3R9IA

2.6a resolution structure of mind complexed with mine (12-31) peptide
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
257
structure length
257
Chain Sequence
ARIIVVTSGKGGVGKTTSSAAIATGLAQKGKKTVVIDFAIGLRNLDLIMGCERRVVYDFVNVIQGDATLNQALIKDKRTENLYILPASQTRDKDALTREGVAKVLDDLKAMDFEFIVCDSPAGIETGALMALYFADEAIITTNPEVSSVRDSDRILGILASKSRRAENGEEPIKEHLLLTRYNPGRVSRGDMLSMEDVLEILRIKLVGVIPEDQSVLRASNQGEPVILDINADAGKAYADTVERLLGEERPFRFIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Septum site-determining protein minD
publication title The Min Oscillator Uses MinD-Dependent Conformational Changes in MinE to Spatially Regulate Cytokinesis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle,hydrolase/cell cycle
total genus 83
structure length 257
sequence length 257
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r9iA00
3K0FB 2BMDA 2ORWA 5HE9A 2AFHE 3FDIA 3THXB 3GCGA 3VNUA 3QKRB 4Q1BA 3QXJA 3SOPA 3BB4A 3MUFA 2PMDA 4XSHA 4DHEA 1IN6A 4X8MA 4EQ6A 2IYWA 1P2SA 4I81A 3T06B 1NJGA 1OFUX 2CE2X 1E9FA 2VF8A 3EA0A 2BBTA 2DBYA 3X1XA 1K5GA 1DAEA 5FUVA 4M4SA 1RYHA 1Z07A 3KJEA 1D8TA 5FPTA 3ZQJA 4AYWA 3B82A 2ZI6A 1E2GA 3JZAA 5JEDA 4LV8B 1AS3A 2G83A 1ZIPA 5SZHB 1WCV1 1DAGA 1IJFA 1KO5A 1VHLA 2HXYA 2V3CC 1Z08A 3HU2A 1NNEA 1QHGA 3K70C 2UZ3A 2P6RA 4TYQA 3WMGA 4D81A 2HLDD 4RZ3A 4B3DA 4DZZA 2OT3B 3QNUA 2PBRA 4IRUB 1XTQA 2HUPA 1IY2A 4MRPA 2AFIE 1EG7A 1X8KA 2CJWA 2WM9B 4AI6A 1KNXA 1WQ1R 3GJXC 4HLDA 4A82A 4JSYA 1N6HA 5C46F 3GLHE 4DLVA 2QM7A 5HZKA 1G8FA 1R6BX 3BWDD 3AVXA 1KZ7B 1OKKA 3R8CA 2ATXA 2YJTD 5SZKB 3R9IA 2R6CA 1JJVA 3IGFA 5KU1A 4BEJA 1W36C 1JI0A 4DDVA 1R2QA 2ZRHA 1GSIA 4HYYA 1KI1A 2OESA 1DE0A 1MH1A 3NDPA 3V4RA 3L2OB 3ZS8A 4EDHA 2ODWA 2B7BA 5TB5A 1LFDB 1TL7C 4MYUA 2FPMA 3NVAA 4R71A 5DN6D 3QPVA 4ZIRA 3AB3A 3M0EA 2FSGA 3SYLA 1H65A 4QHYA 3FMIA 1UDXA 3AVPA 1QG2A 2GK7A 4G5OA 2ZRIA 4EPTA 5L3RA 4BLPA 1TADA 2BDTA 1NN0A 2FFHA 5FTMA 2F7SA 3K0AB 4DCNA 2O0JA 1P9RA 1G7TA 4YLGA 5JBQA 2FPKA 3P4YA 4JT4A 1HTWA 1PLLA 4D4JA 4D0GA 4XD7D 5FPSA 1Z29A 3MFYA 3QXHA 2PCJA 1U8YA 3CR8A 3BC1A 4EQ6B 3GP8A 4J0QA 3CRMA 1P72A 2BEJA 3BE4A 5IRCD 1Z06A 3TMKA 1NI3A 2VHJA 2IWHA 1RW4A 4LBYA 4IJMA 1QVRA 821PA 3CZPA 2JLZA 4M22A 1JPNA 1O87A 3KFVA 4Q19A 2VBCA 1KDPA 1IM2A 3U6BA 1TF2A 2GAOA 2ZUBA 2AR7A 3AUXA 3U6KA 3EASA 5E95A 3TVTA 3N70A 2XZOA 5CM9C 3LO5A 2ONJA 3U3JA 1OXXK 2WPDD 5C4GB 1WB9A 1PUIA 1TF7A 1QZXA 1P75A 2JEOA 2A30A 1VG1A 3MCAA 3PEUA 1ZM2A 5J40A 2FA9A 4NTZA 3JZMA 1T4GA 5B2ZA 2X2EA 1AA9A 1N25A 1AGRA 3E1SA 3K0CA 3E2IA 1YHNA 4MQBA 5DYGA 2DFTA 2GVZC 2REXB 2Q6TA 3UXMA 4NCIA 4HZIA 4WIAA 3THWA 3KFXA 3IEVA 4UXJA 4TT3A 2QSYA 1E0KA 5EXXA 1NN3A 4LV5B 1V5WA 4P0TA 4B3CA 2JJ2D 1KDTA 4BASA 4NPHA 5J4KA 1P73A 3HPRA 4PQRA 1J90A 1E2QA 2HEIA 3NH9A 4NBSA 2B92A 2IHYA 3BRWD 3I8SA 2CDNA 1G7RA 1A82A 4O0MA 3HYRA 2RH5A 1LS6A 4B3FX 5HCNA 2O0KA 4ZIRB 3L82B 3FOZA 1R10A 4DLRA 4B73A 1M7BA 1IN7A 1Z0FA 2BCGY 4RKFA 4O2LA 2ZSBA 4DSNA 4QC2A 4FCTA 4LDJA 5LDDC 4D80A 3QBVA 1ZM3A 5IF9A 4M1TA 3M6AA 2C98A 4NKRA 2W2TA 4JLOA 3B1ZA 3P26A 4F93B 5F98A 2R65A 4I99A 4BZPA 1JBKA 2WSMA 5CJPA 4DBLC 4YQFA 4TYPA 2EFGA 4M9ZA 4TWZA 3ZVMA 1HT1E 2IYZA 2Z4SA 3QY0A 3TUJC 5G40A 1PJRA 1PLJA 1G6OA 1GRNA 3KKMA 5EUMA 2ZTSA 4V0ME 2AHOA 1VYVA 1W47A 2IEYA 3EZ7A 4MRVA 4ZDKA 3UG7A 1NVUQ 5FL7A 5ELXA 3ND9A 4FMCF 4Q4HA 2PH1A 4PO1A 4TMTA 1YZQA 1X8JA 4MRSA 3CPEA 5KUTA 1RJ9A 2ZVPX 4RD3A 5FR1A 4ERNA 4P31A 1QHHA 3BERA 1OJLA 4TN1A 4B2PA 1IQPA 2HJVA 4JL5A 1R0XA 2HT6A 3KKPA 3BH7A 3AP2A 1GUAA 4HAXA 5AJYA 4V0LA 4LYAA 3BOSA 2C04A 4R9UC 2IWRA 1G8PA 4Q21A 2NZJA 2YVUA 3OZXA 3VKGA 3BD9A 4DEXA 3THWB 5FBQB 2FNAA 2XSZA 2IF2A 1II8A 4D2IA 2VF7A 1SKYB 4HLQB 2AN9A 2JIZA 1XPRA 2DB3A 4HDOB 4LOAA 4WVFA 4DVGA 3EZ2A 2ZIAA 4XTCS 3B85A 3PR1A 2NPFA 2FX3A 2WVJA 2WWGA 1ZINA 4KHZA 4OYHA 4CZ2A 2QAGC 3R8FA 4LJAA 1G64A 3W9YA 4URXR 4YMUA 4QOSA 2DWPA 1R8QA 2H5EA 4AKGA 4JLNA 2CK3D 3W6OA 3CF2A 1F3OA 1Z2CA 3KB1A 2BBSA 4P4TA 1WBBA 4LBVA 2O8CA 3Q7PA 4TMZA 4HLUC 2PJRA 4G0NA 3M4YA 4Y0VA 4D4MA 1E1QD 1QG4A 2J7PD 2MMCA 2C78A 3RABA 1W0JA 4BECA 2OE2A 3MWYW 2BVNA 4RD6A 2IXFA 3LV8A 1ZCAA 1WXQA 5BN5A 2G3YA 4R2IA 1G20E 5FBVB 5CLQA 4DB4A 2IX3A 5A5GA 1H8ED 1MR3F 4BGDA 5TXGA 2CCJA 4LC0A 2QP3A 4DUGD 1OXUA 3KZ1E 3W6NA 2G0TA 1H8HD 2H57A 4S2EA 1G3MA 3HU1A 4JL8A 3BFVA 4TQAA 1XCGB 3NEYA 3VKHA 3IKJA 1GITA 4XTRA 2AK3A 3SJZA 4Q4HB 1DTSA 1QVAA 4NCHA 1U90A 5JS7A 2VRWA 4A2PA 2GDJA 5KDLA 2WWWA 1II9A 3FHTA 4BRWA 1Q22A 1RJ9B 4LHXA 1L2TA 1FW6A 4GNKA 1OXSC 1MOZA 2XJ4A 4OK3A 1G7CA 1QHHB 2HYDA 2GJ9A 4XVRA 1SVWA 5AK0A 1NY6A 1AN0A 1COWA 3K53A 4B47A 721PA 221PA 4RJLA 1AZTA 4A6PA 3BBPA 1N6RA 4ASUA 4R2HA 1ZBDA 3AP3A 4YDHB 1II0A 4L8GA 5DHAA 2OCYC 1OF1A 4LJYA 2HJGA 2C96A 3EARA 2QMOA 1FX0A 1CJTC 3IIJA 2BBOA 2VP5A 4DDTA 1R7RA 3TIFA 2WHXA 1II8B 4OI2A 1NN5A 2GXAA 2QMEA 1NKTA 1P2TA 1P61B 1TX4B 1OE0A 2QSZA 4HAZA 4QJ3A 1XZQA 4TYYA 5CLLA 1OFTA 5IT5A 4A8JC 3ZVLA 4K81B 2X1VA 2PX0A 4B44A 4M9XA 1XEWX 2WWXA 2XXAA 3RS5A 4KFSA 1IJEA 3L0OA 1EWQA 1NL3A 4MDEA 5EUQB 3U60B 4BPBA 4XIGS 1U98A 2J46A 2WKQA 2O8CB 2OG2A 2VHCA 1XF9A 5TARA 2G9NA 1Q57A 1NLFA 5EE3A 5JS8A 1F2TA 1XWIA 5BXQC 1XJCA 2V55B 5LD2C 1NP6A 1CR0A 4RCYA 3PUZA 4UJ3A 3G0HA 3EPLA 2WZQA 3TUZC 1G3UA 4B71A 1Z6AA 2IUSA 3PENA 2TMKA 2ZU6A 1SXJE 2A7QA 4V02A 5EXSA 2RB4A 4BQSA 2KI5A 4Q1AA 1A4RA 1TU3A 3EX7C 2A5JA 2C9CA 4OL0A 4LJ8A 4C0KA 5EP1A 4ZV4A 3P27A 2YINC 2ZR0A 4P33A 2QA5A 3JVUA 2AK2A 1OH5A 2HLDA 2HXSA 4F4JA 2V7QD 1GG2A 4QBGB 1Z22A 1LS1A 3K0EA 4A2QA 3FFAA 2ODNA 1TUIA 4IOKA 1XXHE 3KQNA 1CU1A 4OKSA 1T9HA 3WYGA 3CNOA 4WZBE 2BOVA 3WHLA 4C2TA 1VG0B 3NWJA 5HTKA 1XCPA 3NXSA 1W0KD 5DHFA 3W34A 4IDHA 3PUYA 1UJ2A 2EYQA 5JWHA 1D2MA 4RD2A 1G7SA 1ZP6A 1T8TA 4PAMA 2QI9C 2ZJYA 3CW2A 3PCRB 1E2PA 3SHWA 4CF7A 2JLWA 2W6JD 2WMNB 2JATA 3DDCA 4Q7MB 2W0SA 2VIIA 1ZYUA 1E2MA 1FX0B 3QXSA 1ANKA 5CIWA 5G41A 4KBFA 2FV8A 4K8OA 5DN6A 4PC3A 2EQBA 3FKQA 1V43A 3C14C 3C4JA 2H1LA 3UG6A 5FFMA 4QNMA 3B8HA 3AKYA 3VX3A 3SEAA 2VSOA 5J4LA 2ZRAA 2LKCA 3LBIA 3REFA 2XXAB 3CWZA 3W6PA 4JJZA 2P65A 4FI3C 3QEOA 4AG5A 1Z6XA 4IXNA 2A5GA 1P5ZB 5LB2A 4DB2A 4XD7A 4B33A 4X8LA 5AJZA 3QQ5A 2IYVA 3KXKA 4HLUA 2ZJAA 3TW4A 3UPUA 3EAQA 2MMGA 1SHZA 2EWVA 3WBKA 4DCVA 1VCOA 5EZ6B 3NBXX 1CRQA 2OO7A 2ZE6A 5AUQA 4K46A 4Q5IA 1KSHA 2X8AA 4B34A 4L15A 3G82C 1XPOA 4A1FA 5AUOB 3VKWA 3HR7A 4I4LA 2NIPA 2J3EA 4GFDA 5KYKA 1Q1BA 2IL1A 2GBLC 3KJHA 1T6NA 3K70D 3ADDA 2YC2C 4KU4A 4CEJA 1RRFA 1YZGA 3HPQA 3HP1A 3L0PA 1OIXA 1KAOA 2FFAA 1KNQA 1YR8A 2FFBA 4F92B 1FP6A 3SC3A 3QG1A 1WDTA 2YHSA 4QJ5A 2O8FB 2CMKA 4PZYA 4US0R 1KI7A 1EFHA 4A4DA 5DLQC 2QUZA 3I73A 5DNYB 4CIDA 1RYFA 1Z0IA 1NBME 3CX7A 1N6PA 2AXPA 3K9HA 4NCKA 1S4QA 3FHOA 2BMFA 4MUAA 1E1RD 4BZXA 1W36D 1YR7A 3TR0A 3ADBA 1AIPA 1CLUA 1T0JB 2JJ2A 1W4CA 4LJ6A 5KOYA 4IW3B 2Q9AA 3DM9B 3EPHA 1NIPA 2ANCA 4RZXA 4O3MA 4G01B 5CDFA 2SHKA 3SBEA 1DG1G 1N6OA 2NPIA 2DWOA 2QROA 2BWJA 3KQUA 3TE6A 4E09A 4YDSA 3GFOA 2HYIC 1UEJA 2VLIA 3QKUA 3GEEA 3Q9LA 3RSOA 4URWR 3VAAA 1Z6GA 2CLDX 1E2LA 1CTQA 1DEKA 3SJAA 3B1YA 1L4YA 5BW8A 1E3MA 3N2EA 1ELOA 1ZRHA 4TMVA 4A8JA 4CT5A 4H1VA 2ZJ5A 1U0LA 1T3HA 5A0FA 2RMKA 5J5CA 1GTVA 1KJWA 1F60A 4URUR 3CBQA 2VP0A 5B30A 5J4YA 3AVYA 2PZGA 3DL0A 4X8OA 1CBUA 1NF3A 1E96A 4IKEA 3GFPA 4KODA 2NTYC 4W7SA 1UBEA 2BJVA 2RGBA 3OE7D 2OCPA 3UWOA 3WHKA 4ZKDA 1OH6A 1OXVA 1J99A 4JYCA 3QSYA 4TLCA 4TMWA 4QJ4A 5FL3A 2OEPA 3R7WA 1GP2A 2Q9CA 4HUQA 4KLZA 1OPXA 5KO2A 3HR8A 3O8RA 1J7KA 2G77B 4PPNA 4HAVA 3LNCA 3KJIA 2ZJZA 3LW7A 4GP7A 3RWOA 3K8YA 2GZAA 1ZD1A 5JWOA 3C15C 2FMXA 3SYKA 1RRPA 1NJFA 1BYIA 1DARA 1DVRA 1SVOA 1N2CE 3DOFA 3GLFE 4YXWA 4GPTA 5KPDA 1P2VA 3T12A 4LK2A 3IO5A 1ZC3A 2QZ4A 3IEUA 4JZKA 4CEJB 1BO6A 4KSCA 4PSAA 2GEDA 1FFHA 1NVVR 2P3SA 1GZSA 2R62A 4Q00A 1AGPA 2DR3A 2X2FA 4M1WA 2IS1A 2RGNC 1FOEB 4OI0A 3A1WA 3A36A 3U7FB 3K9GA 1ZIOA 4IFEA 2J0QA 1CIPA 5JECA 3LBHA 4EPWA 2EWWA 4Q1CA 1JEEA 1G17A 2J59A 1UBGA 5JSZA 5GJWC 1OB2A 5FOXA 2VH5R 1AZSC 3QPUA 3I62A 3C41J 3FMOB 2HCBA 2ZE7A 3MG9A 1KI2A 2CL6X 3WY9A 3FVQA 2F55A 4LWZA 3VTKA 1JQLB 3ND8A 4PZLA 3F0TA 3GFTA 1CJUC 4JYBA 5B57C 3PFIA 1C4OA 3K09A 1VG9B 3R9WA 4YMSA 3N2IA 3SHFA 4Q47A 4KYUA 3U2QA 5H70A 1IBRA 2CK3A 3ZDQA 1VYUA 1YVDA 2C95A 3NHBA 4PAQA 2ZRBA 1VTKA 1Q1QA 2V8OA 4LJ9A 2NGRA 1HE1C 1KJZA 2FN4A 2ERYA 4LC1A 4DIEA 3LY5A 1YRBA 2J7PA 4LHVA 4DLTA 4MYCA 3TUIC 3ZIAD 4A8JB 4WOPA 1R0WA 4CYMA 3MWLA 2AX4A 3WMFA 2VQSA 3CX6A 5JZVA 3CF0A 3FKSD 1Q21A 3HWSA 2GCNA 1HV8A 4PAOA 5AR1A 4MRNA 3RAPR 3AVQA 3ADKA 1ZUHA 4CVNA 3KKQA 5JJKA 2H92A 1VYTA 1UPTA 3HDTA 4FW9A 5TVKA 2QTFA 3VMFA 2DY1A 1NVVQ 2VP9A 2BKUA 1H8EA 3F8TA 3GPLA 1CR2A 4PANA 121PA 5AWFC 4B3GA 3TSZA 2C5LA 2E87A 4DUGA 3R7WB 5KDOA 1H8HA 5LD2B 4HUQB 5EQTA 1LY1A 5FTLA 1TF5A 3I8XA 3ZD7A 4LYFA 3ZD6A 1UM8A 1OB5A 1T8UA 5AJVB 3RS3A 2D4HA 1SKQA 2KJQA 1E2FA 1MO6A 2GZDA 4GOXA 4OJKA 4JBWA 3PEYA 4MGIR 1JAIA 5KHOC 3EWSA 3KL4A 1CP2A 4GP6A 3BORA 4N0EA 5JEEA 1US8A 2FFQA 1RZ3A 4LI0A 3KDSE 4B6EA 5JMTA 1A7JA 5L3QA 2HT1A 1SKYE 2WJJA 4B43A 4B2IA 4UKDA 5FTKA 3AKCA 3CUEF 2ORVA 2QORA 2WICA 2WMOB 2BM1A 2Z0MA 5KNDA 1W48A 5TMPA 2EFDB 3TSOA 3SQXA 3NBFA 2LWIA 3U7EB 1A2BA 5E4FA 2GXSA 2OFWA 5JSZB 4W9MC 3U4QA 1PZNA 2ZI7A 1UKVY 4GZMA 3UK6A 2FU5C 1FTSA 4GRAA 3IO3A 2IUUA 1E9BA 1E98A 1W5TA 1AQYA 2QAJA 5DYIA 1E9EA 5KSOA 4ZCLA 5HR5A 2DHRA 4A36A 4PPQA 1W2HA 5FBRB 4MDFA 1JEDA 4UNPA 4Z51A 3MWJA 1E2EA 4TQ9A 4ABYA 4RY2A 2Q3MA 4TL9A 4NP6A 4AKIA 3I4LA 1ZM4A 4CEIA 5GVRA 1A1VA 1P60A 4EKDA 5EZ5A 2IYQA 4PSKA 4Q1EA 2HDNB 2UKDA 5BN3A 1N5KA 1IOZA 2D2EA 2VHQA 4GMDA 3DOEA 4AG6A 1XRJA 3WP0A 1VCIA 2J1LA 5CK5A 4TZ0A 1E79D 4NL4H 1YE8A 4HLCA 3OF5A 1DAKA 1EXMA 1G21E 4LGMA 5J4VA 3DMNA 5K8UA 4HDQB 1M1YE 2WOJA 1YJ5A 3IIMA 3KQLA 2PZFA 1FPMA 4PHHA 1G8HA 3ZS9A 2ZAOA 3H2YA 3LRPA 2G0NA 1XX6A 1GNPA 2LCFA 1U99A 1DAFA 2AL7A 2IUTA 3JVVA 4BRUA 4EFNA 1R8SA 2V6JA 1KO8A 1U94A 3DKVA 3ETLA 5B64A 3Q3JB 4GMXA 4JLBA 4DKXA 2QG6A 2NMVA 4CT4B 2ZRMA 2QMHA 4KCGA 3RS4A 1HT2E 1M7GA 1SXJD 2OFXA 1P9WA 2F1IA 4OK5A 2V7QA 4ON9A 4BFZA 2IYYA 2QT1A 2GJSA 5EXPA 2FE4A 2IC5A 2ZEJA 2GVDC 1S9DA 3BXZA 2Q0HA 4FMDB 3T5DA 4A2WA 3AUYA 1US8B 2DCUA 1TPZA 2BCJQ 2ZYWX 4Q66C 3U7HB 1K8RA 2P2LA 4DCUA 2G1KA 1HEIA 5L3QB 2IF0A 3GJ5A 1W0KA 1XMVA 4GOKA 4EJSC 1BH2A 4YMWA 4C0JA 2ZI5A 2ZJ2A 3U3OA 3SBDA 4TQUS 3DPUA 1FMLA 5L3SA 4M1KA 4OHZA 4PZZA 1YR9A 3U4QB 1IY1A 2W6JA 4F38A 4YONB 4B74A 2ZVQX 4ZKEA 4IOMA 5JWRA 2ZYTX 2QNRA 4Z8XA 3AGPA 2XTMA 4LYHA 2N1BA 5TV2A 3EPKA 1PV4A 4NMMA 4KSBA 4E5UA 3MJHA 3HYTA 4M1MA 1OV4A 3A6PC 1R5NA 2WJYA 2ZYUX 2ZRGA 1KY3A 3D3QA 3IPYA 4AIIA 5BN4A 2IA5A 4CEIB 1K5DA 1EFCA 1Z6TA 1X6VA 4QL3A 2UVQA 1E32A 2XTNA 3RS2A 3T34A 3EZ9A 1S1CA 3P4XA 2GXUA 2BHRA 3VR6A 4TMXA 4OQNA 3EZ6A 1J8YF 3GLIA 2WKPA 3FWYA 2ZE5A 2ZITA 1J2JA 3GJ3A 1Z63A 4KLNA 1FNMA 5L3VA 2C9YA 1N5LA 3A4LA 2DFKB 1MRNA 4GI7A 2EFCB 3QPWA 4UNSA 1AKYA 4KVAA 4M9QA 3CLVA 4JVSB 4B32A 3IBGA 4P4SA 2D74A 2H8KA 3DZDA 3I5YA 2XGJA 3KKOA 5FPHA 3TKLA 4MKHA 1CEEA 1MT0A 4FN5A 1KDOA 4Q1DA 3B5JA 1O3YA 2B21A 2Z43A 2ZANA 3FFBA 4OBEA 3X2SA 4RD1A 1SZPA 1BKDR 4TLBA 3GD7A 1G8GA 1GDDA 4BFXA 2O8DA 4TL8A 2F43A 2H18A 4W5WA 1S96A 4QGHA 4FCWA 2A5YB 3C16C 4KVGA 5JHGB 3RVBA 3CZQA 3SU8A 4DLXA 5IK2D 1MABA 3PIRA 4TL7A 1P4SA 1XJ0A 4N1AA 4FWIB 1UADA 3U44A 1JR3D 4P4UA 2ZJ8A 2D62A 5F2EA 4N3NA 4BEBA 1XTKA 2IBMA 2CLCX 4ARZB 2OZEA 1JB1A 2ZSAA 1E1RA 3BK7A 1FQKA 4UQOA 2JLUA 4GT1A 3H0KA 1IXZA 3CWQA 2OM2A 1PLKA 2NO6A 3U3MA 4QKQA 4EPRA 3T61A 3AQ4A 5L3SB 4AY2A 1P7CA 3GJ0A 5HE8A 1XMSA 3H1TA 2ZRCA 1N6NA 1G1MA 1MV5A 1X8LA 1XTJA 2CEAA 2O8EA 1M6NA 2VEDA 1E6CA 4OI1A 4EFLA 2EW1A 2W6ID 1NSTA 4HI0E 3NEJA 3LA6A 4I1UA 2ZE8A 1T5IA 5EP2A 3EWAA 1GRQA 5C2JB 1KO7A 4M2LA 4Z1MD 4D6PA 1MKYA 4RCZA 4UXHA 3AVTA 3MLEA 2H17A 2QPOA 2CHGA 1CULC 3PUVA 5EE1A 1IN4A 1X1RA 4C0QC 4XOIA 4DDWA 2ATVA 1ZU5A 1KTVA 3FB4A 2XZPA 1FZQA 2QEQA 3RDPA 2R6DA 3P20A 3FMFA 1OYYA 5HZHA 1ZC4A 2WWIA 3OE7A 2QP9X 1WP9A 5FOUA 2OCAA 2WV9A 1FUKA 1FL9A 3GLIB 1T3LA 4NDZA 5CYOA 3BH0A 2NQ2C 1G18A 4M1YA 2ZRKA 4JIMA 3EZFA 5DSZA 1Q0UA 5JLJA 2BMEA 1SXJC 4EAQA 2GA8A 1JXMA 4WA7A 4V03A 5FUYA 1EWRA 4NYJQ 4P4SB 2YKGA 1S0UA 4OHYA 2PLRA 5LB4A 2GILA 1CJMA 1EK0A 2I1VB 3K70B 4DLWA 1X3SA 1IY0A 2ZXUA 5BYJA 3GEHA 3AVUA 5FPKA 1F5NA 2KSQA 3U3RA 4IHQA 5JFGA 3OEHD 2FWRA 2R2AA 1J70A 2F43B 4JJKA 2O8DB 3Q7QA 4NHOA 4RD0A 4BFTA 1YZUA 2OBNA 2H7VA 1TQ4A 3DO6A 3TQCA 1MABB 3CONA 1RE0A 3U44B 2B8TA 1S2MA 3GLGA 2CVFA 3ASZA 2CHQA 1JR6A 4DJTA 3DM5A 4IXMA 1J8MF 2J0VA 1W36B 4M21A 3WYAA 1ZUIA 2B8WA 1WA5A 4DCTA 4HB2A 4IFBA 2IYSA 2AD1A 2PLFA 4I1VA 4F4IA 2O8EB 1NMYA 4UNQA 5BWMA 1EFRD 2N42A 2ZS9A 3BGWA 1OT3A 3I92A 1W4AA 2ONKA 4LUCA 4BWYA 3BAFA 4KI0A 1ESMA 1QF9A 1Q1ZA 2OCBA 3F3YA 1E2HA 2J41A 4IDNA 2O8BA 4L9WA 4TZ6A 1EX7A 2AKAB 2F1JA 1EX6A 2PZEA 4IDQA 3ZIAA 1SVIA 4ILEA 4JSTA 1RFLA 4M1SA 1Z47A 3AEZA 2OXRA 1E9SA 3FKSA 5GJCA 1BMFD 1OFIA 4A0HA 1D9XA 1HUQA 2F9LA 2Q9BA 3W8NA 1KYIA 3BFKA 1E94E 3S1AA 4ZI3A 2QQEA 4QFMA 2FZLA 2JDID 4OJQA 4RFVA 5KSZA 3BB1A 2ANBA 1YKSA 2QGZA 4FINA 2A5DA 2OBLA 3L0IB 3CO5A 5AJXA 1NKSA 4ITRC 5DI9A 3P1JA 4ACBA 2VP4A 2GCOA 3EIQA 2O8FA 3L43A 5KSPA 2GEUA 4M1OA 4Q48A 5J4HA 1YZKA 2PT5A 5DE3A 3CF6R 3A58B 1TQ2A 4Z54A 2IEZA 3MWKA 4JVMA 4QBHA 1VMAA 3I61A 2YZ2A 2WJGA 4BFVA 5JJLA 2A2ZA 4RVCA 4D25A 5BYKA 1E9DA 1KIMA 2I1QA 2IHBA 2GAAA 3OFND 1P9NA 4PTLA 1FUUA 4QHTA 2OLJA 2ZSEA 2OILA 3X1WA 1AS2A 1ZU4A 3AVWA 2XB4A 4HAUA 2QPTA 3L0SA 5C4MA 2Z5FA 4FMCB 4P32A 4B35A 5EJEA 4IDOA 4PQFA 1SQ5A 2GESA 4OK6A 1Y3AA 2XX3A 4NYIR 5CDFE 5L8VA 5CB8A 4MA4A 2C77A 2IYUA 3LXRA 4O2RA 4ZPXA 3IDQA 3RNLA 4Q7LA 3GLGB 2E9SA 4BE7B 3HU3A 2E1RA 3MGCA 1U9IC 4YC7A 1XEXA 1DO0A 3IIKA 4DLUA 521PA 4TSFD 3E5HA 4MGKR 4X8HA 2OBMA 4C3ZA 3EXAA 2D3WA 1P3JA 3W8RA 2QAGA 4HATA 4PHTA 4Q9IA 2FDCA 3VNVA 3OIWA 1VCNA 2OUKA 2P6UA 3I72A 3SI7A 3EPJA 5FUXA 3PUWA 3B1XA 1U8ZA 4MITA 4MRRA 2PCLA 3RYTC 3UATA 1RRCA 3MRSA 5CB6A 4C9BA 4QGGA 2ZI9A 1Z6YA 3DMDA 2JAQA 4IVRA 2WSSD 1E0JA 2F1HA 2O8BB 4IVPA 1M2OB 2O52A 2GETA 1OXTA 3QE0A 3SNHA 4A9AA 1GKUB 1ZAKA 3ONWA 4CRWB 2ZQ5A 3AF1A 3TLXA 1L7VC 2Z6VA 4DRZA 3QKSA 4A0FA 4JLDA 1W2GA 2W0MA 3D7MA 1KI6A 4I1SA 4LHZA 4A0GA 2XZLA 2V1UA 2GXQA 2CLSA 3QVUA 2R6FA 3S1AB 2YOGA 2XOKD 3LWNA 2BEKA 2K5UA 2VA8A 3CRQA 2FG5A 4PC6A 4DXAA 1E9CA 1FP7A 2J7KA 2DFNA 4F7WA 4C4PA 2WPDA 1WE2A 3EC1A 4V0KA 1GOTA 4IDPA 2YWEA 3T35A 2GCOB 1TQ6A 2GRJA 4NYIQ 2IYXA 1SGWA 4NH0A 3NC1C 4Q9LA 3RRYA 1ODFA 2VL7A 1SXJA 3A8TA 5DI3A 4IOJA 1IXRC 4KO8A 2ZRPA 2AWOA 3CH5A 3T1VA 3K9LA 4RD4A 5HKKD 1Z8FA 1UKZA 4EPYA 4OHXA 1LW7A 2Q3HA 2FGKA 4F91B 1KAGA 1QRAA 4II7A 4LPKA 3SE0A 3KTAA 1ZNXA 2OXCA 1ONBA 4XVUA 1KSFX 2CVHA 2NG1A 2IS4A 5EP4A 3AVVA 2ORIA 5UKDA 5SZJA 4BUJA 5JHHB 1XXHA 2XNDD 3GJ4A 2ZS8A 3LAWA 1SHKA 4DCSA 3VR1A 1I2DA 4NU0A 4JL6A 2QMUA 2QY9A 2ZI3A 4G5RA 3B60A 4XVQA 5AUPB 3TJZA 2V4ZA 3WBJA 1XEXB 1D5CA 2FSIA 2NOAA 2ZUDA 4HZUB 1BIFA 2QAGB 1DAMA 3H86A 1W4RA 3ASYA 4WZ6A 2EFEB 4JLMA 1B23P 3VHXA 2KBFA 4I1OA 1FNNA 1NRJB 1ZNZA 4TTQA 2JLXA 4PXAA 2CXXA 1XFAA 3EIEA 1OSNA 1BOFA 1JQJC 1NMXA 4D0LB 4URVR 4ZO4A 4Q7JB 1EGAA 2RGEA 3KXIA 1JXOA 1SVSA 1L8QA 1S9HA 4RFSA 5AJWA 3RLFA 4QHSA 1DADA 4ZDWA 4DWJA 1E2NA 1R0YA 2MSCB 3CNNA 5K8LA 1UAAA 1XD2A 3NH6A 1C9KA 4JS0A 3T1OA 1KZGB 3QKSB 4C2UA 1KDRA 1YR6A 2ZU0C 3B2EA 1DO2A 3OHMA 4A15A 5GADl 3PQCA 4NYMQ 1KI6B 4BLRA 4TL6A 4AC9A 1UKEA 1X86B 1OIWA 5GVSA 2C99A 5HPYB 3O8CA 3CPJB 1FTNA 2IXGA 2CNWD 4EIWA 1ESNA 2VHTA 2F1RA 4JKIA 4LZZA 4FWTA 3EA5A 2GF9A 4C0BA 3OIUA 1VHTA 2RGXA 3FE2A 2WOOA 3OAAD 4XSGA 4HSEA 1JJ7A 1NSFA 2GK6A 1E2IA 2HF9A 1M8PA 1EESA 1SXJB 5DI3B 1XMIA 1UBCA 2YYZA 3K0CC 5M04A 1JECA 4IEEA 5D3MB 5JRZA 3A1TA 3AV0B 4LPSA 2A9KA 2YWFA 5IK2A 1AM4D 2AWNA 3OIVA 2GTPA 5FOWA 4AURA 2FPLA 4WAUA 1JR3A 5FI1B 1E4VA 1G5PA 1OLOA 1OW3B 2WBLC 3KTAB 1T91A 1I4LD 3QXCA 3TQFA 1R0ZA 4PX9A 3CRRA 2IYTA 3VFDA 5GJVC 1PUJA 4M8NE 4JBYA 3VHLB 1XXHB 1U2RA 3NIBA 1QDEA 3TR5A 1HURA 2BC9A 4GSYA 3RSLA 3ZZUA 3DEFA 2J0SA 4ZCIA 2HCJB 5HCIA 4L4UA 4GZLA 1PVOA 2J45A 3PV0A 4N0DA 2ZAMA 4QBIA 1SVMA 2W6IA 4Z8YA 3W3ZB 3LLMA 1E1QA 1I4DD 4UXIA 3UKDA 4Z1MA 3Q5EA 1GILA 1KK0A 2XNSA 2P5SA 4G5GA 4LHWA 3VR4A 1GVNB 4POAA 4Q4AA 3SN6A 4WW0A 1N0VC 4B3BA 3Q72A 3GJ8A 4DLSA 1XU4A 2GF0A 4EUNA 1KHTA 1E0SA 5SZIA 2VTKA 5G3YA 3CR7A 1LVGA 1OH7A 4RFSB 2QE7D 2ZROA 2DPXA 1N5IA 3REGA 3SYNA 5JRJA 1XEWY 2IS6A 4A6XA 3LQQA 1XD2B 3U61B 3VU9A 4CDGA 2O5VA 4QG7A 4AK9A 1RIFA 3ZVRA 4TTRA 4RZ2A 4CW7A 1SVKA 1S3GA 1E0AA 4XH9B 1AQUA 2JJ1D 3AVOA 5TY0A 2NO1A 4OQLA 2OLKA 2GBLA 1E2JA 5KDDA 1CS4C 3OIYA 4BLOA 5KNCA 4AKEA 1NLZA 5AUNB 2C9OA 3MSXA 5B58C 2FOLA 3HJNA 1WBDA 3AP1A 1ZM9A 4C30A 1XB2A 4DT1A 4Q18A 2ZJOA 4PC1A 4FIDA 3OEHA 1ZD8A 1D6JA 2ZR9A 3LDAA 1FMJA 3WMEA 5K8IA 5G53C 3OEED 1Q3HA 4TLAA 3GLFA 2D7DA 5FOSA 1G6HA 1DPFA 2GKSA 3KJGA 3CX8A 2KWIA 4JBXA 3LW8A 4PC7A 4EFMA 1N6KA 1LF5A 3IQWA 1XTSA 4JLPA 4HAYA 1HH4A 5FR2A 3AH8A 3B9QA 5FBWB 2PEZA 4PPGA 3CRVA 3W5IA 2IT1A 2DWQA 1NVXQ 4MYTA 2P6NA 2W58A 2YWHA 2YNMA 3RS0A 4OI4A 4AYTA 3K0SA 4L16A 4XWAA 3O8DA 2AKYA 3TK1A 4B6FA 3WRXC 4H1UA 1AS0A 5FI0B 1EFRA 5D3QA 5F3WB 1RRGA 3QF4A 4M9SA 3UMRA 1Z0JA 2FGJA 4OHVA 2WIBA 3MMPA 3W90A 1W4BA 4FMBB 1W5SA 1Z5ZA 1IONA 2DYKA 1W46A 2CCKA 1ZD9A 2EFHB 3GLIE 1CF4A 1YU9A 1XP8A 2EYUA 3TRFA 5FBLB 1OYWA 1KY2A 4C0HA 2FF7A 4E07A 3ADCA 4BFWA 1N0UA 1NY5A 4Q4AB 2R6GA 4KITB 5IHPA 4U02A 3OESA 4KFRA 5FPYA 1BMFA 1BS1A 2QP4A 5EP3A 4BLQA 1RKBA 1XD9A 2OFOA 1RPZA 3C5CA 1S1MA 4US1R 3KX2A 2OHFA 4TYWA 1G8YA 2DFLA 4AYXA 2JDIA 1HA3A 3BB3A 3NC0C 3T1QA 3TVDA 3VU9B 2IK8A 3VR3A 2Y8EA 3NDBB 2VHUA 3I1FA 5A4JA 1UFQA 3U5ZB 2J87A 3WXMA 1RC8A 4XWOA 4CGZA 1KI8A 1KK2A 3B7GA 2VP2A 1F6BA 1A2KC 1VKJA 1Z0KA 4G5SA 4HAWA 2KBEA 4JLVA 4O25A 4RKEA 2QBYA 2QM8A 3CPHA 3X1DA 1C1YA 1NIJA 1W44A 4XJXA 1X1SA 1F2UA 2A3RA 1AKEA 1F48A 2WWFA 3R9XA 3OFNA 1KSGA 4ARZA 2RGNA 3X1YA 3FHCB 1ZJ6A 1KI9A 621PA 3PEWA 4DT1B 4OQFA 1M74A 2JA1A 2L0XA 2CJWB 2W2XA 1UEIA 1MO3A 1UKYA 3GLFB 1VG8A 4R98A 3O47A 1TQDA 4RZUA 5CJ2A 4HUTA 5P21A 1KO4A 1LB1B 1VIYA 1XJQA 2WAXA 5J47A 3GLHA 2ECKA 3LH5A 2GJAA 3EC2A 4DEYA 3B1WA 5E3HA 4LY6A 2KE5A 4L5BA 1OFHA 1W49A 1HQYE 2QENA 5FTJA 4IEIA 2VP6A 421PA 5EXTA 1NLYA 2Q21A 3B13B 2VYFA 1TNDA 4TSFA 2FJUA 4LJ4A 4CEHA 2ZETA 4MUBA 1HY3A 3UIEA 1QHSA 5CM8B 1VIAA 2REOA 4QRHA 3QF4B 3MJRA 1S3SA 4HEJA 3ZZTA 2ZYVX 1BYUA 1TU4A 2QL6A 4BLSA 2BKEA 2MSDB 2QRNA 3WNCA 2PEYA 2WSSA 3U3KA 3GEIA 1T0HB 2D7CA 1LV7A 2PMKA 2YC4C 2WJVA 1W1WA 2IYLD 4PFSA 3X1ZA 4DIDA 1N6IA 4QGAA 1VECA 5FOTA 3BS4A 1NG9A 5FUWA 3P32A 1M34E 5KNBA 2GNOA 1DOAA 5KSYA 3DHWC 2NZ8A 4MGYR 3MAAC 2HV8A 3FMPB 4V0NA 5JI2E 1CR1A 3ZH9B 2QGNA 4LBWA 3RRMA 5CYPA 2CL7X 3CH4B 2XOKA 4QXAA 4LYJA 2P67A 3SFZA 1YRAA 1LNZA 2W00A 1UDWA 4IOLA 4B3XA 5GJBA 1ETUA 4Q9KA 3W5JA 2J0UA 3D8BA 2W83A 2CCGA 1G3QA 4PSVA 4YMVA 1R4AA 3MD0A 4YXWD 5EE9A 4JVLA 4BFUA 2QPAA 4PO9A 3SDZA 2QBYB 4NYJR 5HKKA 1F2UB 3GLGE 2WAYA 1W7AA 2J5XA 3A4MA 3B1VA 1VDZA 4LJ7A 3K1JA 3TH5A 1CJKC 2I3BA 4EPXA 3EW9A 2BBWA 4ZDJA 3T1TA 3FTQA 4PQYA 2XB2A 3D31A 4D26A 1G4AE 3Q8XB 4BLTA 1OIVA 4KAXA 4AWXA 4G1UC 1U81A 1OHHD 1NBMD 2XNDA 3C5HA 1KSJA 1NVWQ 1WRBA 2OAP1 3GLHB 3PITA 1E4YA 1ZNWA 4DSOA 3KQKA 3TSWA 4A0RA 2JGNA 3ZZ0A 3EIHA 1P6XA 4L9SA 4OQXA 2NO7A 3NKVA 5TDHA 2AXNA 3V4FA 2GHIA 3PUXA 3TNFA 3KB2A 1Z0DA 2ZRDA 4CEHB 3KKNA 2OSBA 1QHXA 2RHDA 4DC9A 2F6RA 2G88A 3V00A 4LJ5A 4E22A 2CBZA 1I2MA 4LX0A 4LCBA 5F9FA 1Z0AA 2P5TB 3NBZC 3WNDA 3L8ZA 3UMFA 2R44A 2JLQA 1XMJA 4ESVA 4WZAE 1JNYA 3LX5A 4GBMA 4Q02A 4MKGA 1IN5A 3VX4A 4BFYA 1MRSA 1XTIA 3RRZA 2I4IA 3NBYC 2JLVA 1R5OA 4Q03A 5E7IA 1KI3A 1YZTA 2N46A 2V54A 2LKDA 2ZI4A 3AF0A 3B78A 2RGCA 2B6HA 1GKYA 5EE5B 4U00A 1WF3A 1D2EA 4V0MA 1MO5A 5LBIA 2IW3A 3LLUA 4DSUA 1KK1A 2EVWX 4AD8A 2CNWA 3ICEA 4TTPA 1QHIA 2JCSA 1N5JA 2J0UB 3OAAA 1Q12A 1Q3TA 4Q7KA 1Q1EA 3RRNA 3TAHA 3N5CA 5H68A 8OHMA 1U0JA 2ZRLA 1IAQA 4M53A 3BIFA 1TEVA 3ZVNA 1Z2AA 1GKIA 3DKPA 5JJIA 1OKKD 1TTTA 1G3IA 1ZCBA 3QF7A 3QUSA 5E7JA 1XDBA 2YOHA 3QBTA 1CRPA 3ECCA 2G6BA 1XPUA 4BFSA 4EJSA 1KMHA 3CKLA 4Q01A 3PXGA 1KJYA 5C18A 3LQRA 1S8FA 2HF8A 3NHAA 3WRYC 2PL3A 3PEVA 1QBKC 4KBGA 2GEVA 3QG5A 4DSTA 1E2KA 4FD2A 1P62B 3CM0A 4NCNA 3VR5A 3C8UA 4PR0A 2WIAA 2R6AA 2GZHA 1Q44A 3WNBA 4ESHA 3RANA 3C7KA 3ICQB 4M0LA 2FEMA 3IQXA 1UF9A 4AKHA 2RGGA 2BJWA 4HB3A 5LPNA 4FCVA 3THOA 1AJEA 3PG5A 2RAPA 4ZCMA 4HB4A 3LVQE 4YMTA 1DELA 2CHVA 4Y0AA 2WJHA 3BFXA 2C2HA 3B9PA 5JCZA 2P0EA 3NTUA 5JCPA 4GDFA 2GJ8A 3RWMB 4Q4JA 2ZJBA 4GL2A 3A1SA 2Q3FA 2JLRA 3LX8A 4LBZA 1KI4A 2QE7A 4GOJA 2XTZA 3ZLJA 3SR0A 4IVQA 1XEFA 3E70C 4WXPA 4QNRA 1G9XA 2VSXA 1GM5A 3FPAA 4MKIA 3QENA 3FGNA 2Z83A 3SZRA 1T3SA 4D4LA 4P3YA 2ZSDA 2BM0A 4KJZA 2JJ1A 5DH9A 4TMKA 4QBFA 4DLZA 2A5FA 5DO9A 1B0UA 3CRW1 1KMQA 2WWYA 1KKMA 4QM7A 5JI3E 2XJ9A 1Z83A 1G41A 2CL0X 2GCPA 2FSFA 2XAUA 4QM6A 1UBFA 3H4MA 5DISB 4UNRA 2YWGA 2ZPTX 1CR4A 3KUDA 4UNNA 2OAQ1 4UJ5A 3IHLA 1G3RA 2BMJA 4TLDA 1XTRA 2ZRNA 3TW8B 3OEEA 4HDCA 4B48A 4C7OA 4Q1FA 4TT3D 2IYRA 2FH5B 3DVLA 4NCJA 1OH8A 3IILA 1TEXA 2F9MA 3CIOA 1E99A 4JLKA 3QI2A 1KMHB 2YOFA 5H1YA 4LRWA 2G1JA 4EJSB 4NZYA 4XWKA 1IHUA 5H8WA 3PJRA 4HZUA 2FZ4A 1SULA 1U0HC 2RGAA 2F3TA 1D2NA 3K09C 2REBA 4JLAA 1NMZA 3W3AA 3UMSA 3RC8A 5DGXA 3RC3A 1TUEA 4URZR 2C8VA 3A1VA 6Q21A 3AM1A 3ZJYA 2UZIR 2CE7A 1T5LA 3Q85A 1D9ZA 1YQTA 3BJIC 4KYIB 4MKFA 4G5QA 5FH9A 1DG3A 3Q5DA 3VQTA 3B6EA 3O8BA 1E79A 2WTUA 3CB4A 5ANRB 1IXSB 4Q4LA 3WP1B 3UANA 2R9VA 4NE2A 4A92A 1XNJA 1KO1A 3KQHA 1ZUNB 1AK2A 1CKEA 1NN1A 4C0SA 3ZQ6A 1GL6A 4ZDIA 3K9NA 3SFVA 2KB0A 3NG1A 1XD8A 4Q4JB 1GAJA 1F2TB 4HB0A 4WBSA 4PC2A 4OHWA 5FL7D 2D06A 2OV2A 2MSEB 1LTQA 1GL7A 4B2LA 4R7ZA 4WXRA 2ZS7A 1TMKA 5EE0A 3EG5A 4D0NA 4URYR 4W5JA 3F5FA 4PPFA 1QHNA 2JJ8A 5E7MA 2JLYA 1DAHA 3A1UA 1ZW6A 1P2UA 1YZNA 2W2VA 3D6TB 3DZ8A 3T5GA 5F9HA 3V9PA 5D3MA 4NYMR 1G4UR 1KOFA 2NO0A 1G5TA 4MYHA 4MH0R 2QTHA 2XEXA 4JKYA 3U7GA 1JR3E 3GQBA 1GWNA 3IBYA 1E9RA 1K6MA 1ZMXA 2ERXA 5K8TA 3A37A 4E03A 2PX3A 1IN8A 3SJCA 1N3BA 3TAUA 1N6LA 2QU8A 2RGDA 4QGFA 1GFIA 4C7OB 1NG1A 2XSZD 3PVSA 2J9RA 3G5UA 1EFUA 1WMSA 2JIZD 2VO1A 5IDVA 1GRRA 2D2FA 2YV5A 1SVLA 3SS8A 4Q9HA 2GJKA 4B75A 3M1IA 3THYA 3LBNA 1E9AA 1Z3IX 3SJBA 4H9GA 5CIQA 4LSGA 2ZR7A 1Q20A 1KGDA 2NO9A 3L8YA 5FOVA 4BZQA 3FYHA 4Q9JA 1R5BA 4F4CA 5G3ZA 4ACAA 1CXZA 3IPXA 2PJZA 1JALA 1DS6A 4LHYA 4JLJA 3CNLA 1KKLA 3K0FA 3QXXA 3THXA 1I4TD 1W0JD 3QKRA 2X19A 1E2DA 3T15A 1G19A 3GJ6A 4MGZR 2FSHA 4US2R 1RVDA 3SQWA 5BQ5A 3AKEA 4V0OA 2ZSFA 3QEJA 1E69A 4KV9A 1L4UA 1TAGA 2ZRFA 1A5TA 4FMDF 2PT7A 2RKOA 3QJYA 2BV3A 5C1BA 1QHYA 4KXFB 2C03A 1LF0A 1DBSA 4LV6A 3KUCA 1GIAA 1KK3A 3LXXA 4NONA 4PHGA 2O0HA 4JT2A 1JAHA 1HYQA 2AD5A 4U5XA 1XZPA 1VPLA 2A78A 1M7HA 5FTNA 4KFUA 2QTVB 2V6IA 3QKTA 4OQMA 3AF4A 4W5HA 1Z28A 2ZRJA 1YZLA 4G3XA 3I3SR 4B76A 3IUYA 1GNQA 1Y63A 4TLEA 1ZNYA 3IHWA 4KFTA 2RCNA 2WKRA 3AGQA 5KPJA 5CITA 4PHFA 3AF3A 1EFTA 2QRZA 1N0WA 3LD9A 1G291 2ZUCA 4JVNA 4PO8A 2ZREA 2F3RA 2B7CA 1ZVQA 4RSGA 3LFUA 1COWD 2VPPA 1CJVC 2QT0A 3WYFA 2JLSA 2XITA 4DDUA 2GWHA 2ASEA 3ZGXA 4ASUD 5CK4A 2IS2A 3J81k 1DAIA 1XCMA 4ZI2A 3R20A 3A4NA 3LVRE 3GJ7A 1ZM7A 4DLYA 1G16A 1JPJA 2VSFA 5DIFA 4JMPA 3AF2A 4C0AC 3I32A 1OHHA 3AKDA 1NBMA 3ZYCA 1GNRA 2WJIA 1VCMA 1FQJA 1HQCA 3H84A 3KXLA 3QIAA 3VR2A 4D4KA 4C0LA 1GL9B 3TBKA 3TGPA 2IXEA 2X77A 3BH6A 3GMTA 3UWKA 2EU8A 3THYB 3QVVA 1U9IA 2ODBA 1G5RA 2ODEA 2JASA 2V9PA 4U7DA 2WWHA 4FXPA 3I5XA 4D82A 4EPVA 3K0AA 4TYNA 1U8AA 2Z4RA 1HE8B 2H16A 2ZM5A 2V1XA 3RHFA 1MO4A 2R8RA 3RS7A 4S35A 3QOFA 2RHMA 2FEOA 1XBTA 2BIFA 2QQ0A 5KTYA 2QN6A
chains in the Genus database with same CATH superfamily
2ORWA 2FUG1 3MVEA 3FDIA 1UXOA 2WRZA 3QKRB 3SOPA 3QXJA 4XQGA 4CUJA 2WKSA 3BB4A 1ILWA 3MUFA 4WNAB 1GCGA 3LDGA 1RTTA 4FE7A 1D2CA 3A4VA 2C7VA 1ZGJA 3G8YA 5K8CA 2QKYA 4AWAA 1OFUX 1MB2A 2BZ1A 3EA0A 2DBYA 3IDSA 5FUVA 4ECEA 2X3YA 5JAUA 1NRIA 1D8TA 3WWCA 5B3LA 4RMNA 3ZQJA 1K4YA 3B82A 1XDWA 3L1JA 4XM2A 1T3ZA 2ZB7A 4Z0NA 2G83A 4FQ8A 4PX5A 4QU0A 5SZHB 4Z4IA 2B8EA 3NC4A 3TDKA 4PIMA 1IJFA 1VHLA 2RAFA 1Z08A 1TM4E 4XIYA 5IX8A 3K70C 3KJFA 2X23A 3WMGA 4D81A 2HLDD 5BQFA 4B3DA 2OT3B 1P6QA 5A02A 1NXQA 1Y3BE 7REQA 3N8DA 3GCWA 1B6GA 3EEIA 3U09A 4KBYA 4WNYA 4ZI7A 5I48A 2CJWA 4EUKA 1PSDA 4L8FA 3GJXC 2FWJA 4YPFA 3LHIA 4FE4A 4HLDA 1FUYB 3ZHYA 2VH2A 4CHTA 2PKRA 5HMMA 4RVSA 5C46F 5LVAA 4BNNA 3CYFA 1WF6A 1H3FA 3J7TA 4BQNA 4PONA 4DILA 3AVXA 4DM4A 3PHCA 4LRXA 2WW8A 2ATXA 3OKCA 5SZKB 3IQGX 4I1RA 2I3DA 5CU7A 2EP8A 3FWHA 2JHCA 5KU1A 4OD0A 4OQQA 2V7PA 4RK7A 1YIOA 4OGWA 4DDVA 1GSIA 2DQSA 5JH7A 3Q98A 3DCJA 1TMGE 3NBKA 2XUOA 1MH1A 1BG6A 2JZNA 3FIUA 3NDPA 1EUCB 1XA0A 3VA7A 3HP7A 4GDMA 1NUAA 2ODWA 4JBGA 4NZPA 2GNPA 3HV2A 1LFDB 4O2AB 4ZYLA 1E5TA 2FPMA 3NTLA 1CJSA 3NVAA 2FAXA 3JYQA 5DN6D 3M0EA 3GEGA 4A8HA 3SYLA 2J9GA 1T2VA 1R0CA 1UDXA 1HL7A 3T7TA 4RDXA 1FJXA 3P9KA 5JD3A 1V6AA 4ZZ1A 4BLPA 1YBHA 4P86A 2Y1CA 1D1SA 1GDHA 2BDTA 3UT6A 4EUSA 5C7OO 4LMAA 4BQFA 1ATZA 3E7WA 4IMPA 3CEHA 1P9RA 3F9RA 1MEOA 1CUYA 1UPBA 2CZGA 4RLSA 3ZNPA 2X4LA 4EVSA 5JBQA 4GOND 1HTWA 5DHTA 3QNMA 1UC4B 5I5EA 5DGIA 4X97A 3JALA 2P9EA 3NHUA 4M9RA 2EP5A 1TGVA 1DQSA 2JH3A 2WWVD 2A3NA 2Q99A 3L6DA 3PU6A 4EG8A 3JPWA 3FOAA 4PWYA 4Q3NA 1EK6A 3GP8A 1MJHA 2X7JA 3K9BA 4U63A 2PY6A 4O29A 5KTPA 5IRCD 1U6IA 5KWIA 1L1QA 2A1UB 2IWHA 4HF7A 3KYBA 1QVRA 2H31A 1W87A 4IJMA 5IMSA 1PNRA 2Q4OA 2JLZA 1OZAA 3I2GA 2W2PA 3SZLA 2HD4A 4HGPA 4M22A 1JPNA 5JSKA 2PAFA 3CUVA 1EE1A 6PFKA 4EUFA 1O95D 4X91A 3BDIA 5C8YB 4AJLA 2ZUBA 1Z82A 3EASA 2XWJI 1MB4A 2FX5A 4AQ7A 1MV8A 3F4BA 1Y8AA 2ADFA 4N3GA 2HUNA 2Y93A 4YP9A 3TVTA 5F5NA 3H2IA 3WKEA 3ZKWB 2WU4A 3R3WA 4B8ZA 1DRKA 1GEGA 1SHJA 1OXXK 4RW0A 5BSWA 3VPFA 3BQ9A 5JZOA 1SXQA 3DXFA 1PSWA 3UFXA 1WB9A 3ZUPA 1W85B 1QZXA 2PX5A 3LZDA 1W9MA 5INTA 2A30A 1VQ1A 3MCAA 2QUAA 5AJHA 3DT8A 2PANA 5J40A 3WGUA 3JZMA 1R1DA 5EG5A 5B2ZA 1DIBA 5HJEA 2RONA 1MZVA 5JTUA 3OT4A 1N2CB 1RE1A 2A88A 3IMFA 3E2IA 1YR1A 1KZ9A 4MQBA 1EFAA 1BCSB 2VTEA 5IYZF 4G0QA 2VI5A 3PHHA 4KKXB 5MN5A 1UK8A 1TZCA 2KHZA 4RKYA 4UEWA 4LRQA 3IEVA 4BN0A 1OX5A 1SXGA 4UXJA 3TD9A 4AKTA 1H1LA 4X90A 1QRSA 1KFKB 5EXXA 4LV5B 3OLVA 4JASB 1V5WA 4P0TA 4QXQA 3FBTA 4JOQA 2H5LA 1FEZA 3KHTA 3VNQA 2CSXA 3ZX4A 3ANSA 3AR2A 5J4KA 4RM2A 1XSEA 4JYPA 4PQRA 1J90A 4D45A 4L4ZA 4OQEA 4NBSA 1RZRA 4XEUA 1KS2A 1ZFNA 3VNBA 2CDNA 2OB1A 3B3GA 3P2YA 4L8WB 3ESYA 4GYKA 5ADHA 1PR9A 3MGAA 1VPEA 1CUDA 2O0KA 4C1NA 3K2EA 5KIAA 4AXBA 1M7BA 3QJ5A 3K9CA 2Q07A 3KELA 3CVVA 4O2LA 1ECPA 2WZCA 2H1HA 3ETEA 3KQOA 4DSNA 4FCTA 3ZK9A 3IAUA 4K0KB 3RUIA 2JI6A 3FTNA 3QBVA 1X2BA 3M6AA 4M1TA 5JNSA 1OY1A 1S2GA 2QUKA 3LP5A 3MTEA 3GNTA 1OVMA 2AHRA 2BJHA 3OM8A 2I9PA 3KJZA 3P26A 2P91A 4HWPA 4I99A 4I50B 4IO0A 4O4LB 5DSTA 4BZPA 1DV2A 2WSMA 4ES6A 2AEFA 2HV9A 4FGUA 1P1HA 4O8CA 4ZZ3A 3QY0A 4K0RA 3EXIB 3NR2A 1PJRA 5F35A 5IARA 1ONPA 4F0JA 1PLJA 2IZ1A 3EVEA 4RJIA 3LUKA 3SCZA 1U3DA 2JL1A 2DT8A 1ZITA 2ZTSA 2ZQYA 5IP5A 5EL0A 3ZXXA 1QCYA 1JHMA 2P9ZA 4EI8A 1DJPA 1AQLA 4M89A 4MRVA 2GFQA 5F73A 2FJ0A 1NVUQ 2VK8A 1D4FA 3KLMX 3WL6A 3N2KB 4M0CA 4ZMBA 5C7LO 2AUNA 1R5JA 1QE0A 5DHRA 2QRLA 3COPA 1JHXA 1PQYA 3A7EA 4E30A 1NRXA 3IEXA 1S02A 1T9BA 2HK8A 1DKQA 1U2QA 2PPLA 3NP7A 1W59A 2P0YA 5KUTA 3Q6NA 4ZPJA 1RJ9A 4DA9A 1H66A 5FR1A 3MBIA 3RYHB 1HDGO 3IMCA 4X66B 4NOMA 2YASA 4OH7A 4P31A 1OJLA 5I4CA 1NW3A 3T7KA 1LC3A 5LXTA 5IABA 1FSZA 2FW8A 3DBRA 1TEZA 1DUIA 1IZZA 2DE0X 2R86A 1NP7A 3BH7A 3CT6A 3KKPA 3KOXA 1GUAA 2GN4A 3DEIA 2AZTA 2C9DA 4HQOA 1ZBQA 4JA2A 3I52A 1IHOA 1KQ3A 3BOSA 3K2IA 1CE8B 4L6AA 4MJ3A 1SU4A 2OL4A 4KRYA 1G8PA 1HOXA 3A2LA 5LJLA 4FOPA 4KHPB 4ZYTA 3BD9A 3M6IA 3NNNA 4DEXA 1X1DA 4PG7A 3BMCB 4MLDA 4NU8X 2WSYB 3ZHUA 4F5ZA 4K6GA 2IF2A 1SKYB 3CZMA 3AXTA 1JLLA 2KW5A 4HDOB 3VYWA 2AOXA 3DNPA 3LECA 1MX1A 2HA2A 1MQAA 5C3MA 4RTMA 3OOEA 5CEFA 1B6RA 2WWGA 4TOIA 4DIFA 4KHZA 3JQAD 5HRAA 2IUFA 4J07A 5DRYA 3W9YA 1G64A 4CU2A 4H7IA 5SYNA 4IF6A 4URXR 3UMBA 1LQUA 3LY9A 3LSYA 4OB7A 4W7IA 1R8QA 3Q9UA 4AKGA 4JLNA 2BGWA 4RM3A 1WWKA 1JEOA 5DWVA 1FDRA 1M2HA 3KB1A 3LBAA 3T3GA 2BBSA 3CISA 5T4FA 4LBVA 4QWWA 3MILA 4Z0HO 3IBSA 4Y0VA 2OTCA 1I3KA 3MFQA 2MMCA 1K7CA 3IV6A 2B7LA 3P0HA 2OE2A 4RD6A 1DX6A 1ODIA 2X1LA 3ON5A 2J3DA 2HA3A 1KL7A 1G6KA 4AJ1A 4ER7A 4B8WA 5BN5A 3GHYA 3PNKA 4R2IA 1PG0A 5ESDA 5CLQA 3JWJA 2IX3A 3DA8A 1MR3F 2XODA 4Q3LA 5I45A 1PJ8A 2QP3A 3IKMB 3WJAA 4QOHA 1RI5A 1H8HD 3LM8A 5AM1A 4DUGD 4E70A 2DUNA 3BFVA 1PFGA 1WDWB 2O4CA 4TQAA 1V2HE 2F2TA 1GITA 4E13A 1C9NA 1DRWA 4HDAA 4PBSA 4Q4HB 1EUYA 4NCHA 1X1AA 4GQIA 1U90A 4Q9NA 3ETGA 5JS7A 2JLUA 3ABRB 1E0DA 2WPNA 1USVA 1WSDA 3NCTA 3B9RA 3O74A 3PFGA 4QTTB 1QP7A 3GELA 1U5BA 5KDLA 3DW1X 5FPQA 5LP6B 2XYVA 4M7OA 1TAQA 2IPAB 4LHXA 2OMEA 4ED9A 3VSAA 5K6RA 3OMWA 1K8YB 4GNKA 3HKBB 2JS7A 4ZT4A 1G7CA 1L4HA 3UZUA 2GJ9A 4XVRA 1A0OA 5NULA 3DZBA 4CMHA 2ZJ0A 4D8VA 4YRAA 2VDVE 3F6SA 4PS0A 1NY6A 4Y30A 3FSGD 4QUGA 4XARA 4I1YA 2RSLA 1P31A 4B47A 2BGRA 1FXUA 4RJLA 3JRNA 4A6PA 1R27A 1V8FA 1YI0A 2HMWA 1IE3A 1YO6A 4QIHA 5DGTA 5CFRA 2DERA 3CEJA 5DHAA 2H1OA 2OCYC 3NUZA 2HJGA 3HJFA 2QMOA 3UK0A 4O2BF 3L7YA 1Z35A 4GZ6A 4YWHA 3TIFA 3ZQKA 3BE8A 1U0SY 2WHXA 4DDTA 1QPZA 4EO7A 1GG5A 2J3MA 3QWFA 3VBEA 4R4JA 2MU1A 5JSUA 2HMUA 1A9QA 1H42A 4Q37A 4RWEA 4HAZA 5A5EA 4I2NA 5FORA 4TYYA 4MAAA 1U2GC 1OFTA 2V7UA 1V26A 5HX7A 2ZCVA 3ZVLA 4K81B 1ZMOA 2PX0A 2X1VA 3DV2A 1YT5A 2JF0A 2XXAA 1SG6A 1AGYA 1W0CA 1QIGA 3F6BX 3MPUA 5EUQB 4E3ZA 4AUNA 4XIGS 1U98A 2J46A 3DLTA 4YHBA 2VP3A 4Z9FA 3RGGA 4BATA 4LDQA 2VHCA 2GPBA 3RUAA 2O8CB 5TARA 2DBVO 4X3CA 4WFIA 5EE3A 5EHGA 1TVMA 5JAMA 5JS8A 3O82A 1UXHA 4ALMA 2ZQZA 2QD2A 4J6EA 5KCMA 1XJCA 2GBPA 2MDTA 2DAPA 1UBOS 3VZBA 1X9GA 1PIWA 1AUQA 1ZMRA 1TT5B 2VC2B 3QOXA 4UJ3A 1KRXA 4HN4B 2ZVJA 4YAOA 3TUZC 5DK4A 1JFRA 1G3UA 2NADA 5KJ1A 2IUSA 3QUTA 4NIMA 5IEJA 1Q7TA 4KQ6A 2P2YA 2TMKA 3FXAA 1J0EA 1SXJE 5SY9A 5HQ3A 2EARA 4XGIA 1ND5A 5K0GA 1WZUA 3PI6A 2X8BA 3FGPA 3I9V1 4M38A 3WLSA 1SOUA 4EHAA 1BCRB 3T3NA 1P9OA 3NRBA 1TU3A 1IZYA 5CNJA 4RXUA 5HDBB 1PYOA 5F33A 4HOYA 2P9YA 3G0OA 3IIIA 3BN3A 3C4QA 4MVJP 4FDVA 1ZISA 1XKLA 5J2TB 2R4TA 3FR8A 3V7NA 3JQGB 1GG2A 3K0EA 1JEAA 1Z5PA 2WMYA 1B0AA 4LSMA 1JLHA 2LXNA 3LP8A 3WWDA 1M34B 2HRCA 4HYTA 5DASA 5AIBA 5AW4A 1YRWA 2GYVA 2Q1YA 2BOVA 3KXDA 3RIEA 3WHLA 4QDXA 2IDMA 5HTKA 1RAGA 3M82A 3OX4A 2ES4A 1Q1AA 1VIDA 3GIWA 3CB2A 2XRMA 1JDUA 4IIBA 3UJHA 2I71A 3F6CA 3QUAA 4KMSA 2DR2A 1ZJZA 1IXKA 4HWRA 3PUYA 2BMVA 4IHJA 1UJ2A 4MPDA 4YAJA 3T9FA 4B6SA 3PX7A 4G8JA 1Z6QA 3BXXA 1RHRA 2C9MA 3ESQA 4GLBA 4J0KA 2H1RA 1IAVA 4YYEA 1Y5IA 1ADYA 3H99A 1M54A 3TOCA 3SHWA 2JLWA 3IESA 3GEBA 2VYVD 3PGJA 4YFYA 1ZYUA 3UK7A 1E2MA 1FX0B 3Q7EA 1ANKA 3H1PA 5G41A 1CD5A 4GPBA 2R1VA 3VYSB 4F85A 4MR9B 1XK6A 2C0CA 2XI4A 1OLUA 3TTSA 5JXWA 4EHFA 4PC3A 2ZPUA 1ZA2A 3DV0A 2HO5A 3I9LA 2JI9A 2W4QA 3MS2A 2QW8A 5EC8A 2QNIA 5FFMA 5FEMA 3UG6A 2BAGA 2FWNA 4FEAA 1B2RA 5I5GA 3VX3A 3KSZO 1EK2A 1RWPA 2LKCA 1A9YA 3B36A 2PNJA 3PF9A 3ROQA 3W6PA 4TV8B 5BMVB 1FRZA 3FPSA 2RG1A 4PYMA 2FVYA 2HX1A 3VHQA 5KKAA 4PTYA 4RKRA 1P1FA 4UW9A 4GGMX 4C7BA 3EULA 3GFVA 5LB2A 2LE0A 3F4KA 1YDFA 1R9MA 4WZZA 1IWOA 3F46A 5TR9A 5J2UF 3JQEA 4HG2A 2GN8A 4QU5A 4KXYA 3WK5A 3ZD8A 4NXMB 2MMGA 1KA9H 1RACA 1RQLA 3WBKA 2GD6A 1C9JA 1VI2A 4QU8A 2O5CA 3PJEA 4U7HA 1OFVA 1CRQA 2QN1A 3S2SA 5GY7A 5AUQA 4Q5IA 5LN1A 4B34A 3HR7A 4MS1A 5DBHX 1GCUA 5KYGA 4GXQA 2JGDA 4HQNA 4GFDA 4RANA 3B1KA 5JFOA 1OTHA 2DZDA 3E9EA 4PIPA 1FLDA 3IP7A 4EHJA 3K70D 1TUBA 3NX4A 2JIOA 3RUCA 4BQEA 2QTMA 3T3EA 2PMCA 1L8OA 2WJ4A 1PFUA 4B6QA 1TRHA 2FWPA 3HCWA 4J9VA 2JGJA 4KOAA 1JHYA 1FP6A 3SC3A 1J4AA 2HJSA 2Q8PA 2Y0PA 1Z7EA 1OWPA 3SICE 2O8FB 3IBCA 1VA4A 4RL6A 1PWYE 4N6GA 4XB1A 5I7OA 3V3KA 2OECA 2ZBPA 4NOKA 1SCNE 4BQIA 2DTXA 2QVBA 1RYFA 1WXFA 4MXDA 2EBHX 3UMVA 1NBME 4D56A 3URKA 3T3OA 4I19A 3L5OA 3OO0A 1G8MA 4NCKA 4Q9AA 1NBHA 1VDMA 2OVBA 1Z4NA 1T4CB 4XE5A 4F8JA 3PT5A 1RWKA 3HJHA 4MUAA 4BZXA 4Q15A 1GGMA 2FWMX 1Z5OA 4BNKA 1CLUA 1GPMA 1SCBA 2JJ2A 1KFBB 1T9KA 2R68A 4MW0A 3G0GA 1YU6A 1F4LA 2QB5A 2ANCA 1LTKA 1X7ZB 2AZ4A 3O4GA 3UAXA 3WBFA 4O3MA 2P1ZA 2SHKA 4HDMA 4C76A 3HKEA 2DWOA 3WGNA 3QEMA 6GPBA 3QW2A 3N9IA 2QT9A 1EJ6A 1OBVA 2DLDA 1GG8A 2HRDA 2PD3A 3A6KA 2K6GA 1VE9A 4J76A 4KXVA 4N54A 1V6CA 1WXWA 2BP7B 3MJ4A 3QVKA 4BJ1A 4OXIA 3DNMA 3SC6A 3DD5A 1Q95A 3Q9LA 3RSOA 4URWR 3VAAA 3GT3A 2NV2B 1Z6GA 4WNIA 5FWYB 1DEKA 3SJAA 3DL4A 2EWMA 3A11A 2Z8ZA 2AFRA 3EIFA 2C00A 3FPCA 4H31A 4K9NA 2ZJ5A 2GN6A 2VKQA 4KN5A 5A0FA 3BXOA 2ZVDA 2VP0A 1NPDA 2VRCA 4X8OA 1NF3A 1X87A 2X2PA 4BRSA 1GPYA 3OOHA 3ZWBA 3HC7A 3RVPA 3WO1A 1Y42X 1UBEA 2EX4A 1RPJA 3WHKA 3RHZA 2XQFA 4RVOA 4RHCA 3PC8A 1QGDA 3C1AA 3NWOA 5BQXA 3AU8A 1LI5A 2VLBA 5AHXA 4BX2A 1GP2A 4E5DA 4HUQA 1FQOA 1QS0B 4KLZA 1PQPA 4D9BA 2ZCJA 4QVIA 1J7KA 1WNFA 2CXTA 1FFBA 2WUDA 3CV3A 1J2TA 4PPNA 4R16A 3LW7A 4GP7A 3KPYA 4ZWNA 2DCMA 3RWOA 3D2AA 2BI8A 1JT9A 2J30A 1NJFA 3DOFA 1SVOA 4WASA 3DMPA 4LNAA 1M8GA 3G79A 4B87A 5KPDA 2B4AA 3E5RA 3RD5A 3IO5A 3RJ9A 1ZC3A 5D6OA 2Q8QA 5J5VA 4F4HA 5JV5A 3PX3A 2H63A 4CEJB 4L74A 3KT3A 2D1QA 4PSAA 1G5IA 2ET6A 1AGPA 2DR3A 2X2FA 4OHCA 2IS1A 1FOEB 4OI0A 3A1WA 3A36A 1ZHFA 5D8DA 2J0QA 1CIPA 2YHIB 4H0FA 4J4HA 2AZXA 4EPWA 1U4OA 3P0EA 4Q1CA 2CUKA 1RAFA 1KVUA 2D1TA 2J59A 5E1DA 4F9FA 2Y1EA 1UMCB 3JQPA 1MIHA 3QTLA 4YUAA 3QZUA 2XGSA 5FOXA 4BV2A 2VH5R 3I62A 2A4KA 2GCGA 3OFVA 3O2NA 4KNVA 1N36B 4KWTA 4AX8A 3G85A 5DCLA 4NNOA 1QGUB 3FVQA 5JD6A 1DLJA 3ND8A 4LDAA 3F0TA 2IDJA 5T67A 4J1TC 1VPDA 2WF5A 2W71A 3I34X 3GMDA 5LA6F 1OBHA 5ELMA 1P0IA 2AJLI 4YMSA 2SKDA 3UGKA 4TXNA 4O4JA 3N2IA 5B6JA 3SHFA 3VPGA 3ZDQA 1VYUA 2FK7A 4E51A 3RREA 4QDTA 4NK4A 3WMRA 3KJNA 3KDAA 4LJ9A 4IGKA 1U4SA 1VHWA 3W1WA 1KJZA 3O94A 5GM1A 4DIEA 4IXDA 4DLTA 2RJ3A 3TUIC 3RIYA 4Y9TA 3ZIAD 2X15A 1R0WA 3EMDA 1SCDA 5CBKA 3MWEB 2AX4A 3WMFA 5JZVA 2BHNA 5JMPA 3FKSD 3FG9A 4B7UA 4IW3B 4ZTZB 3HWSA 4TV9F 4TX1A 4YO8A 1OASA 3SIXA 4DZRA 4D9EA 3R5TA 1P5RA 4OFZA 2FE1A 1C81A 3WLMA 5JJKA 5DTQA 1JU3A 1UPTA 1VYTA 2DY1A 1NVVQ 1H8EA 2VPXA 3F8TA 4D9KA 3RI3A 3HXQA 4G5YA 2JH9A 4B3GA 3DEJA 3WWYA 4QZVA 3R7WB 4MP6A 5LIRA 5EQTA 5FTLA 1LY1A 4IJQA 3I8XA 3ZD7A 4IIFA 3ZD6A 3FVVA 5IKEA 1ZD3A 3RS3A 2J8ZA 3H13A 4X44A 2KJQA 1A98A 1E2FA 2GZDA 3NGLA 3TWOA 4ALIA 4JI8B 4DJEC 1D1PA 1NYTA 2C31A 4OJKA 1RYDA 4MGIR 1JAIA 1NNI1 2AXQA 5AW5A 2BKLA 4M9CA 4PYQA 1H5UA 2V45A 1BC5A 4N0EA 2W90A 4W1RA 1YTLA 4AY3A 1GZ6A 3S7ZA 2B1GA 1KAHA 2CLFB 2ZGVA 2PIDA 3L1VA 4KGXA 3W5AA 4M0UA 4CMJA 2BD0A 5GINE 3KDSE 4JUDX 3I37X 4S24A 1M66A 2DWCA 3Q7RA 2LDBA 1TVCA 5B58T 3ZCSA 1G2IA 4KRGA 3VO1A 5TEWA 4F2GA 3BXHA 2VT2A 4B43A 1DB3A 3SK0A 2R1TB 3VYUB 3GJTA 1FXWF 2VXYA 4DMHA 1J33A 4ZYZA 5EI5A 2WMOB 5EHIA 5KNDA 1W48A 3R24A 5TMPA 3QWBA 5DTJA 4PLZA 2Q4EA 3PQ3A 2VWQA 5C31A 2D1RA 3NHRA 3U7EB 5JSZB 3K1TA 3U4QA 1PZNA 4RENA 1MGPA 3QX3A 1DFIA 1F6DA 1NJ6A 1FTSA 2C1ZA 1FY2A 3R0XA 2NZUG 4JN6B 2IUUA 3GFGA 3PF8A 3L7MA 1W5TA 4AO7A 2A4MA 3Q3VA 4CIVA 3LK7A 1V11A 4PQEA 5DYIA 5FYQA 2HA6A 3AEXA 5THKA 4ZCLA 2BI7A 5HR5A 3EVGA 3WWEA 5FBRB 2AN1A 3PGXA 1S89A 3ZHQA 4UNPA 3GZNB 4Z51A 4AS2A 4D4IA 4TQ9A 1KZYC 5ALXA 1LQTA 4JLUA 2Q3MA 2H51A 2HQ1A 3EVDA 2C2MA 1PT9A 3FWZA 3Q0EA 4PYKA 5A4DA 4M37A 4GMFA 1RRVA 3TQTA 5EZ5A 1PZMA 3UO8B 2X3UA 3GARA 1TYEB 3IAM6 2D0PB 4BMCA 2D2EA 3IAAA 3TRHA 1ULTA 5LKRA 1VCIA 4TZ0A 4BFCA 3D81A 4NL4H 1VHJA 2IYOA 2IEIA 1DAKA 3OF5A 3THSA 3VR6H 5IWCA 4QDJA 5K8UA 4OKNA 1UJCA 1NI5A 2W2NA 3FLBA 3L8DA 4I3HA 2XVZA 3L7AA 2D8AA 3H11B 3IIMA 1XA4A 4PYOA 4YUVA 5JALA 4PHHA 3ZS9A 4XYGA 1BQEA 4FFLA 3E9NA 4RQUA 2NNLD 1P44A 4BNFA 1WUJS 1XX6A 3BHMA 3BM5A 3H7IA 3EOBI 2H4YA 2QZPA 2AL7A 2IUTA 2QRMA 5K6AA 1OXMA 1R8SA 4C7MA 1K5PA 2E4WA 2VBFA 4HAOA 1Q17A 3HYLA 2Q6LA 3ENNA 5H02A 2XCIA 4ZP1A 3HO6A 1IIBA 4JLBA 2X0EA 4C4ZA 5B64A 1N33B 4CT4B 3I64A 1YB2A 1BZYA 2XQGA 1ADJA 2YWBA 3CZ9A 1CUAA 1K6XA 3L07A 5EIBC 4UQPA 2P7HA 3AG6A 5DBEX 1SBYA 2AEMA 2F1IA 1I9CA 2IQIA 4HHEA 1O57A 3DUWA 5LZ5A 2H48A 4CKEB 5LUAA 4D3FA 2J9XB 1VFNA 2IOFK 3BXZA 3HBAA 2EKBA 4FMDB 4OJYA 3W2IA 4KR7A 3AUYA 4IIJA 2DCUA 1W96A 4BE4A 2P2LA 3FMGA 3HBJA 3W8FA 1RM3A 5AKXA 3ZOZA 3U7QA 1CY1A 3O8QB 4Y2QA 2W2KB 3C5WP 4UE2A 3INRA 1NC1A 1WUKS 1XMVA 3DFFA 3EVNA 3VTZA 1ETHA 3ORHA 4YTEA 4EJSC 1Z6ZA 1E3IA 3ETCA 5LLSA 2ZI5A 2O2CA 2ZJ2A 4L5YA 4TQUS 4XX1A 5AI9A 3OICA 4WBNB 1CUZA 4J91A 4GICA 1U8CB 2JJYA 3PC7A 2W6JA 4AZ3B 4F38A 4MQEB 2ZVQX 4LOHA 4ZKEA 5JWRA 1F12A 2QNRA 3KWLA 3E7XA 1VL2A 3DKKA 2D59A 4Z8XA 4JP3A 3OY2A 5THXA 3T1NA 5FHRA 1QYCA 1BOOA 4GPD1 1ZWLA 3OSUA 2XZTA 1U7ZA 2XECA 3RAFC 1PQWA 2XZLA 2VPTA 1XQYA 3SJUA 5AVJA 1J8DA 1FBNA 2IEDA 2PUBA 4WKCA 4JXZA 2JGLA 3LYLA 1KE2A 3PQ7A 4Y2YA 3MJHA 1UWLA 4ZK6A 4RX1A 1B00A 5KREA 4G89A 1R5NA 3O4IA 4B3MB 4J1TA 1MT3A 3D3QA 2NUAA 4K9QA 3X1JA 3LPDA 4BTVA 3PHBE 5H4GA 3K0KA 3W1VA 3OCZA 4F4DA 2UVQA 4D92A 3RS2A 3IP8A 4KK3A 1I3MA 1CQJB 3I1YA 3MCTA 2GXUA 4KAJA 1KBZA 2BHRA 2GMWA 1P0CA 3MTDA 5TVGA 4CQMB 5KOHA 4IO1A 3G7NA 3U17A 2JFFA 3EZ6A 4ZRNA 1JNXX 4IINA 2J09A 3A7DA 3BG5A 3GLIA 3HUTA 3GJ3A 5A0VA 1FU4A 1G66A 2C5BA 5L3VA 1HRKA 2C9YA 3HY6A 5BMOA 4GKKB 1FNDA 2QK4A 4LNHA 2DFKB 1MRNA 1SA0B 3ND7A 4HGQA 1NKVA 1WHSA 3VRHA 4ZJUA 4HNTA 4IWYA 3X3HA 1I3CA 1AKYA 2ZWOA 1JH8A 1CHNA 3UJCA 2IELA 4JJFA 1YS1X 4P4SA 5BYBA 2D74A 4TGLA 4D43A 3PA8A 3WB1A 4MS4A 5FPHA 5BUZA 1CEEA 3QLVC 5D6NA 3BFPA 2HAEA 4FN5A 4Q1DA 1S8AA 1JSLA 2A9PA 4HTAA 5F64A 5FI3A 6REQA 5K4HA 1KVTA 5IH7A 2KM1A 1KPIA 2P35A 3X2SA 5J1SB 5HF5A 1BKDR 2D6FA 4N48A 4L3OA 3PS9A 1J07A 2WD7B 2Z6AA 1XR3A 4TL8A 2O8DA 2I8LA 1YQEA 1S96A 3MIZA 4FCWA 3QJGA 3C45A 3OLQA 3JWIA 1X39A 3F71A 5KYTA 1EFVA 4ZODA 5SYAA 5IK2D 5EMLA 1LK5A 1A8UA 1EEXB 5FO0A 4DLXA 3PIRA 4TL7A 4DJ5X 5KWVA 4RTRA 1XJ0A 1V3VA 2UYHA 2PYIA 2DHCA 4K8RB 1JR3D 3R5JA 3UOAB 3BILA 1JQKA 2B9EA 2XQKA 3BK2A 3ESCA 4BEBA 5M5BA 4LJ6A 2ZSAA 3RBVA 3E9ZA 1V96A 4OHUA 4TTJA 1JVSA 3TL2A 5HUHA 5EERA 1KS9A 1JP7A 1PLKA 2NO6A 3I9JA 3UJDA 2C2BA 1CLEA 1KVQA 3N6XA 4EUHA 5JO0A 5L3SB 1JSZA 4C5CA 2QXYA 5HE8A 1XMSA 2OV4A 3O4JA 1MV5A 2D13A 3BDAA 1X8LA 1NI4A 5KU7A 4EMUA 5MFZA 3RTGA 4D4GA 4EY4A 3JD0A 1M6NA 3CUKA 5A6VA 4MKZA 3C7CB 4RF5A 5AP9A 5IYZA 3BMQA 3LA6A 4DCCA 2B0CA 2YJ4A 1LQ2A 2ASVA 2W2LD 5H7XA 1TJ4A 1IEXA 4AZ0A 3UB4A 5C2JB 4M2LA 3MJTA 5IN4A 2Q2VA 1MKYA 2F59A 2AG8A 2Q50A 4IS3A 4QECA 4IDBA 4JNCA 3PKJA 4TKVA 1M2NA 3FLAA 2C2KA 3EY4A 1X1RA 1R0SA 1ODTC 2ATVA 1KTVA 1ITZA 3GUUA 2XNCA 1ORHA 2ODAA 4G5XA 4DRXB 5A6SB 2Q8NA 4JEUA 2HQSA 3FRHA 5CCDA 5CNMA 5JPIA 1OYYA 3PQFA 2YIMA 3HDJA 4WCFC 4W63A 4EB0A 4HQRA 1JQ3A 1ZEMA 1HMPA 4ENPA 1X7XA 2P69A 2Q0SA 1EDBA 3KD2A 1XMOB 1OI2A 4TTAA 4YCBA 2SCUA 3G2HA 5AI0A 1PD0A 1Z2DA 3EZFA 2OFFA 3GLQA 4HVAA 1IDOA 3SVLA 4K05A 2ID8A 4K40A 1VLMA 4F46A 1I4WA 2CC2A 4ISCA 3WHIA 4UBIA 1IEQA 4K9MA 2ZTVA 1JXMA 3KG2A 3PNQA 1WQ3A 3JAWB 4WA7A 4Y3UA 4MHOA 4NYJQ 4WLOA 4E11A 2XZDA 3TLJA 1TFRA 2BEUB 4U2KA 4B3TB 1V39A 3GP3A 2I1VB 1VHQA 3HUEA 1R8JA 1IY0A 2ZXUA 3OTGA 2WE8A 2XF2A 4NZOA 5BYJA 2RJNA 4N5DA 5B53A 3I09A 2B94A 3U3RA 1IMOA 1H93A 3L0YA 3ZDDA 1YOBA 2CDAA 1Z17A 2HNBA 1O94C 3CUYA 2PVSA 2XUGA 5T3UA 5KVAA 1D4ZA 1F1JA 5CYFA 3D3NA 2ARKA 4DADA 1G55A 2AGVA 4L7QA 5FBZA 3TQCA 1MB3A 3ZXSA 1PQUA 1ODKA 1SBTA 4JI7B 1E1LA 2ZIUB 4KQIA 1P7ZA 5JCJA 3IQEA 3FYTA 4E12A 2GUGA 3ASZA 3BMNB 2PO7A 3DP9A 5L6MB 2B4QA 4C43A 4A91A 2GPJA 1Z4OA 5CDGA 1KEEA 2B8WA 3OZRA 4QYIA 3E35A 1Y3FE 5C34B 4Z5XA 4HB2A 4MR8A 3P5SA 2AD1A 2PLFA 2GRUA 3GU3A 4F4IA 2O8EB 3BWEA 2AF4C 1IG0A 1NMYA 5BWMA 5JXHA 2QV0A 1N3IA 2N42A 4N0MA 5IFLA 3I92A 4JROA 3N86A 1YE3A 2EZ4A 3BAFA 3LUDA 3P9YA 1Q1ZA 2PGIA 4IDNA 2J41A 5G02A 1PD1A 4TZ6A 1EX7A 1CZNA 2AKAB 4U3JA 4V3BA 5A9RA 3E03A 1QWSA 1WUHS 4B5KA 3FX2A 4S2UA 3DVSX 1GGJA 4M1SA 1R6UA 2MHCA 1Z47A 3AEZA 5T57A 1PQ4A 3FOCA 2QVLA 3OZ7A 3ZWNA 4PR3A 4CM3A 2ZPAA 4C05A 4OHKA 3PNBA 3UHFA 1HUQA 2Q9BA 3A0UA 1KYIA 3H6KA 1E94E 2YWJA 4MDHA 3U4GA 1QOPB 3U4IA 3MJCA 3H1EA 3VO2A 2XXJA 1YKSA 3AFHA 4FINA 3LKDA 3VR3D 3A3YA 4DDHA 1GQRA 4A16A 3L0IB 1GZ4A 3DMGA 4CCAA 5F4BA 4CPDA 1QQ5A 1T13A 2VP4A 4BKRA 3EIQA 3STUA 2OXEA 4R69A 2IU6A 4Q48A 2WI8A 4NFSA 1ZI6A 5J4HA 4AM8A 3CF6R 3A58B 4G0PA 1TQ2A 4RGYA 5KJEA 2X9LA 4PVDA 2E48A 1DKPA 1FXSA 2OUIA 1UP7A 3EUFA 3VUFA 3I61A 4WESB 2YZ2A 3GXBA 1OLSA 3MWDB 2FPOA 2WJGA 5JDCA 1ZXXA 4PYJA 4RVCA 4D25A 1KIMA 4ETIA 5BVGB 5IT9A 1NVTA 1FUUA 2BKXA 1WU7A 1ARZA 1G8AA 1O08A 2JZCA 3BIJA 4G63A 3WGYA 3DEKA 5ADVA 4MW1A 3HB9A 3IE0A 3THRA 1KXZA 1OX4A 1ZU4A 2O2ZA 4GWGA 5AK4A 3X1WA 3ZWPA 1GPDG 2QPTA 1Z7BA 3UH0A 4FMCB 5EJEA 3LMKA 4B35A 3IP1A 1ML3A 4BO0A 3LUHA 2CF5A 4DEVA 2PR7A 4PRLA 1JF8A 2JHAA 3IBFA 4OGKA 4REQB 5CDFE 2VTBB 5DV9A 2HWWA 4KQ9A 5ILOA 1EWKA 4CMIA 4LHSA 5CB8A 4HNRA 4HDSA 4MA4A 3B6JA 3HVJA 2C77A 2IYUA 2JBAA 3IQFA 1GTJ1 4O2RA 4B4VA 2ZIXA 5ICMA 4WKBA 3USES 1OTYA 1FU8A 1UT6A 1AU9A 1B8OA 1V25A 2D4AA 3FBWA 4Z7OB 2CYBA 521PA 4C3ZA 1JHRA 3OZIA 5LL6P 1IUPA 3EDMA 2QAGA 2VTBA 4Q9IA 2IY8A 1ZZGA 5E8RA 2WFMA 1BFDA 2OUKA 1RQRA 4UBNA 2PWZA 2CNNA 1U8ZA 4MRRA 3N07A 3ITNA 3HJAA 3TSCA 2YTZA 2VVTA 2ZXFA 4C9BA 3KAKA 1XWWA 2GSDA 4O2BA 2JAQA 3NETA 5ERGB 5JBNA 3GZ4A 4GKJB 3OQIB 3USCS 3VJKA 3HCRA 3IMKA 5JG7A 5LMUB 1U3GA 2IY9A 2QTCA 4O4HB 2CDBA 1GCAA 3OIFA 4CRWB 3OQ6A 1IM5A 2FXIA 4DV4B 4X5OA 3NYIA 1QZ3A 1VKHA 1MNAA 5DM70 3QKSA 3QE9Y 5K3FA 1EVYA 4KPUA 2IVZA 3AC0A 3FPJA 4IS2A 1MDBA 4IX9A 4HNAA 1EUZA 1PR0A 4I1SA 4LHZA 2DFVA 2NQ8A 3T5BA 5J5AA 2NU9B 3VU0A 2GXQA 2CLSA 3QVUA 2R6FA 3L18A 3F96A 3R0IA 4LS3A 5CT5A 5HILA 3S1AB 2YOGA 4LYDA 3TECE 2K5UA 1ZOOA 2HK7A 2FQWA 2YWDA 4K6FA 1TXGA 4II2A 2DFNA 1NQUA 1NYQA 1HETA 3IELA 4NULA 3AERB 4DYHA 4JIGA 4GM4A 4WFJA 3CJRA 4NH0A 3NC1C 2PX6A 3E9CA 4YJ2B 3SSNA 3IVCA 2O6HA 1ODFA 1YS2X 1NBEA 2O4UX 1ISPA 4FFOA 2PX2A 4O2AF 3H1FA 5IFKA 1GNLA