP A;  3T90 A;  2GIV A;  4UIA A;  1XJO A;  2Z3P A;  4OC5 A;  5AG4 A;  2AE6 A;  2JLM A;  1Z8W A;  4XPK A;  3V38 A;  5K8O A;  4F6A A;  4QUS A;  3D8P A;  3PB4 X;  3CDX A;  2GU2 A;  1ELL P;  3GB0 A;  3S6K A;  2ZW7 A;  2D4O A;  5LYF A;  3PP9 A;  2O28 A;  3F5B A;  3PRT A;  1Y0Y A;  2RFH A;  3QB8 A;  4NGN A;  4C7I A;  2B3U A;  2YGW A;  5A27 A;  2PCU A;  3FMC A;  1CG2 A;  2Q43 A;  4UEE A;  5G21 A;  3SJG A;  2EBJ A;  4KUB A;  2CNT A;  4NXY A;  1UWY A;  3TT2 A;  3KHX A;  4X2T A;  2B4D A;  5KTD A;  1ZLI A;  2O53 A;  2D4P A;  1LRZ A;  1CX8 A;  1F2O A;  1WK4 A;  1Q7L A;  4MHN A;  5DWN A;  4NGT A;  1CPS A;  4KOS A;  2B58 A;  2ZW4 A;  5HVH A;  2ZEN A;  2X7B A;  3CXQ A;  1HEE A;  2ZEE A;  3PEI A;  2Q4Y A;  4YWY A;  5C82 A;  4YGO A;  2PJ0 A;  2J8M A;  4F8Z A;  4FD5 A;  3S6H A;  3FNC A;  2PC1 A;  1Y9W A;  2J8R A;  3H8E A;  4KOX A;  1QSR A;  4A95 A;  4CS0 B;  1LOK A;  1IB1 E;  5JQ4 A;  1YK3 A;  1HDQ A;  4P6Y A;  4ZY2 A;  1LAN A;  1FT7 A;  4CAF A;  4FAI A;  3WR7 A;  2ZPA A;  5LYL A;  4CYP A;  4KOR A;  4M6I A;  3L2N A;  5F47 A;  5CPA A;  2VBQ A;  1YVO A;  3KQX A;  4KOT A;  4W9Y A;  1Q2Y A;  4CGO A;  2FVG A;  1RTQ A;  4CYQ A;  2HUZ A;  5GCN A;  3IWG A;  4FUU A;  4A2Z A;  4F0X A;  4M3S A;  4YU9 A;  3S9M A;  4KVM E;  1S5K A;  4F9U A;  1V0C A;  2BOA A;  4K3N A;  3SI2 A;  1S7L A;  1Y9K A;  4FD4 A;  5JPH A;  3IGR A;  3I3G A;  2FIW A;  3GUX A;  3ZZI A;  3ZJ0 A;  4UBR A;  2YNE A;  1NMT A;  2WUU A;  2J8N A;  4MHZ A;  2VQY A;  4HPS A;  1P0H A;  2VZY A;  4OC2 A;  1R57 A;  3TFY A;  2EK9 A;  4NJR A;  2PE3 A;  2HV2 A;  1CM0 A;  4L8A A;  2PJB A;  4NGP A;  4MFP A;  1KUX A;  2FS5 A;  4MFJ A;  4OID A;  5HMN A;  1TXR A;  4UEF A;  2PRB A;  4XNH B;  2OOT A;  5A28 A;  2HB6 A;  3IWE A;  3TX8 A;  4M6H A;  2YNC A;  2CNM A;  3F8K A;  5KTC A;  1GYT A;  2NSM A;  2PVV A;  4E2A A;  2VEZ A;  2AFZ A;  2ANP A;  3LWU A;  4M85 A;  4EME A;  1ZG7 A;  2ARH A;  2JBK A;  1VIX A;  4UFV A;  3V7Z A;  1Q2D A;  4R57 A;  1FY7 A;  3A9L A;  2Q7B A;  2EVN A;  5LRJ A;  5EC4 A;  4AB7 A;  4IUS A;  4P4B A;  5BWA B;  1M4D A;  1QQ9 A;  3DLJ A;  4R87 A;  3KHZ A;  3D7D A;  3HUV A;  4K30 A;  2FE7 A;  1EE3 P;  4OIW A;  2Z3M A;  4L89 A;  5K8P A;  3SXN A;  5F49 A;  2Q04 A;  4JLY A;  1ARL A;  3T9Y A;  5IX3 A;  4E0A A;  4UCP A;  3NE7 A;  1RO5 A;  4MFK A;  2PJ3 A;  3H5Z A;  1WWZ A;  1Y7R A;  4OAE A;  1TIQ A;  1VHE A;  3TTH A;  3SJF A;  4ZX8 A;  4ZGY B;  2OB0 A;  3KL9 A;  4KZT A;  5CNP A;  2PRQ A;  2B4D B;  3LMS A;  3B3T A;  4XPL A;  4UF4 A;  4BMH A;  3B3V A;  5LRK A;  2CIJ A;  4MBU A;  5E96 A;  4ZYQ A;  4CGN A;  1ZG8 A;  1R43 A;  4PV6 A;  1PUA A;  4MRI A;  3T8W A;  2DEA A;  2Q0Y A;  2AFU A;  2PJ9 A;  2ZEP A;  3FEE A;  1IYL A;  4KOW A;  2DXQ A;  4MMO A;  4OKO A;  4KLV A;  2F8H A;  2CY2 A;  4F0Y A;  1VHO A;  3CPX A;  4PSX A;  3SHP A;  4KS9 A;  3DNS A;  3DSB A;  4MFZ A;  1VHS A;  5FVJ A;  4PXD A;  4XPD B;  4OC0 A;  3EXN A;  2JEV A;  2C6P A;  2JDD A;  3D68 A;  3GLJ A;  3IEH A;  4P44 A;  2OR4 A;  4LUA A;  3W91 A;  2AJ6 A;  1S7N A;  2V77 A;  2Q4V A;  1YR0 A;  2PJC A;  3G8W A;  1R3N A;  3SXO A;  4C7H A;  2POK A;  5IV0 A;  2Q44 A;  3QAY A;  1KUV A;  5DS0 A;  3LD2 A;  4MHY A;  4CGL A;  5F09 A;  2ZEH A;  1BO4 A;  3D7H A;  4R6T A;  3W6S A;  4UCM A;  4NGR A;  4CGM A;  4FD7 A;  4UEZ A;  4BD9 A;  2ZW6 A;  1YW6 A;  3D7G A;  1DE4 C;  2PJ8 A;  2REE A;  1MJA A;  3IO1 A;  3K9T A;  1Z4R A;  3KKW A;  4FD6 A;  3NA6 A;  2RB7 A;  3MN8 A;  4TNU A;  3PB8 X;  4PSW A;  3NH8 A;  2GE3 A;  4R8F A;  4Q36 A;  2GRE A;  4P4D A;  5I0C A;  3FED A;  1NSA A;  1Q2C A;  2XEF A;  1IYK A;  4MHP A;  5HVG A;  1I21 A;  3DR8 A;  1F2P A;  3NFZ A;  3BJ7 A;  5AG7 A;  2HQY A;  4R3K A;  4FWU A;  4JXR A;  1QST A;  4U9Z A;  5H84 A;  3WT4 A;  2BUE A; 
#chains in the Genus database with same CATH homology
 3BLN A;  2WPX A;  3VWD A;  1MK4 A;  2R8V A;  1PU9 A;  3B8G A;  2WPW A;  5AG6 A;  2BL1 A;  2Z3K A;  1GHE A;  4MY3 A;  3TOB A;  3UY5 A;  1XE4 A;  4NEX A;  1YGH A;  4HNX B;  2KCW A;  4KVO E;  1Z9U A;  3TOA A;  1NSL A;  4DNC A;  4H6U A;  4AVA A;  3QAH A;  4B13 A;  2R7H A;  4AG9 A;  2GAN A;  4UA3 A;  1S60 A;  1B6B A;  4ONU A;  4QBJ A;  5ISV A;  1RXT A;  4MFL A;  4NSQ A;  4KSF A;  4Q38 A;  4CYO A;  1YRE A;  4UWI A;  2F5I A;  4MFQ A;  3R96 A;  3V8I A;  4B5O A;  3I9S A;  3EO4 A;  3GKR A;  5IB0 A;  2G0B A;  2G3T A;  1S7K A;  3DSB A;  3P2H A;  1J4J A;  2QIR A;  1XF8 A;  5AG5 A;  2Z3L A;  1BOB A;  5C88 A;  2Z3O A;  2A4N A;  2DPT A;  5DWM A;  3D2M A;  2Y0M A;  4CAX A;  2I00 A;  1I12 A;  2I79 A;  2ZW5 A;  4H6Z A;  4Y49 B;  2QEC A;  4CAW A;  1XMT A;  5G20 A;  2OH1 A;  3TCV A;  2OU2 A;  4H89 A;  2EUI A;  3GYA A;  2CNS A;  2REF A;  3G3S A;  4BBH A;  2Z11 A;  4E8O A;  4B12 A;  4CYN A;  4YRH A;  3LOD A;  4ORF A;  1L0C A;  4B14 A;  1MJ9 A;  3TO7 A;  4A33 A;  2FSR A;  2YNC C;  3EFA A;  4KOY A;  2PR1 A;  1M1D A;  1M4G A;  2OZG A;  3F0A A;  1ON0 A;  1QSO A;  1KZF A;  3JVN A;  2VI7 A;  1S3Z A;  4QVT A;  4AG7 A;  3N7Z A;  3RYO A;  4UCN A;  4B10 A;  1MJB A;  2PDO A;  3W6X A;  3P2F A;  1UFH A;  4CAE A;  1OZP A;  3EC4 A;  2PSW A;  1N71 A;  2R98 A;  1CJW A;  1XEB A;  3JUW A;  4NF1 A;  4ZBG A;  1U6M A;  3DDD A;  4KSA A;  4QC6 A;  2WSA A;  3H4Q A;  2B3V A;  4JJX A;  4OLL A;  3PZJ A;  4CRY B;  1ZO0 A;  3FIX A;  3FB3 A;  5F48 A;  2FIA A;  4HNY B;  4GS4 A;  4B5P B;  3MGD A;  4X5K A;  3R1K A;  4XNH C;  2G3A A;  4RI1 A;  2C27 A;  3D3S A;  2PQ8 A;  1I1D A;  2OZH A;  3FYN A;  4HKF A;  4R3L A;  2FT0 A;  2BEI A;  4Y49 C;  3VWE A;  4A32 A;  4UWJ A;  4R9M A;  3FRM A;  4NCZ A;  2JDC A;  3R9F A;  3BJ8 A;  2Z10 A;  2PR8 A;  4MI4 A;  5J8C A;  5EBV A;  1M44 A;  2CXA A;  1XIX A;  4II9 A;  4JWP A;  2B5G A;  2Z0Z A;  2OZU A;  4J3G A;  2DPS A;  5AGE A;  3TE4 A;  2IL4 A;  4AVB A;  3DR6 A;  2FL4 A;  4CAV A;  4C2Y A;  3GY9 A;  5G1Z A;  3IU2 A;  4U9Y A;  1YLE A;  4KOU A;  3S6G A;  3TO6 A;  4LX9 A;  3PGP A;  4B5P A;  3E0K A;  2P6G A;  3FXT A;  4A31 A;  2VZZ A;  4JXQ A;  4KUA A;  4XPD C;  4U5Y A;  4CGP A;  4RS2 A;  3OWC A;  2P6E A;  2NMT A;  1YVK A;  4MY0 A;  4QB9 A;  1Z4E A;  1QSN A;  3FBU A;  3D2P A;  5J8F A;  3R9E A;  2P6F A;  1K4J A;  1P4N A;  4C2X A;  4KOV A;  2Z3N A;  4UFW A;  3CXS A;  2ATR A;  2R1I A;  4OAD A;  4B11 A;  3CXP A;  2BSW A;  1IID A;  4JD6 A;  3C26 A;  4MJ8 A;  1B87 A;  2H5M A;  5G22 A;  2P0W A;  4A30 A;  2QML A;  4AVC A;  1QSM A;  4YFJ A;  2K5T A;  3EY5 A;  4KVX A;  3S6F A;  1NE9 A;  2YND A;  2VXK A;  4C2Z A;  3JTK A;  2ZXV A;  2FCK A;  4PK3 A;  4PK2 A;  1IIC A;  4MHD A;  3R9G A;  2FXF A;  4KLW A;  5HH1 A;  5F46 A;  2B5G B;  4CRZ B;  4I49 A;  4HNW B;  2RC4 A;  3R95 A;  1YX0 A;  1M4I A;  3IU1 A;  4C68 A;  3K9U A;  4UFX A;  1SQH A;  5KTA A;  4IF5 A;  2B4B A;  3TO9 A;  1VKC A;  1S7F A;  4EVY A;  1KUY A;  3T90 A;  2GIV A;  2Z3P A;  5AG4 A;  2AE6 A;  2JLM A;  4XPK A;  4F6A A;  4QUS A;  3D8P A;  3S6K A;  2ZW7 A;  2D4O A;  3PP9 A;  2O28 A;  3F5B A;  3QB8 A;  4C7I A;  2B3U A;  2YGW A;  5A27 A;  5G21 A;  4KUB A;  2CNT A;  4NXY A;  3TT2 A;  2B4D A;  5KTD A;  2D4P A;  1LRZ A;  5DWN A;  1WK4 A;  4KOS A;  2B58 A;  2ZW4 A;  2X7B A;  3CXQ A;  2Q4Y A;  5C82 A;  4YGO A;  2J8M A;  4FD5 A;  3S6H A;  3FNC A;  2PC1 A;  1Y9W A;  2J8R A;  4KOX A;  1QSR A;  4A95 A;  4CS0 B;  1IB1 E;  5JQ4 A;  1YK3 A;  4CAF A;  3WR7 A;  2ZPA A;  4CYP A;  4KOR A;  5F47 A;  2VBQ A;  1YVO A;  4KOT A;  1Q2Y A;  4CGO A;  4CYQ A;  2HUZ A;  5GCN A;  3IWG A;  4A2Z A;  4F0X A;  4M3S A;  4KVM E;  1S5K A;  1V0C A;  5JPH A;  1S7L A;  1Y9K A;  4FD4 A;  3IGR A;  3I3G A;  2FIW A;  3ZZI A;  3ZJ0 A;  4UBR A;  2YNE A;  1NMT A;  2WUU A;  2J8N A;  2VQY A;  1P0H A;  2VZY A;  1R57 A;  3TFY A;  4L8A A;  2HV2 A;  1CM0 A;  4MFP A;  1KUX A;  2FS5 A;  4MFJ A;  5HMN A;  2PRB A;  4XNH B;  5A28 A;  3IWE A;  2YNC A;  2CNM A;  3F8K A;  5KTC A;  4E2A A;  2VEZ A;  4M85 A;  2ARH A;  4UFV A;  1Q2D A;  4R57 A;  1FY7 A;  3A9L A;  2Q7B A;  2EVN A;  5EC4 A;  4AB7 A;  4IUS A;  5BWA B;  1M4D A;  4R87 A;  4K30 A;  2FE7 A;  2Z3M A;  4L89 A;  3SXN A;  5F49 A;  2Q04 A;  4JLY A;  3T9Y A;  5IX3 A;  4E0A A;  4UCP A;  3NE7 A;  1RO5 A;  4MFK A;  3H5Z A;  1WWZ A;  1Y7R A;  4OAE A;  1TIQ A;  3TTH A;  4ZGY B;  2OB0 A;  5CNP A;  4KZT A;  2B4D B;  4BMH A;  4XPL A;  4MBU A;  5E96 A;  4CGN A;  4PV6 A;  1PUA A;  2Q0Y A;  4KOW A;  1IYL A;  2DXQ A;  4KLV A;  2CY2 A;  4F0Y A;  3SHP A;  4PSX A;  4KS9 A;  3DNS A;  4MFZ A;  1VHS A;  5FVJ A;  4XPD B;  3EXN A;  2JEV A;  2JDD A;  4LUA A;  3W91 A;  2AJ6 A;  1S7N A;  3G8W A;  2Q4V A;  1YR0 A;  3SXO A;  4C7H A;  5IV0 A;  2Q44 A;  1KUV A;  3LD2 A;  4CGL A;  3W6S A;  1BO4 A;  4UCM A;  4CGM A;  4FD7 A;  2ZW6 A;  2REE A;  3KKW A;  1MJA A;  4FD6 A;  1Z4R A;  4PSW A;  2GE3 A;  4Q36 A;  1Q2C A;  1IYK A;  1I21 A;  3DR8 A;  5AG7 A;  5H84 A;  3BJ7 A;  5H86 A;  2HQY A;  4R3K A;  4U9Z A;  4JXR A;  1QST A;  5I0C A;  2BUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...