3R9FA

Crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with coenzyme a and glutamyl sulfamoyl adenosine (esa)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
180
structure length
180
Chain Sequence
DVSLTPSGIKVNDEITLLYPALKYAEELYLLINQNKINFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYKTKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccE protein
publication title Structural Basis for Microcin C7 Inactivation by the MccE Acetyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 56
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3r9fA00
2QECA 3I9SA 1GHEA 1KZFA 2DXQA 2I00A 2R1IA 2OZUA 3ZZIA 5HMNA 2D4OA 1OZPA 4JWPA 4PSXA 2FE7A 4E2AA 2GANA 5J8CA 5IB0A 4MBUA 2VQYA 4MI4A 1Z9UA 1IYLA 1QSNA 3NE7A 4CRZB 3R9FA 2B3UA 3DNSA 3H4QA 4F6AA 4KUBA 3FBUA 4UWJA 3GY9A 2ZW6A 1K4JA 1J4JA 4KVME 1NE9A 2B4DA 3SHPA 4R3LA 2VZZA 1BO4A 1MJAA 5FVJA 2CY2A 2PC1A 2FCKA 2Q44A 2PR8A 3S6GA 1NMTA 1P4NA 2BSWA 3FXTA 3KKWA 3F5BA 3BJ8A 1S7FA 2A4NA 2Z0ZA 4R57A 1WK4A 4QVTA 2Q7BA 4FD4A 1KUVA 1KUXA 3BJ7A 2QIRA 2Z10A 1XE4A 2P6FA 5KTCA 2PR1A 4K30A 4OLLA 1M4IA 2HQYA 4CS0B 3FNCA 2OU2A 2G3TA 1YK3A 1XF8A 2Q4YA 2AJ6A 3R9EA 3TOBA 5I0CA 4NSQA 3G3SA 5J8FA 2B4BA 2PQ8A 2FS5A 4B5OA 3TO6A 2HUZA 3R9GA 3F8KA 2G3AA 4HNXB 4NCZA 4XNHC 3UY5A 2Y0MA 4HKFA 3EY5A 5GCNA 3PZJA 3P2HA 1YLEA 1YX0A 3FYNA 4AVAA 2FSRA 2AE6A 1S60A 2JEVA 2PDOA 4R3KA 1Z4EA 2VEZA 2OZHA 4PK2A 1L0CA 4KOYA 2IL4A 3C26A 1RO5A 2WPWA 4JD6A 2ZW5A 4MHDA 4QUSA 2QMLA 1XEBA 3EO4A 2NMTA 3CXQA 3D2PA 1N71A 5EC4A 5IX3A 4J3GA 4FD7A 1S7LA 1YGHA 2Q4VA 1M1DA 3VWEA 2BUEA 4B5PB 2P0WA 3W6SA 2JDCA 4JLYA 2ZXVA 5EBVA 2FT0A 2P6EA 2FIWA 3TFYA 4M85A 1IYKA 1XMTA 2B5GB 2Q0YA 4OADA 3P2FA 3TT2A 3ZJ0A 4OAEA 4KORA 3RYOA 2VZYA 2G0BA 5IV0A 1PU9A 1I1DA 5JPHA 4U5YA 2EUIA 4ONUA 4YGOA 3T90A 2PRBA 2B3VA 2ZPAA 4NF1A 3F0AA 2BEIA 5F46A 2H5MA 4L89A 3TOAA 4I49A 4ORFA 5C82A 3S6FA 2WPXA 1WWZA 2J8NA 3CXSA 3T9YA 1TIQA 2F5IA 1XIXA 1VHSA 4QC6A 3FB3A 3LD2A 4M3SA 3DSBA 1S5KA 4KOXA 3EFAA 4YRHA 4UA3A 2Z11A 1I21A 4KOWA 4IF5A 2REEA 1VKCA 4JXQA 4XPDB 1Y7RA 3JVNA 1QSTA 4YFJA 2R98A 3TE4A 3B8GA 4BMHA 1B6BA 2R8VA 4B5PA 1Y9KA 2Q04A 2X7BA 4H89A 1SQHA 2J8MA 3DR8A 1Z4RA 3N7ZA 3G8WA 5CNPA 3S6HA 1ON0A 5F47A 5H86A 1Q2DA 4KLWA 4MY0A 2B5GA 4II9A 2GE3A 3R95A 4UWIA 2D4PA 2KCWA 1S7NA 4QBJA 5ISVA 4R87A 1QSOA 1LRZA 2PSWA 3SXNA 4E0AA 1CJWA 2P6GA 3DDDA 3MGDA 3TCVA 4PSWA 2I79A 3DR6A 4KVXA 4KUAA 3TO9A 5DWNA 3FRMA 4X5KA 2FXFA 3IWGA 1U6MA 4QB9A 3SXOA 4XPKA 4U9ZA 4GS4A 5KTAA 3EXNA 4HNWB 1CM0A 5JQ4A 4LX9A 4KOUA 1QSMA 4AB7A 5C88A 4KOVA 4RS2A 2EVNA 1YVKA 3PP9A 5HH1A 3E0KA 2O28A 4PV6A 1NSLA 1IIDA 1PUAA 5KTDA 5DWMA 3BLNA 1P0HA 1IICA 4KZTA 1Q2YA 1M44A 1YVOA 2ARHA 3LODA 3VWDA 4HNYB 3D8PA 3W6XA 2ATRA 2OB0A 4FD6A 1M4DA 3QAHA 2FL4A 3GKRA 2OH1A 2FIAA 2VXKA 4JJXA 3S6KA 4EVYA 4H6UA 4MY3A 1R57A 5F49A 4XPLA 1YR0A 4UBRA 4H6ZA 4E8OA 4RI1A 2B58A 3PGPA 1IB1E 3WR7A 3TO7A 2CNTA 4MJ8A 2HV2A 1MJ9A 1KUYA 1MJBA 3V8IA 4NEXA 4KOTA 4AG7A 4CAXA 2J8RA 3TTHA 3GYAA 4AVBA 4L8AA 4CAWA 2CNSA 1FY7A 1B87A 4KOSA 3R1KA 4XNHB 1V0CA 5F48A 1RXTA 2C27A 4Y49B 1UFHA 1Q2CA 3D3SA 4PK3A 3K9UA 2K5TA 4FD5A 4R9MA 2ZW4A 2JLMA 4KVOE 3W91A 4DNCA 4KLVA 5E96A 4NXYA 2OZGA 1QSRA 2ZW7A 2B4DB 3FIXA 2R7HA 3OWCA 2CNMA 2VI7A 4LUAA 1M4GA 4XPDC 3D2MA 4Y49C 4ZBGA 4CAVA 1MK4A 4IUSA 2GIVA 2JDDA 2RC4A 4F0YA 1I12A 4JXRA 3QB8A 1YREA 3IGRA 3I3GA 4U9YA 5H84A 3CXPA 1S3ZA 4AG9A 4AVCA 2REFA 1Y9WA 3EC4A 1BOBA 4CRYB 3R96A 2VBQA 3JUWA 1S7KA 2BL1A
chains in the Genus database with same CATH superfamily
2YNEA 2QECA 3I9SA 1GHEA 1KZFA 2EK9A 3IU1A 5THWA 2DXQA 3H8FA 1FNOA 4EFDA 4MMOA 2I00A 4Q36A 2R1IA 4F9UA 2OZUA 1F57A 3JTKA 3ZZIA 5HMNA 3B7IA 2PVWA 1ARLA 2D4OA 4TNUA 5K8MA 1OZPA 4H2KA 4JWPA 4PSXA 2O53A 2FE7A 4E2AA 4NGSA 2GANA 3BXMA 3PFEA 4G1PA 4ONWA 4MRIA 5J8CA 5IB0A 5A28A 4OC3A 4MBUA 2VQYA 4MI4A 4MHYA 1Z9UA 4NFRA 1IOFA 1IYLA 1QSNA 2QJ8A 4UFXA 1Z8WA 4FAIA 3NE7A 4CRZB 4RUHA 3D7FA 3R9FA 2B3UA 2WYRA 3DNSA 3H4QA 4F6AA 4KUBA 1BLLE 3FBUA 5G20A 4Z65A 4MCSA 4P10A 1TKHA 3GY9A 2ZW6A 3KR5A 4UWJA 4C68A 1K4JA 2OOTA 1J4JA 3JRUA 4KVME 1NE9A 2ZEPA 2B4DA 1XMBA 3SHPA 4TWEA 2PVVA 4R3LA 2VZZA 1BO4A 5F09A 1MJAA 4NGQA 5FVJA 1TF8A 2CY2A 2PC1A 2CXAA 1DTDA 4MCQA 2EK8A 3D7GA 2FCKA 2YNDA 4M6IA 4NJQA 4B13A 2Q44A 2PR8A 3S6GA 1TKJA 1NMTA 1P4NA 2BSWA 3WC5A 3FXTA 3KKWA 1F2PA 3PB4X 3F5BA 3BJ8A 3FEEA 4B6ZA 1S7FA 3SI2A 4P4EA 2A4NA 2GFQA 2Z0ZA 3D4UA 3KHXA 1VGYA 4X2TA 2V8GA 1XFOA 4A30A 2YGWA 3CT9A 4R57A 3LWUA 1WK4A 1ZO0A 2C1CA 4QVTA 1RTQA 2ZEDA 4NJRA 2YNCC 4P4DA 2Q7BA 1PYTB 4DJLA 1YSJA 4FD4A 4CYOA 1BAVA 1KUVA 1KUXA 3BJ7A 2QIRA 1CG2A 2NYQA 2Z10A 1XE4A 3KQXA 4K3NA 2P6FA 4W9YA 2EWBA 5KTCA 2PR1A 4K30A 2AFMA 2AFOA 3K9TA 4NGRA 5G22A 3RO0A 4CAFA 4JZ0A 4OLLA 1M4IA 4B10A 2PCUA 4B12A 3S9LA 3DLJA 2HQYA 4CS0B 3FNCA 2PJ4A 2OU2A 3SI1A 2PJCA 2I3CA 1Y7EA 2G3TA 1YK3A 2ZEHA 1XF8A 1YQEA 2Q4YA 2AJ6A 4R8FA 3R9EA 2PJ0A 3TOBA 5I0CA 4NSQA 3G3SA 3IWWA 3CPAA 4KSFA 3PB7X 5J8FA 1NSAA 2B4BA 2BCOA 2PQ8A 4C2ZA 2FS5A 5CBMA 3PEIA 4B5OA 3TO6A 2GLFA 3V7ZA 4BD9A 2HUZA 3R9GA 3F8KA 2G3AA 4HNXB 4NCZA 4XNHC 3T8WA 3UY5A 1CPSA 1ZG9A 4KSAA 4CYPA 1BPNA 2Y0MA 4HKFA 5A27A 3DGVA 3L2NA 3EY5A 5GCNA 3PZJA 3VATA 3P2HA 1YLEA 4YWYA 1YX0A 3FYNA 4LQGA 4AVAA 5JGFA 2FSRA 4NGTA 1IGBA 2AE6A 1S60A 2JEVA 2PDOA 5G21A 3CPXA 4PXEA 2Z3OA 5D29A 1Y0YA 4R3KA 3WC6A 1Z4EA 2PJ9A 2VEZA 3B3SA 4UIAA 4CGOA 2IMOA 3D67A 4KS9A 2OZHA 4PK2A 4EWTA 1VIXA 1L0CA 4P44A 4KOYA 3PBEA 3PRTA 2IL4A 3S9NA 3C26A 1PCAA 1RO5A 2WPWA 4JD6A 2ZW5A 4MHDA 3GLJA 4QUSA 2QMLA 1ZG7A 5LRGA 1LANA 1XEBA 3EO4A 2NMTA 3SJXA 3CXQA 3D2PA 1AMPA 1N71A 4PQAA 5EC4A 6CPAA 1VHEA 2DEAA 2HC9A 5IX3A 4J3GA 2QVPA 4FD7A 1S7LA 1YGHA 1Z2LA 3IC1A 3PB9X 2WSAA 2Q4VA 4PXDA 1M1DA 5LRKA 1AYEA 3CZXA 4OIWA 4OP4A 1TKFA 3VWEA 2BUEA 2RB7A 3PFOA 4B5PB 2P0WA 2DPSA 3W6SA 2JDCA 4JLYA 1OBRA 2ZXVA 5EBVA 2BO9A 1BPMA 4A33A 3B3VA 4O23A 1YW4A 2FT0A 2P6EA 5CPAA 3KASA 2Q51A 2FIWA 3TFYA 4M85A 1IYKA 1ZLIA 5DS0A 4CGNA 3PBBA 3FVLA 3H8EA 1XMTA 2B5GB 2Q0YA 5AG5A 3SJEA 1CBXA 4HPSA 3KHZA 4OADA 5K8OA 4GM5A 3PB6X 1Y0RA 3P2FA 3QNVA 2ZENA 3TT2A 2DF5A 3HLPA 4B11A 4A37A 3ZJ0A 1IY7A 4OAEA 4KORA 2EBJA 3RYOA 2VZYA 2G0BA 4R76A 5IV0A 1PU9A 4F0XA 3B3WA 1I1DA 5JPHA 3KZWA 4MFKA 4U5YA 4OC5A 2EUIA 2PJ3A 4A94A 2GU2A 5LRJA 4ONUA 4KSIA 4YGOA 4ZGYB 2NSMA 2GREA 3T90A 2PRBA 5J1QA 2B3VA 2ZPAA 4F9VA 2PIYA 3TC8A 4A38A 4NF1A 1ELLP 2XEIA 3S6FA 5AGEA 2PJ5A 3F0AA 2AFZA 4UFVA 3H8GA 4UIBA 2BEIA 4X8IA 5AG4A 5F46A 2H5MA 3MN8A 2ANPA 4L89A 4MHNA 3TOAA 4I49A 2ZEEA 4ORFA 4CAEA 3D7DA 2CTCA 2AFSA 2OR4A 4P4JA 3GB0A 2WPXA 1WWZA 4OKOA 1LOKA 1FT7A 3D68A 3NA6A 4C7IA 2J8NA 3CXSA 3T9YA 1TIQA 3B2YA 5LYIA 4EMEA 2F5IA 1XIXA 1VHSA 4QC6A 3KI9A 1F2OA 4WWVA 3FB3A 3LD2A 4M3SA 3DSBA 1S5KA 4IK2A 4KOXA 3EFAA 3IFEA 2AFUA 3VARA 4YRHA 1HEEA 1LAPA 2C6GA 3FJUA 2EO8A 3CDXA 4UA3A 5JM6A 2AFXA 2Z11A 1I21A 4CYNA 3FH4A 4IF5A 4KOWA 2O4HA 2REEA 1VKCA 4JXQA 3RBUA 3ISXA 4XPDB 1Y7RA 3JVNA 3SJFA 1QSTA 4UCMA 2PJ2A 3IU2A 2R98A 3QAYA 4MCPA 3V38A 4YFJA 3TE4A 3KL9A 2PJ8A 3SJGA 2PJ6A 4ZY1A 1XJOA 3B8GA 5AG6A 4BMHA 1B6BA 2R8VA 4DUKA 4B5PA 5ELYA 1Y9KA 2Q04A 2X7BA 4H89A 1AUGA 2Z3KA 1SQHA 2J8MA 3FX6A 3DR8A 1Z4RA 3N7ZA 4ZY2A 5EMIA 3G8WA 5CNPA 3S6HA 3IWEA 1ON0A 3MRUA 4OC2A 5F47A 2AFWA 2JBJA 1Q2DA 2ZEOA 5H86A 1H8LA 2ZEGA 4C2XA 1Z5RA 2C6CA 4KLWA 4MY0A 3D7HA 1A2ZA 2B5GA 4II9A 2ZOFA 5D8NA 2GE3A 2FVGA 3B3TA 3LACA 3BI0A 1GYTA 4MFQA 3R95A 4UWIA 2DPTA 2D4PA 4NGMA 1Z8TA 2KCWA 4MCRA 5AG7A 1Z8XA 3N5FA 2PJAA 1S7NA 3HUVA 1XRYA 4BBHA 1ZLHA 4QBJA 5ISVA 4R87A 1QSOA 4PPZA 1LRZA 5IB9A 1M4LA 2PSWA 2WUUA 3KQZA 2C6PA 2CTBA 3SXNA 4E0AA 1CJWA 4OC4A 2P6GA 3DDDA 4ZX9A 5BWAB 1VHOA 3MGDA 1Q7LA 4A31A 5LYLA 4OMEA 3TCVA 4PSWA 2I79A 3DR6A 4KVXA 4KUAA 2JBKA 3TO9A 2Q7SA 4C7HA 5DWNA 4B14A 3FRMA 4X5KA 2ZOGA 4ZY0A 4FBEA 2FXFA 3B3CA 4DYOA 3IWGA 4FUUA 1U6MA 4QB9A 1X10A 3SXOA 1XBUA 2F8HA 4GXHA 1XOVA 4XPKA 1YLOA 4ZYQA 4X3RA 4U9ZA 3BI1A 3PB8X 4GS4A 4OIDA 5KTAA 3EXNA 4HNWB 2Z3NA 4UCNA 4Q38A 8CPAA 2HB6A 4MFPA 1CM0A 5JQ4A 4LX9A 4KOUA 1ARMA 1QSMA 3WC7A 4OC1A 4AB7A 5C88A 4KOVA 4NGPA 1CPXA 4NGNA 4RS2A 4FWUA 2EVNA 1TF9A 1YVKA 3PP9A 5HH1A 3E0KA 4A2ZA 1CP6A 3FMCA 4UEZA 2O28A 3TX8A 4PV6A 4UF4A 1NSLA 1IIDA 1PUAA 3NE8A 4CGMA 5KTDA 5DWMA 3BLNA 1P0HA 4C2YA 4MHPA 1IICA 4KZTA 1Q2YA 3H5ZA 1M44A 1YVOA 2ARHA 3LODA 3VWDA 3RNZA 4HNYB 4A32A 5LYDA 3D8PA 1IU8A 3D66A 3VH9A 3W6XA 3IIBA 2ATRA 2OB0A 4FD6A 4A39A 1M4DA 3QAHA 2FL4A 4A95A 2IQ6A 5HVHA 3GKRA 5K8NA 2OH1A 2FIAA 2Q4ZA 2VXKA 2PJBA 4R6TA 4JJXA 4ZX8A 3S6KA 4H6UA 4EVYA 5C82A 4MFZA 4P6YA 3IO1A 4MY3A 3WT4A 1R57A 5F49A 1YMEA 4XPLA 1YR0A 4UBRA 2V8DA 4H6ZA 2F7VA 4E8OA 4RI1A 2B58A 4IAVA 3PGPA 4MFJA 1JWQA 2QYVA 1UWYA 2J9AA 1IB1E 1HDQA 2V8VA 2Z3PA 3WR7A 4UEEA 3TO7A 2ZELA 4UFWA 4UCPA 2CNTA 3WABA 4MJ8A 4ZI6A 2HV2A 1KWMA 1ZG8A 1MJ9A 4JYWA 1KUYA 1HDUA 1MJBA 2G9DA 4P4FA 3V8IA 4NEXA 4CPAA 3K2KA 4KOTA 3FF3A 4AG7A 3GIUA 4CAXA 3ISZA 2J8RA 3TTHA 1LCPA 3GYAA 4L8AA 4RN7A 5HVFA 4AVBA 5K8PA 4CAWA 5HVGA 2BOAA 4WJBA 2CNSA 1IOIA 1FY7A 2PIZA 3IJ3A 1B87A 1R3NA 2PE3A 3R1KA 4KOSA 4YU9A 4XNHB 1V0CA 2XEGA 5F48A 1RXTA 2JEWA 2C27A 4LQ6A 4Y49B 1UFHA 2POKA 3A9LA 3BHXA 5G1ZA 1EE3P 1Q2CA 4P4BA 4MHZA 2CF4A 4MFLA 3D3SA 3NH5A 4PK3A 2WZNA 3K9UA 1QMUA 3FEDA 2K5TA 3SI0A 2XEJA 3KR4A 4FD5A 4R9MA 3NH4A 2ZW4A 2JLMA 2VL1A 4KVOE 4PXCA 3W91A 4DNCA 4KLVA 2RFHA 5E96A 5LYFA 4NXYA 2OZGA 1QSRA 4F8ZA 7CPAA 2ZW7A 4R7MA 1X12A 2B4DB 3FECA 1R43A 3FIXA 2R7HA 3I1UA 3OWCA 2CNMA 2PJ7A 4P45A 4CGPA 2V8HA 2VI7A 4LUAA 1YW6A 1M4GA 4OC0A 2PJ1A 2ZEMA 5HXDA 3RAMA 1LAMA 4MXUA 4XPDC 1JQGA 1DE4C 2V77A 1QQ9A 3GUXA 3D2MA 4Y49C 4ZBGA 4CAVA 1MK4A 4IUSA 2GIVA 3RZAA 4CYQA 3S9MA 3NH8A 2JDDA 2ODFA 4M6HA 2IJZA 1ELMP 2RC4A 3IEHA 1TXRA 4PXBA 2Q43A 1I12A 4JXRA 3QB8A 4P4IA 4F0YA 1YREA 1Z8LA 1CX8A 3B35A 4CGLA 3LMSA 3IGRA 4M6GA 3I3GA 4U9YA 5JH9A 2YNCA 5H84A 3CXPA 4UEFA 1S3ZA 2CIJA 2XEFA 2Z3MA 4AG9A 2GLJA 4AVCA 5I4MA 2REFA 1Y9WA 3NFZA 3KGQA 4Q7AA 1CP7A 2ZEFA 3EC4A 1BOBA 4AXVA 3R96A 4CRYB 4IHMA 2PRQA 2Z3LA 2VBQA 1LFWA 4BINA 2ABZA 3JUWA 1S7KA 2BL1A
chains in the Genus database with same CATH topology
2YNEA 2QECA 3I9SA 1GHEA 1KZFA 3IU1A 2DXQA 2I00A 4Q36A 2R1IA 2OZUA 3JTKA 3ZZIA 5HMNA 2D4OA 1OZPA 4JWPA 4PSXA 2FE7A 4E2AA 2GANA 5J8CA 5IB0A 5A28A 4MBUA 2VQYA 4MI4A 1Z9UA 1IYLA 1QSNA 4UFXA 3NE7A 4CRZB 3R9FA 2B3UA 3DNSA 3H4QA 4F6AA 4KUBA 3FBUA 5G20A 4UWJA 3GY9A 4C68A 2ZW6A 1K4JA 1J4JA 4KVME 1NE9A 2B4DA 3SHPA 4R3LA 2VZZA 1BO4A 1MJAA 5FVJA 2CY2A 2PC1A 2CXAA 2FCKA 2YNDA 4B13A 2Q44A 2PR8A 3S6GA 1NMTA 1P4NA 2BSWA 3FXTA 3KKWA 3F5BA 3BJ8A 1S7FA 2A4NA 2Z0ZA 4A30A 2YGWA 4R57A 1WK4A 1ZO0A 4QVTA 2Q7BA 2YNCC 4FD4A 4CYOA 1KUVA 1KUXA 3BJ7A 2QIRA 2Z10A 1XE4A 2P6FA 5KTCA 2PR1A 4K30A 5G22A 4CAFA 4OLLA 1M4IA 4B10A 4B12A 2HQYA 4CS0B 3FNCA 2OU2A 2G3TA 1YK3A 1XF8A 2Q4YA 2AJ6A 3R9EA 3TOBA 5I0CA 4NSQA 3G3SA 4KSFA 5J8FA 2B4BA 2PQ8A 2FS5A 4B5OA 3TO6A 2HUZA 3R9GA 3F8KA 2G3AA 4HNXB 4NCZA 4XNHC 3UY5A 4KSAA 4CYPA 2Y0MA 4HKFA 5A27A 3EY5A 5GCNA 3PZJA 3P2HA 1YLEA 1YX0A 3FYNA 4AVAA 2FSRA 2AE6A 1S60A 2JEVA 2PDOA 5G21A 2Z3OA 4R3KA 1Z4EA 2VEZA 4CGOA 4KS9A 2OZHA 4PK2A 1L0CA 4KOYA 2IL4A 3C26A 1RO5A 2WPWA 4JD6A 2ZW5A 4MHDA 4QUSA 2QMLA 1XEBA 3EO4A 2NMTA 3CXQA 3D2PA 1N71A 5EC4A 5IX3A 4J3GA 4FD7A 1S7LA 1YGHA 2WSAA 2Q4VA 1M1DA 3VWEA 2BUEA 4B5PB 2P0WA 2DPSA 3W6SA 2JDCA 4JLYA 2ZXVA 5EBVA 4A33A 2FT0A 2P6EA 2FIWA 3TFYA 4M85A 1IYKA 4CGNA 1XMTA 2B5GB 2Q0YA 5AG5A 4OADA 3P2FA 3TT2A 4B11A 3ZJ0A 4OAEA 4KORA 3RYOA 2VZYA 2G0BA 5IV0A 1PU9A 1I1DA 5JPHA 4MFKA 4U5YA 2EUIA 4ONUA 4YGOA 4ZGYB 3T90A 2PRBA 2B3VA 2ZPAA 4NF1A 5AGEA 3F0AA 4UFVA 5AG4A 2BEIA 5F46A 2H5MA 4L89A 3TOAA 4I49A 4ORFA 4CAEA 4F0XA 3S6FA 4C2ZA 4C2XA 2WPXA 1WWZA 4C7IA 5C82A 2J8NA 3CXSA 3T9YA 1TIQA 2F5IA 1XIXA 1VHSA 4QC6A 3FB3A 3LD2A 4M3SA 3DSBA 1S5KA 4KOXA 3EFAA 4YRHA 4UA3A 2Z11A 1I21A 4CYNA 4KOWA 4IF5A 2REEA 1VKCA 4JXQA 4XPDB 1Y7RA 3JVNA 1QSTA 4UCMA 3IU2A 2R98A 4YFJA 3TE4A 3B8GA 5AG6A 4BMHA 1B6BA 2R8VA 4B5PA 1Y9KA 2Q04A 2X7BA 4H89A 2Z3KA 1SQHA 2J8MA 3DR8A 1Z4RA 3N7ZA 3G8WA 5CNPA 3S6HA 3IWEA 1ON0A 5F47A 5H86A 1Q2DA 4KLWA 4MY0A 2B5GA 4II9A 2GE3A 4MFQA 3R95A 4UWIA 2DPTA 2D4PA 2KCWA 5AG7A 1S7NA 4BBHA 4QBJA 5ISVA 4R87A 1QSOA 1LRZA 2PSWA 2WUUA 3SXNA 4E0AA 1CJWA 2P6GA 3DDDA 5BWAB 3MGDA 4A31A 3TCVA 4PSWA 2I79A 3DR6A 4KVXA 4KUAA 3TO9A 4C7HA 5DWNA 4B14A 3FRMA 4X5KA 2FXFA 3IWGA 1U6MA 4QB9A 3SXOA 4XPKA 4U9ZA 4GS4A 5KTAA 3EXNA 4HNWB 2Z3NA 4UCNA 4Q38A 4MFPA 1CM0A 5JQ4A 4LX9A 4KOUA 1QSMA 4AB7A 5C88A 4KOVA 4RS2A 2EVNA 1YVKA 3PP9A 5HH1A 3E0KA 4A2ZA 2O28A 4PV6A 1NSLA 1IIDA 1PUAA 4CGMA 5KTDA 5DWMA 3BLNA 1P0HA 4C2YA 1IICA 4KZTA 1Q2YA 3H5ZA 1M44A 1YVOA 2ARHA 3LODA 3VWDA 4HNYB 4A32A 3D8PA 3W6XA 2ATRA 2OB0A 4FD6A 1M4DA 3QAHA 2FL4A 4A95A 3GKRA 2OH1A 2FIAA 2VXKA 4JJXA 3S6KA 4EVYA 4H6UA 4MFZA 4MY3A 1R57A 5F49A 4XPLA 1YR0A 4UBRA 4H6ZA 4E8OA 4RI1A 2B58A 3PGPA 4MFJA 1IB1E 2Z3PA 3WR7A 3TO7A 4UFWA 4UCPA 2CNTA 4MJ8A 2HV2A 1MJ9A 1KUYA 1MJBA 3V8IA 4NEXA 4KOTA 4AG7A 4CAXA 2J8RA 3TTHA 3GYAA 4AVBA 4L8AA 4CAWA 2CNSA 1FY7A 1B87A 4KOSA 3R1KA 4XNHB 1V0CA 5F48A 1RXTA 2C27A 4Y49B 1UFHA 3A9LA 5G1ZA 1Q2CA 4MFLA 3D3SA 4PK3A 3K9UA 2K5TA 4FD5A 4R9MA 2ZW4A 2JLMA 4KVOE 3W91A 4DNCA 4KLVA 5E96A 4NXYA 2OZGA 1QSRA 2ZW7A 2B4DB 3FIXA 2R7HA 3OWCA 2CNMA 4CGPA 2VI7A 4LUAA 1M4GA 4XPDC 3D2MA 4Y49C 4ZBGA 4CAVA 1MK4A 4IUSA 2GIVA 4CYQA 2JDDA 2RC4A 4F0YA 1I12A 4JXRA 3QB8A 1YREA 4CGLA 3IGRA 3I3GA 4U9YA 2YNCA 5H84A 3CXPA 1S3ZA 2Z3MA 4AG9A 4AVCA 2REFA 1Y9WA 3EC4A 1BOBA 4CRYB 3R96A 2Z3LA 2VBQA 3JUWA 1S7KA 2BL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEC A;  3I9S A;  1GHE A;  1KZF A;  2DXQ A;  2I00 A;  2R1I A;  2OZU A;  3ZZI A;  5HMN A;  2D4O A;  1OZP A;  4JWP A;  4PSX A;  2FE7 A;  4E2A A;  2GAN A;  5J8C A;  5IB0 A;  4MBU A;  2VQY A;  4MI4 A;  1Z9U A;  1IYL A;  1QSN A;  3NE7 A;  4CRZ B;  3R9F A;  2B3U A;  3DNS A;  3H4Q A;  4F6A A;  4KUB A;  3FBU A;  4UWJ A;  3GY9 A;  2ZW6 A;  1K4J A;  1J4J A;  4KVM E;  1NE9 A;  2B4D A;  3SHP A;  4R3L A;  2VZZ A;  1BO4 A;  1MJA A;  5FVJ A;  2CY2 A;  2PC1 A;  2FCK A;  2Q44 A;  2PR8 A;  3S6G A;  1NMT A;  1P4N A;  2BSW A;  3FXT A;  3KKW A;  3F5B A;  3BJ8 A;  1S7F A;  2A4N A;  2Z0Z A;  4R57 A;  1WK4 A;  4QVT A;  2Q7B A;  4FD4 A;  1KUV A;  1KUX A;  3BJ7 A;  2QIR A;  2Z10 A;  1XE4 A;  2P6F A;  5KTC A;  2PR1 A;  4K30 A;  4OLL A;  1M4I A;  2HQY A;  4CS0 B;  3FNC A;  2OU2 A;  2G3T A;  1YK3 A;  1XF8 A;  2Q4Y A;  2AJ6 A;  3R9E A;  3TOB A;  5I0C A;  4NSQ A;  3G3S A;  5J8F A;  2B4B A;  2PQ8 A;  2FS5 A;  4B5O A;  3TO6 A;  2HUZ A;  3R9G A;  3F8K A;  2G3A A;  4HNX B;  4NCZ A;  4XNH C;  3UY5 A;  2Y0M A;  4HKF A;  3EY5 A;  5GCN A;  3PZJ A;  3P2H A;  1YLE A;  1YX0 A;  3FYN A;  4AVA A;  2FSR A;  2AE6 A;  1S60 A;  2JEV A;  2PDO A;  4R3K A;  1Z4E A;  2VEZ A;  2OZH A;  4PK2 A;  1L0C A;  4KOY A;  2IL4 A;  3C26 A;  1RO5 A;  2WPW A;  4JD6 A;  2ZW5 A;  4MHD A;  4QUS A;  2QML A;  1XEB A;  3EO4 A;  2NMT A;  3CXQ A;  3D2P A;  1N71 A;  5EC4 A;  5IX3 A;  4J3G A;  4FD7 A;  1S7L A;  1YGH A;  2Q4V A;  1M1D A;  3VWE A;  2BUE A;  4B5P B;  2P0W A;  3W6S A;  2JDC A;  4JLY A;  2ZXV A;  5EBV A;  2FT0 A;  2P6E A;  2FIW A;  3TFY A;  4M85 A;  1IYK A;  1XMT A;  2B5G B;  2Q0Y A;  4OAD A;  3P2F A;  3TT2 A;  3ZJ0 A;  4OAE A;  4KOR A;  3RYO A;  2VZY A;  2G0B A;  5IV0 A;  1PU9 A;  1I1D A;  5JPH A;  4U5Y A;  2EUI A;  4ONU A;  4YGO A;  3T90 A;  2PRB A;  2B3V A;  2ZPA A;  4NF1 A;  3F0A A;  2BEI A;  5F46 A;  2H5M A;  4L89 A;  3TOA A;  4I49 A;  4ORF A;  5C82 A;  3S6F A;  2WPX A;  1WWZ A;  2J8N A;  3CXS A;  3T9Y A;  1TIQ A;  2F5I A;  1XIX A;  1VHS A;  4QC6 A;  3FB3 A;  3LD2 A;  4M3S A;  3DSB A;  1S5K A;  4KOX A;  3EFA A;  4YRH A;  4UA3 A;  2Z11 A;  1I21 A;  4KOW A;  4IF5 A;  2REE A;  1VKC A;  4JXQ A;  4XPD B;  1Y7R A;  3JVN A;  1QST A;  4YFJ A;  2R98 A;  3TE4 A;  3B8G A;  4BMH A;  1B6B A;  2R8V A;  4B5P A;  1Y9K A;  2Q04 A;  2X7B A;  4H89 A;  1SQH A;  2J8M A;  3DR8 A;  1Z4R A;  3N7Z A;  3G8W A;  5CNP A;  3S6H A;  1ON0 A;  5F47 A;  5H86 A;  1Q2D A;  4KLW A;  4MY0 A;  2B5G A;  4II9 A;  2GE3 A;  3R95 A;  4UWI A;  2D4P A;  2KCW A;  1S7N A;  4QBJ A;  5ISV A;  4R87 A;  1QSO A;  1LRZ A;  2PSW A;  3SXN A;  4E0A A;  1CJW A;  2P6G A;  3DDD A;  3MGD A;  3TCV A;  4PSW A;  2I79 A;  3DR6 A;  4KVX A;  4KUA A;  3TO9 A;  5DWN A;  3FRM A;  4X5K A;  2FXF A;  3IWG A;  1U6M A;  4QB9 A;  3SXO A;  4XPK A;  4U9Z A;  4GS4 A;  5KTA A;  3EXN A;  4HNW B;  1CM0 A;  5JQ4 A;  4LX9 A;  4KOU A;  1QSM A;  4AB7 A;  5C88 A;  4KOV A;  4RS2 A;  2EVN A;  1YVK A;  3PP9 A;  5HH1 A;  3E0K A;  2O28 A;  4PV6 A;  1NSL A;  1IID A;  1PUA A;  5KTD A;  5DWM A;  3BLN A;  1P0H A;  1IIC A;  4KZT A;  1Q2Y A;  1M44 A;  1YVO A;  2ARH A;  3LOD A;  3VWD A;  4HNY B;  3D8P A;  3W6X A;  2ATR A;  2OB0 A;  4FD6 A;  1M4D A;  3QAH A;  2FL4 A;  3GKR A;  2OH1 A;  2FIA A;  2VXK A;  4JJX A;  3S6K A;  4EVY A;  4H6U A;  4MY3 A;  1R57 A;  5F49 A;  4XPL A;  1YR0 A;  4UBR A;  4H6Z A;  4E8O A;  4RI1 A;  2B58 A;  3PGP A;  1IB1 E;  3WR7 A;  3TO7 A;  2CNT A;  4MJ8 A;  2HV2 A;  1MJ9 A;  1KUY A;  1MJB A;  3V8I A;  4NEX A;  4KOT A;  4AG7 A;  4CAX A;  2J8R A;  3TTH A;  3GYA A;  4AVB A;  4L8A A;  4CAW A;  2CNS A;  1FY7 A;  1B87 A;  4KOS A;  3R1K A;  4XNH B;  1V0C A;  5F48 A;  1RXT A;  2C27 A;  4Y49 B;  1UFH A;  1Q2C A;  3D3S A;  4PK3 A;  3K9U A;  2K5T A;  4FD5 A;  4R9M A;  2ZW4 A;  2JLM A;  4KVO E;  3W91 A;  4DNC A;  4KLV A;  5E96 A;  4NXY A;  2OZG A;  1QSR A;  2ZW7 A;  2B4D B;  3FIX A;  2R7H A;  3OWC A;  2CNM A;  2VI7 A;  4LUA A;  1M4G A;  4XPD C;  3D2M A;  4Y49 C;  4ZBG A;  4CAV A;  1MK4 A;  4IUS A;  2GIV A;  2JDD A;  2RC4 A;  4F0Y A;  1I12 A;  4JXR A;  3QB8 A;  1YRE A;  3IGR A;  3I3G A;  4U9Y A;  5H84 A;  3CXP A;  1S3Z A;  4AG9 A;  4AVC A;  2REF A;  1Y9W A;  3EC4 A;  1BOB A;  4CRY B;  3R96 A;  2VBQ A;  3JUW A;  1S7K A;  2BL1 A; 
#chains in the Genus database with same CATH topology
 2YNE A;  2QEC A;  3I9S A;  1GHE A;  1KZF A;  2EK9 A;  3IU1 A;  5THW A;  2DXQ A;  3H8F A;  1FNO A;  4EFD A;  4MMO A;  2I00 A;  4Q36 A;  2R1I A;  4F9U A;  2OZU A;  1F57 A;  3JTK A;  3ZZI A;  5HMN A;  3B7I A;  2PVW A;  1ARL A;  2D4O A;  4TNU A;  5K8M A;  1OZP A;  4H2K A;  4JWP A;  4PSX A;  2O53 A;  2FE7 A;  4E2A A;  4NGS A;  2GAN A;  3BXM A;  3PFE A;  4G1P A;  4ONW A;  4MRI A;  5J8C A;  5IB0 A;  5A28 A;  4OC3 A;  4MBU A;  2VQY A;  4MI4 A;  4MHY A;  1Z9U A;  4NFR A;  1IOF A;  1IYL A;  1QSN A;  2QJ8 A;  4UFX A;  1Z8W A;  4FAI A;  3NE7 A;  4CRZ B;  4RUH A;  3D7F A;  3R9F A;  2B3U A;  2WYR A;  3DNS A;  3H4Q A;  4F6A A;  4KUB A;  1BLL E;  3FBU A;  5G20 A;  4Z65 A;  4MCS A;  4P10 A;  1TKH A;  3GY9 A;  2ZW6 A;  3KR5 A;  4UWJ A;  4C68 A;  1K4J A;  2OOT A;  1J4J A;  3JRU A;  4KVM E;  1NE9 A;  2ZEP A;  2B4D A;  1XMB A;  3SHP A;  4TWE A;  2PVV A;  4R3L A;  2VZZ A;  1BO4 A;  5F09 A;  1MJA A;  4NGQ A;  5FVJ A;  1TF8 A;  2CY2 A;  2PC1 A;  2CXA A;  1DTD A;  4MCQ A;  2EK8 A;  3D7G A;  2FCK A;  2YND A;  4M6I A;  4NJQ A;  4B13 A;  2Q44 A;  2PR8 A;  3S6G A;  1TKJ A;  1NMT A;  1P4N A;  2BSW A;  3WC5 A;  3FXT A;  3KKW A;  1F2P A;  3PB4 X;  3F5B A;  3BJ8 A;  3FEE A;  4B6Z A;  1S7F A;  3SI2 A;  4P4E A;  2A4N A;  2GFQ A;  2Z0Z A;  3D4U A;  3KHX A;  1VGY A;  4X2T A;  2V8G A;  1XFO A;  4A30 A;  2YGW A;  3CT9 A;  4R57 A;  3LWU A;  1WK4 A;  1ZO0 A;  2C1C A;  4QVT A;  1RTQ A;  2ZED A;  4NJR A;  2YNC C;  4P4D A;  2Q7B A;  1PYT B;  4DJL A;  1YSJ A;  4FD4 A;  4CYO A;  1BAV A;  1KUV A;  1KUX A;  3BJ7 A;  2QIR A;  1CG2 A;  2NYQ A;  2Z10 A;  1XE4 A;  3KQX A;  4K3N A;  2P6F A;  4W9Y A;  2EWB A;  5KTC A;  2PR1 A;  4K30 A;  2AFM A;  2AFO A;  3K9T A;  4NGR A;  5G22 A;  3RO0 A;  4CAF A;  4JZ0 A;  4OLL A;  1M4I A;  4B10 A;  2PCU A;  4B12 A;  3S9L A;  3DLJ A;  2HQY A;  4CS0 B;  3FNC A;  2PJ4 A;  2OU2 A;  3SI1 A;  2PJC A;  2I3C A;  1Y7E A;  2G3T A;  1YK3 A;  2ZEH A;  1XF8 A;  1YQE A;  2Q4Y A;  2AJ6 A;  4R8F A;  3R9E A;  2PJ0 A;  3TOB A;  5I0C A;  4NSQ A;  3G3S A;  3IWW A;  3CPA A;  4KSF A;  3PB7 X;  5J8F A;  1NSA A;  2B4B A;  2BCO A;  2PQ8 A;  4C2Z A;  2FS5 A;  5CBM A;  3PEI A;  4B5O A;  3TO6 A;  2GLF A;  3V7Z A;  4BD9 A;  2HUZ A;  3R9G A;  3F8K A;  2G3A A;  4HNX B;  4NCZ A;  4XNH C;  3T8W A;  3UY5 A;  1CPS A;  1ZG9 A;  4KSA A;  4CYP A;  1BPN A;  2Y0M A;  4HKF A;  5A27 A;  3DGV A;  3L2N A;  3EY5 A;  5GCN A;  3PZJ A;  3VAT A;  3P2H A;  1YLE A;  4YWY A;  1YX0 A;  3FYN A;  4LQG A;  4AVA A;  5JGF A;  2FSR A;  4NGT A;  1IGB A;  2AE6 A;  1S60 A;  2JEV A;  2PDO A;  5G21 A;  3CPX A;  4PXE A;  2Z3O A;  5D29 A;  1Y0Y A;  4R3K A;  3WC6 A;  1Z4E A;  2PJ9 A;  2VEZ A;  3B3S A;  4UIA A;  4CGO A;  2IMO A;  3D67 A;  4KS9 A;  2OZH A;  4PK2 A;  4EWT A;  1VIX A;  1L0C A;  4P44 A;  4KOY A;  3PBE A;  3PRT A;  2IL4 A;  3S9N A;  3C26 A;  1PCA A;  1RO5 A;  2WPW A;  4JD6 A;  2ZW5 A;  4MHD A;  3GLJ A;  4QUS A;  2QML A;  1ZG7 A;  5LRG A;  1LAN A;  1XEB A;  3EO4 A;  2NMT A;  3SJX A;  3CXQ A;  3D2P A;  1AMP A;  1N71 A;  4PQA A;  5EC4 A;  6CPA A;  1VHE A;  2DEA A;  2HC9 A;  5IX3 A;  4J3G A;  2QVP A;  4FD7 A;  1S7L A;  1YGH A;  1Z2L A;  3IC1 A;  3PB9 X;  2WSA A;  2Q4V A;  4PXD A;  1M1D A;  5LRK A;  1AYE A;  3CZX A;  4OIW A;  4OP4 A;  1TKF A;  3VWE A;  2BUE A;  2RB7 A;  3PFO A;  4B5P B;  2P0W A;  2DPS A;  3W6S A;  2JDC A;  4JLY A;  1OBR A;  2ZXV A;  5EBV A;  2BO9 A;  1BPM A;  4A33 A;  3B3V A;  4O23 A;  1YW4 A;  2FT0 A;  2P6E A;  5CPA A;  3KAS A;  2Q51 A;  2FIW A;  3TFY A;  4M85 A;  1IYK A;  1ZLI A;  5DS0 A;  4CGN A;  3PBB A;  3FVL A;  3H8E A;  1XMT A;  2B5G B;  2Q0Y A;  5AG5 A;  3SJE A;  1CBX A;  4HPS A;  3KHZ A;  4OAD A;  5K8O A;  4GM5 A;  3PB6 X;  1Y0R A;  3P2F A;  3QNV A;  2ZEN A;  3TT2 A;  2DF5 A;  3HLP A;  4B11 A;  4A37 A;  3ZJ0 A;  1IY7 A;  4OAE A;  4KOR A;  2EBJ A;  3RYO A;  2VZY A;  2G0B A;  4R76 A;  5IV0 A;  1PU9 A;  4F0X A;  3B3W A;  1I1D A;  5JPH A;  3KZW A;  4MFK A;  4U5Y A;  4OC5 A;  2EUI A;  2PJ3 A;  4A94 A;  2GU2 A;  5LRJ A;  4ONU A;  4KSI A;  4YGO A;  4ZGY B;  2NSM A;  2GRE A;  3T90 A;  2PRB A;  5J1Q A;  2B3V A;  2ZPA A;  4F9V A;  2PIY A;  3TC8 A;  4A38 A;  4NF1 A;  1ELL P;  2XEI A;  3S6F A;  5AGE A;  2PJ5 A;  3F0A A;  2AFZ A;  4UFV A;  3H8G A;  4UIB A;  2BEI A;  4X8I A;  5AG4 A;  5F46 A;  2H5M A;  3MN8 A;  2ANP A;  4L89 A;  4MHN A;  3TOA A;  4I49 A;  2ZEE A;  4ORF A;  4CAE A;  3D7D A;  2CTC A;  2AFS A;  2OR4 A;  4P4J A;  3GB0 A;  2WPX A;  1WWZ A;  4OKO A;  1LOK A;  1FT7 A;  3D68 A;  3NA6 A;  4C7I A;  2J8N A;  3CXS A;  3T9Y A;  1TIQ A;  3B2Y A;  5LYI A;  4EME A;  2F5I A;  1XIX A;  1VHS A;  4QC6 A;  3KI9 A;  1F2O A;  4WWV A;  3FB3 A;  3LD2 A;  4M3S A;  3DSB A;  1S5K A;  4IK2 A;  4KOX A;  3EFA A;  3IFE A;  2AFU A;  3VAR A;  4YRH A;  1HEE A;  1LAP A;  2C6G A;  3FJU A;  2EO8 A;  3CDX A;  4UA3 A;  5JM6 A;  2AFX A;  2Z11 A;  1I21 A;  4CYN A;  3FH4 A;  4IF5 A;  4KOW A;  2O4H A;  2REE A;  1VKC A;  4JXQ A;  3RBU A;  3ISX A;  4XPD B;  1Y7R A;  3JVN A;  3SJF A;  1QST A;  4UCM A;  2PJ2 A;  3IU2 A;  2R98 A;  3QAY A;  4MCP A;  3V38 A;  4YFJ A;  3TE4 A;  3KL9 A;  2PJ8 A;  3SJG A;  2PJ6 A;  4ZY1 A;  1XJO A;  3B8G A;  5AG6 A;  4BMH A;  1B6B A;  2R8V A;  4DUK A;  4B5P A;  5ELY A;  1Y9K A;  2Q04 A;  2X7B A;  4H89 A;  1AUG A;  2Z3K A;  1SQH A;  2J8M A;  3FX6 A;  3DR8 A;  1Z4R A;  3N7Z A;  4ZY2 A;  5EMI A;  3G8W A;  5CNP A;  3S6H A;  3IWE A;  1ON0 A;  3MRU A;  4OC2 A;  5F47 A;  2AFW A;  2JBJ A;  1Q2D A;  2ZEO A;  5H86 A;  1H8L A;  2ZEG A;  4C2X A;  1Z5R A;  2C6C A;  4KLW A;  4MY0 A;  3D7H A;  1A2Z A;  2B5G A;  4II9 A;  2ZOF A;  5D8N A;  2GE3 A;  2FVG A;  3B3T A;  3LAC A;  3BI0 A;  1GYT A;  4MFQ A;  3R95 A;  4UWI A;  2DPT A;  2D4P A;  4NGM A;  1Z8T A;  2KCW A;  4MCR A;  5AG7 A;  1Z8X A;  3N5F A;  2PJA A;  1S7N A;  3HUV A;  1XRY A;  4BBH A;  1ZLH A;  4QBJ A;  5ISV A;  4R87 A;  1QSO A;  4PPZ A;  1LRZ A;  5IB9 A;  1M4L A;  2PSW A;  2WUU A;  3KQZ A;  2C6P A;  2CTB A;  3SXN A;  4E0A A;  1CJW A;  4OC4 A;  2P6G A;  3DDD A;  4ZX9 A;  5BWA B;  1VHO A;  3MGD A;  1Q7L A;  4A31 A;  5LYL A;  4OME A;  3TCV A;  4PSW A;  2I79 A;  3DR6 A;  4KVX A;  4KUA A;  2JBK A;  3TO9 A;  2Q7S A;  4C7H A;  5DWN A;  4B14 A;  3FRM A;  4X5K A;  2ZOG A;  4ZY0 A;  4FBE A;  2FXF A;  3B3C A;  4DYO A;  3IWG A;  4FUU A;  1U6M A;  4QB9 A;  1X10 A;  3SXO A;  1XBU A;  2F8H A;  4GXH A;  1XOV A;  4XPK A;  1YLO A;  4ZYQ A;  4X3R A;  4U9Z A;  3BI1 A;  3PB8 X;  4GS4 A;  4OID A;  5KTA A;  3EXN A;  4HNW B;  2Z3N A;  4UCN A;  4Q38 A;  8CPA A;  2HB6 A;  4MFP A;  1CM0 A;  5JQ4 A;  4LX9 A;  4KOU A;  1ARM A;  1QSM A;  3WC7 A;  4OC1 A;  4AB7 A;  5C88 A;  4KOV A;  4NGP A;  1CPX A;  4NGN A;  4RS2 A;  4FWU A;  2EVN A;  1TF9 A;  1YVK A;  3PP9 A;  5HH1 A;  3E0K A;  4A2Z A;  1CP6 A;  3FMC A;  4UEZ A;  2O28 A;  3TX8 A;  4PV6 A;  4UF4 A;  1NSL A;  1IID A;  1PUA A;  3NE8 A;  4CGM A;  5KTD A;  5DWM A;  3BLN A;  1P0H A;  4C2Y A;  4MHP A;  1IIC A;  4KZT A;  1Q2Y A;  3H5Z A;  1M44 A;  1YVO A;  2ARH A;  3LOD A;  3VWD A;  3RNZ A;  4HNY B;  4A32 A;  5LYD A;  3D8P A;  1IU8 A;  3D66 A;  3VH9 A;  3W6X A;  3IIB A;  2ATR A;  2OB0 A;  4FD6 A;  4A39 A;  1M4D A;  3QAH A;  2FL4 A;  4A95 A;  2IQ6 A;  5HVH A;  3GKR A;  5K8N A;  2OH1 A;  2FIA A;  2Q4Z A;  2VXK A;  2PJB A;  4R6T A;  4JJX A;  4ZX8 A;  3S6K A;  4H6U A;  4EVY A;  5C82 A;  4MFZ A;  4P6Y A;  3IO1 A;  4MY3 A;  3WT4 A;  1R57 A;  5F49 A;  1YME A;  4XPL A;  1YR0 A;  4UBR A;  2V8D A;  4H6Z A;  2F7V A;  4E8O A;  4RI1 A;  2B58 A;  4IAV A;  3PGP A;  4MFJ A;  1JWQ A;  2QYV A;  1UWY A;  2J9A A;  1IB1 E;  1HDQ A;  2V8V A;  2Z3P A;  3WR7 A;  4UEE A;  3TO7 A;  2ZEL A;  4UFW A;  4UCP A;  2CNT A;  3WAB A;  4MJ8 A;  4ZI6 A;  2HV2 A;  1KWM A;  1ZG8 A;  1MJ9 A;  4JYW A;  1KUY A;  1HDU A;  1MJB A;  2G9D A;  4P4F A;  3V8I A;  4NEX A;  4CPA A;  3K2K A;  4KOT A;  3FF3 A;  4AG7 A;  3GIU A;  4CAX A;  3ISZ A;  2J8R A;  3TTH A;  1LCP A;  3GYA A;  4L8A A;  4RN7 A;  5HVF A;  4AVB A;  5K8P A;  4CAW A;  5HVG A;  2BOA A;  4WJB A;  2CNS A;  1IOI A;  1FY7 A;  2PIZ A;  3IJ3 A;  1B87 A;  1R3N A;  2PE3 A;  3R1K A;  4KOS A;  4YU9 A;  4XNH B;  1V0C A;  2XEG A;  5F48 A;  1RXT A;  2JEW A;  2C27 A;  4LQ6 A;  4Y49 B;  1UFH A;  2POK A;  3A9L A;  3BHX A;  5G1Z A;  1EE3 P;  1Q2C A;  4P4B A;  4MHZ A;  2CF4 A;  4MFL A;  3D3S A;  3NH5 A;  4PK3 A;  2WZN A;  3K9U A;  1QMU A;  3FED A;  2K5T A;  3SI0 A;  2XEJ A;  3KR4 A;  4FD5 A;  4R9M A;  3NH4 A;  2ZW4 A;  2JLM A;  2VL1 A;  4KVO E;  4PXC A;  3W91 A;  4DNC A;  4KLV A;  2RFH A;  5E96 A;  5LYF A;  4NXY A;  2OZG A;  1QSR A;  4F8Z A;  7CPA A;  2ZW7 A;  4R7M A;  1X12 A;  2B4D B;  3FEC A;  1R43 A;  3FIX A;  2R7H A;  3I1U A;  3OWC A;  2CNM A;  2PJ7 A;  4P45 A;  4CGP A;  2V8H A;  2VI7 A;  4LUA A;  1YW6 A;  1M4G A;  4OC0 A;  2PJ1 A;  2ZEM A;  5HXD A;  3RAM A;  1LAM A;  4MXU A;  4XPD C;  1JQG A;  1DE4 C;  2V77 A;  1QQ9 A;  3GUX A;  3D2M A;  4Y49 C;  4ZBG A;  4CAV A;  1MK4 A;  4IUS A;  2GIV A;  3RZA A;  4CYQ A;  3S9M A;  3NH8 A;  2JDD A;  2ODF A;  4M6H A;  2IJZ A;  1ELM P;  2RC4 A;  3IEH A;  1TXR A;  4PXB A;  2Q43 A;  1I12 A;  4JXR A;  3QB8 A;  4P4I A;  4F0Y A;  1YRE A;  1Z8L A;  1CX8 A;  3B35 A;  4CGL A;  3LMS A;  3IGR A;  4M6G A;  3I3G A;  4U9Y A;  5JH9 A;  2YNC A;  5H84 A;  3CXP A;  4UEF A;  1S3Z A;  2CIJ A;  2XEF A;  2Z3M A;  4AG9 A;  2GLJ A;  4AVC A;  5I4M A;  2REF A;  1Y9W A;  3NFZ A;  3KGQ A;  4Q7A A;  1CP7 A;  2ZEF A;  3EC4 A;  1BOB A;  4AXV A;  3R96 A;  4CRY B;  4IHM A;  2PRQ A;  2Z3L A;  2VBQ A;  1LFW A;  4BIN A;  2ABZ A;  3JUW A;  1S7K A;  2BL1 A; 
#chains in the Genus database with same CATH homology
 2YNE A;  2QEC A;  3I9S A;  1GHE A;  1KZF A;  3IU1 A;  2DXQ A;  2I00 A;  4Q36 A;  2R1I A;  2OZU A;  3JTK A;  3ZZI A;  5HMN A;  2D4O A;  1OZP A;  4JWP A;  4PSX A;  2FE7 A;  4E2A A;  2GAN A;  5J8C A;  5IB0 A;  5A28 A;  4MBU A;  2VQY A;  4MI4 A;  1Z9U A;  1IYL A;  1QSN A;  4UFX A;  3NE7 A;  4CRZ B;  3R9F A;  2B3U A;  3DNS A;  3H4Q A;  4F6A A;  4KUB A;  3FBU A;  5G20 A;  4UWJ A;  3GY9 A;  4C68 A;  2ZW6 A;  1K4J A;  1J4J A;  4KVM E;  1NE9 A;  2B4D A;  3SHP A;  4R3L A;  2VZZ A;  1BO4 A;  1MJA A;  5FVJ A;  2CY2 A;  2PC1 A;  2CXA A;  2FCK A;  2YND A;  4B13 A;  2Q44 A;  2PR8 A;  3S6G A;  1NMT A;  1P4N A;  2BSW A;  3FXT A;  3KKW A;  3F5B A;  3BJ8 A;  1S7F A;  2A4N A;  2Z0Z A;  4A30 A;  2YGW A;  4R57 A;  1WK4 A;  1ZO0 A;  4QVT A;  2Q7B A;  2YNC C;  4FD4 A;  4CYO A;  1KUV A;  1KUX A;  3BJ7 A;  2QIR A;  2Z10 A;  1XE4 A;  2P6F A;  5KTC A;  2PR1 A;  4K30 A;  5G22 A;  4CAF A;  4OLL A;  1M4I A;  4B10 A;  4B12 A;  2HQY A;  4CS0 B;  3FNC A;  2OU2 A;  2G3T A;  1YK3 A;  1XF8 A;  2Q4Y A;  2AJ6 A;  3R9E A;  3TOB A;  5I0C A;  4NSQ A;  3G3S A;  4KSF A;  5J8F A;  2B4B A;  2PQ8 A;  2FS5 A;  4B5O A;  3TO6 A;  2HUZ A;  3R9G A;  3F8K A;  2G3A A;  4HNX B;  4NCZ A;  4XNH C;  3UY5 A;  4KSA A;  4CYP A;  2Y0M A;  4HKF A;  5A27 A;  3EY5 A;  5GCN A;  3PZJ A;  3P2H A;  1YLE A;  1YX0 A;  3FYN A;  4AVA A;  2FSR A;  2AE6 A;  1S60 A;  2JEV A;  2PDO A;  5G21 A;  2Z3O A;  4R3K A;  1Z4E A;  2VEZ A;  4CGO A;  4KS9 A;  2OZH A;  4PK2 A;  1L0C A;  4KOY A;  2IL4 A;  3C26 A;  1RO5 A;  2WPW A;  4JD6 A;  2ZW5 A;  4MHD A;  4QUS A;  2QML A;  1XEB A;  3EO4 A;  2NMT A;  3CXQ A;  3D2P A;  1N71 A;  5EC4 A;  5IX3 A;  4J3G A;  4FD7 A;  1S7L A;  1YGH A;  2WSA A;  2Q4V A;  1M1D A;  3VWE A;  2BUE A;  4B5P B;  2P0W A;  2DPS A;  3W6S A;  2JDC A;  4JLY A;  2ZXV A;  5EBV A;  4A33 A;  2FT0 A;  2P6E A;  2FIW A;  3TFY A;  4M85 A;  1IYK A;  4CGN A;  1XMT A;  2B5G B;  2Q0Y A;  5AG5 A;  4OAD A;  3P2F A;  3TT2 A;  4B11 A;  3ZJ0 A;  4OAE A;  4KOR A;  3RYO A;  2VZY A;  2G0B A;  5IV0 A;  1PU9 A;  1I1D A;  5JPH A;  4MFK A;  4U5Y A;  2EUI A;  4ONU A;  4YGO A;  4ZGY B;  3T90 A;  2PRB A;  2B3V A;  2ZPA A;  4NF1 A;  5AGE A;  3F0A A;  4UFV A;  5AG4 A;  2BEI A;  5F46 A;  2H5M A;  4L89 A;  3TOA A;  4I49 A;  4ORF A;  4CAE A;  4F0X A;  3S6F A;  4C2Z A;  4C2X A;  2WPX A;  1WWZ A;  4C7I A;  5C82 A;  2J8N A;  3CXS A;  3T9Y A;  1TIQ A;  2F5I A;  1XIX A;  1VHS A;  4QC6 A;  3FB3 A;  3LD2 A;  4M3S A;  3DSB A;  1S5K A;  4KOX A;  3EFA A;  4YRH A;  4UA3 A;  2Z11 A;  1I21 A;  4CYN A;  4KOW A;  4IF5 A;  2REE A;  1VKC A;  4JXQ A;  4XPD B;  1Y7R A;  3JVN A;  1QST A;  4UCM A;  3IU2 A;  2R98 A;  4YFJ A;  3TE4 A;  3B8G A;  5AG6 A;  4BMH A;  1B6B A;  2R8V A;  4B5P A;  1Y9K A;  2Q04 A;  2X7B A;  4H89 A;  2Z3K A;  1SQH A;  2J8M A;  3DR8 A;  1Z4R A;  3N7Z A;  3G8W A;  5CNP A;  3S6H A;  3IWE A;  1ON0 A;  5F47 A;  5H86 A;  1Q2D A;  4KLW A;  4MY0 A;  2B5G A;  4II9 A;  2GE3 A;  4MFQ A;  3R95 A;  4UWI A;  2DPT A;  2D4P A;  2KCW A;  5AG7 A;  1S7N A;  4BBH A;  4QBJ A;  5ISV A;  4R87 A;  1QSO A;  1LRZ A;  2PSW A;  2WUU A;  3SXN A;  4E0A A;  1CJW A;  2P6G A;  3DDD A;  5BWA B;  3MGD A;  4A31 A;  3TCV A;  4PSW A;  2I79 A;  3DR6 A;  4KVX A;  4KUA A;  3TO9 A;  4C7H A;  5DWN A;  4B14 A;  3FRM A;  4X5K A;  2FXF A;  3IWG A;  1U6M A;  4QB9 A;  3SXO A;  4XPK A;  4U9Z A;  4GS4 A;  5KTA A;  3EXN A;  4HNW B;  2Z3N A;  4UCN A;  4Q38 A;  4MFP A;  1CM0 A;  5JQ4 A;  4LX9 A;  4KOU A;  1QSM A;  4AB7 A;  5C88 A;  4KOV A;  4RS2 A;  2EVN A;  1YVK A;  3PP9 A;  5HH1 A;  3E0K A;  4A2Z A;  2O28 A;  4PV6 A;  1NSL A;  1IID A;  1PUA A;  4CGM A;  5KTD A;  5DWM A;  3BLN A;  1P0H A;  4C2Y A;  1IIC A;  4KZT A;  1Q2Y A;  3H5Z A;  1M44 A;  1YVO A;  2ARH A;  3LOD A;  3VWD A;  4HNY B;  4A32 A;  3D8P A;  3W6X A;  2ATR A;  2OB0 A;  4FD6 A;  1M4D A;  3QAH A;  2FL4 A;  4A95 A;  3GKR A;  2OH1 A;  2FIA A;  2VXK A;  4JJX A;  3S6K A;  4EVY A;  4H6U A;  4MFZ A;  4MY3 A;  1R57 A;  5F49 A;  4XPL A;  1YR0 A;  4UBR A;  4H6Z A;  4E8O A;  4RI1 A;  2B58 A;  3PGP A;  4MFJ A;  1IB1 E;  2Z3P A;  3WR7 A;  3TO7 A;  4UFW A;  4UCP A;  2CNT A;  4MJ8 A;  2HV2 A;  1MJ9 A;  1KUY A;  1MJB A;  3V8I A;  4NEX A;  4KOT A;  4AG7 A;  4CAX A;  2J8R A;  3TTH A;  3GYA A;  4AVB A;  4L8A A;  4CAW A;  2CNS A;  1FY7 A;  1B87 A;  4KOS A;  3R1K A;  4XNH B;  1V0C A;  5F48 A;  1RXT A;  2C27 A;  4Y49 B;  1UFH A;  3A9L A;  5G1Z A;  1Q2C A;  4MFL A;  3D3S A;  4PK3 A;  3K9U A;  2K5T A;  4FD5 A;  4R9M A;  2ZW4 A;  2JLM A;  4KVO E;  3W91 A;  4DNC A;  4KLV A;  5E96 A;  4NXY A;  2OZG A;  1QSR A;  2ZW7 A;  2B4D B;  3FIX A;  2R7H A;  3OWC A;  2CNM A;  4CGP A;  2VI7 A;  4LUA A;  1M4G A;  4XPD C;  3D2M A;  4Y49 C;  4ZBG A;  4CAV A;  1MK4 A;  4IUS A;  2GIV A;  4CYQ A;  2JDD A;  2RC4 A;  4F0Y A;  1I12 A;  4JXR A;  3QB8 A;  1YRE A;  4CGL A;  3IGR A;  3I3G A;  4U9Y A;  2YNC A;  5H84 A;  3CXP A;  1S3Z A;  2Z3M A;  4AG9 A;  4AVC A;  2REF A;  1Y9W A;  3EC4 A;  1BOB A;  4CRY B;  3R96 A;  2Z3L A;  2VBQ A;  3JUW A;  1S7K A;  2BL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...