3R9FA

Crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with coenzyme a and glutamyl sulfamoyl adenosine (esa)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
180
structure length
180
Chain Sequence
b'DVSLTPSGIKVNDEITLLYPALKYAEELYLLINQNKINFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYKTKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccE protein
molecule tags Transferase
source organism Escherichia coli
publication title Structural Basis for Microcin C7 Inactivation by the MccE Acetyltransferase.
pubmed doi rcsb
total genus 56
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3r9fA00
1QSRA 3PGPA 5ISVA 5KTDA 3T9YA 3DDDA 4KORA 1L0CA 1OZPA 2VEZA 4AVAA 5EC4A 1Z9UA 3PP9A 2FCKA 2J8RA 2QECA 2VI7A 4EVYA 5GCNA 2PSWA 1S5KA 3S6HA 4KVME 1XEBA 3IGRA 2REEA 1IIDA 2P6GA 2H5MA 3TFYA 4QC6A 2OU2A 1IYLA 1Y9KA 2PR8A 1M4GA 4AG7A 4MJ8A 3TO7A 3DSBA 5EBVA 4J3GA 1IB1E 2IL4A 4X5KA 3QAHA 2Q4VA 3PZJA 3G3SA 2NMTA 4JJXA 1Q2YA 2OZHA 1B87A 2BSWA 1VKCA 4HNXB 4CRYB 3CXQA 3K9UA 1XF8A 4Y49B 2PR1A 2Z11A 5FVJA 5HMNA 2OZGA 2GANA 2FXFA 2CNSA 5CNPA 4KLWA 3FYNA 3F8KA 2R7HA 1YX0A 2G3TA 2BUEA 1U6MA 2DXQA 4H6ZA 1MK4A 4PK3A 4KZTA 2KCWA 2Z0ZA 2QIRA 2GIVA 3EO4A 3EC4A 4ZBGA 4KOUA 3S6FA 1YVOA 3B8GA 4KOVA 5F46A 2Z10A 4UBRA 1I1DA 2ZW5A 2A4NA 1KUVA 3FIXA 5H86A 4F0YA 5E96A 4FD4A 2JLMA 5KTAA 1P4NA 4NEXA 5J8CA 2ZW7A 2FL4A 4E8OA 4XPDC 3F0AA 3G8WA 3TT2A 4AG9A 4U9ZA 1FY7A 3R96A 4I49A 3H4QA 2Q0YA 3WR7A 2JEVA 3TOBA 4YFJA 3P2HA 5C82A 4KVXA 1B6BA 2B5GB 2ZW6A 2VZZA 2HUZA 5DWMA 4NCZA 3VWEA 4R9MA 1BO4A 1MJBA 2EUIA 3BJ7A 4R87A 4CS0B 4KOWA 2HV2A 1RXTA 2ZXVA 4NXYA 2FT0A 4CAVA 2JDDA 3DNSA 4FD6A 4NF1A 4XPKA 2BEIA 3EFAA 1PU9A 1YR0A 2AJ6A 4CRZB 1Y9WA 1R57A 2OH1A 3D3SA 2VZYA 3V8IA 3I3GA 1M4IA 3SXNA 4OLLA 3S6GA 1Q2CA 1TIQA 3GYAA 4QVTA 2Y0MA 4MBUA 4JD6A 1GHEA 1Z4RA 3QB8A 2R1IA 4R57A 4B5PB 5F49A 1YGHA 3VWDA 5F47A 1I12A 5IX3A 3N7ZA 2B4BA 1Z4EA 1Q2DA 2CNTA 4XPDB 1I21A 1UFHA 1CM0A 3IWGA 2B4DA 4U5YA 2B3UA 2B3VA 3ZZIA 1QSOA 3GKRA 2GE3A 3R9FA 4B5PA 1BOBA 3R95A 2FSRA 4BMHA 2PQ8A 3S6KA 4JWPA 4PV6A 3D2PA 4H89A 1Y7RA 2WPWA 2WPXA 2RC4A 3EXNA 1YK3A 2QMLA 4ORFA 3SHPA 4PSWA 3TO9A 1YVKA 1XIXA 4NSQA 3FB3A 4E2AA 1KZFA 2D4OA 4UWIA 1K4JA 3TTHA 5F48A 4AB7A 3JVNA 1SQHA 1NSLA 3R1KA 2FIWA 2K5TA 4K30A 2REFA 1CJWA 4MY0A 2Q04A 5DWNA 4MY3A 2Q7BA 4L89A 3W6XA 4R3KA 2G3AA 5JPHA 2CNMA 4KUAA 1S60A 1WK4A 2B4DB 1RO5A 1V0CA 3P2FA 3FRMA 3EY5A 2PRBA 4MI4A 1XMTA 2Q4YA 2ARHA 5H84A 4F6AA 2FS5A 1N71A 2P6FA 4KLVA 2CY2A 1IYKA 2ZPAA 5IV0A 3I9SA 3T90A 5HH1A 1KUXA 4LX9A 2C27A 4HKFA 4KOYA 2B5GA 4ONUA 4PSXA 3RYOA 1VHSA 2O28A 4KOTA 2OB0A 2R8VA 3SXOA 4DNCA 4QBJA 1S3ZA 1YLEA 3CXSA 2J8MA 1KUYA 2BL1A 3ZJ0A 2B58A 1QSNA 3C26A 4U9YA 2VQYA 5KTCA 3JUWA 4KUBA 2EVNA 4RS2A 4FD5A 1S7NA 1M4DA 4HNYB 2D4PA 3D8PA 3CXPA 4KVOE 2AE6A 3FBUA 4YGOA 4AVBA 4CAWA 4PK2A 1XE4A 3D2MA 4KOSA 2ATRA 1MJ9A 4FD7A 4XNHB 1WWZA 4L8AA 4OADA 3W6SA 4AVCA 1P0HA 4JXRA 4OAEA 4XPLA 2P0WA 3FXTA 2R98A 4B5OA 3KKWA 1NMTA 4CAXA 2P6EA 3BJ8A 2FIAA 1LRZA 2F5IA 2J8NA 5C88A 4R3LA 4MHDA 3NE7A 3E0KA 3TE4A 2I00A 2I79A 2G0BA 4M85A 2PC1A 2FE7A 3DR8A 3TOAA 4GS4A 1J4JA 4YRHA 3R9EA 4JLYA 2HQYA 2X7BA 1S7KA 4UA3A 4RI1A 4E0AA 3LODA 3FNCA 3UY5A 4H6UA 4KOXA 2Q44A 4IF5A 1QSTA 2OZUA 5JQ4A 1S7LA 1YREA 4JXQA 4Y49C 5J8FA 1M1DA 4XNHC 4IUSA 3F5BA 1S7FA 3BLNA 1ON0A 4M3SA 3TO6A 5I0CA 4QB9A 4HNWB 2PDOA 3W91A 4LUAA 5IB0A 2VXKA 2VBQA 1NE9A 3MGDA 1M44A 3R9GA 3LD2A 4UWJA 1QSMA 2ZW4A 3TCVA 1MJAA 1PUAA 4QUSA 4II9A 3DR6A 1IICA 2JDCA 3GY9A 3OWCA
chains in the Genus database with same CATH superfamily
1QSRA 3PGPA 1IGBA 5KTDA 1Q7LA 3H5ZA 3T9YA 5ISVA 3QAYA 2AFUA 4G1PA 1Z8LA 3CZXA 3DDDA 1L0CA 4KORA 5A27A 1OZPA 2VEZA 3PB7X 4AVAA 4FAIA 2HB6A 5EC4A 5LYDA 1JWQA 2WUUA 3PFOA 2Z3KA 1Z9UA 3PP9A 2FCKA 3D7FA 4F9VA 2J8RA 2QVPA 1M4LA 2QECA 2VI7A 4EVYA 4JYWA 5GCNA 1XOVA 4OKOA 2PSWA 1ARMA 4CGPA 2PJCA 4MFPA 1IU8A 4B12A 4MFQA 3NFZA 4A95A 3PFEA 5LRGA 3S9LA 1S5KA 4RUHA 4EMEA 2ANPA 3S6HA 3KHXA 4KVME 1XEBA 3IGRA 3ISXA 2DEAA 2REEA 1IIDA 2ZENA 2P6GA 2EO8A 4OC1A 3D68A 3KI9A 4A94A 5K8NA 2IQ6A 3WC7A 2H5MA 4DJLA 3TFYA 4QC6A 4MHYA 2WZNA 2ZEHA 4NJQA 2ABZA 2OU2A 1IYLA 1ELMP 2PR8A 1Y9KA 1M4GA 2AFZA 2GU2A 3RZAA 4AG7A 4MJ8A 4X3RA 4UEEA 3TO7A 3DSBA 4UFVA 5EBVA 3VH9A 3WC5A 2WYRA 3B3TA 4J3GA 5F09A 1IB1E 1HDQA 4TWEA 1F2OA 2IL4A 1X10A 2DF5A 4X5KA 4Q7AA 3QAHA 1HEEA 2Q4VA 3PZJA 1BPNA 3G3SA 4OIWA 4F0XA 2CTCA 4CGOA 2NMTA 3KR5A 4B10A 3KQXA 1LOKA 2Q4ZA 4JJXA 1Q2YA 2OZHA 5LYFA 2PJ2A 1B87A 2BSWA 4A2ZA 2DPTA 1VKCA 4HNXB 4CRYB 3IC1A 4OC0A 3CXQA 3K9UA 1XF8A 4UF4A 4MHZA 5THWA 3WT4A 4IK2A 4ONWA 4Y49B 2PR1A 2Z11A 5FVJA 1VIXA 5HMNA 1TF8A 2OZGA 2GANA 1DE4C 4WJBA 2FXFA 2CNSA 4A37A 3H8EA 5CNPA 3KASA 4GXHA 5AG4A 4UIAA 4KLWA 2BO9A 2PE3A 3FYNA 3IWEA 3F8KA 4P44A 2ZEEA 2R7HA 3BI1A 3IO1A 1YX0A 2G3TA 2BUEA 1U6MA 2DXQA 4H6ZA 1MK4A 4PK3A 4KZTA 2KCWA 2Z0ZA 2QIRA 3JTKA 4W9YA 2GIVA 1TKHA 3EO4A 1PYTB 2PJ0A 4ZX8A 5HXDA 2Z3LA 3EC4A 2ZOGA 1YQEA 4ZBGA 4C2XA 2Z3OA 3IJ3A 4KOUA 3S6FA 2FVGA 1YVOA 3B8GA 4KOVA 5F46A 2Z10A 4UBRA 4CGLA 1I1DA 1TKJA 2A4NA 1KUVA 2ODFA 2ZW5A 3FIXA 3FH4A 3PEIA 5E96A 5H86A 3WABA 5LYLA 4FD4A 2PJAA 2JLMA 5KTAA 1P4NA 3GB0A 4NEXA 1ZLIA 2V8VA 3SJFA 5J8CA 3IIBA 2ZW7A 2FL4A 4E8OA 4XPDC 3KL9A 4ZY0A 3F0AA 3G8WA 3TT2A 4AG9A 4WWVA 2V8HA 3B3CA 4U9ZA 4R6TA 1FY7A 3R96A 4I49A 1QQ9A 1VHOA 1CP6A 3H4QA 5LRJA 2Q0YA 4CYQA 3WR7A 4OIDA 7CPAA 2JEVA 3IEHA 4CYOA 3D66A 1FT7A 2PJ8A 3TOBA 1YW6A 2YNCC 4YFJA 3MRUA 3P2HA 4NGNA 3D67A 4NGMA 1Z2LA 5C82A 5D8NA 3GIUA 4B6ZA 2PJ3A 5AG5A 4KVXA 1YMEA 1B6BA 3D7HA 1ZG9A 3JRUA 4NGPA 2B5GB 2ZW6A 2VZZA 3H8FA 4C7HA 4TNUA 2WSAA 4MHNA 2POKA 2PIZA 4OC5A 5AG6A 3S9NA 2HUZA 4P4IA 4UCPA 4CAFA 5DWMA 4NCZA 3VWEA 2J9AA 4R7MA 5J1QA 2AFMA 4R9MA 2EWBA 1BO4A 1MJBA 2EUIA 3BJ7A 4MFJA 1XRYA 2CF4A 3FF3A 4R87A 4CS0B 5A28A 4H2KA 4FWUA 1PCAA 4KOWA 2HV2A 1RXTA 2XEGA 4MRIA 2ZXVA 4NXYA 2PJ5A 4NJRA 5HVHA 3NE8A 2FT0A 3N5FA 1F2PA 1ELLP 1CBXA 4CAVA 2JDDA 1Y0YA 2IMOA 2PRQA 5LRKA 3DNSA 4FD6A 4NF1A 1R3NA 4XPKA 4A32A 2C6CA 4P4FA 2BEIA 3EFAA 1PU9A 1TF9A 1YR0A 2BCOA 4FUUA 4PXDA 2AJ6A 4CRZB 1Y9WA 4F8ZA 1R57A 2OH1A 4A33A 3D3SA 2VZYA 2Z3MA 3I3GA 4Q36A 1M4IA 3SXNA 3V8IA 4OLLA 3S6GA 1Q2CA 2IJZA 2O53A 2ZOFA 3WC6A 3PBBA 1LCPA 1TIQA 1Z8TA 3GYAA 4MFLA 5HVFA 4C2YA 4P6YA 4NGSA 3KGQA 5JGFA 4CGMA 4QVTA 2Y0MA 4MBUA 3TC8A 4C68A 4JD6A 1FNOA 1GHEA 1Z4RA 3QB8A 4CGNA 2R1IA 5G20A 4R57A 2RFHA 4MXUA 4B5PB 2O4HA 1OBRA 4AXVA 4UCNA 2F8HA 5F49A 3PB8X 1YGHA 3VWDA 3LWUA 5F47A 1BPMA 5K8PA 2RB7A 3FEDA 3S9MA 2PJ7A 1I12A 5IX3A 3N7ZA 2B4BA 5CBMA 1EE3P 1Z4EA 1Q2DA 2CNTA 4MCPA 4XPDB 4IAVA 1I21A 1XMBA 1UFHA 5EMIA 2OR4A 1CM0A 2B4DA 3IWGA 4P10A 2GFQA 2NYQA 3FX6A 2YNCA 3SI0A 3IU2A 4U5YA 2PJ9A 1VGYA 1A2ZA 2B3UA 2B3VA 3DGVA 3SI2A 3ZZIA 1QSOA 3GKRA 3D4UA 3IU1A 3PBEA 5DS0A 3VARA 2GE3A 3QNVA 2ZEGA 1BOBA 2ZEMA 3PB4X 3R9FA 3R95A 3RBUA 4B5PA 2FSRA 4BMHA 1LAPA 2DPSA 2Q51A 2PQ8A 3S6KA 4JWPA 4MFZA 4PV6A 3L2NA 3D2PA 3CT9A 1BLLE 3GUXA 4X8IA 4H89A 1Y7RA 2WPWA 2C1CA 2WPXA 2RC4A 4LQGA 3EXNA 1YK3A 2QMLA 5AG7A 4ORFA 3SHPA 2PJ1A 4PSWA 2ZEFA 2Z3PA 3TO9A 2JEWA 1YVKA 2G9DA 1XIXA 1LAMA 3FVLA 4NSQA 3FB3A 4E2AA 1KZFA 4F0YA 2D4OA 5BWAB 3BI0A 4UWIA 1K4JA 3TTHA 4C7IA 3HUVA 4A30A 2JBKA 4UIBA 2ZEOA 5I4MA 3A9LA 4RN7A 1KWMA 5F48A 4AB7A 3JVNA 2OOTA 1SQHA 1NSLA 3R1KA 5G21A 2GLFA 4Q38A 2FIWA 2K5TA 1RTQA 4K30A 5LYIA 3VATA 4ZGYB 1AMPA 4ZI6A 2REFA 1CJWA 4MY0A 4OC2A 1YSJA 3FMCA 2YNEA 4NGQA 3SI1A 2Q04A 5DWNA 4MY3A 3H8GA 2Q7BA 1CG2A 4KS9A 2YGWA 4L89A 1Z5RA 1ZLHA 4R3KA 4ZX9A 4GM5A 2G3AA 3W6XA 5IB9A 5JPHA 2CNMA 4MCQA 4KUAA 1S60A 1WK4A 4P4JA 2B4DB 4UEZA 4UFWA 1RO5A 1IOIA 1V0CA 3RNZA 2AFOA 3KZWA 3P2FA 3FRMA 5D29A 4JZ0A 1CX8A 2AFSA 4BINA 3EY5A 2PRBA 4MI4A 2VL1A 1XMTA 2Q4YA 2ARHA 5H84A 4F6AA 1IY7A 2FS5A 1CP7A 1Z8WA 1N71A 2P6FA 4KLVA 4A31A 2CY2A 1IYKA 2I3CA 3KR4A 1IOFA 2ZPAA 3B2YA 4YWYA 5IV0A 2AFWA 3I9SA 5AGEA 4OMEA 2C6PA 4CYNA 3T90A 4MCSA 5HH1A 1KUXA 3B7IA 1NSAA 3K2KA 4EWTA 4IHMA 4LX9A 2C27A 3KHZA 1QMUA 4HKFA 4KOYA 3D7GA 2B5GA 1TKFA 4ONUA 4OC4A 2HC9A 4PSXA 4CYPA 3RYOA 1VHSA 2O28A 1XJOA 3FECA 4KOTA 2OB0A 2R8VA 3ISZA 3SXOA 4DNCA 1H8LA 1ZG8A 4QBJA 1S3ZA 1YLEA 3CXSA 4ZYQA 2J8MA 1YW4A 1KUYA 2BL1A 4MCRA 4PXEA 2CTBA 4Z65A 2JBJA 3ZJ0A 1X12A 4A38A 2B58A 1QSNA 3C26A 3IFEA 3CDXA 4R8FA 4U9YA 2VQYA 6CPAA 5JH9A 2ZELA 4R76A 8CPAA 5KTCA 1ZG7A 2V77A 3JUWA 2C6GA 4BBHA 4M6IA 1BAVA 2Z3NA 2EVNA 4KUBA 4RS2A 4FD5A 1S7NA 1M4DA 4HNYB 2D4PA 3D8PA 1XFOA 3DLJA 3CXPA 4KVOE 2AE6A 3SJGA 2PVWA 3FBUA 4YGOA 4AVBA 2GREA 4CAWA 4PK2A 1XE4A 1DTDA 5HVGA 3D2MA 3GLJA 4DYOA 2EK8A 3FJUA 4KOSA 3V7ZA 2ATRA 1MJ9A 4FD7A 5ELYA 4X2TA 4A39A 4MMOA 4UFXA 3BXMA 3T8WA 4XNHB 4K3NA 1WWZA 4L8AA 4LQ6A 4OADA 3LACA 1Y0RA 4C2ZA 1ARLA 2PJBA 3W6SA 4AVCA 2V8GA 3FEEA 1P0HA 4JXRA 1HDUA 4OAEA 4B13A 4CAEA 4MFKA 2F7VA 4KSAA 4O23A 4PXBA 4XPLA 4PQAA 2EK9A 2P0WA 4YU9A 3FXTA 4KSIA 4FBEA 2R98A 4B5OA 3KKWA 3B3WA 1NMTA 3NH4A 1F57A 2AFXA 4CAXA 4F9UA 4BD9A 4B11A 1AYEA 2P6EA 3BJ8A 1LANA 2PCUA 1YLOA 2FIAA 1LRZA 2F5IA 2J8NA 5C88A 4HPSA 2PVVA 4R3LA 4MHDA 3SJXA 3B3SA 4ZY1A 3NE7A 3D7DA 3E0KA 3TE4A 4OP4A 2I00A 1TXRA 2I79A 5K8MA 2G0BA 4NGTA 1ZO0A 4M85A 2PC1A 3NH8A 3CPAA 2CIJA 2BOAA 2FE7A 3DR8A 3TOAA 4GS4A 1AUGA 1J4JA 2YNDA 4YRHA 2NSMA 3R9EA 2XEIA 5G22A 1R43A 4JLYA 3CPXA 4NGRA 2HQYA 1VHEA 2X7BA 1S7KA 1CPXA 3KQZA 4RI1A 4UA3A 4M6HA 4E0AA 3LODA 2QYVA 3FNCA 2V8DA 2PJ6A 4P4BA 3TX8A 4P4EA 4EFDA 3NH5A 3UY5A 4H6UA 4KOXA 2PJ4A 2Q44A 4UCMA 2GLJA 4IF5A 1QSTA 2OZUA 5JQ4A 1S7LA 3B35A 1YREA 3HLPA 4JXQA 4Y49C 5CPAA 5J8FA 1M1DA 1LFWA 3RO0A 4OC3A 3LMSA 5JM6A 4XNHC 4CPAA 4IUSA 3F5BA 1S7FA 3BLNA 1Z8XA 1JQGA 3PB6X 1ON0A 4M3SA 4ZY2A 3TO6A 5I0CA 4UEFA 4PXCA 3BHXA 5K8OA 2Q43A 3I1UA 4HNWB 2PDOA 2CXAA 3NA6A 4QB9A 1UWYA 2ZEPA 3W91A 4LUAA 4PPZA 4B14A 4KSFA 5IB0A 1Y7EA 2VXKA 2VBQA 1NE9A 2ZEDA 1M44A 3MGDA 1CPSA 3MN8A 3R9GA 3LD2A 1XBUA 2XEFA 3PRTA 4M6GA 4UWJA 3B3VA 3K9TA 4P4DA 2EBJA 1QSMA 3IWWA 2XEJA 2ZW4A 3PB9X 4NFRA 5G1ZA 3TCVA 3V38A 1MJAA 1PUAA 4QUSA 3SJEA 4II9A 3RAMA 2Q7SA 3DR6A 2QJ8A 4DUKA 1IICA 2JDCA 3GY9A 3OWCA 2PIYA 4P45A 1GYTA 4MHPA
chains in the Genus database with same CATH topology
1QSRA 3PGPA 5ISVA 5KTDA 3H5ZA 3T9YA 3DDDA 4KORA 1L0CA 5A27A 1OZPA 2VEZA 4AVAA 5EC4A 2WUUA 2Z3KA 1Z9UA 3PP9A 2FCKA 2J8RA 2QECA 2VI7A 4EVYA 5GCNA 2PSWA 4CGPA 4MFPA 4B12A 4MFQA 4A95A 1S5KA 3S6HA 4KVME 1XEBA 3IGRA 2REEA 1IIDA 2P6GA 2H5MA 3TFYA 4QC6A 2OU2A 1IYLA 1Y9KA 2PR8A 1M4GA 4AG7A 4MJ8A 3TO7A 3DSBA 4UFVA 5EBVA 4J3GA 1IB1E 2IL4A 4X5KA 3QAHA 2Q4VA 3PZJA 3G3SA 4F0XA 4CGOA 2NMTA 4B10A 4JJXA 1Q2YA 2OZHA 1B87A 2BSWA 4A2ZA 2DPTA 1VKCA 4HNXB 4CRYB 3CXQA 3K9UA 1XF8A 4Y49B 2PR1A 2Z11A 5FVJA 5HMNA 2OZGA 2GANA 2FXFA 2CNSA 5CNPA 5AG4A 4KLWA 3FYNA 3IWEA 3F8KA 2R7HA 1YX0A 2G3TA 2BUEA 1U6MA 2DXQA 4H6ZA 1MK4A 4PK3A 4KZTA 2KCWA 2Z0ZA 2QIRA 3JTKA 2GIVA 3EO4A 2Z3LA 3EC4A 4ZBGA 4C2XA 2Z3OA 4KOUA 3S6FA 1YVOA 3B8GA 4KOVA 5F46A 2Z10A 4UBRA 4CGLA 1I1DA 2ZW5A 2A4NA 1KUVA 3FIXA 5H86A 4F0YA 5E96A 4FD4A 2JLMA 5KTAA 1P4NA 4NEXA 5J8CA 2ZW7A 2FL4A 4E8OA 4XPDC 3F0AA 3G8WA 3TT2A 4AG9A 4U9ZA 1FY7A 3R96A 4I49A 3H4QA 4CYQA 2Q0YA 3WR7A 2JEVA 4CYOA 3TOBA 4YFJA 2YNCC 3P2HA 5C82A 5AG5A 4KVXA 1B6BA 2B5GB 2ZW6A 2VZZA 4C7HA 2WSAA 5AG6A 2HUZA 4UCPA 4CAFA 5DWMA 4NCZA 3VWEA 4R9MA 1BO4A 1MJBA 2EUIA 3BJ7A 4MFJA 4R87A 4CS0B 5A28A 4KOWA 2HV2A 1RXTA 2ZXVA 4NXYA 2FT0A 4CAVA 2JDDA 3DNSA 4FD6A 4NF1A 4XPKA 4A32A 2BEIA 3EFAA 1PU9A 1YR0A 2AJ6A 4CRZB 1Y9WA 1R57A 2OH1A 4A33A 3D3SA 2VZYA 2Z3MA 3I3GA 4Q36A 1M4IA 3SXNA 3V8IA 4OLLA 3S6GA 1Q2CA 1TIQA 4MFLA 3GYAA 4C2YA 4CGMA 4QVTA 2Y0MA 4MBUA 4C68A 4JD6A 1GHEA 1Z4RA 3QB8A 4CGNA 2R1IA 5G20A 4R57A 4B5PB 4UCNA 5F49A 1YGHA 3VWDA 5F47A 1I12A 5IX3A 3N7ZA 2B4BA 1Z4EA 1Q2DA 2CNTA 4XPDB 1I21A 1UFHA 4CAEA 1CM0A 3IWGA 2B4DA 2YNCA 3IU2A 4U5YA 2B3UA 2B3VA 3ZZIA 1QSOA 3GKRA 3IU1A 2GE3A 3R9FA 4B5PA 1BOBA 3R95A 2FSRA 4BMHA 2DPSA 2PQ8A 3S6KA 4JWPA 4MFZA 4PV6A 3D2PA 4H89A 1Y7RA 2WPWA 2WPXA 2RC4A 5AG7A 3EXNA 1YK3A 2QMLA 4ORFA 3SHPA 4PSWA 2Z3PA 3TO9A 1YVKA 1XIXA 4NSQA 3FB3A 4E2AA 1KZFA 2D4OA 5BWAB 4UWIA 1K4JA 3TTHA 4C7IA 4A30A 3A9LA 5F48A 4AB7A 3JVNA 1SQHA 1NSLA 3R1KA 5G21A 4Q38A 2FIWA 2K5TA 4K30A 4ZGYB 2REFA 1CJWA 4MY0A 2YNEA 2Q04A 5DWNA 4MY3A 2Q7BA 4KS9A 2YGWA 4L89A 3W6XA 4R3KA 2G3AA 5JPHA 2CNMA 4KUAA 1S60A 1WK4A 2B4DB 4UFWA 1RO5A 1V0CA 3P2FA 3FRMA 3EY5A 2PRBA 4MI4A 1XMTA 2Q4YA 2ARHA 5H84A 4F6AA 2FS5A 1N71A 2P6FA 4KLVA 4A31A 2CY2A 1IYKA 2ZPAA 5IV0A 3I9SA 5AGEA 4CYNA 3T90A 5HH1A 1KUXA 4LX9A 2C27A 4HKFA 4KOYA 2B5GA 4ONUA 4PSXA 4CYPA 3RYOA 1VHSA 2O28A 4KOTA 2OB0A 2R8VA 3SXOA 4DNCA 4QBJA 1S3ZA 1YLEA 3CXSA 2J8MA 1KUYA 2BL1A 3ZJ0A 2B58A 1QSNA 3C26A 4U9YA 2VQYA 5KTCA 3JUWA 4BBHA 2Z3NA 4KUBA 2EVNA 4RS2A 4FD5A 1S7NA 1M4DA 4HNYB 2D4PA 3D8PA 3CXPA 4KVOE 2AE6A 3FBUA 4YGOA 4AVBA 4CAWA 4PK2A 1XE4A 3D2MA 4KOSA 2ATRA 1MJ9A 4FD7A 4UFXA 4XNHB 1WWZA 4L8AA 4OADA 4C2ZA 3W6SA 4AVCA 1P0HA 4JXRA 4OAEA 4B13A 4MFKA 4KSAA 4XPLA 2P0WA 3FXTA 2R98A 4B5OA 3KKWA 1NMTA 4CAXA 4B11A 2P6EA 3BJ8A 2FIAA 1LRZA 2F5IA 2J8NA 5C88A 4R3LA 4MHDA 3NE7A 3E0KA 3TE4A 2I00A 2I79A 2G0BA 1ZO0A 4M85A 2PC1A 2FE7A 3DR8A 3TOAA 4GS4A 1J4JA 2YNDA 4YRHA 3R9EA 5G22A 4JLYA 2HQYA 2X7BA 1S7KA 4UA3A 4RI1A 4E0AA 3LODA 3FNCA 3UY5A 4H6UA 4KOXA 2Q44A 4UCMA 4IF5A 1QSTA 2OZUA 5JQ4A 1S7LA 1YREA 4JXQA 4Y49C 5J8FA 1M1DA 4XNHC 4IUSA 3F5BA 1S7FA 3BLNA 1ON0A 4M3SA 3TO6A 5I0CA 4QB9A 4HNWB 2PDOA 2CXAA 3W91A 4LUAA 4B14A 4KSFA 5IB0A 2VXKA 2VBQA 1NE9A 3MGDA 1M44A 3R9GA 3LD2A 4UWJA 1QSMA 5G1ZA 2ZW4A 3TCVA 1MJAA 1PUAA 4QUSA 4II9A 3DR6A 1IICA 2JDCA 3GY9A 3OWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QSR A;  3PGP A;  5ISV A;  5KTD A;  3T9Y A;  3DDD A;  4KOR A;  1L0C A;  1OZP A;  2VEZ A;  4AVA A;  5EC4 A;  1Z9U A;  3PP9 A;  2FCK A;  2J8R A;  2QEC A;  2VI7 A;  4EVY A;  5GCN A;  2PSW A;  1S5K A;  3S6H A;  4KVM E;  1XEB A;  3IGR A;  2REE A;  1IID A;  2P6G A;  2H5M A;  3TFY A;  4QC6 A;  2OU2 A;  1IYL A;  1Y9K A;  2PR8 A;  1M4G A;  4AG7 A;  4MJ8 A;  3TO7 A;  3DSB A;  5EBV A;  4J3G A;  1IB1 E;  2IL4 A;  4X5K A;  3QAH A;  2Q4V A;  3PZJ A;  3G3S A;  2NMT A;  4JJX A;  1Q2Y A;  2OZH A;  1B87 A;  2BSW A;  1VKC A;  4HNX B;  4CRY B;  3CXQ A;  3K9U A;  1XF8 A;  4Y49 B;  2PR1 A;  2Z11 A;  5FVJ A;  5HMN A;  2OZG A;  2GAN A;  2FXF A;  2CNS A;  5CNP A;  4KLW A;  3FYN A;  3F8K A;  2R7H A;  1YX0 A;  2G3T A;  2BUE A;  1U6M A;  2DXQ A;  4H6Z A;  1MK4 A;  4PK3 A;  4KZT A;  2KCW A;  2Z0Z A;  2QIR A;  2GIV A;  3EO4 A;  3EC4 A;  4ZBG A;  4KOU A;  3S6F A;  1YVO A;  3B8G A;  4KOV A;  5F46 A;  2Z10 A;  4UBR A;  1I1D A;  2ZW5 A;  2A4N A;  1KUV A;  3FIX A;  5H86 A;  4F0Y A;  5E96 A;  4FD4 A;  2JLM A;  5KTA A;  1P4N A;  4NEX A;  5J8C A;  2ZW7 A;  2FL4 A;  4E8O A;  4XPD C;  3F0A A;  3G8W A;  3TT2 A;  4AG9 A;  4U9Z A;  1FY7 A;  3R96 A;  4I49 A;  3H4Q A;  2Q0Y A;  3WR7 A;  2JEV A;  3TOB A;  4YFJ A;  3P2H A;  5C82 A;  4KVX A;  1B6B A;  2B5G B;  2ZW6 A;  2VZZ A;  2HUZ A;  5DWM A;  4NCZ A;  3VWE A;  4R9M A;  1BO4 A;  1MJB A;  2EUI A;  3BJ7 A;  4R87 A;  4CS0 B;  4KOW A;  2HV2 A;  1RXT A;  2ZXV A;  4NXY A;  2FT0 A;  4CAV A;  2JDD A;  3DNS A;  4FD6 A;  4NF1 A;  4XPK A;  2BEI A;  3EFA A;  1PU9 A;  1YR0 A;  2AJ6 A;  4CRZ B;  1Y9W A;  1R57 A;  2OH1 A;  3D3S A;  2VZY A;  3V8I A;  3I3G A;  1M4I A;  3SXN A;  4OLL A;  3S6G A;  1Q2C A;  1TIQ A;  3GYA A;  4QVT A;  2Y0M A;  4MBU A;  4JD6 A;  1GHE A;  1Z4R A;  3QB8 A;  2R1I A;  4R57 A;  4B5P B;  5F49 A;  1YGH A;  3VWD A;  5F47 A;  1I12 A;  5IX3 A;  3N7Z A;  2B4B A;  1Z4E A;  1Q2D A;  2CNT A;  4XPD B;  1I21 A;  1UFH A;  1CM0 A;  3IWG A;  2B4D A;  4U5Y A;  2B3U A;  2B3V A;  3ZZI A;  1QSO A;  3GKR A;  2GE3 A;  3R9F A;  4B5P A;  1BOB A;  3R95 A;  2FSR A;  4BMH A;  2PQ8 A;  3S6K A;  4JWP A;  4PV6 A;  3D2P A;  4H89 A;  1Y7R A;  2WPW A;  2WPX A;  2RC4 A;  3EXN A;  1YK3 A;  2QML A;  4ORF A;  3SHP A;  4PSW A;  3TO9 A;  1YVK A;  1XIX A;  4NSQ A;  3FB3 A;  4E2A A;  1KZF A;  2D4O A;  4UWI A;  1K4J A;  3TTH A;  5F48 A;  4AB7 A;  3JVN A;  1SQH A;  1NSL A;  3R1K A;  2FIW A;  2K5T A;  4K30 A;  2REF A;  1CJW A;  4MY0 A;  2Q04 A;  5DWN A;  4MY3 A;  2Q7B A;  4L89 A;  3W6X A;  4R3K A;  2G3A A;  5JPH A;  2CNM A;  4KUA A;  1S60 A;  1WK4 A;  2B4D B;  1RO5 A;  1V0C A;  3P2F A;  3FRM A;  3EY5 A;  2PRB A;  4MI4 A;  1XMT A;  2Q4Y A;  2ARH A;  5H84 A;  4F6A A;  2FS5 A;  1N71 A;  2P6F A;  4KLV A;  2CY2 A;  1IYK A;  2ZPA A;  5IV0 A;  3I9S A;  3T90 A;  5HH1 A;  1KUX A;  4LX9 A;  2C27 A;  4HKF A;  4KOY A;  2B5G A;  4ONU A;  4PSX A;  3RYO A;  1VHS A;  2O28 A;  4KOT A;  2OB0 A;  2R8V A;  3SXO A;  4DNC A;  4QBJ A;  1S3Z A;  1YLE A;  3CXS A;  2J8M A;  1KUY A;  2BL1 A;  3ZJ0 A;  2B58 A;  1QSN A;  3C26 A;  4U9Y A;  2VQY A;  5KTC A;  3JUW A;  4KUB A;  2EVN A;  4RS2 A;  4FD5 A;  1S7N A;  1M4D A;  4HNY B;  2D4P A;  3D8P A;  3CXP A;  4KVO E;  2AE6 A;  3FBU A;  4YGO A;  4AVB A;  4CAW A;  4PK2 A;  1XE4 A;  3D2M A;  4KOS A;  2ATR A;  1MJ9 A;  4FD7 A;  4XNH B;  1WWZ A;  4L8A A;  4OAD A;  3W6S A;  4AVC A;  1P0H A;  4JXR A;  4OAE A;  4XPL A;  2P0W A;  3FXT A;  2R98 A;  4B5O A;  3KKW A;  1NMT A;  4CAX A;  2P6E A;  3BJ8 A;  2FIA A;  1LRZ A;  2F5I A;  2J8N A;  5C88 A;  4R3L A;  4MHD A;  3NE7 A;  3E0K A;  3TE4 A;  2I00 A;  2I79 A;  2G0B A;  4M85 A;  2PC1 A;  2FE7 A;  3DR8 A;  3TOA A;  4GS4 A;  1J4J A;  4YRH A;  3R9E A;  4JLY A;  2HQY A;  2X7B A;  1S7K A;  4UA3 A;  4RI1 A;  4E0A A;  3LOD A;  3FNC A;  3UY5 A;  4H6U A;  4KOX A;  2Q44 A;  4IF5 A;  1QST A;  2OZU A;  5JQ4 A;  1S7L A;  1YRE A;  4JXQ A;  4Y49 C;  5J8F A;  1M1D A;  4XNH C;  4IUS A;  3F5B A;  1S7F A;  3BLN A;  1ON0 A;  4M3S A;  3TO6 A;  5I0C A;  4QB9 A;  4HNW B;  2PDO A;  3W91 A;  4LUA A;  5IB0 A;  2VXK A;  2VBQ A;  1NE9 A;  3MGD A;  1M44 A;  3R9G A;  3LD2 A;  4UWJ A;  1QSM A;  2ZW4 A;  3TCV A;  1MJA A;  1PUA A;  4QUS A;  4II9 A;  3DR6 A;  1IIC A;  2JDC A;  3GY9 A;  3OWC A; 
#chains in the Genus database with same CATH topology
 1QSR A;  3PGP A;  1IGB A;  5KTD A;  1Q7L A;  3H5Z A;  3T9Y A;  5ISV A;  3QAY A;  2AFU A;  4G1P A;  1Z8L A;  3CZX A;  3DDD A;  1L0C A;  4KOR A;  5A27 A;  1OZP A;  2VEZ A;  3PB7 X;  4AVA A;  4FAI A;  2HB6 A;  5EC4 A;  5LYD A;  1JWQ A;  2WUU A;  3PFO A;  2Z3K A;  1Z9U A;  3PP9 A;  2FCK A;  3D7F A;  4F9V A;  2J8R A;  2QVP A;  1M4L A;  2QEC A;  2VI7 A;  4EVY A;  4JYW A;  5GCN A;  1XOV A;  4OKO A;  2PSW A;  1ARM A;  4CGP A;  2PJC A;  4MFP A;  1IU8 A;  4B12 A;  4MFQ A;  3NFZ A;  4A95 A;  3PFE A;  5LRG A;  3S9L A;  1S5K A;  4RUH A;  4EME A;  2ANP A;  3S6H A;  3KHX A;  4KVM E;  1XEB A;  3IGR A;  3ISX A;  2DEA A;  2REE A;  1IID A;  2ZEN A;  2P6G A;  2EO8 A;  4OC1 A;  3D68 A;  3KI9 A;  4A94 A;  5K8N A;  2IQ6 A;  3WC7 A;  2H5M A;  4DJL A;  3TFY A;  4QC6 A;  4MHY A;  2WZN A;  2ZEH A;  4NJQ A;  2ABZ A;  2OU2 A;  1IYL A;  1ELM P;  2PR8 A;  1Y9K A;  1M4G A;  2AFZ A;  2GU2 A;  3RZA A;  4AG7 A;  4MJ8 A;  4X3R A;  4UEE A;  3TO7 A;  3DSB A;  4UFV A;  5EBV A;  3VH9 A;  3WC5 A;  2WYR A;  3B3T A;  4J3G A;  5F09 A;  1IB1 E;  1HDQ A;  4TWE A;  1F2O A;  2IL4 A;  1X10 A;  2DF5 A;  4X5K A;  4Q7A A;  3QAH A;  1HEE A;  2Q4V A;  3PZJ A;  1BPN A;  3G3S A;  4OIW A;  4F0X A;  2CTC A;  4CGO A;  2NMT A;  3KR5 A;  4B10 A;  3KQX A;  1LOK A;  2Q4Z A;  4JJX A;  1Q2Y A;  2OZH A;  5LYF A;  2PJ2 A;  1B87 A;  2BSW A;  4A2Z A;  2DPT A;  1VKC A;  4HNX B;  4CRY B;  3IC1 A;  4OC0 A;  3CXQ A;  3K9U A;  1XF8 A;  4UF4 A;  4MHZ A;  5THW A;  3WT4 A;  4IK2 A;  4ONW A;  4Y49 B;  2PR1 A;  2Z11 A;  5FVJ A;  1VIX A;  5HMN A;  1TF8 A;  2OZG A;  2GAN A;  1DE4 C;  4WJB A;  2FXF A;  2CNS A;  4A37 A;  3H8E A;  5CNP A;  3KAS A;  4GXH A;  5AG4 A;  4UIA A;  4KLW A;  2BO9 A;  2PE3 A;  3FYN A;  3IWE A;  3F8K A;  4P44 A;  2ZEE A;  2R7H A;  3BI1 A;  3IO1 A;  1YX0 A;  2G3T A;  2BUE A;  1U6M A;  2DXQ A;  4H6Z A;  1MK4 A;  4PK3 A;  4KZT A;  2KCW A;  2Z0Z A;  2QIR A;  3JTK A;  4W9Y A;  2GIV A;  1TKH A;  3EO4 A;  1PYT B;  2PJ0 A;  4ZX8 A;  5HXD A;  2Z3L A;  3EC4 A;  2ZOG A;  1YQE A;  4ZBG A;  4C2X A;  2Z3O A;  3IJ3 A;  4KOU A;  3S6F A;  2FVG A;  1YVO A;  3B8G A;  4KOV A;  5F46 A;  2Z10 A;  4UBR A;  4CGL A;  1I1D A;  1TKJ A;  2A4N A;  1KUV A;  2ODF A;  2ZW5 A;  3FIX A;  3FH4 A;  3PEI A;  5E96 A;  5H86 A;  3WAB A;  5LYL A;  4FD4 A;  2PJA A;  2JLM A;  5KTA A;  1P4N A;  3GB0 A;  4NEX A;  1ZLI A;  2V8V A;  3SJF A;  5J8C A;  3IIB A;  2ZW7 A;  2FL4 A;  4E8O A;  4XPD C;  3KL9 A;  4ZY0 A;  3F0A A;  3G8W A;  3TT2 A;  4AG9 A;  4WWV A;  2V8H A;  3B3C A;  4U9Z A;  4R6T A;  1FY7 A;  3R96 A;  4I49 A;  1QQ9 A;  1VHO A;  1CP6 A;  3H4Q A;  5LRJ A;  2Q0Y A;  4CYQ A;  3WR7 A;  4OID A;  7CPA A;  2JEV A;  3IEH A;  4CYO A;  3D66 A;  1FT7 A;  2PJ8 A;  3TOB A;  1YW6 A;  2YNC C;  4YFJ A;  3MRU A;  3P2H A;  4NGN A;  3D67 A;  4NGM A;  1Z2L A;  5C82 A;  5D8N A;  3GIU A;  4B6Z A;  2PJ3 A;  5AG5 A;  4KVX A;  1YME A;  1B6B A;  3D7H A;  1ZG9 A;  3JRU A;  4NGP A;  2B5G B;  2ZW6 A;  2VZZ A;  3H8F A;  4C7H A;  4TNU A;  2WSA A;  4MHN A;  2POK A;  2PIZ A;  4OC5 A;  5AG6 A;  3S9N A;  2HUZ A;  4P4I A;  4UCP A;  4CAF A;  5DWM A;  4NCZ A;  3VWE A;  2J9A A;  4R7M A;  5J1Q A;  2AFM A;  4R9M A;  2EWB A;  1BO4 A;  1MJB A;  2EUI A;  3BJ7 A;  4MFJ A;  1XRY A;  2CF4 A;  3FF3 A;  4R87 A;  4CS0 B;  5A28 A;  4H2K A;  4FWU A;  1PCA A;  4KOW A;  2HV2 A;  1RXT A;  2XEG A;  4MRI A;  2ZXV A;  4NXY A;  2PJ5 A;  4NJR A;  5HVH A;  3NE8 A;  2FT0 A;  3N5F A;  1F2P A;  1ELL P;  1CBX A;  4CAV A;  2JDD A;  1Y0Y A;  2IMO A;  2PRQ A;  5LRK A;  3DNS A;  4FD6 A;  4NF1 A;  1R3N A;  4XPK A;  4A32 A;  2C6C A;  4P4F A;  2BEI A;  3EFA A;  1PU9 A;  1TF9 A;  1YR0 A;  2BCO A;  4FUU A;  4PXD A;  2AJ6 A;  4CRZ B;  1Y9W A;  4F8Z A;  1R57 A;  2OH1 A;  4A33 A;  3D3S A;  2VZY A;  2Z3M A;  3I3G A;  4Q36 A;  1M4I A;  3SXN A;  3V8I A;  4OLL A;  3S6G A;  1Q2C A;  2IJZ A;  2O53 A;  2ZOF A;  3WC6 A;  3PBB A;  1LCP A;  1TIQ A;  1Z8T A;  3GYA A;  4MFL A;  5HVF A;  4C2Y A;  4P6Y A;  4NGS A;  3KGQ A;  5JGF A;  4CGM A;  4QVT A;  2Y0M A;  4MBU A;  3TC8 A;  4C68 A;  4JD6 A;  1FNO A;  1GHE A;  1Z4R A;  3QB8 A;  4CGN A;  2R1I A;  5G20 A;  4R57 A;  2RFH A;  4MXU A;  4B5P B;  2O4H A;  1OBR A;  4AXV A;  4UCN A;  2F8H A;  5F49 A;  3PB8 X;  1YGH A;  3VWD A;  3LWU A;  5F47 A;  1BPM A;  5K8P A;  2RB7 A;  3FED A;  3S9M A;  2PJ7 A;  1I12 A;  5IX3 A;  3N7Z A;  2B4B A;  5CBM A;  1EE3 P;  1Z4E A;  1Q2D A;  2CNT A;  4MCP A;  4XPD B;  4IAV A;  1I21 A;  1XMB A;  1UFH A;  5EMI A;  2OR4 A;  1CM0 A;  2B4D A;  3IWG A;  4P10 A;  2GFQ A;  2NYQ A;  3FX6 A;  2YNC A;  3SI0 A;  3IU2 A;  4U5Y A;  2PJ9 A;  1VGY A;  1A2Z A;  2B3U A;  2B3V A;  3DGV A;  3SI2 A;  3ZZI A;  1QSO A;  3GKR A;  3D4U A;  3IU1 A;  3PBE A;  5DS0 A;  3VAR A;  2GE3 A;  3QNV A;  2ZEG A;  1BOB A;  2ZEM A;  3PB4 X;  3R9F A;  3R95 A;  3RBU A;  4B5P A;  2FSR A;  4BMH A;  1LAP A;  2DPS A;  2Q51 A;  2PQ8 A;  3S6K A;  4JWP A;  4MFZ A;  4PV6 A;  3L2N A;  3D2P A;  3CT9 A;  1BLL E;  3GUX A;  4X8I A;  4H89 A;  1Y7R A;  2WPW A;  2C1C A;  2WPX A;  2RC4 A;  4LQG A;  3EXN A;  1YK3 A;  2QML A;  5AG7 A;  4ORF A;  3SHP A;  2PJ1 A;  4PSW A;  2ZEF A;  2Z3P A;  3TO9 A;  2JEW A;  1YVK A;  2G9D A;  1XIX A;  1LAM A;  3FVL A;  4NSQ A;  3FB3 A;  4E2A A;  1KZF A;  4F0Y A;  2D4O A;  5BWA B;  3BI0 A;  4UWI A;  1K4J A;  3TTH A;  4C7I A;  3HUV A;  4A30 A;  2JBK A;  4UIB A;  2ZEO A;  5I4M A;  3A9L A;  4RN7 A;  1KWM A;  5F48 A;  4AB7 A;  3JVN A;  2OOT A;  1SQH A;  1NSL A;  3R1K A;  5G21 A;  2GLF A;  4Q38 A;  2FIW A;  2K5T A;  1RTQ A;  4K30 A;  5LYI A;  3VAT A;  4ZGY B;  1AMP A;  4ZI6 A;  2REF A;  1CJW A;  4MY0 A;  4OC2 A;  1YSJ A;  3FMC A;  2YNE A;  4NGQ A;  3SI1 A;  2Q04 A;  5DWN A;  4MY3 A;  3H8G A;  2Q7B A;  1CG2 A;  4KS9 A;  2YGW A;  4L89 A;  1Z5R A;  1ZLH A;  4R3K A;  4ZX9 A;  4GM5 A;  2G3A A;  3W6X A;  5IB9 A;  5JPH A;  2CNM A;  4MCQ A;  4KUA A;  1S60 A;  1WK4 A;  4P4J A;  2B4D B;  4UEZ A;  4UFW A;  1RO5 A;  1IOI A;  1V0C A;  3RNZ A;  2AFO A;  3KZW A;  3P2F A;  3FRM A;  5D29 A;  4JZ0 A;  1CX8 A;  2AFS A;  4BIN A;  3EY5 A;  2PRB A;  4MI4 A;  2VL1 A;  1XMT A;  2Q4Y A;  2ARH A;  5H84 A;  4F6A A;  1IY7 A;  2FS5 A;  1CP7 A;  1Z8W A;  1N71 A;  2P6F A;  4KLV A;  4A31 A;  2CY2 A;  1IYK A;  2I3C A;  3KR4 A;  1IOF A;  2ZPA A;  3B2Y A;  4YWY A;  5IV0 A;  2AFW A;  3I9S A;  5AGE A;  4OME A;  2C6P A;  4CYN A;  3T90 A;  4MCS A;  5HH1 A;  1KUX A;  3B7I A;  1NSA A;  3K2K A;  4EWT A;  4IHM A;  4LX9 A;  2C27 A;  3KHZ A;  1QMU A;  4HKF A;  4KOY A;  3D7G A;  2B5G A;  1TKF A;  4ONU A;  4OC4 A;  2HC9 A;  4PSX A;  4CYP A;  3RYO A;  1VHS A;  2O28 A;  1XJO A;  3FEC A;  4KOT A;  2OB0 A;  2R8V A;  3ISZ A;  3SXO A;  4DNC A;  1H8L A;  1ZG8 A;  4QBJ A;  1S3Z A;  1YLE A;  3CXS A;  4ZYQ A;  2J8M A;  1YW4 A;  1KUY A;  2BL1 A;  4MCR A;  4PXE A;  2CTB A;  4Z65 A;  2JBJ A;  3ZJ0 A;  1X12 A;  4A38 A;  2B58 A;  1QSN A;  3C26 A;  3IFE A;  3CDX A;  4R8F A;  4U9Y A;  2VQY A;  6CPA A;  5JH9 A;  2ZEL A;  4R76 A;  8CPA A;  5KTC A;  1ZG7 A;  2V77 A;  3JUW A;  2C6G A;  4BBH A;  4M6I A;  1BAV A;  2Z3N A;  2EVN A;  4KUB A;  4RS2 A;  4FD5 A;  1S7N A;  1M4D A;  4HNY B;  2D4P A;  3D8P A;  1XFO A;  3DLJ A;  3CXP A;  4KVO E;  2AE6 A;  3SJG A;  2PVW A;  3FBU A;  4YGO A;  4AVB A;  2GRE A;  4CAW A;  4PK2 A;  1XE4 A;  1DTD A;  5HVG A;  3D2M A;  3GLJ A;  4DYO A;  2EK8 A;  3FJU A;  4KOS A;  3V7Z A;  2ATR A;  1MJ9 A;  4FD7 A;  5ELY A;  4X2T A;  4A39 A;  4MMO A;  4UFX A;  3BXM A;  3T8W A;  4XNH B;  4K3N A;  1WWZ A;  4L8A A;  4LQ6 A;  4OAD A;  3LAC A;  1Y0R A;  4C2Z A;  1ARL A;  2PJB A;  3W6S A;  4AVC A;  2V8G A;  3FEE A;  1P0H A;  4JXR A;  1HDU A;  4OAE A;  4B13 A;  4CAE A;  4MFK A;  2F7V A;  4KSA A;  4O23 A;  4PXB A;  4XPL A;  4PQA A;  2EK9 A;  2P0W A;  4YU9 A;  3FXT A;  4KSI A;  4FBE A;  2R98 A;  4B5O A;  3KKW A;  3B3W A;  1NMT A;  3NH4 A;  1F57 A;  2AFX A;  4CAX A;  4F9U A;  4BD9 A;  4B11 A;  1AYE A;  2P6E A;  3BJ8 A;  1LAN A;  2PCU A;  1YLO A;  2FIA A;  1LRZ A;  2F5I A;  2J8N A;  5C88 A;  4HPS A;  2PVV A;  4R3L A;  4MHD A;  3SJX A;  3B3S A;  4ZY1 A;  3NE7 A;  3D7D A;  3E0K A;  3TE4 A;  4OP4 A;  2I00 A;  1TXR A;  2I79 A;  5K8M A;  2G0B A;  4NGT A;  1ZO0 A;  4M85 A;  2PC1 A;  3NH8 A;  3CPA A;  2CIJ A;  2BOA A;  2FE7 A;  3DR8 A;  3TOA A;  4GS4 A;  1AUG A;  1J4J A;  2YND A;  4YRH A;  2NSM A;  3R9E A;  2XEI A;  5G22 A;  1R43 A;  4JLY A;  3CPX A;  4NGR A;  2HQY A;  1VHE A;  2X7B A;  1S7K A;  1CPX A;  3KQZ A;  4RI1 A;  4UA3 A;  4M6H A;  4E0A A;  3LOD A;  2QYV A;  3FNC A;  2V8D A;  2PJ6 A;  4P4B A;  3TX8 A;  4P4E A;  4EFD A;  3NH5 A;  3UY5 A;  4H6U A;  4KOX A;  2PJ4 A;  2Q44 A;  4UCM A;  2GLJ A;  4IF5 A;  1QST A;  2OZU A;  5JQ4 A;  1S7L A;  3B35 A;  1YRE A;  3HLP A;  4JXQ A;  4Y49 C;  5CPA A;  5J8F A;  1M1D A;  1LFW A;  3RO0 A;  4OC3 A;  3LMS A;  5JM6 A;  4XNH C;  4CPA A;  4IUS A;  3F5B A;  1S7F A;  3BLN A;  1Z8X A;  1JQG A;  3PB6 X;  1ON0 A;  4M3S A;  4ZY2 A;  3TO6 A;  5I0C A;  4UEF A;  4PXC A;  3BHX A;  5K8O A;  2Q43 A;  3I1U A;  4HNW B;  2PDO A;  2CXA A;  3NA6 A;  4QB9 A;  1UWY A;  2ZEP A;  3W91 A;  4LUA A;  4PPZ A;  4B14 A;  4KSF A;  5IB0 A;  1Y7E A;  2VXK A;  2VBQ A;  1NE9 A;  2ZED A;  1M44 A;  3MGD A;  1CPS A;  3MN8 A;  3R9G A;  3LD2 A;  1XBU A;  2XEF A;  3PRT A;  4M6G A;  4UWJ A;  3B3V A;  3K9T A;  4P4D A;  2EBJ A;  1QSM A;  3IWW A;  2XEJ A;  2ZW4 A;  3PB9 X;  4NFR A;  5G1Z A;  3TCV A;  3V38 A;  1MJA A;  1PUA A;  4QUS A;  3SJE A;  4II9 A;  3RAM A;  2Q7S A;  3DR6 A;  2QJ8 A;  4DUK A;  1IIC A;  2JDC A;  3GY9 A;  3OWC A;  2PIY A;  4P45 A;  1GYT A;  4MHP A; 
#chains in the Genus database with same CATH homology
 1QSR A;  3PGP A;  5ISV A;  5KTD A;  3H5Z A;  3T9Y A;  3DDD A;  4KOR A;  1L0C A;  5A27 A;  1OZP A;  2VEZ A;  4AVA A;  5EC4 A;  2WUU A;  2Z3K A;  1Z9U A;  3PP9 A;  2FCK A;  2J8R A;  2QEC A;  2VI7 A;  4EVY A;  5GCN A;  2PSW A;  4CGP A;  4MFP A;  4B12 A;  4MFQ A;  4A95 A;  1S5K A;  3S6H A;  4KVM E;  1XEB A;  3IGR A;  2REE A;  1IID A;  2P6G A;  2H5M A;  3TFY A;  4QC6 A;  2OU2 A;  1IYL A;  1Y9K A;  2PR8 A;  1M4G A;  4AG7 A;  4MJ8 A;  3TO7 A;  3DSB A;  4UFV A;  5EBV A;  4J3G A;  1IB1 E;  2IL4 A;  4X5K A;  3QAH A;  2Q4V A;  3PZJ A;  3G3S A;  4F0X A;  4CGO A;  2NMT A;  4B10 A;  4JJX A;  1Q2Y A;  2OZH A;  1B87 A;  2BSW A;  4A2Z A;  2DPT A;  1VKC A;  4HNX B;  4CRY B;  3CXQ A;  3K9U A;  1XF8 A;  4Y49 B;  2PR1 A;  2Z11 A;  5FVJ A;  5HMN A;  2OZG A;  2GAN A;  2FXF A;  2CNS A;  5CNP A;  5AG4 A;  4KLW A;  3FYN A;  3IWE A;  3F8K A;  2R7H A;  1YX0 A;  2G3T A;  2BUE A;  1U6M A;  2DXQ A;  4H6Z A;  1MK4 A;  4PK3 A;  4KZT A;  2KCW A;  2Z0Z A;  2QIR A;  3JTK A;  2GIV A;  3EO4 A;  2Z3L A;  3EC4 A;  4ZBG A;  4C2X A;  2Z3O A;  4KOU A;  3S6F A;  1YVO A;  3B8G A;  4KOV A;  5F46 A;  2Z10 A;  4UBR A;  4CGL A;  1I1D A;  2ZW5 A;  2A4N A;  1KUV A;  3FIX A;  5H86 A;  4F0Y A;  5E96 A;  4FD4 A;  2JLM A;  5KTA A;  1P4N A;  4NEX A;  5J8C A;  2ZW7 A;  2FL4 A;  4E8O A;  4XPD C;  3F0A A;  3G8W A;  3TT2 A;  4AG9 A;  4U9Z A;  1FY7 A;  3R96 A;  4I49 A;  3H4Q A;  4CYQ A;  2Q0Y A;  3WR7 A;  2JEV A;  4CYO A;  3TOB A;  4YFJ A;  2YNC C;  3P2H A;  5C82 A;  5AG5 A;  4KVX A;  1B6B A;  2B5G B;  2ZW6 A;  2VZZ A;  4C7H A;  2WSA A;  5AG6 A;  2HUZ A;  4UCP A;  4CAF A;  5DWM A;  4NCZ A;  3VWE A;  4R9M A;  1BO4 A;  1MJB A;  2EUI A;  3BJ7 A;  4MFJ A;  4R87 A;  4CS0 B;  5A28 A;  4KOW A;  2HV2 A;  1RXT A;  2ZXV A;  4NXY A;  2FT0 A;  4CAV A;  2JDD A;  3DNS A;  4FD6 A;  4NF1 A;  4XPK A;  4A32 A;  2BEI A;  3EFA A;  1PU9 A;  1YR0 A;  2AJ6 A;  4CRZ B;  1Y9W A;  1R57 A;  2OH1 A;  4A33 A;  3D3S A;  2VZY A;  2Z3M A;  3I3G A;  4Q36 A;  1M4I A;  3SXN A;  3V8I A;  4OLL A;  3S6G A;  1Q2C A;  1TIQ A;  4MFL A;  3GYA A;  4C2Y A;  4CGM A;  4QVT A;  2Y0M A;  4MBU A;  4C68 A;  4JD6 A;  1GHE A;  1Z4R A;  3QB8 A;  4CGN A;  2R1I A;  5G20 A;  4R57 A;  4B5P B;  4UCN A;  5F49 A;  1YGH A;  3VWD A;  5F47 A;  1I12 A;  5IX3 A;  3N7Z A;  2B4B A;  1Z4E A;  1Q2D A;  2CNT A;  4XPD B;  1I21 A;  1UFH A;  4CAE A;  1CM0 A;  3IWG A;  2B4D A;  2YNC A;  3IU2 A;  4U5Y A;  2B3U A;  2B3V A;  3ZZI A;  1QSO A;  3GKR A;  3IU1 A;  2GE3 A;  3R9F A;  4B5P A;  1BOB A;  3R95 A;  2FSR A;  4BMH A;  2DPS A;  2PQ8 A;  3S6K A;  4JWP A;  4MFZ A;  4PV6 A;  3D2P A;  4H89 A;  1Y7R A;  2WPW A;  2WPX A;  2RC4 A;  5AG7 A;  3EXN A;  1YK3 A;  2QML A;  4ORF A;  3SHP A;  4PSW A;  2Z3P A;  3TO9 A;  1YVK A;  1XIX A;  4NSQ A;  3FB3 A;  4E2A A;  1KZF A;  2D4O A;  5BWA B;  4UWI A;  1K4J A;  3TTH A;  4C7I A;  4A30 A;  3A9L A;  5F48 A;  4AB7 A;  3JVN A;  1SQH A;  1NSL A;  3R1K A;  5G21 A;  4Q38 A;  2FIW A;  2K5T A;  4K30 A;  4ZGY B;  2REF A;  1CJW A;  4MY0 A;  2YNE A;  2Q04 A;  5DWN A;  4MY3 A;  2Q7B A;  4KS9 A;  2YGW A;  4L89 A;  3W6X A;  4R3K A;  2G3A A;  5JPH A;  2CNM A;  4KUA A;  1S60 A;  1WK4 A;  2B4D B;  4UFW A;  1RO5 A;  1V0C A;  3P2F A;  3FRM A;  3EY5 A;  2PRB A;  4MI4 A;  1XMT A;  2Q4Y A;  2ARH A;  5H84 A;  4F6A A;  2FS5 A;  1N71 A;  2P6F A;  4KLV A;  4A31 A;  2CY2 A;  1IYK A;  2ZPA A;  5IV0 A;  3I9S A;  5AGE A;  4CYN A;  3T90 A;  5HH1 A;  1KUX A;  4LX9 A;  2C27 A;  4HKF A;  4KOY A;  2B5G A;  4ONU A;  4PSX A;  4CYP A;  3RYO A;  1VHS A;  2O28 A;  4KOT A;  2OB0 A;  2R8V A;  3SXO A;  4DNC A;  4QBJ A;  1S3Z A;  1YLE A;  3CXS A;  2J8M A;  1KUY A;  2BL1 A;  3ZJ0 A;  2B58 A;  1QSN A;  3C26 A;  4U9Y A;  2VQY A;  5KTC A;  3JUW A;  4BBH A;  2Z3N A;  4KUB A;  2EVN A;  4RS2 A;  4FD5 A;  1S7N A;  1M4D A;  4HNY B;  2D4P A;  3D8P A;  3CXP A;  4KVO E;  2AE6 A;  3FBU A;  4YGO A;  4AVB A;  4CAW A;  4PK2 A;  1XE4 A;  3D2M A;  4KOS A;  2ATR A;  1MJ9 A;  4FD7 A;  4UFX A;  4XNH B;  1WWZ A;  4L8A A;  4OAD A;  4C2Z A;  3W6S A;  4AVC A;  1P0H A;  4JXR A;  4OAE A;  4B13 A;  4MFK A;  4KSA A;  4XPL A;  2P0W A;  3FXT A;  2R98 A;  4B5O A;  3KKW A;  1NMT A;  4CAX A;  4B11 A;  2P6E A;  3BJ8 A;  2FIA A;  1LRZ A;  2F5I A;  2J8N A;  5C88 A;  4R3L A;  4MHD A;  3NE7 A;  3E0K A;  3TE4 A;  2I00 A;  2I79 A;  2G0B A;  1ZO0 A;  4M85 A;  2PC1 A;  2FE7 A;  3DR8 A;  3TOA A;  4GS4 A;  1J4J A;  2YND A;  4YRH A;  3R9E A;  5G22 A;  4JLY A;  2HQY A;  2X7B A;  1S7K A;  4UA3 A;  4RI1 A;  4E0A A;  3LOD A;  3FNC A;  3UY5 A;  4H6U A;  4KOX A;  2Q44 A;  4UCM A;  4IF5 A;  1QST A;  2OZU A;  5JQ4 A;  1S7L A;  1YRE A;  4JXQ A;  4Y49 C;  5J8F A;  1M1D A;  4XNH C;  4IUS A;  3F5B A;  1S7F A;  3BLN A;  1ON0 A;  4M3S A;  3TO6 A;  5I0C A;  4QB9 A;  4HNW B;  2PDO A;  2CXA A;  3W91 A;  4LUA A;  4B14 A;  4KSF A;  5IB0 A;  2VXK A;  2VBQ A;  1NE9 A;  3MGD A;  1M44 A;  3R9G A;  3LD2 A;  4UWJ A;  1QSM A;  5G1Z A;  2ZW4 A;  3TCV A;  1MJA A;  1PUA A;  4QUS A;  4II9 A;  3DR6 A;  1IIC A;  2JDC A;  3GY9 A;  3OWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...