3R9IA

2.6a resolution structure of mind complexed with mine (12-31) peptide
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
257
structure length
257
Chain Sequence
ARIIVVTSGKGGVGKTTSSAAIATGLAQKGKKTVVIDFAIGLRNLDLIMGCERRVVYDFVNVIQGDATLNQALIKDKRTENLYILPASQTRDKDALTREGVAKVLDDLKAMDFEFIVCDSPAGIETGALMALYFADEAIITTNPEVSSVRDSDRILGILASKSRRAENGEEPIKEHLLLTRYNPGRVSRGDMLSMEDVLEILRIKLVGVIPEDQSVLRASNQGEPVILDINADAGKAYADTVERLLGEERPFRFIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Min Oscillator Uses MinD-Dependent Conformational Changes in MinE to Spatially Regulate Cytokinesis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle,hydrolase/cell cycle
molecule keywords Septum site-determining protein minD
total genus 83
structure length 257
sequence length 257
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r9iA00
2OBNA 5DSZA 4UKDA 2JLYA 1GM5A 2ZRLA 2BBOA 1R4AA 1AKYA 2ZRNA 4MDEA 4DLUA 1YZQA 4OQLA 1W0JD 1XEXB 3PUZA 4R2IA 1G8PA 3U3KA 1RRCA 1QHHA 3NBXX 4HAXA 4LV6A 3AVQA 5JJIA 2ONKA 1SZPA 1RW4A 1G6HA 5H68A 3LWNA 4URUR 1W0KD 1E0AA 1S0UA 1UKZA 2AFHE 3NKVA 1NY6A 5E7MA 2PJRA 1L2TA 2Z0MA 3SN6A 2FEMA 5FBVB 3QPUA 2FX3A 1K8RA 2RGGA 3DMDA 4A6PA 1FX0A 1AS0A 4LV8B 4X8HA 4M1TA 2JLXA 1HH4A 1K5GA 2WJGA 3CW2A 3NBYC 2ODEA 2N46A 3BFKA 4NYMQ 3TQFA 4LRWA 3UPUA 2GXSA 3H1TA 4ASUA 3THWB 3IEUA 1HQYE 3GLGE 1SVMA 3QIAA 3PEVA 2VLIA 2H18A 1IY0A 3AP2A 1E1QD 5EXXA 1G6OA 821PA 4TN1A 2FFQA 4TL8A 4X8LA 3U5ZB 1FQJA 3B7GA 1H8EA 1U0JA 2GF9A 3O8CA 4HEJA 3MJRA 3QXSA 1ZMXA 3T5GA 4B6EA 3LA6A 2FDCA 1Q20A 3PEUA 5J4LA 3ZVNA 2DCUA 1Z6AA 4BE7B 2G6BA 4GP7A 1U90A 3IIMA 1A4RA 1JAHA 4D82A 2IXFA 1D5CA 2EFCB 2UZIR 1E2HA 2ZJ5A 3Q85A 4IEIA 5JSZB 1HUQA 3GFTA 3AB3A 4C2TA 4JJKA 1T91A 1G64A 4LCBA 2IS1A 3FOZA 1SVWA 4F91B 5GADl 4CT5A 3P4YA 4ARZA 2EWVA 1YZLA 4QOSA 1R5OA 1Z83A 1YZUA 3EG5A 4TQ9A 3L0SA 5JJKA 1IY2A 1R0WA 2QROA 1KI7A 4B75A 4PPFA 1J7KA 1CP2A 3D31A 4WIAA 1LTQA 2BEJA 1G3QA 3K09A 2J0UA 4Q7MB 2YVUA 2RGDA 3B1VA 2GXAA 3IO5A 3NH9A 1Z2AA 2PZFA 4BQSA 3B78A 1H8ED 1XX6A 4B3DA 3K53A 2HYIC 3B9PA 1KI8A 3LAWA 4IDQA 2R6DA 2NOAA 1EFUA 3K70B 2H1LA 1LF0A 4EUNA 2QPTA 3BIFA 1XMJA 1XF9A 1W5SA 4BLRA 2YV5A 1Z8FA 2VP2A 2QAGC 3THOA 3B6EA 4PQRA 1LFDB 3LRPA 1G291 2RMKA 2GETA 1KI3A 1OF1A 1UFQA 4JLJA 4TMXA 3C4JA 1DG1G 1G19A 1WBDA 4O2LA 3WHLA 1KSJA 4PPNA 4AURA 4WXPA 3R20A 5G40A 4Z51A 1ANKA 2R6FA 2V8OA 1D2MA 4UNPA 1XXHE 1W47A 4OHZA 5KYKA 4DDUA 1E1RD 1XD8A 4N0EA 4XIGS 1OHHD 1AM4D 421PA 1N2CE 1RFLA 3B1WA 1QHGA 1DOAA 1OH5A 2A78A 1OV4A 3D3QA 4CEJB 2OFWA 4V0OA 4A9AA 2KWIA 5EE1A 2MMGA 1NBMD 3CH4B 4FMCB 3QKRA 4CRWB 3NXSA 1KO7A 1NRJB 1TNDA 3NHBA 3BJIC 4Q7KA 2GXUA 3IPYA 4EJSB 4F4IA 1MRNA 3QI2A 3AQ4A 3QEOA 5DIFA 2O0HA 3WP1B 1P9RA 1E9CA 2IK8A 5FR2A 5KO2A 3LD9A 3RS7A 5FPYA 4Q18A 4LBVA 4GFDA 1HEIA 4G0NA 2KE5A 5D3QA 3AF1A 2JLRA 3WNDA 5FTMA 3HWSA 3GJ0A 2GBLA 4BLOA 2BM0A 4NHOA 1NN1A 4Z8XA 4XOIA 1GL6A 2WJVA 1GOTA 3DKVA 1VYTA 3BERA 4BRWA 4CGZA 2AHOA 2O5VA 1OE0A 1SXJA 3SQXA 2OAP1 1I4LD 3DPUA 3VNVA 2FN4A 1LV7A 1JR3E 3ZVLA 1OHHA 4FMCF 3KFVA 4NL4H 2QP3A 3AUYA 3PCRB 3I32A 1E0JA 3QY0A 3BH7A 2XX3A 3THWA 1KHTA 4B73A 1ZIPA 3QEJA 4NCHA 2ODNA 3VMFA 1AA9A 2CLCX 1UBGA 1IXRC 1E9RA 2ZYUX 4ZDWA 4MYCA 1DAFA 4HZUB 1E9DA 3CR7A 2XSZA 2VSFA 4B33A 4RZXA 1GRRA 1TEXA 4Q4HB 4QJ4A 4JLMA 2AXPA 3CF2A 3TKLA 2JJ8A 1Z6YA 2FG5A 4RZ3A 4M21A 4RZUA 5JMTA 1QHNA 2QM8A 2AKAB 3A4MA 2EFDB 5FTJA 1YZKA 3SJCA 2EFEB 4LHXA 1G20E 4AWXA 3D6TB 2GK6A 1YQTA 5H1YA 1LVGA 1JECA 2J41A 1IAQA 3W5JA 2ZI6A 3DL0A 3KKQA 4R2HA 3SR0A 3W3ZB 5L3SA 5LD2C 4URWR 4DLSA 1VG0B 3PUVA 3DM5A 4FMBB 1W5TA 2A30A 3IILA 3CWZA 1FOEB 1M7HA 5E7IA 2NO0A 4IKEA 3RS3A 1CEEA 5EXSA 1VECA 4CT4B 2IL1A 4IOKA 5AK0A 4Y0AA 2ZREA 4NDZA 2FZ4A 4JSYA 4MYHA 3RRZA 1CBUA 2BIFA 2RH5A 4FD2A 4M9SA 1E2NA 4M53A 2GZDA 3DOFA 4BZQA 1G8GA 4PHFA 1E1RA 1W0JA 5GVRA 2ZJYA 3ZLJA 3R8CA 3THXA 1ZUNB 2Q0HA 1TADA 4XVRA 2O8BA 2UVQA 2VHTA 4LC0A 4LUCA 4OQFA 3I4LA 2GCOB 4S35A 4TSFA 4YC7A 2GTPA 2PX3A 4E22A 3QSYA 2A7QA 4JBXA 1G8FA 3L0OA 2CK3A 4HDQB 2WOOA 1TQ6A 2ZSEA 4PXAA 5J4YA 1Q44A 2PT7A 3QG5A 3TMKA 1VHTA 2YOFA 3KTAA 3CF6R 4F93B 1HE8B 1R0ZA 4B3CA 2QEQA 2CCGA 1CRPA 5JHHB 2JATA 3CKLA 3KZ1E 3B2EA 2H92A 2QGZA 3GLHE 4BEBA 4IDPA 5TB5A 2QBYB 1KJWA 1WRBA 2FSGA 4MQBA 2XGJA 2CDNA 1E2KA 1E1QA 5FI0B 3U6BA 4HLUC 3ZQJA 2XTNA 1M34E 1TTTA 1OFTA 4FINA 5F2EA 3LY5A 3RNLA 2VA8A 3QBTA 1Q1BA 1EX6A 1XP8A 1ZAKA 2ZANA 4DCVA 2ZRPA 3FHOA 1YR6A 3U3RA 4KYUA 3SDZA 4C30A 4B3FX 3SJZA 2WKRA 3GLIB 4IXMA 1I2DA 4MYUA 2QRZA 1T5IA 3X1WA 1DE0A 1DAMA 1P62B 1NP6A 3TUJC 1U9IA 4B76A 2GF0A 4LPSA 3GLIE 2CLDX 4JS0A 5B64A 4QGGA 4WVFA 3TW8B 3H4MA 4TYYA 1FP6A 2WSSA 3GJ4A 2WVJA 5D3MA 2C9YA 3E2IA 2J5XA 2W6IA 5JCPA 4FMDB 4PANA 3ETLA 3UANA 4D0NA 2ZUDA 1BS1A 2BCJQ 2X2EA 3C41J 1LS1A 2IUUA 3HYRA 1LY1A 3TGPA 1OW3B 2VHCA 3P20A 5JCZA 1N6IA 2FPKA 1RJ9A 4WZAE 3GLGB 4LK2A 2ZSDA 2LKCA 2CJWB 3PITA 4D6PA 1NF3A 4NONA 4U7DA 2PEZA 5J4KA 5JFGA 5CDFE 2R8RA 1NIJA 5B2ZA 5FUXA 4KVAA 4CEJA 3AF2A 3QQ5A 3DEFA 1OXUA 1RYHA 4NCJA 1XPOA 4IRUB 1UBCA 1ZUIA 1VG8A 1AGRA 2ZUCA 1T6NA 4GRAA 4PPQA 3VHLB 4ACBA 4DXAA 2FSHA 3KKPA 4EJSC 3RLFA 2QE7A 3PENA 2GBLC 3VX3A 1KO1A 3X1DA 2WZQA 2RGNA 3FMFA 1XU4A 3CLVA 1BKDR 3VQTA 3LBIA 1X8LA 2J3EA 1CU1A 4RZ2A 5B30A 4TTQA 1Z29A 5JJLA 1ZCBA 1NMZA 3IIKA 5CB6A 2O52A 2FH5B 3NH6A 3TLXA 1IXSB 4ON9A 1SKYB 5L3SB 2P5SA 4UXIA 2IBMA 2HLDD 1JNYA 2EQBA 4AYXA 2YC2C 1Z06A 4DRZA 2G0NA 2RHMA 1NLFA 2IHYA 1W2HA 3GD7A 5HKKD 2QQ0A 1AQUA 4G5RA 4TLCA 3G82C 1N5IA 4TMVA 5AR1A 4BLQA 2BM1A 1MT0A 4LWZA 2C9OA 1CJTC 2I3BA 1E4YA 1II8B 3EZ7A 4DCUA 1HY3A 4FW9A 5J47A 2HYDA 3IO3A 3ND8A 4D4MA 4BFUA 4PZYA 1C9KA 1SXJE 3KX2A 4B2IA 4HSEA 1OFIA 2GJ9A 5KDLA 5FOSA 3UG7A 5L8VA 2QQEA 3KB2A 1N6OA 2WMOB 4O0MA 4D25A 4UQOA 1UADA 3GP8A 1FQKA 5CITA 1G3UA 1JR3D 2YWEA 1WB9A 2MSCB 3LO5A 4HUQA 4I1UA 2ZRBA 2N1BA 3THXB 5F9FA 3W8NA 2FOLA 3U2QA 1JJ7A 5H8WA 2CVFA 3SOPA 4LX0A 4GP6A 1NIPA 1ESMA 3HU3A 4B71A 5LB4A 4RJLA 2G83A 2J7PA 5KHOC 4X8MA 1GDDA 2I4IA 2YWGA 1F3OA 3AKEA 2F3TA 3L43A 4QHTA 2OO7A 1U9IC 2QSYA 4HLQB 2P6NA 4DSOA 1JQJC 2C96A 4C7OA 4HI0E 2DFNA 2FMXA 3EZ2A 1YR9A 3EX7C 2ZSAA 1O87A 2VYFA 3BH6A 3LX5A 2H57A 3QKSA 4IXNA 4KFUA 1CR4A 1E69A 2JA1A 4JKYA 1DO2A 2KB0A 4HB2A 2H16A 1N5LA 1UEJA 3VKGA 1MV5A 3AVXA 2ZRGA 2ATVA 4AIIA 4RVCA 2IYRA 5GJVC 5IHPA 1OYYA 3WMFA 1X1RA 3QVVA 1W49A 1XTRA 4YDSA 521PA 4DSTA 2IEZA 3THYA 2IS6A 1GFIA 1N0VC 2F3RA 3A1WA 3AUXA 1T0HB 5B57C 1P9NA 1E9BA 5J4VA 4OI1A 3QVUA 2FGJA 5CJPA 2B7BA 1SXJD 2PZEA 3EPLA 3Q9LA 2WJYA 3FPAA 1OB5A 2GEDA 2NO7A 1ZUHA 4IVRA 2OSBA 4JLNA 4AY2A 3K9GA 2Z83A 2CCJA 2G3YA 2HXSA 3K70D 1ELOA 2A5GA 2VBCA 4TLBA 2XXAA 3RS4A 2FE4A 4B32A 3Q7PA 2A5JA 4R98A 4A1FA 4OI4A 2ZS9A 3G5UA 2VP6A 4RFSB 2EW1A 2JIZA 3B85A 2D62A 2Q3HA 4L9SA 5KSZA 1S1MA 1S3SA 4HB3A 2A9KA 4MRRA 2ZTSA 5L3RA 1IBRA 1ZU5A 4MKGA 4IW3B 1OH8A 3GLFA 2Q3FA 5DI9A 3ECCA 3CR8A 4MRSA 2J45A 4K81B 1SKQA 5JECA 4EPTA 1NI3A 1GWNA 3FE2A 5DNYB 2P6RA 3NEYA 3AM1A 2ZR9A 4EKDA 4P0TA 3ZVRA 3ADCA 1MO6A 4GOJA 1XXHB 4QC2A 4EFLA 1OPXA 2WWWA 3MWYW 3OF5A 3Q5EA 2NO9A 2DWOA 4TYNA 1WP9A 3K0CC 3HU1A 3EXAA 1T4GA 4PQFA 2OM2A 2OXCA 4DSNA 1SVSA 5HCIA 2NO1A 3BFXA 4AKEA 1FMJA 4Q9JA 3LH5A 1W44A 2B8TA 4JBWA 3I5YA 1SKYE 3FHTA 2RKOA 1GNRA 4KV9A 4URYR 2J7PD 3H84A 1RYFA 4PZLA 1KSFX 1P73A 4LJ7A 1S4QA 4YMSA 2QMOA 2ORIA 1KK3A 1NVXQ 4PC2A 4QNMA 1KSHA 4HATA 1FW6A 1IN5A 4XSHA 3TJZA 4K46A 1XTKA 1Q1ZA 3MRSA 2MSEB 4RD1A 4TL9A 1F5NA 4Q5IA 3RC8A 1DEKA 3UMFA 1ODFA 1RC8A 5CIWA 1TF7A 1N6LA 3KUCA 2QPAA 2ZJZA 2WKPA 3WNBA 3VU9A 1IJEA 2YKGA 5AJVB 1VDZA 4BEJA 1CULC 1T3SA 1NVVR 3GJ8A 4RD3A 1S1CA 2BVNA 3Q72A 1Z6TA 2ZSFA 4DSUA 1RRPA 4D2IA 5DH9A 5BN3A 2D7DA 4GSYA 3FFAA 2G9NA 3ADBA 3BB1A 4D4KA 1N5KA 1QVAA 2ZEJA 3K0FB 4QXAA 1M8PA 4AKIA 1CIPA 4ZPXA 5C46F 1EK0A 2GVZC 2ODWA 3KQHA 4GPTA 4JLKA 4IJMA 4OJQA 1TU4A 4D81A 4WA7A 4C7OB 3K70C 1IM2A 1N25A 1ZM4A 1E99A 2XAUA 1G17A 2ODBA 1COWA 1II0A 1Z5ZA 3AVVA 4P3YA 2AK3A 2VO1A 1ESNA 4Q1BA 2ZE5A 5DI3A 2XSZD 3TR5A 1KJZA 1KIMA 1NKTA 4RCYA 2R65A 4JL5A 2HJVA 4UNQA 4IVQA 4JLOA 1E2IA 4EJSA 3R9WA 4MKHA 2F6RA 4HAYA 1YE8A 1E2PA 2XOKA 1J8YF 3CIOA 1KO4A 4TLEA 3WP0A 3GCGA 4QM7A 4FWIB 3CNOA 2QUZA 2ZRHA 3T1VA 2PT5A 4OI2A 2JAQA 3B82A 5CYOA 1GP2A 2QTVB 5EE0A 5JS8A 2LKDA 2JLZA 2ZRKA 1GAJA 2ZI7A 3ICQB 1K5DA 2C99A 5HTKA 2VH5R 5CDFA 3MSXA 1YHNA 2ANBA 3QXHA 4BFWA 2J7KA 4F4JA 5KDDA 1P2SA 1I4DD 2NTYC 4M1YA 1T9HA 3MCAA 3QBVA 2P0EA 1D2NA 3KXIA 5BQ5A 1ZBDA 1YR8A 4N1AA 5DISB 5LD2B 1PV4A 2GA8A 4ERNA 3CRVA 4FMDF 1E3MA 4P4TA 4U00A 1GL9B 1QHIA 1F2UB 5C4MA 3A4LA 4YXWD 4LPKA 3NIBA 1FTNA 2OUKA 2NPIA 1GSIA 2AL7A 1U94A 1ZJ6A 3M0EA 4IEEA 4AKGA 1W36D 4DLYA 1PZNA 1Z47A 2HUPA 4KYIB 2AXNA 1GUAA 1P6XA 2C78A 4ITRC 1TAGA 4RSGA 4W5WA 3KDSE 5FBLB 5J5CA 4HLCA 2C8VA 3U60B 4C0QC 5H70A 4LGMA 4Q48A 1DAGA 1XJ0A 3VNUA 3PUYA 3LDAA 3M1IA 2RB4A 5GJWC 4Q7JB 3EWSA 4NP6A 1FNMA 2GILA 1QG2A 2QZ4A 2GKSA 4NCNA 4TMWA 3PFIA 1JBKA 2VHUA 1U99A 2CCKA 5G3YA 2WWXA 2CL7X 3VAAA 3TVDA 3SNHA 2IYLD 2ZETA 5FOVA 3U7GA 3DM9B 3ZD7A 3KQLA 1NVWQ 2D2EA 4Q03A 5FL7D 3X2SA 4EFMA 4K8OA 3L82B 1G4AE 4O2RA 4BECA 4E03A 1J2JA 1KAOA 4GOKA 2WJIA 4PR0A 1CRQA 4XTRA 3PXGA 2XITA 2OBMA 3D7MA 5J4HA 1CR0A 4WXRA 2DFTA 221PA 3IHLA 3I8XA 5CM9C 5JRZA 1L4UA 2IYZA 2ZJBA 3NDBB 4G5OA 3T34A 3CRRA 4JLPA 4NYIQ 1G3MA 2ONJA 1Q22A 2P2LA 1E9FA 1E6CA 1W36B 5FR1A 3ASYA 3O8RA 3T1QA 3OIWA 3AVUA 1G5RA 1XMVA 3W6OA 1IXZA 1E0KA 1DADA 1F2UA 1LW7A 1G3IA 1FUUA 1AKEA 4TWZA 1NG1A 1KO5A 4KSBA 4CEIA 2ZVQX 2XNDD 4HZIA 1NKSA 2H17A 2NZ8A 2Q6TA 4JL8A 4QGFA 4EPXA 6Q21A 1II8A 2BHRA 4TZ6A 5TMPA 2ZI5A 2CL0X 2IF2A 2ZUBA 4OKSA 4OK6A 1OFHA 1YVDA 2BMFA 4KODA 5GJCA 3SFVA 2OCPA 1Q3HA 1ZD1A 3K0FA 1JQLB 3W6PA 4DUGA 4DLVA 5JEDA 2QP9X 3SQWA 2H5EA 1UBEA 4V0NA 3WMEA 4CYMA 3KL4A 4GMDA 2QU8A 3ZS8A 3U7HB 3W90A 2EWWA 2XJ9A 4QHSA 2Q9BA 3VR1A 1G18A 3OFND 4XVQA 1HQCA 1NN3A 1ZCAA 2A2ZA 4CZ2A 4TT3A 3FHCB 4F4CA 2O8DB 1IONA 3V9PA 1KTVA 3PIRA 1NJFA 2RHDA 4GZMA 4Q4LA 3LV8A 2D7CA 1C1YA 1QHYA 2JASA 3AKCA 1V43A 1W4AA 4ZCIA 2QNRA 4JVNA 4IOLA 1TX4B 4BGDA 4B43A 3BB4A 4HB0A 4MUAA 3EZFA 1ZP6A 4BZXA 3QKRB 5TDHA 2QT1A 1OKKD 3GLFE 4ARZB 2WWGA 4MGZR 3EAQA 1NJGA 2IYXA 1GNQA 2GJKA 3BOSA 2JJ1D 4LZZA 1Z22A 2BBWA 2WMNB 5TY0A 3S1AA 3PQCA 4NE2A 1FZQA 4DIDA 2N42A 1P2VA 2R44A 3OIYA 5C2JB 1HTWA 2W2VA 3VR3A 3IPXA 1ZD8A 4DLRA 3UMSA 5FOTA 3HP1A 4YONB 2C5LA 4P4SA 3A58B 4H1VA 1RRFA 1ZVQA 1HA3A 2R6CA 5JBQA 3KQUA 3R7WB 4I81A 2IYUA 2JLSA 4MUBA 2WICA 1GILA 1OJLA 2IW3A 4D26A 1XD9A 2OESA 3WYFA 4Q9HA 2IS2A 1M7GA 4M4SA 4RCZA 4DCNA 5GVSA 4LV5B 4AK9A 2EYQA 1R6BX 3FMOB 1XTJA 1SVKA 3ZH9B 4BZPA 2WOJA 1XWIA 4LHYA 2WTUA 3TSOA 1KI6A 4HUQB 4PSAA 1KKLA 2PJZA 4ZCLA 2NZJA 4KO8A 5EUMA 4W5HA 3T1OA 2D3WA 3BORA 1DAIA 1Z63A 3AGQA 2MSDB 3QE0A 4CEHA 2V54A 1X8KA 2ZR7A 2X8AA 4ZDIA 5EE9A 4B48A 2B21A 3FKSD 3SI7A 3BK7A 3WXMA 5IF9A 1D6JA 2XNDA 3EARA 2B6HA 4ZKEA 4A0RA 1KDRA 3EIEA 4I1VA 1RIFA 3K8YA 4TQUS 2IWHA 1G4UR 3WBKA 1SQ5A 2Q9AA 4B35A 1NN0A 3I1FA 1EX7A 3K0SA 1IOZA 4MGYR 1DBSA 1S8FA 1OH7A 1EXMA 3ZZTA 1VCIA 4OK5A 2FFAA 2HXYA 2ZVPX 4M9XA 1BIFA 3OFNA 1H65A 4TMKA 1W2GA 2F9LA 3K0AA 4KAXA 1QHSA 3T61A 2CBZA 1FPMA 4XTCS 4Z8YA 2OFXA 5DN6D 5FL3A 4TYPA 2VEDA 3W34A 1OIVA 2D74A 3DHWC 1V5WA 5KSOA 3GJ3A 5P21A 2NPFA 1KOFA 2BOVA 3CZPA 4NKRA 5AJYA 2ZRMA 1SVLA 3FMPB 1CS4C 1E2GA 3FKSA 2JJ1A 1GKYA 1E79D 2FU5C 2FEOA 1EFTA 5TVKA 1K6MA 1DARA 1VTKA 4DKXA 3U3MA 5FTNA 1NNEA 4DWJA 1JALA 2ZR0A 3NWJA 4OHYA 3HYTA 4PAQA 1KJYA 1YZGA 5JS7A 1KGDA 3MWLA 1AK2A 1CLUA 3A6PC 3I3SR 5BXQC 2C9CA 2HT6A 2W0MA 2BC9A 1P60A 1GL7A 1KY3A 2QT0A 1GG2A 3K9LA 3I8SA 1G16A 1P61B 1T5LA 1JXMA 2CK3D 4HZUA 1T8TA 5IT5A 1ZIOA 1MR3F 1KI4A 1EFHA 5DN6A 2QMUA 3KUDA 1E9EA 3HU2A 4F38A 3SYNA 4O25A 5TARA 1QDEA 3VKWA 3NBFA 1MOZA 2O8EA 1BOFA 5AUNB 2WWIA 3GLHA 4A8JB 1R7RA 1WF3A 1CJMA 4MITA 4KLZA 5G3ZA 3NDPA 2EU8A 3Q8XB 2VIIA 1GKIA 3KQKA 2KBFA 1N0WA 2OEPA 5FI1B 2C04A 2JDIA 3SHFA 4Q00A 1NG9A 3F8TA 2JGNA 3ONWA 5K8TA 2CHGA 4I99A 2BBTA 5DHAA 3IEVA 3NBZC 3KKNA 5JZVA 1DPFA 4RD0A 5EUQB 1P72A 1G7TA 1YZTA 3EASA 2GESA 2O0KA 3IDQA 2GAOA 4QM6A 1XEWX 1DELA 4ZI3A 1U98A 1LB1B 1KYIA 1KI6B 2CE2X 2YJTD 2O8DA 1JJVA 1R8QA 2OCAA 4KITB 4N0DA 3REGA 1T3LA 4V0LA 1G8YA 4DCSA 4P4SB 2HLDA 2ZRCA 4Q66C 4RD4A 5CM8B 1MH1A 5EQTA 1QVRA 1OB2A 2QBYA 4ASUD 2OE2A 2BWJA 3PG5A 3O8DA 5FPTA 1KY2A 5CK4A 2OXRA 1IY1A 1HURA 1TQ4A 3QF4A 1S2MA 4LJ6A 4Q4JB 3EA0A 3RRYA 4E5UA 4C0KA 4CF7A 2QA5A 4EQ6A 4BLSA 2EFGA 4HB4A 4DZZA 2GRJA 5AUOB 3QENA 4L15A 3BB3A 1FMLA 2OCYC 3CWQA 1IQPA 1KI1A 3SFZA 3Q7QA 3KXLA 5IDVA 1QRAA 4A2QA 2DWPA 4TLDA 5K8IA 4LBYA 5E95A 1JPNA 2ZQ5A 4URVR 2H8KA 1N5JA 1W46A 3SYLA 4PAMA 2B8WA 3CUEF 1SHZA 1OXSC 2W0SA 4W5JA 1XDBA 4LOAA 3A36A 1GRNA 3MUFA 4DDTA 4KFRA 3VR2A 4XVUA 3R8FA 1RPZA 5JWOA 4CEHB 4TMZA 1JR3A 1XCGB 5LPNA 4QFMA 5DYIA 3J81k 2ERYA 4RKEA 4Q1EA 2HF9A 3GLGA 2WJJA 2WKQA 1ZM3A 3A1TA 4QRHA 3B8HA 3CM0A 1IN6A 3WYAA 2ZJOA 4X8OA 2P5TB 121PA 1UPTA 2QTHA 4NCKA 3JZMA 1WA5A 3VR5A 4AD8A 1CR1A 5UKDA 3DOEA 5CYPA 4PC6A 3P4XA 3U3JA 1U0LA 2ZAOA 2BBSA 2R62A 4GBMA 3C5HA 4MGIR 1MO4A 2CE7A 4EAQA 2ZSBA 1BYIA 5BW8A 1N6PA 3HPQA 3U6KA 4DT1A 1OSNA 2GZHA 721PA 4MRVA 3CBQA 3C5CA 3VX4A 4P32A 1AS3A 4TQAA 3UWKA 4ESHA 5FUWA 4LJYA 3IGFA 4N3NA 5KNBA 1LNZA 1OXXK 1D8TA 4LYJA 5JHGB 4QBFA 4QGHA 4HAWA 4WZ6A 1RJ9B 3VR6A 3QUSA 1Q0UA 2DBYA 1E2LA 3IKJA 2IEYA 1J70A 2KJQA 3IUYA 3SZRA 3PVSA 3OE7D 4P33A 2OZEA 3MLEA 2Z4SA 2ZRFA 1KZ7B 1ZNZA 4M1KA 5TXGA 3E5HA 3QJYA 4L16A 2ZJ8A 3BH0A 1WCV1 4Z54A 1W4RA 1Z3IX 1F60A 1N6RA 1NLZA 4XSGA 1G8HA 3U4QB 1TQDA 5E3HA 1NVVQ 3H0KA 2IT1A 4B3GA 2CMKA 1SHKA 2CHVA 3UWOA 5KTYA 3ADDA 1FNNA 8OHMA 3SS8A 4NTZA 1T3HA 2Z6VA 4G5GA 4LJAA 4D0GA 2AD5A 2D2FA 2CNWD 3EC1A 4MGKR 4JBYA 4BASA 5KPDA 1G1MA 3BD9A 4US2R 1F6BA 3ASZA 3ZYCA 5C4GB 1UKVY 1Z6GA 3L0PA 2ZI3A 1W48A 2PX0A 3GFOA 5FOUA 2ZI9A 1DS6A 3O47A 4JVSB 4L8GA 2J46A 2VF8A 1UAAA 3KQNA 1I2MA 1XBTA 2SHKA 2DFKB 1G7CA 3CRW1 2ZRJA 4NPHA 2AR7A 4LDJA 3FKQA 3CX8A 4IDNA 3TSZA 4Q4JA 1GRQA 1HT1E 5KOYA 3B9QA 2J0SA 3TNFA 2DR3A 3ADKA 3K9HA 4QGAA 3FTQA 4JKIA 4KI0A 4CW7A 2WHXA 2QSZA 2P6UA 4TL6A 2Z43A 3RWMB 4LJ8A 3HJNA 4DVGA 2FSIA 4Q02A 5EE5B 3QF4B 4PHHA 1BYUA 4LBZA 3SHWA 4GI7A 1P3JA 1X3SA 2OG2A 3WNCA 1NMXA 1BH2A 2ZS7A 3KJEA 4M9QA 5EE3A 4B2PA 5KNDA 2GAAA 2VL7A 4B3BA 1JAIA 3RANA 3ZZ0A 4V0MA 3GLHB 1TL7C 2VSXA 2JLQA 3OEEA 4IDOA 5FBRB 2ZYTX 3LFUA 2G77B 4LYFA 2XEXA 3DO6A 4QBHA 3EPJA 1SXJC 4IHQA 3T1TA 3GMTA 3BGWA 4JVLA 4OHVA 4A4DA 4HDOB 1XXHA 1KSGA 3KJHA 1R10A 3ZJYA 1XFAA 3SJAA 4H9GA 4LY6A 2WAXA 1XTIA 2P65A 4ZDKA 3LBHA 2QAGB 1SGWA 3EZ9A 4CDGA 1KMHA 2GJAA 4TLAA 3GPLA 2NIPA 2JLVA 4JLAA 5FPKA 5E4FA 3U3OA 2V6JA 1YJ5A 2WBLC 1XPUA 3SJBA 5HE8A 2W2TA 4LBWA 1XD2B 4ZCMA 2X19A 1DAKA 2QORA 2VQSA 4KCGA 4M1OA 4YDHB 1VIYA 1GVNB 4RD2A 1OKKA 2FJUA 2QI9C 2YWHA 2XZOA 3DMNA 5JLJA 1E2MA 1XNJA 3OE7A 1RRGA 4DC9A 2CLSA 1VMAA 3AEZA 2RAPA 1AIPA 2EYUA 4UNSA 3AP1A 2IWRA 1DAEA 5EXPA 4RFSA 1VYVA 3RAPR 3SEAA 3OAAA 3W3AA 4AKHA 1GITA 1IHUA 5HCNA 1TU3A 2K5UA 1VHLA 1J8MF 1Z0IA 2KI5A 4F7WA 5AJZA 2QGNA 5LDDC 4UNRA 2Q9CA 4TL7A 2H7VA 3ZDQA 1G41A 1MKYA 2WAYA 2ZRIA 4NYMR 3DZDA 4PTLA 1KAGA 1KZGB 1P2TA 2BEKA 2QMHA 4CEIB 1G7RA 3UIEA 1ZM9A 2ZROA 4OBEA 4QKQA 2XZLA 3ZZUA 3LX8A 4LI0A 2AWOA 1JB1A 3B1XA 3K0AB 4QBIA 4BFVA 4PPGA 2E1RA 3I61A 3T15A 1UDXA 1U0HC 3KFXA 2GVDC 1XJCA 2J9RA 2ANCA 2RGCA 3EA5A 5L3VA 4M1MA 4A15A 4JLDA 4HAVA 3AKDA 4DB2A 1UKEA 1Q1EA 2EVWX 5KSPA 3RWOA 2F55A 3WMGA 3MWJA 2CJWA 2W58A 3W5IA 2MMCA 2YZ2A 5CIQA 5FH9A 3C15C 2C98A 1T0JB 1ZU4A 1EGAA 4TTPA 4DLXA 2JLUA 4HYYA 2LWIA 2IX3A 1Z0JA 1PLLA 4ZIRB 5JRJA 4IFEA 2GCNA 2LCFA 5TV2A 1G9XA 1QF9A 3SYKA 4A0FA 3IIJA 1Q57A 3Q3JB 3GJ7A 2ZAMA 3X1ZA 1FTSA 3OHMA 3OESA 4YXWA 3AVPA 4C0HA 1DTSA 3AKYA 1TQ2A 4DHEA 1CJVC 1KDPA 4LHVA 4S2EA 5BN4A 3WYGA 1ETUA 2YOGA 2AD1A 1KK0A 2G1JA 2Y8EA 3RABA 4O3MA 3IHWA 3UG6A 2G1KA 1PJRA 2JDID 1XPRA 2NQ2C 1L8QA 4LJ4A 2BMDA 5CK5A 1P9WA 4ABYA 4BLTA 1SVIA 4ZKDA 1COWD 5LB2A 4BFSA 3ZD6A 3R9XA 1HYQA 4KFTA 4R9UC 5KNCA 2GWHA 3U44A 1XTQA 1CXZA 1M1YE 2FA9A 5G41A 1A2BA 4D4JA 4MDFA 3LW7A 1FP7A 1TPZA 1PVOA 1JXOA 2RCNA 3KTAB 5JSZA 1UF9A 4I1OA 1E96A 2OLJA 1PUIA 1G7SA 2PLFA 5DYGA 1XMSA 3GJ5A 1M6NA 4QNRA 4C0LA 4EPYA 2PBRA 1KK1A 1UBFA 3H2YA 1OLOA 4Q47A 2DWQA 4V02A 5EP1A 1JI0A 4YMUA 4HLDA 1T8UA 5EZ6B 2ZRDA 4Z1MD 3AVTA 1NLYA 2QG6A 3TUZC 3TAUA 5K8LA 4OK3A 3NC0C 5CLQA 1O3YA 2GEVA 2PMKA 4Q9IA 3SBDA 5BYJA 2BJWA 4FN5A 4KU4A 4ZI2A 5HR5A 4NH0A 5DE3A 1TEVA 5FBWB 3V4RA 4M22A 4PQYA 1Q3TA 2ZYWX 4RD6A 4LHZA 1W1WA 3NC1C 5AUPB 1Y63A 5CJ2A 2CL6X 1AQYA 4R7ZA 4POAA 3TK1A 3RC3A 1TF5A 1RKBA 1TMKA 1KMHB 4BRUA 1I4TD 2YNMA 2I1QA 3GJXC 4CIDA 1FL9A 2J0QA 2ZU6A 1L4YA 4M1SA 4IFBA 3DZ8A 2DB3A 3TRFA 1P75A 2QN6A 4TMTA 2BJVA 5AWFC 1XZPA 3CPEA 5SZKB 4NBSA 2OFOA 2CEAA 1US8B 2V3CC 1R8SA 2JJ2D 5F9HA 3MG9A 2V1XA 1XCMA 1S96A 4BFYA 5DO9A 1KI2A 2E9SA 3K9NA 1RZ3A 5EP3A 2ZI4A 3RDPA 2F1HA 4B6FA 4URXR 2ZU0C 4M8NE 5AJWA 1X6VA 1XRJA 2E87A 2PH1A 1KNQA 3EZ6A 3RRNA 2VP0A 2QPOA 4PSKA 2FWRA 4MKFA 4A8JC 2NMVA 2CXXA 2A3RA 3M6AA 4TT3D 4V03A 4D0LB 4DIEA 4KHZA 2QP4A 1ONBA 3FB4A 4MRNA 4PHTA 5FPHA 3LW8A 1M2OB 2I1VB 2IUTA 2VP5A 2FZLA 3KKOA 1UJ2A 4F92B 3IBYA 2Q21A 4FWTA 3U7FB 5CLLA 5DLQC 2HV8A 5L3QB 3EPKA 3Q5DA 1MO3A 1F2TB 4V0ME 2R6AA 3SC3A 2OLKA 3WBJA 5SZHB 3VTKA 2QY9A 5KU1A 2ZE6A 3KJGA 3OZXA 1ZM2A 2PLRA 1W4BA 1NBMA 2CVHA 1XEWY 1Q12A 1XD2A 5FFMA 3A8TA 1VCOA 3OEED 4FXPA 3ZS9A 4A82A 2AN9A 4JSTA 4JT4A 1F48A 4GT1A 2IF0A 4Q1FA 4G01B 1II9A 4OHXA 3RS2A 3P27A 3UK6A 3K09C 4DJTA 2ECKA 2QRNA 2IXGA 3GEEA 3PUXA 1S3GA 3UKDA 4R71A 1GNPA 2JCSA 3U44B 4KXFB 4G3XA 2YINC 3MMPA 3BC1A 4YLGA 1P7CA 1GTVA 1YR7A 2J87A 3HPRA 4FCTA 4MKIA 1YRBA 4XWOA 1Y3AA 4ZV4A 4Q1CA 3JZAA 3U4QA 2XB4A 4Q4HA 3V4FA 3AF4A 3VR4A 1E2FA 2WPDD 1Z0DA 1TUIA 3AF3A 4JYCA 1WE2A 2WM9B 4OQNA 4WW0A 4DEXA 2GEUA 2HDNB 3CPJB 2REXB 5FPSA 2NG1A 4JMPA 2O0JA 1D9ZA 2KBEA 3RVBA 1N6HA 2YYZA 4E07A 3NVAA 1ZM7A 2O8CA 5BWMA 2R6GA 3KXKA 1Z28A 3OEHD 1TUEA 4JVMA 3AVYA 4TZ0A 3EC2A 2GNOA 2C77A 4Q9KA 2PZGA 2VP9A 3JVVA 3CH5A 4PO8A 1EFRD 2GXQA 4I4LA 3MAAC 1XEFA 2IC5A 2IYTA 2BV3A 5BYKA 2O8BB 1H8HA 2ERXA 2PCLA 2VPPA 4DT1B 3RSLA 3B13B 1CKEA 3T06B 1QBKC 3WY9A 2JIZD 2P3SA 3IBGA 2OAQ1 1P4SA 1XJQA 4Y0VA 2BKUA 3QXCA 3HR7A 1W4CA 4H1UA 4OI0A 4BWYA 2REBA 1M7BA 4U5XA 4JZKA 1LF5A 1RVDA 1KK2A 1ZINA 5JI2E 2C2HA 2XNSA 1US8A 3L2OB 3FFBA 3QG1A 1E4VA 2AWNA 4PFSA 3F5FA 4DBLC 2P67A 3EIQA 1P5ZB 4C0BA 1J99A 2GDJA 1UEIA 3B1ZA 3N5CA 3I92A 3WHKA 1HT2E 3LQRA 2V1UA 4AG6A 4YMWA 1BMFD 4G5SA 3PR1A 4J0QA 4UNNA 4Q1DA 4OL0A 4FI3C 2QM7A 1NY5A 1S9DA 4G5QA 1HE1C 1CJKC 4FCWA 1AS2A 2V4ZA 4LHWA 3R7WA 5EP4A 1E9SA 1PLKA 1U2RA 2WWYA 4WOPA 1E79A 1XEXA 3WRXC 4C0JA 2JLWA 3QXJA 1XCPA 1Z08A 3A4NA 3EW9A 4QJ5A 1NN5A 3RSOA 4B2LA 3S1AB 2CNWA 1ZNWA 3FDIA 4ILEA 3U61B 1AZTA 3X1XA 2NGRA 3A1UA 1F2TA 1W0KA 1KDOA 4DDVA 3PEWA 3VKHA 4B44A 5HZHA 1U8ZA 1EFCA 3SBEA 4MRPA 1Q1QA 1WMSA 3RHFA 3UMRA 1TF2A 2QENA 3VU9B 4BUJA 1QG4A 2REOA 1N0UA 2VP4A 1U8YA 5L3QA 2V55B 3QKUA 3TE6A 2W6JD 2ZPTX 5HZKA 1KDTA 4LYAA 2AFIE 4MH0R 1W36C 2G0TA 4LJ9A 2HCBA 1OIXA 5DGXA 5BN5A 1XTSA 3LVRE 1BMFA 3C8UA 3EWAA 2C95A 2UKDA 3GFPA 4PC3A 5JWRA 4C9BA 1NMYA 1ZC4A 2HCJB 3P26A 5A4JA 2UZ3A 2ORVA 5C1BA 3NTUA 4YMTA 5B58C 1FUKA 3A1SA 4GDFA 2XTMA 3DVLA 3NEJA 4Q21A 3LLUA 4UXJA 1ZD9A 1WXQA 3GJ6A 3QKTA 4HUTA 4KBFA 1E0SA 2J1LA 5EZ5A 4HDCA 2DHRA 2HEIA 4PO1A 5DHFA 2PMDA 1KI9A 2WSSD 4OJKA 5KSYA 3E70C 4MYTA 5JI3E 2O8FA 4Q4AB 4HLUA 2ZXUA 1IN7A 3MJHA 5F98A 1RE0A 2OCBA 2W6ID 1E9AA 4UJ5A 5DI3B 3AH8A 4B34A 1EWQA 2O8EB 1CF4A 3PV0A 2QMEA 4AI6A 2OILA 4TYQA 3AV0B 3BRWD 1XB2A 4NCIA 2F7SA 4AC9A 1EWRA 1U81A 4NU0A 1AGPA 3F0TA 3TIFA 4OYHA 2VF7A 4BFZA 2FGKA 3KKMA 3TQCA 2TMKA 1MABA 1KNXA 2JJ2A 5AUQA 1IJFA 3ZVMA 1BO6A 3QPWA 4URZR 2F1RA 4YQFA 4BFTA 1DG3A 4C0SA 3AVWA 2XJ4A 4AYWA 5AJXA 3OIUA 2X2FA 1WQ1R 2WIAA 3FWYA 4GZLA 3B5JA 4A8JA 1ZC3A 4L5BA 4Q19A 2O8CB 1R0YA 3C7KA 3P32A 1OIWA 4RY2A 2HT1A 2R9VA 4FIDA 5HPYB 1ZNYA 1A82A 2YC4C 3DKPA 4EPWA 4DLTA 2ZITA 3LXXA 3BXZA 5FOWA 4ZDJA 5KDOA 2D06A 1Z2CA 2QTFA 4JJZA 4KBGA 4LYHA 4Q7LA 4DB4A 2NO6A 1VYUA 3CB4A 2BMJA 4FCVA 4EPRA 3BWDD 4W9MC 2WSMA 3LBNA 4Q1AA 4B3XA 4EDHA 2ATXA 4Q01A 3CONA 1SXJB 1E2DA 4TTRA 3VFDA 5IK2D 2IHBA 3FVQA 1ZNXA 3EPHA 3HR8A 2D4HA 2ZM5A 2GK7A 1QHXA 5A0FA 1D2EA 2IUSA 4V0KA 3G0HA 3R9IA 2GCPA 2BDTA 4W7SA 3CX7A 1CJUC 3D8BA 3TSWA 3MD0A 1QZXA 1KO8A 1C4OA 5F3WB 3C16C 4C0AC 4C2UA 2VHJA 1JPJA 5FOXA 2WWFA 1L7VC 4CVNA 5CB8A 4A92A 1N6KA 5FUYA 2RGNC 5FL7A 5KUTA 1G5PA 2V9PA 2W6JA 4OHWA 1JEDA 1KMQA 1IN8A 4XWAA 3BFVA 4ZIRA 2J59A 3ZIAA 5J40A 2FSFA 3ZGXA 4PC1A 1B0UA 1UM8A 2V6IA 3K0EA 5JWHA 1PLJA 1X1SA 3I62A 1OT3A 2RGXA 3GQBA 3PUWA 1E2JA 1MABB 2W00A 3SE0A 3FMIA 3N2IA 1FFHA 3WRYC 2WPDA 4JYBA 2FFBA 2QE7D 4C4PA 4QG7A 1LS6A 4PC7A 4KFSA 5EP2A 3OIVA 5HKKA 4PX9A 1DO0A 1Z0KA 4M2LA 2OHFA 4DDWA 2F1JA 4JIMA 2WIBA 1A1VA 3CPHA 3PEYA 2WV9A 3N70A 1CTQA 2FV8A 4U02A 3I73A 1HV8A 1OXTA 2A5DA 1VG9B 4C3ZA 1N6NA 1VIAA 1VKJA 2F43B 2ZYVX 2Z5FA 4IVPA 4ZO4A 3LXRA 5IRCD 4DUGD 2RGEA 1J90A 4KJZA 3L8YA 5E7JA 2RGBA 4IOJA 1KKMA 4HAZA 4M9ZA 3AGPA 3ZIAD 3E1SA 4US1R 1QHHB 4NYJQ 3QKSB 1GKUB 1N3BA 2GHIA 3FGNA 4UXHA 4PHGA 1R5NA 2L0XA 3CZQA 5FTKA 2DYKA 3NG1A 4A6XA 2OV2A 1DVRA 4OQMA 4DLWA 2YWFA 4WZBE 4PAOA 4QL3A 4DCTA 1ZRHA 3FYHA 4RFVA 5A5GA 5EJEA 1GIAA 4AG5A 4EQ6B 1FX0B 4II7A 1E2EA 3L0IB 2IYWA 4KVGA 2ZE7A 1MO5A 1EG7A 1YRAA 3O8BA 1NSTA 3TUIC 4L9WA 4AYTA 5FUVA 2FF7A 3I5XA 3CX6A 1JEEA 3RRMA 4A0HA 1SVOA 3CRQA 1VPLA 4DEYA 2AKYA 2ORWA 1E32A 4E09A 3BE4A 3IQXA 4US0R 5G53C 2DY1A 4ACAA 1E98A 1Z0FA 4BFXA 4XD7A 1Q21A 4HAUA 2O8FB 4EIWA 3ICEA 2ZJAA 3JVUA 3QOFA 5K8UA 1G5TA 4P4UA 3AP3A 3REFA 1UDWA 3T35A 4NYJR 1OXVA 2GZAA 4JL6A 4WAUA 4LSGA 2HJGA 4KSCA 3RS5A 4A2PA 5M04A 2X77A 3T5DA 1ZW6A 4PO9A 1X86B 3DDCA 3TR0A 2WWHA 4B47A 2GJ8A 3MGCA 1WDTA 1ZYUA 3THYB 3CNNA 1Z07A 2ZRAA 2BMEA 3TW4A 5ELXA 4BPBA 1D9XA 5D3MB 4NYIR 1W7AA 3BBPA 2W83A 1EFRA 4DLZA 1IN4A 2PEYA 3K0CA 3F3YA 5EXTA 2AK2A 4LC1A 1B23P 3AVOA 1U8AA 2QAJA 2OBLA 3HDTA 1OH6A 2PL3A 2F9MA 3QNUA 1A5TA 1OYWA 2A5FA 3P1JA 2XXAB 4I1SA 2BKEA 4QJ3A 4XWKA 2F43A 2C03A 4EPVA 1E2QA 1R0XA 4Q9LA 3IQWA 4B74A 2X1VA 3CO5A 4QBGB 2XZPA 3I72A 4GMXA 4XD7D 1WBBA 1AJEA 1MRSA 3GEIA 4GOXA 3T12A 1R2QA 3NHAA 3GLFB 1NBME 3U7EB 2OT3B 3MWKA 3OAAD 3QF7A 4LJ5A 5LBIA 3LNCA 1GZSA 2A5YB 2GJSA 4OQXA 4A36A 3LVQE 4M1WA 2Z4RA 4PSVA 3VHXA 4L4UA 4YMVA 3KB1A 2VSOA 3B60A 3BS4A 2KSQA 5KPJA 2QL6A 4NMMA 4GL2A 4ESVA 1YU9A 2BCGY 1CR2A 3LQQA 2V7QA 2YHSA 5FTLA 3SU8A 4M0LA 2VRWA 1AZSC 2IYVA 2IS4A 3GLIA 4XJXA 3MFYA 1XZQA 3M4YA 2IA5A 4NZYA 1VCMA 1G21E 4QHYA 4IDHA 3RS0A 3C14C 2GCOA 3QXXA 2Q3MA 4JT2A 2F1IA 2FFHA 2RGAA 2CHQA 4MA4A 1X8JA 4P31A 2ZE8A 3UXMA 2W2XA 3BAFA 1R5BA 4BLPA 1M74A 1A7JA 1EESA 3TBKA 3W6NA 3N2EA 1NL3A 2XTZA 3A37A 3K1JA 1PUJA 2ASEA 3TH5A 3CF0A 3V00A 3EIHA 3OEHA 2PCJA 4TYWA 4KLNA 3W8RA 4PZZA 2XB2A 1VG1A 4TSFD 2V7QD 3B1YA 3W9YA 1DAHA 5FBQB 621PA 3LLMA 1Z0AA 5HE9A 4EFNA 2FPLA 1VCNA 1UKYA 2J0UB 3KJIA 2EFHB 2IYYA 4G1UC 3CRMA 2ZJ2A 2FPMA 4UJ3A 1YKSA 5IK2A 2AX4A 4A2WA 2XOKD 4D80A 1G3RA 4IOMA 1H8HD 1S9HA 3UATA 2R2AA 3CNLA 3RYTC 3ZQ6A 2HF8A 3AF0A 5C18A 3TAHA 5ANRB 1YZNA 1E94E 1OFUX 4WBSA 2FNAA 1P2UA 2J0VA 4GNKA 3PJRA 5SZJA 1SULA 2IXEA 3TVTA 4JLVA 4A0GA 2VHQA 1Z6XA 5GJBA 1NVUQ 2DPXA 3ND9A 3QPVA 2B92A 2YOHA 5SZIA 1NSFA 3H86A 2VTKA 2ZS8A 2IYQA 3X1YA 2IYSA 2WJHA 1JR6A 2ZIAA 4RKFA 3GEHA 4XH9B 2B7CA 2QAGA 5JEEA 4Z1MA 4JLBA 4D4LA 1AN0A 2DFLA 1A2KC 1XMIA 4Q4AA 2G88A 3A1VA 3L8ZA 2JEOA
chains in the Genus database with same CATH superfamily
1I0LA 4UKDA 5HM8A 2ACEA 3DVAB 1JB9A 1R4AA 3E9DA 2Z57A 2ZRNA 3LC2O 1KH1A 4K9RA 4OQLA 2HRZA 3U3KA 1ZGJA 2DJIA 3PUZA 1G8PA 3Q7TA 4R2IA 4YJ2B 4B4KA 1KFKB 1U1EA 1DRJA 1A8HA 4YCDA 2ONKA 1SZPA 1RW4A 4ZCTA 5D87A 3H0EA 4EB8A 1EXDA 2BGGA 3K5HA 2A33A 4PN3A 1NXWA 4URUR 1W0KD 1QYCA 2HNBA 3UJPA 2K2WA 2AFHE 3NKVA 5E7MA 3SXJA 4C14A 3U4IA 1RJFA 4G0ZA 4BUCA 4A6PA 4EGJA 4DLBA 3FUXA 4YCSA 2CXPA 1VJ5A 2VK2A 1FX0A 3SSMA 4M1TA 2JLXA 5TX7A 3CW2A 2HRBA 2P6MA 2WJGA 3NBYC 2QTMA 1DB3A 2PU5A 1Q7BA 3IQFA 2GXSA 4U2FA 3U7JA 1DFGA 3DO5A 3R7AA 2P5YA 3GLGE 3VPGA 5D5QA 1NBAA 4JV5B 3PEVA 2VLIA 1R4MA 1IY0A 2QR5A 1E1QD 4P3OA 2QT9A 3LZDA 4QYXA 3G79A 1B6GA 3C6QA 1QGAA 4ENWA 2FFQA 2HREA 4X8LA 5B1EA 4EHLA 1UDCA 5KYGA 3N05A 3MS4A 4QDTA 5TQVA 1H8EA 1U0JA 4D3ZA 4M8LA 4HEJA 3KVOA 5K0FA 3IKVA 4B6EA 1ZZEA 4MV4A 3LA6A 3WBFA 4QSHA 3S0JA 3PDIB 3GLSA 5FLKA 4EYOA 4F6RA 2FDCA 2D1YA 1YASA 3ZVNA 2DCUA 2XTJA 3DR3A 4OH1A 3FWNA 1OASA 2RIPA 3EWNA 4KZPA 7REQB 3WL6A 3DUWA 3AI7A 3LCJA 1U90A 3IIMA 3PSAA 4PZ9A 5CB4F 1JAHA 4PLGA 2IXFA 1D5CA 2G4LA 3INNA 5C8XA 1H2HA 5K0GA 3T7SA 2JLZA 2YS7A 2ZJ5A 1UQRA 3O4HA 1IOLA 3Q85A 4M9UA 4GP9A 5G0SA 4KQKA 4UHEA 5JSZB 4L4ZA 2GKGA 4FHFA 1T91A 4K3UA 5KKNB 5CVJA 2IS1A 3MS2A 3TI7A 4F91B 4PGGA 3ZJ5A 4CT5A 3P4YA 3NP7A 2EWVA 2DCMA 4QOSA 1U2DC 3RIEA 3T0GA 2CMFA 5TMEA 2QIOA 1NKVA 5FWDA 1R0WA 5JJKA 3QK7A 2E5LB 3VR5H 1A9OA 4PZEA 5BOVA 1J7KA 1EWTA 1CP2A 1G2PA 5IFLA 1W5AA 3E8MA 4OQPA 1TYCA 4A16A 5AVUA 3K09A 1YB1A 1JIVA 2HKIA 3GJSA 4Q7MB 4NBNA 5TGTA 2RGDA 3B1VA 1PUXA 3UMJA 4DYVA 2IELA 1S2IA 2ONYA 4ENTA 3EZYA 2GXAA 3A2KA 1Z16A 3CY6A 4PFQA 4BQSA 2H5JA 3G2HA 5CT6A 1C3OA 1RP1A 4MO9A 4Q05A 5FV4A 3ZJUA 4H16A 4YECA 2C7BA 3QYAA 2EJCA 3LQ2A 4QU5A 3WGGA 2HYIC 2FX5A 3B9PA 1CQIB 1RAGA 1KI8A 1AF4A 3G0IA 4PM4A 4RVNA 4X61A 1XHEA 2X4LA 4BWFB 4DN6A 2JIQA 2PTGA 1AK1A 4U7JA 1EFUA 3T3DA 1WD5A 3QFFA 1CRZA 1LF0A 1T4DA 1T5SA 2WMYA 3BIFA 5JMPA 2DUMA 3G0GA 3CNEA 3NIDB 1O2DA 4P3NA 5HFJA 1W5SA 5BUZA 4EKGA 1Z8FA 2VP2A 1RVV1 2OL4A 2PJUA 4K2AA 4UUOA 3WYDA 4Q7EA 1LFDB 3LRPA 1MAVA 1G291 4Q24A 2MSKA 2FZKA 1VOTA 2UXCB 3C4JA 4YN3A 2A9OA 5CHYA 5A9SA 4DRXA 4PCAA 1WBDA 4A0SA 4WNAA 3A1CA 1FYDA 4GQAA 2AFHA 4FGKA 1DP4A 3GGGA 1GLGA 1F8XA 3Q12A 4UNPA 5T5QA 1ISRA 4OHZA 3M4NA 5AW8A 5KYKA 1ORTA 2WIJA 4WCFB 5EFOA 1E1RD 4YR7A 4N0EA 1OHHD 5G4KA 1I51A 2XE4A 4EWLA 2J3MA 1O4WA 1QHGA 3JSXA 1RSZA 1OV4A 1UC8A 3ESBA 4R9VA 1A8SA 1MJGM 4X7PA 2NV0A 1UPBA 3LHIA 1Z0ZA 3LA8A 4V0OA 5IBQA 2KWIA 3MVEA 2KYRA 2I3ZA 3QGMA 3VBEA 4A9AA 1VMKA 2MMGA 5E38A 4BVAA 5JS6A 2JK1A 5K0SA 2G1AA 4MWEA 3NXSA 5JXGA 3SHQA 4HLNA 3E9ZA 1ZR4A 1K8YB 3HBLA 3NHBA 2G71A 3BL8A 1M2EA 4Q7KA 5EUBA 4KMOA 1WXWA 5DIFA 4B45A 1QIMA 1AUPA 2IK8A 4NU8X 5COBA 2X4DA 3RJZA 1OLSB 4RF5A 2H52A 3GR6A 4UEQA 4E2WA 4YJHB 2UZ0A 3I9LA 1TMYA 1DCTA 5D3QA 3SXUA 1KXZA 5ERYA 3WB2A 1XNRB 5FTMA 2V6FA 1JYEA 4OLJA 4OSEA 5FPQA 4F85A 1H6AA 1TMOA 4NHOA 4QEDA 3T8YA 4ETWA 4Z8XA 4LF5B 4IG9A 2XNHA 2Q5LA 2WJVA 3JASA 3SF0A 2NV6A 1C9NA 3DKVA 3IP9A 4FFWA 3M6FA 4Q16A 1NX9A 1KQFA 4CGZA 2HQOA 4TKZA 2WJAA 2HNKA 3OWXA 1V2HE 1T9KA 2FSUA 2AN5A 1NDUA 2OAP1 3UAOA 3NV7A 1QXSA 3HG7A 3ZVLA 2ZB3A 3RSCA 2JC3A 4XRRA 2PL5A 4PF1A 4A3SA 1LC3A 4JYPA 4CPDA 2BEWB 2YQZA 2J4DA 2PH3A 3AIOA 3BH7A 3RUAA 1ZD4A 5EFZA 3JYHA 1TTHA 1GTSA 3D3JA 1TVEA 3VMFA 4WACA 4GMKA 4RESA 3T3GA 3BGVA 1LVUA 1TJNA 4I55A 1DAFA 4MQEB 4UCWA 1S3IA 1Q11A 4YWHA 1EDOA 1JLHA 3RH0A 3CR7A 3CIFA 2XSZA 2CHUA 1L7RA 1VSQA 2QPLA 1GRRA 3ICCA 4N39A 2H65A 3MWDA 2X9LA 3CF2A 3QVWA 1HNNA 3OTWA 5AI5A 3KR9A 2ST1A 3TKLA 3ZDZB 1EAYA 3O8OA 2ZG6A 4LF6B 1U8EA 2QM8A 4D4IA 5FTJA 4ARIA 4IZHA 3G2LA 2NZ2A 3ZHRA 2B8JA 5LQRA 1T34A 2MTBA 1P9LA 3TQIA 3LYLA 2EFEB 3LP5A 4G5XA 4TMFA 1Q0ZA 3RTBA 3IAM1 1G20E 1WTCA 2CFOA 3E2PA 3RRXA 1ZGAA 4I9NA 3K6SB 1O6GA 1E6EA 5FPPA 1IAQA 3BD7A 3DL0A 4R2HA 3W3ZB 2IPXA 1BJTA 4URWR 3TMYA 2XYVA 4DLSA 1RCTE 1X1EA 3O5AA 1IXKA 3PUVA 1NW7A 3K3PA 4L6AA 1X77A 2I1LA 1FS6A 3G1TA 4Z9AA 1RIIA 4RUKA 5C3MA 3AX6A 3R09A 3GGPA 2A30A 4K6HA 3T5AA 3CWZA 1E64A 1TM3E 5E7IA 2FCRA 4MCJA 1V11B 3ENWA 2PGAA 5EXSA 3W3AD 1JVNA 2WJPA 3AEQA 5AK0A 1X15A 3OMXA 4NDZA 1Y1LA 3PICA 4P6VF 3RRZA 1RWQA 2RH5A 3KQPA 5A4KA 2PZ8A 3HKBB 2GZDA 4P35A 4L22A 1N33B 1VLMA 2FG7C 3OUUA 2ZJYA 4RS3A 5GVRA 1RDFA 4YUVA 3R8CA 4F0JA 3V7FA 3N2ZB 4PG8A 3THXA 3EAGA 4RV4A 4OO3A 1CZHA 3X44A 4XDZA 4XCVA 4G89A 1YAHA 3I4LA 2CUNA 1V47A 4OQFA 2DG2A 3UHFA 4O3FA 1USIA 5KYUA 4B6GA 3ZR4B 3BICA 2CK3A 5AW3A 1ZN2A 3OPXA 3C8DA 1TQ6A 2AOTB 3HJAA 1Q44A 4L7QA 2H2AA 5YASA 3TMKA 3U9LA 1UBTS 2YOFA 3KTAA 4A8PA 3GA0A 4PRZA 1JHAA 3W04A 1HE8B 4EY3A 4F93B 5ALSA 1QIJA 2QEQA 1CRPA 1RLOA 2JATA 5D86A 1OXMA 3CT4A 2R3SA 1BXGB 3CKLA 2PK3A 3UN1A 3L5KA 1D1QA 1EFAA 2HR1A 2X6RA 1OFVA 1V8FA 1FK8A 2E5FA 3LO8A 4UATA 3WMWA 4JWTA 3ZE9A 4MQBA 1L7NA 1V6AA 2CDNA 5LMCA 3I2HA 1NW3A 1E1QA 1U2TA 3M6IA 4GI3A 5EMNA 4BO4A 1YAJA 1M2GA 1T35A 2G06A 2GZ3A 4RK7A 4Y2VA 4HLUC 1YJCA 2XMPA 2XTNA 1ORVA 5H3LA 4O4LF 5HFNA 3ZQJA 1TTTA 3LWBA 3RNLA 1J5PA 2OUIA 3NWOA 3KELA 3KOUA 2ZCJA 3QBTA 3IJ5A 1EX6A 4AZTA 1R1DA 4I50A 4DCVA 2ZANA 2X0NA 2O3TA 1JU4A 4O4HB 2H51A 4KYUA 3HUUA 3SDZA 1OVGA 1ZG3A 3R5FA 2ECFA 3OECA 1WU8A 3SJZA 1SHJA 2ZKIA 3DW3X 4FM9A 4N8SA 2VQDA 2FW9A 3MBKA 3X1WA 2VDOB 5A6SB 1NP6A 3FSJX 3UY4A 4F96A 1XI2A 3PFKA 2Q5OA 2GF0A 4LPSA 3WQBA 3SX4A 3GLIE 4JS0A 4Q9AA 5B64A 3TW8B 4WVFA 2BHLA 1UT5A 2QLLA 3JD3A 1V1MA 4O1MA 5HXAA 2B2NA 3EGXA 3WWOA 4TYYA 4FYXA 2GBPA 1ZOOA 5AFSA 3ETGA 5JPIA 3KWJA 4ENRA 3TLGA 4PBTA 1FDUA 5G1OA 2OZKA 3LCUA 1D1PA 4D0NA 2BGTA 3HMKA 1GUFA 2I8AA 5DHRA 1Z5UA 1YGPA 5IH3A 1OLSA 3K2QA 3B38A 2EBUA 4J1QA 3TGPA 1REQA 2GN6A 4D97A 4X6UA 3V9AA 2C58A 1BC5A 3L6EA 2ZSDA 2LKCA 3PITA 3JS5A 4FEAA 4E5PA 2HJHA 1XRPA 1YIDA 1TRKA 2PEZA 3A3OA 4XQCA 5CDFE 5J4KA 5FTWA 3UWMA 1NIJA 3G0CA 1IHPA 5FUXA 3RVOA 4CEJA 1WXHA 2JGLA 3QQ5A 3B9RA 3MF4A 2ZATA 2P27A 1GZUA 4I6EA 1VHWA 3I2YX 5BSMA 1AGRA 4GRAA 4F5DA 1SIOA 3WZ2A 4MV0A 2I7CA 1HR0B 3I9KA 3KKPA 1I4EB 4EJSC 1UMKA 1Z7EA 4BNFA 5LUAA 1T13A 1KO1A 1XTBA 4YMHA 2QOEA 4XYEA 2RGNA 3QFHA 1DKOA 1A71A 1UZUA 2HMAA 2QJOA 4AT1A 1JHYA 3ZGYA 2F67A 1BKDR 1F17A 3LBIA 3F8SA 3P9XA 4JXZA 5B30A 2XKJE 4PTZA 1ZCBA 2I6GA 3IIKA 5AM1A 2O52A 2PQ0A 5DHTA 3OLVA 4R8RA 1WXGA 2BGIA 5DBIA 3K5PA 3QM1A 4F97A 5L3SB 1ENZA 4MEJA 1U9ZA 3CUTA 4Y0NA 1SZCA 3U4GA 2PS0A 3VSBA 2P3OA 3ZUGA 1H2FA 5JW6A 2RHMA 4FYVA 5FNVF 5LU8A 1XQWA 1U6KA 3OHPA 2R1UA 4N03A 4PZCA 3MTQA 3GD7A 1RNLA 3NCHA 1NUTA 4TLCA 2J9GA 3L7NA 4TMVA 1NFFA 4BLQA 3DMPA 1M67A 4FC6A 4LWZA 1VDMA 4KPEC 2I3BA 1E4YA 3IKTA 2O7SA 3JAKA 4TVSA 4ZA2A 4KQFA 2HYDA 4BFUA 5BN1A 3KOMA 2BDUA 1V5EA 2AG1A 4DQKA 3FBWA 1RC1A 3QOWA 2PE5A 2SKEA 2AC2A 4JX8A 1XNQB 2QQEA 4DQLA 1N6OA 2WZBA 4UQOA 1J09A 1ODIA 5IDYA 3W0LB 1JHQA 2VP3A 5C4IA 3VSEA 1C3VA 4LGCA 3BK1A 4WFJA 5I7HA 2XCUA 2WA1A 1OBFO 4KR6A 3H8VA 3R2JA 1GY8A 4IL5A 4DV6B 4F3TA 5L4SA 1VLZA 3IAHA 1OOEA 3L18A 4I1UA 4JOCA 3THXB 1JFVA 3W8NA 2FOLA 2OGSA 1KS9A 3DBHB 4LTDA 2CVFA 2J3QA 3H05A 1J1ZA 2JD1A 3MTDA 3EN0A 3TGLA 2G83A 4PG6A 5FFNA 5BW5A 5KHOC 2HGSA 1ML4A 2CLFB 4B6JA 5JQGA 1PZEA 2C2MA 1P4RA 2I4IA 1F3OA 3O73A 3A9CA 2ZDGA 4QHTA 4ZU1X 3SC2B 3CSUA 5A7HA 2QSYA 4HLQB 4DSOA 3H75A 4QASA 5K7SA 2C96A 1P8AA 1RBZA 4HI0E 4RLQA 1C0KA 4WA8A 4ETNA 2DFNA 3NYQA 3OI7A 3U80A 2VDJA 3KWLA 2VXOA 3OO0A 4MVWA 5C7IO 3LX5A 2H57A 2B98A 5DK4A 2OV3A 2ES4A 4TS1A 4YAIA 1AHPA 1E1CB 1DO2A 2C2ZA 4JKYA 4NEGA 4R9NA 1HFWA 5F73A 3VVLA 4HB2A 2X3FA 1HLFA 2P3QA 2X0RA 3C1UA 4RLHA 1C1XA 4CDMA 1MV5A 4DCOA 4BOYA 1XZJA 2O19A 1WUIS 4YV1A 3QVSA 4IIXA 1DHRA 2FRDC 3PDUA 4P08A 3T7TA 4AJ4A 1QV6A 1Y5LA 4LXTA 4ER6A 5LQNA 1JZTA 1Q92A 2VJCA 5CURA 4F2HA 4AIIA 4P53A 3EE6A 2IYRA 3F4KA 5GJVC 3KKEA 3ORYA 4L5CA 4GEKA 4N9WA 2OXTA 2P1RA 3QELA 1X9HA 1X1RA 3H3JA 1NMSA 2WW8A 3B7WA 3RIXA 1Y9DA 1GR0A 4X3CA 4JI8B 4MAAA 4DSTA 1LUAA 1LSOA 4HEHA 2IS6A 1GFIA 2F3RA 4HXGA 1X70A 2OTCA 4R1NA 3CBGA 4MDHA 1T0HB 3E0XA 1P9NA 4GGMX 1RWVA 3EPHA 1MNQA 1OWPA 2ISCA 3IQDB 2FGJA 4TWAA 1TB4A 2BFAA 3D3WB 1JU3A 2BR4A 5AM5A 3HYNA 4P4NA 4XRGA 2UVDA 3Q9LA 4RW0A 1I9CA 2WM2A 3FLAA 3FPAA 2PS3A 5AW9A 4W5QA 1OB5A 4IVRA 4ZANA 3K9GA 1U28A 2Z83A 1DRUA 3IV6A 4LRUA 3D0OA 3ZWVA 4L78A 1ZUWA 4IWYA 2PWZA 1NI4B 4R98A 3TXAA 4OI4A 2ZS9A 3VZCA 4NJMB 4HNRA 1ULAA 1LRKA 4LGVA 3SDBA 2VP6A 4RFSB 3ZI4A 5IUJC 1P4GA 3B85A 3ZX5A 3BTVA 1IDOA 5KOIA 2JJYA 3NUGA 4UHFA 1W75A 3RK1A 2W22A 1FDRA 1FW8A 2ZTSA 4NX2A 5L3RA 1ABBA 4FYPA 2QYHA 2PRYA 1JE1A 1NT4A 1ZEJA 2GN0A 1A1SA 3DE7X 4IW3B 4P5EA 3GLFA 1FA9A 1JFRA 5BQXA 4FILA 4HHEA 3CR8A 4MRSA 2IBTA 4K81B 5FIUA 1SKQA 4B9AA 2WIKA 4BXOB 3V1YA 3FE2A 1GWNA 3CLKA 2WUFA 3HSKA 1QVWA 3NEYA 4UUQA 5GONB 3U37A 4CTMA 4YMGA 2P6RA 2A0FA 3ZVRA 3TCNA 3ADCA 2J0EA 5FOQA 3FRHA 5IJAA 2WHPB 4QC2A 4EFLA 4KWTA 1OPXA 3MWYW 3Q5EA 4PV7A 3VTAA 4TYNA 1YRLA 3L9XA 3K96A 1OCEA 2W37A 3HU1A 4WGFA 3C1TA 3RU2A 2OM2A 3M1AA 2NVOA 2OXCA 5HCIA 1U4SA 2BR5A 3BEOA 2Q41A 4R1MA 3BFXA 3RAJA 5BSRA 3MILA 4Q9JA 4RTLA 4NNPA 4EBBA 1UPUA 3D4IA 2JIPA 4UQLA 5TQ0B 1SKYE 3KQVA 5ED4A 3I5YA 1H66A 2J7PD 2O6LA 2PMWB 3D6MA 4INOA 1RYFA 2XB9A 4URYR 3TRHA 4C20A 4F4UA 3LY7A 3MHPA 1EVJA 1QE5A 2EKPA 4H08A 5L4LA 1KSFX 3AZPA 3FFWA 3FAZA 1QFXA 1L1FA 1MG5A 2QMOA 4GKKB 4X63A 4IIFA 4IIHA 2V5AA 4KREA 1KK3A 1Q6YA 2AGVA 3AYZB 1JFSA 2XUKA 5KWEA 4OXKA 3THYA 1MCZA 2AC4A 3GXBA 2ZGVA 1E7QA 3NEAA 3TJZA 4ND2A 2CYAA 1F12A 2AQHA 1XTKA 1Q1ZA 4MO2A 4TL9A 2O06A 3STWA 3CZCA 1NNLA 4CMAA 3UMFA 1GPLA 3R7DA 1KOJA 4ROTA 1PHPA 1DXOA 1I3KA 4KPGA 5CH5A 5KZMB 3KB6A 1N6LA 5JD6A 5ULLA 2JIRA 2WYHA 1VLHA 3G0DA 3FBGA 3GLKA 4B3IA 3EJ6A 2X15A 3PEFA 4B1FA 1J23A 1RPAA 3GJ8A 3LPMA 3EY4A 1BX1A 4I4TB 2BVNA 3LT4A 2FUNB 4TKVB 4DSUA 1T1IA 4BQRA 2VHZA 4HFMA 4RH1A 1NVDA 2IPLA 4D2IA 3FFAA 1C9EA 2FW0A 4CLEA 3HADA 3ONFA 4PSDA 5K3EA 3AF6A 2J32A 5CNIA 4CM7A 3TVYA 2LXNA 2QW8A 5IYZF 4CM5A 3OM8A 3E2MA 3KEMA 4QVGA 4GPTA 4OJQA 3WNZA 4BNTA 2CNOA 1BWSA 2QVXX 1VIMA 3QTLA 1UPAA 4WA7A 5IH7A 1X42A 1C50A 2XAUA 5H59A 4DDKA 4HNTA 4KH1A 4HQNA 4B6PA 4WJLA 3AVVA 4P3YA 1TK9A 4ID9A 2VO1A 4C43A 1ESNA 4H7EA 4Q1BA 5E6RA 2XSZD 4UTXA 3TR5A 3SICE 2QRHA 3T1HB 2YMPA 1V16A 3SXPA 1HYBA 1M1YA 2O2JA 3FIJA 4B3HA 2QD1A 3EOZA 3VJRA 3TD9A 3DBVO 1YI8A 2HJVA 2FKAA 5IT0A 4EJSA 3R9WA 3FPLA 2F6RA 2WU8A 3IJEB 4MKHA 3I9JA 4TLEA 2XOKA 1J8YF 3CIOA 4WTOA 4MS4A 2VZ9A 5GV7A 4BFCA 2I5PO 3HR4A 1QH1A 2QDKA 4W1QA 4EHBA 3NWBA 2QUZA 3H1GA 3DMTA 2O9JA 1D4OA 1QWOA 1EZ4A 1RAFA 1ZGGA 1GP2A 2P78A 2PT5A 3DD5A 3DMHA 5JS8A 2R8PA 4MW1A 2ZRKA 1GAJA 4RPJA 2NWQA 2BLNA 2EL7A 3T9FA 3TN7A 1K5DA 4P92A 2BELA 5B1IA 1ZISA 1PWEA 2VH5R 5LP6F 1YHNA 3QXHA 4X20B 4BNNA 5E6SB 2BFFB 1UFRA 3O21A 1ZEMA 4H31A 4QPPA 2YJZA 4TM7A 3SQMA 3WL5A 4CQLA 3LL7A 3OPYB 1APBA 2F3PA 5BQ5A 1ZBDA 3AUFA 2DTXA 5DISB 4EFDA 5LD2B 1E7SA 4U00A 2YWCA 1DKPA 3EYWA 3E22B 4IDCA 1MFZA 3NYIA 3SHOA 3ZU5A 2OO3A 4LPKA 4CT0A 1FTNA 2PNJA 1O7JA 3COZA 3ZWYA 4HT3B 3P71T 4BJ3A 1GSIA 1M54A 2N3ZA 4JFRA 3WKBA 5A4FS 1SRRA 1ZJ6A 1ABFA 4MYSA 3HCWA 2X0FA 5J2TA 2ECOA 3EGCA 2UVPA 3MTGA 4PONA 5KVQA 3H42B 4EEZA 1QNLA 2HUPA 3HB5X 1RQGA 2R8YA 5B12A 3GUUA 2VPTA 4ITRC 4RSGA 3J7TA 1R9NA 1A27A 2A9FA 3D2CA 4HQLA 4UUPA 3IT3A 3KDSE 2Z4TA 1A2QA 4GYYA 4X5OA 2HW8A 3KIPA 3ND7A 3U60B 3FTCA 3DFFA 3JVEA 2OWDA 3G5MA 1IPEA 4LGMA 3K73O 1DAGA 1W581 3VNUA 3PUYA 2JB9A 3LDAA 4L9AA 1XA3A 1LV8A 3RUEA 3L8FA 3OJCA 4C7MA 4K28A 1U65A 4CM8A 7MDHA 2OG1A 5LQAA 3TR6A 3GJTA 4OUDB 4EUSA 2CCKA 4D02A 1KMIY 3AEXA 3NLLA 5KQMA 2I4OA 3FNEA 1JMYA 3M4ZA 1MZVA 4MQFA 5IBCA 3SNHA 1E6LA 5BW6B 3B70A 3PUHA 4FEYA 2DQZA 1LC0A 3DB2A 5CXXA 3JARA 2D0PB 1AXRA 1WDMA 1I2BA 1XL0A 2YZKA 4C4AA 5IC4A 4K8OA 2WG2A 2PFKA 1G4AE 3NTLA 5G4LA 1KAOA 1X1DA 2WJIA 4PQEA 1N7GA 1UMCB 3D8SA 1CUDA 2C57A 2OBMA 2OD7A 2X7XA 4P7BA 4N6GA 3VPFA 4BAUA 3RRJA 4OSOA 5KOHA 2O2YA 3AI2A 3HCDA 3U62A 1SBZA 3BJMA 2C00A 3S2FA 5JRZA 1RCFA 3TEMA 3NDBB 3KQTA 5JCJA 4JLPA 4NYIQ 5J2UA 2HXGA 4YUWA 5COQA 2QW1A 2P2LA 2V7PA 4FQ8A 4OP1A 4FYJA 4RACA 4XEHA 2V97A 3TLGB 3EGEA 5FR1A 4TVKA 2ODAA 1T5BA 3AR5A 4DGQA 5LBTA 3W6OA 1IXZA 2Z6UA 1K7SN 4JI1B 1E7RA 3L8MA 3G88A 4E6EA 4GYKA 2ZSIA 1F2UA 1Y3FE 2P7IA 2FN8A 5H82A 5ALHA 2XOEA 2GM3A 3OZSA 5ICFA 1AKEA 1EUCA 5LB2A 4TWZA 2VEOA 1ZCZA 4X97A 3QFSA 4A27A 3ZHUA 2REQB 2ZVQX 4YQYA 4ZOQI 2NZ8A 5B3AA 4AJLA 2XYQA 2BM8A 3SR3A 2OZLB 2ZPUA 3EEBA 3MJSA 2R11A 1DOHA 2LTAA 2O5RA 2BMFA 4KODA 5GJCA 2OCPA 1Q3HA 1IC6A 3NONA 3EZNA 2EWMA 3SQWA 5ALLA 3UCFA 4V0NA 3TZKA 3AY0A 4GMDA 3ZS8A 1YB4A 3KQMA 4B4UA 4RLFA 2EWWA 1EDBA 4GMFA 2G36A 1U4NA 2IOHA 3N28A 4ZOLF 4ENSA 3AW8A 1NPDA 4V3CA 5HQJA 3VR4D 2H3EA 3FHCB 2O8DB 4NNJA 4FT2A 4KRYA 4R01A 3ONNA 1V43A 3HBAA 4M7OA 4QBTA 5DB4A 2PUTA 3V3TA 4B43A 2BYTA 4IDEA 2ZVJA 1MW8X 1B3BA 3EZFA 4BZXA 2JPDA 2HK8A 1SAYA 4KIGA 1OKKD 1Z4PX 1IVNA 1U0EA 2AMVA 2X7JA 4R69A 4ARZB 4IJUA 4D43A 3R40A 1YACA 3BOSA 1PFKA 1XIVA 2GJKA 2ZULA 2WMNB 2BBWA 3UVEA 5EWJB 3DZJA 2V58A 4JBNA 2VZLA 1NP7A 1M1YB 3KOOA 3OIYA 5C2JB 4CG0A 8ATCA 1XRRA 2Z09A 5IN5A 3VR3A 4OQDA 3IPXA 3VR5D 4NNOA 1M1UA 1C41A 4CQNA 5HF9A 4RZQA 4WWHA 2X8BA 2HU8A 2VHYA 4YONB 5FOTA 2A9QA 2Q2OA 3QVGB 4WY2A 2C5LA 2I8LA 3RYIB 1AGXA 2X6TA 3UO8B 1WB4A 3AUJB 3ESAA 4B87A 1XTUA 3EZXA 5BURA 4XM0A 3DLBA 3BRQA 2PH7A 3F6RA 4UHCA 1EH5A 1SD2A 5IJ0A 1GCIA 2ZBGA 3IT0A 3LUHA 1JYFA 3I0ZA 2BJHA 3R7WB 5JBQA 3F7OA 5KYXB 3KQUA 4I81A 4X6XA 4BO7A 1H42A 4WOBA 5A4DA 4YCCA 3PQ8A 1GILA 1QV9A 2FE1A 5FHQA 3VO2A 3GIWA 4UMDA 5LVAA 4DKJA 3VNBA 2J85A 3BULA 1XD9A 2OESA 4HBZA 3M5PA 4KOAA 1YS7A 1KRHA 1NYRA 3ENZA 3H4TA 3NGMA 2VHXA 4FZ5A 3WYFA 2W6MA 1M7GA 2HQSA 4ZALA 2DVMA 3W79A 4I9GA 5GVSA 4LV5B 4AK9A 1QRDA 3MTIA 4JELA 1K8ZB 2R1TA 3E4DA 3O93A 4J1SA 3EEOA 2P9GA 3A25A 1BE0A 2DUNA 5JXWA 2OCXA 3PD7A 1LWOA 2WOJA 5EHGA 5K4HA 4MVJH 5I5EA 2BFCB 1OAAA 3IEXA 5F3DA 3TSOA 2VJLA 4EVSA 3F78A 4L73A 4EW3A 4ZCLA 4F86A 2NQTA 2G7ZA 1WKVA 2VN8A 3AHHA 2D3WA 4W5HA 5ARBA 4E12A 1DAIA 1Z63A 3EQZA 2UZ1B 4IICA 2OGZA 2ZQYA 1PVVA 4QYTA 5LN1A 1YHYA 1J22A 1LPMA 1XVIA 2X8AA 3IULA 4IQ0A 2IRWA 2YYAA 1RJGA 2F1KA 3UHOA 1IJBA 3EARA 3GGSA 3A6LA 5IX8A 1CUFA 3MPOA 4J2TA 3L9WA 5CG2A 1KDRA 3CXRA 4UVEA 1V45E 1J2TA 2HBQA 3MW8A 4XPZA 4TQUS 4ZCSA 1TTPB 2BP7A 7MHTA 1EVYA 4KR2A 4LZNA 1SQ5A 2Q9AA 4NPAA 1J2UA 1FVOA 1RZRA 1NN0A 2HMVA 5CYFA 3KSBC 2B4YA 1MP0A 1EX7A 1IOZA 1IMJA 3BMQA 3FSEA 2WFAA 3BJEA 4QEKA 2DQSA 1EXMA 3ZZTA 1QQBA 1ZCFA 3S27A 2ZVPX 3TQHA 2VK8A 1U3WA 2XYHA 3G2NA 3KM0A 5C3UA 5IMSA 1DUIA 1KEPA 3GK3A 3IVRA 1QPZA 4JJ8A 1XSEA 1H65A 4M8IA 3VH4A 1EHCA 2Z1NA 1Y3DE 2F9LA 1MH9A 2CF6A 2W4MA 5DBOA 4KAXA 2CVOA 1JFLA 4D9BA 3N7UA 3WB0A 5KVSA 3ZWXA 1U8FO 1QRUA 1EUCB 2D5IA 5CFZA 4BP9A 3WAJA 3GA5A 2PXHA 2LVBA 3N53A 1KOFA 4ISBA 4BVHA 3LY8A 4KQXA 3JWPA 3WS7A 1J97A 2JFYA 2ZRMA 4OATA 2I03A 1MEJA 5DXAA 3PGXA 3WK7A 1FDTA 1CS4C 1E2GA 2HADA 3Q10A 1PWYE 3FKSA 3WWYA 2XCQA 3E81A 5JJ5A 3MN1A 4ZQBA 1EFTA 1DARA 1T6ZA 5E0OA 1U8UA 2EG9A 3Q0EA 4NFYA 1UMDA 4KMSA 2EDCA 3DBRB 4ZCQA 1YRQA 1EFVB 2DHEA 3NWJA 1D4FA 1VQ1A 3V8VA 1VFPA 2PRZA 4PAQA 1SD5A 3P9YA 4PYLA 1E3IA 4R9SA 4I08A 1NW9B 2FZVA 3MWLA 4EKYA 3DTVB 3A6PC 2FOIA 3FR7A 4YFYA 4CMIB 1Z4LA 2HT6A 2BC9A 1P60A 3VNQA 4N0MA 2QT0A 3ACCA 3E84A 1PG5A 3I8SA 3WK8A 2P11A 2F48A 1DCKA 4AJHA 1JXMA 3IIIA 1Z2NX 1MR3F 2ZIXB 3RSSA 4DARA 3RC1A 1KFCB 2IGTA 3C7AA 3I04M 3V8NA 4PRKA 5AT1A 4CDNA 4F9TA 6NULA 2FUEA 3W5SA 1E9EA 1PT7A 5AKIA 5I01A 1UOOA 3EXG1 4QDUA 1QDEA 4L9RA 4YP0A 3NBFA 3QU7A 2AG0A 5LZ9A 2G40A 2J5KA 1VKHA 5TE9A 4A8JB 1R7RA 5CA1F 2P90A 1WF3A 1CJMA 2PV0A 4G56A 1SN7A 3W2EA 3LGAA 1W94A 5JO9A 4CN8A 4F2PA 4F5WA 4OX9B 2EU8A 2Y1FA 3BCHA 2VCYA 3Q8XB 1W30A 4L2IB 3FCXA 3SHVA 3AHJA 4QVIA 1V4VA 3DXZA 1PF7E 4I1YA 3H5OA 5ILQA 3SF8B 2OEPA 1BJRE 1DTWA 2JS7A 2TMDA 4G1FA 5F21A 2XCIA 3GLTA 2NUPA 1IZ7A 2LIPA 2UUPA 3IP8A 3SHFA 1NG9A 3D64A 2JFZA 1TKAA 2CHGA 4JYAB 3O4IA 2FHSA 4PG7A 4TV9A 4BNKA 2D3TA 2ZWPA 4MWSA 5GM2A 3NBZC 1JRLA 3KKNA 3JD1A 1SUEA 4C3OB 1ICEA 5EUQB 5DN9A 5DLPA 4MTLA 2VI5A 4WLNA 2GESA 3WL4A 3N76A 1O9GA 2DBQA 4DV0B 3BIXA 3OOSA 4EF4A 2D59A 2D5AA 5BVHB 2Q1WA 2GD0A 4ZJYA 1KI6B 3TGWA 1KFJB 4BV2A 3NHLA 3ZE7A 3AM4A 3K71B 2I29A 2PTHA 3BQMB 1GAWA 4PIPA 4V0LA 1G8YA 4G9EA 4YTEA 5IN4A 5IDWA 2Z3WA 4BKOA 1QVRA 2JHGA 4ASUD 4F9EA 3AB8A 1DZIA 1TCAA 3PG5A 2F17A 3KZOA 1AKQA 5CK4A 4DV7B 2PKRA 4LJ6A 4EB6B 1L4KA 3KETA 3ZV4A 1DKLA 1RLMA 3ILXA 4C0KA 3RVQA 4IS3A 4J4BA 2QA5A 2QVCA 3EVTA 2I3AA 4EQ6A 2Z9BA 2EFGA 4DZZA 1WKBA 4GU5A 1M2WA 4W82A 1FMLA 2R5WA 2OCYC 3CWQA 1IQPA 1OGYA 1M5UA 3RW9A 4LMBA 3SFZA 4YPVA 2IDJA 1CZUA 3KXLA 5FAXA 1TVMA 5CVTA 3GFGA 4OHCA 5TS2A 5E95A 4UOZA 5C51B 4E1VA 1MRZA 3HJTA 4URVR 2C3YA 4TTVA 5F64A 4XM2A 3SYLA 1VZ3A 4PAMA 4Z9YA 5FWXB 5LYJF 3QBDA 4CTJA 1F8GA 1SHZA 4W5JA 2II6A 3KL2A 1PQ4A 1XDBA 2JH3A 2HZBA 3EH2A 2V65A 1AV7A 1L7QA 4JLWA 4BBZA 1CY7A 1VP3A 1U3TA 3EBLA 1R8YA 3I5MA 3H2KA 4DG8A 4XVUA 4J16A 1CUYA 2Z2YA 2OBXA 1ZD5A 3KOYA 3ICVA 1Q7GA 1GL3A 4DWWA 4DS3A 2XLBA 2TS1A 4QULA 1U2GA 3U13A 5CVDA 3GLGA 2QL5A 1DKNA 1L1QA 3A1TA 4G0MA 4QRHA 3ZHBA 1YS1X 3T5CA 4X8OA 4OCZA 1W9MA 121PA 2VDNB 2XIJA 3BKXA 3SLRA 4NCKA 5GINE 5UKDA 4A5OA 2PPVA 3DOEA 4CNBA 1LPPA 3G6WA 3H5WA 5CYPA 5KSWB 3U3JA 1U0LA 2ZAOA 2E3JA 5FI3A 4PN7A 3GEPA 4ETMA 4WFIA 4TXJA 4DHWA 1UUFA 2I22A 5E2IA 1ONPA 5BW8A 5JPDA 3U6KA 1ZH0A 1V48A 4UU7A 4HH0A 3HHPA 3CBQA 5LZ7A 3VX4A 1QK4A 2PAFA 1YC2A 3PHCA 2WU1A 4OOFA 1XEAA 5FUWA 2FK7A 3IGFA 3F3KA 4L74A 4N3NA 5COAA 5KNBA 4GHWA 1WOYA 3FOBA 1FMCA 1OQAA 5IAKA 5MFPA 5FNZA 3VNAA 5I7WA 4LDRA 1OILA 4LHSA 1FYVA 1YWGO 3S5UA 1GFZA 4A1OA 1Z36A 4PSUA 1MLDA 4A03A 5ALJA 1HM5A 8GPBA 1E5TA 1FBTA 4FHCA 4YAEA 3ZBPA 2IEYA 3JALA 3HB4X 1J70A 3OY7A 3OZVA 5G1PA 1JQAA 1G9SA 1N2EA 3OE7D 3QYJA 1YMQA 2DPGA 4P33A 2CXTA 1YRYE 4RK0A 1K2VN 1KHHA 1KZ7B 1CRWG 2EZTA 2WSLA 4M1KA 4I8DA 4CM8B 3VA7A 3PTAA 4L16A 3AESA 4X92A 4Z54A 1FXWA 1WCV1 1I9GA 3IUPA 1N6RA 3R7LA 3C3EA 4M83A 3LBAA 4NCAA 3E9MA 4XSGA 1G8HA 2OORA 1K89A 3AY6A 3K1YA 4H3SA 5E3HA 1N2XA 2JBAA 5BQOA 2BI7A 3OKPA 2B1IA 4LHEA 4DM3A 2IT1A 1QONA 4KGVA 4YY3B 1I4OA 2CMKA 4KE6A 2YIDA 2CHVA 3RTEA 1E6UA 2ZTHA 1FNNA 3HL4A 1JEYB