3R9IA

2.6a resolution structure of mind complexed with mine (12-31) peptide
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
257
structure length
257
Chain Sequence
ARIIVVTSGKGGVGKTTSSAAIATGLAQKGKKTVVIDFAIGLRNLDLIMGCERRVVYDFVNVIQGDATLNQALIKDKRTENLYILPASQTRDKDALTREGVAKVLDDLKAMDFEFIVCDSPAGIETGALMALYFADEAIITTNPEVSSVRDSDRILGILASKSRRAENGEEPIKEHLLLTRYNPGRVSRGDMLSMEDVLEILRIKLVGVIPEDQSVLRASNQGEPVILDINADAGKAYADTVERLLGEERPFRFIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Septum site-determining protein minD
publication title The Min Oscillator Uses MinD-Dependent Conformational Changes in MinE to Spatially Regulate Cytokinesis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle,hydrolase/cell cycle
total genus 83
structure length 257
sequence length 257
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r9iA00
1EFRD 3LBHA 4TWZA 5EP4A 2F1RA 3TW4A 3RHFA 4NONA 1NKSA 4CRWB 2VYFA 1CP2A 3F0TA 3KKNA 4FMDB 4OK5A 3BBPA 2ZI6A 4B2LA 1QBKC 3GJXC 4QGGA 2EQBA 2QENA 4CT5A 4IOMA 1BYIA 2OUKA 4C0BA 3CZQA 1Z08A 2PCJA 2QEQA 1S2MA 1UEIA 2W00A 5AUPB 1ZM7A 1DS6A 4RZXA 4PAMA 1G18A 3NXSA 3OAAD 5JCZA 5FPYA 5JEEA 4HAUA 2J1LA 2X19A 1R0YA 1P7CA 2J46A 4B75A 1E1QA 5JZVA 2WWGA 4F38A 1N6LA 2HJVA 1TNDA 1J99A 1W4AA 1LTQA 2R6FA 4LCBA 1UPTA 2PEYA 5EE9A 1IY1A 1IY0A 1E2JA 4XSGA 3U3JA 3BD9A 1EFUA 1XJCA 2WWIA 1E2EA 1F2UB 1XD8A 4G5SA 5LPNA 1OXUA 4NYMQ 3SJZA 2IS1A 3L0OA 3IDQA 1XB2A 1XCPA 3GJ8A 1X8KA 4AD8A 1OB2A 1F3OA 1KDTA 2FE4A 4JKYA 2ODBA 2REBA 3EX7C 1KDPA 5CYOA 1RFLA 1P2VA 1RYHA 4HUTA 3VFDA 4KO8A 4OHYA 5EE5B 3NBFA 4MRSA 2BC9A 1SQ5A 1UFQA 2J9RA 3QEJA 2IYVA 4RCZA 2ZS8A 5LD2C 2YZ2A 3EA5A 2IYSA 2JGNA 2D62A 3AQ4A 4IFEA 4Q00A 1HTWA 4AKIA 5GVSA 2NG1A 1OSNA 4TYQA 2JJ1A 1W5TA 5L3SA 4IJMA 1E96A 1R8QA 1E0SA 2QTHA 3FHTA 5FPKA 4R2IA 1CRQA 2HV8A 4A8JB 4K46A 4GP7A 2ZRLA 3X2SA 4FN5A 2CL6X 2RH5A 4TMKA 1GDDA 3DVLA 2JA1A 5JECA 721PA 4TSFA 3FVQA 2WSSA 2C5LA 3JZMA 2AXNA 2WJHA 3BOSA 3P26A 4OBEA 5J4KA 4R2HA 1OIXA 4MGIR 2DB3A 1OH7A 3CNLA 5EXXA 3UMSA 2OAQ1 4LJYA 2GZHA 3O8CA 2WOJA 2PBRA 4JL8A 1CXZA 4Q4HB 3RLFA 3NDPA 1ZVQA 1BO6A 1WMSA 4DDVA 3SQWA 3ZS9A 2QMEA 2NO9A 3QXSA 3OEHD 5E7MA 1KAGA 2WPDA 1NVWQ 3VHLB 1TU4A 4LK2A 3FOZA 3QIAA 2GXSA 4LJ4A 1D8TA 2OFOA 2I1QA 2ATVA 2PZGA 1S8FA 2WMNB 5F2EA 1UBFA 4V0KA 2H7VA 1W4CA 2XOKD 2YVUA 4DB4A 3EZ6A 1XEXB 3PFIA 4N3NA 4NYJR 2GNOA 3THOA 3WYAA 3CONA 1MO5A 3SJAA 2AD5A 2HT1A 1KSFX 1WBBA 3B9QA 4XVQA 5DN6D 4G1UC 4QM7A 4ZCIA 1GOTA 4PC3A 4G5QA 1WQ1R 5IDVA 1Z6XA 1N6OA 1Z22A 1U98A 2GCNA 4X8HA 2ZM5A 3T5DA 4TMZA 3I73A 2GWHA 4F4CA 5F9FA 2WICA 1G3IA 4LGMA 4EFMA 3SZRA 2QBYB 1N25A 2A5GA 2A30A 1IN5A 3FDIA 5BW8A 4OQFA 5FI1B 2F9MA 4A36A 2XITA 4RD4A 1HEIA 1GAJA 3I8SA 4YDHB 1E98A 5G53C 1R0WA 1NIJA 3AEZA 2EFCB 2OXCA 3CKLA 4NH0A 3ICQB 2W83A 5GADl 2PX3A 3FMFA 3B6EA 3GLGA 4QBIA 4CGZA 2YC4C 1FL9A 2P6NA 1E32A 1OXXK 3B9PA 2D74A 2HCBA 3K70B 1EWRA 3ZVLA 2Z5FA 4JS0A 1XXHB 4GOXA 1N6RA 1OFIA 1LF0A 1WF3A 2AFIE 1H8ED 3ASYA 4P33A 5L3QB 4GT1A 1IJFA 1E9DA 4RD0A 3GP8A 4PTLA 3X1DA 3PEYA 4LY6A 1EK0A 5SZIA 1KI2A 1O87A 1OKKD 3WNBA 3Q7PA 1Z6TA 2GCOB 2ZE8A 1GSIA 4C0JA 2JCSA 1F60A 3K53A 4A0HA 4PAOA 3KQHA 3AKCA 4MRRA 2O8EA 2HXSA 3QXCA 1MABB 2HCJB 4KYIB 2VP5A 4JLBA 4BLPA 3TK1A 1GP2A 1GKIA 1U99A 3CWQA 4PHGA 3R9IA 1GNRA 4AY2A 1U81A 1VIYA 2OCAA 3QPUA 4W5WA 5BQ5A 1P2TA 1SHKA 3OF5A 4OI2A 2QA5A 4B73A 3DZ8A 4HAZA 4DLZA 1K5GA 1OW3B 4PHHA 3MFYA 2GEUA 3B78A 3A37A 1UEJA 4RD6A 1TTTA 3WNCA 1GFIA 1HH4A 2YOHA 4PZZA 1GWNA 1G6HA 1VG8A 2YOFA 1J2JA 3HYRA 5JFGA 2P6RA 2GXQA 1DARA 4G5GA 4Z1MA 3TIFA 5G3YA 1MO4A 2WV9A 4EQ6A 1OYYA 2YV5A 1TAGA 4NMMA 3AVXA 4Q1DA 2DWOA 3FKQA 1GIAA 1JR6A 3IO3A 3EZ2A 5CLQA 4OI1A 1R0XA 4LWZA 1G1MA 2CNWA 2QP4A 1SXJC 4HSEA 3KFVA 4PPNA 2RHMA 2WOOA 1AGRA 5L3RA 3KJGA 4DKXA 1G5RA 1VYTA 4IKEA 1FMJA 5TV2A 2WTUA 2OCPA 4FD2A 1RRCA 1SXJA 2VF8A 3TUZC 2JJ2A 1D2NA 4KSCA 1ZINA 2YWFA 3P20A 5HR5A 3FTQA 2A7QA 2QUZA 4K8OA 1YZUA 2C78A 1HT2E 4LRWA 2OE2A 1HA3A 2O5VA 3ND8A 3RSOA 1ZJ6A 1QHYA 2G0NA 2P67A 4I1UA 3VR6A 1WE2A 3DPUA 3T1VA 1M6NA 1X8JA 3TBKA 4BRWA 3B2EA 4B74A 3BB3A 4B6EA 2ORIA 3BJIC 1LV7A 1BOFA 2VP4A 4ZI2A 1ESNA 1M34E 3HWSA 1NI3A 4LBZA 4M53A 2IXEA 1UBGA 3QENA 3FHOA 4QHYA 5JLJA 3HU3A 2DY1A 5H8WA 2BKUA 2X77A 1ESMA 3W5IA 3UWKA 3VR1A 1YRAA 2QTVB 1XBTA 3QKSA 3ASZA 5JWOA 1TUIA 3P1JA 4L8GA 3TUJC 3WRYC 1LF5A 2WKPA 2D7CA 3O8DA 3U7EB 1D5CA 2OG2A 4Y0VA 1UKEA 1KMHA 3LQQA 2ORWA 4TL8A 1KKLA 4ON9A 4L15A 3PEVA 2AKAB 1KY3A 3THXB 3HP1A 4BPBA 4NZYA 3WP1B 5KPDA 4TTQA 1XTRA 2BBTA 4GZLA 4DLSA 2PMKA 3AF1A 2IEZA 1G64A 1PLJA 2VHCA 3Q85A 4P4SB 4RZ3A 4DDTA 1TQ2A 2F43A 2IS2A 3MJRA 1NP6A 4OL0A 4TT3A 4RCYA 5JI2E 4CEJB 1G4UR 1KKMA 4DWJA 1T3LA 1MOZA 1AIPA 4RFSB 2NO7A 5C18A 2FFAA 2N46A 4WW0A 5JJIA 2IBMA 1PJRA 1N0WA 4MDFA 3Q3JB 2IF2A 3SDZA 1I2DA 1LS1A 2QG6A 2JLUA 1S3GA 1COWA 3PXGA 4QHSA 2BJWA 1II9A 2DFKB 2I3BA 2VSOA 1NVXQ 2ZS9A 1EXMA 2B8TA 4BLOA 2GJKA 3MCAA 4CIDA 1D9ZA 1G8HA 2PMDA 5JHHB 5JBQA 5JSZB 1OLOA 1XXHE 4XTCS 3X1YA 3ZVNA 3ADKA 2X2EA 3WBKA 5UKDA 1YRBA 4FXPA 5DYIA 2IXGA 1HY3A 4BFYA 2PLRA 4XOIA 1ZIOA 4BFWA 1PV4A 2ZEJA 3MWKA 2FFQA 1XZQA 4M9SA 3RABA 4FW9A 1X1SA 4BFZA 4V0ME 2UVQA 2AFHE 5DGXA 1J7KA 5DNYB 5AUNB 2IYRA 2HJGA 1A4RA 2VF7A 1UF9A 3U2QA 4TLAA 1DELA 2F3RA 2O0JA 4I81A 4N0EA 4UNPA 2BWJA 3HDTA 1M7GA 1KYIA 2G9NA 3PUVA 4OI4A 3KUCA 1CF4A 1AK2A 1R7RA 1AQYA 1T9HA 1EGAA 4Q4LA 3ADBA 3IGFA 4YMUA 1W44A 3AV0B 4BECA 1E2PA 3EPJA 1EX7A 1SVKA 2NTYC 2Q3HA 5E95A 3FFAA 3PUXA 4PSAA 5LB4A 3RS5A 3I72A 1XP8A 1N6KA 4QRHA 2A5FA 3F8TA 4R98A 3RRZA 3ZVRA 1KZGB 3WMFA 2A2ZA 5FUXA 4ACAA 3KKMA 4E09A 1J70A 2CHVA 1ZD1A 1EFHA 1RJ9A 1O3YA 3RC3A 1SVSA 4ZCMA 1Y63A 5B30A 2RGEA 4JLVA 4WAUA 4I4LA 3QBVA 2FSGA 2W6JA 1SULA 2FG5A 3BB1A 4KITB 3H1TA 3REGA 3DOFA 5KU1A 1BMFA 5EXSA 1YZKA 3GJ4A 4N0DA 3FHCB 4CEHB 5DI3B 2F6RA 1N5KA 4KFRA 4QBGB 3TMKA 2W2XA 2IWRA 2NPFA 2J3EA 3AF3A 2P2LA 4MGKR 2CE7A 3AVTA 2ERYA 3C8UA 2YWHA 1F48A 4A4DA 1G41A 2FPMA 1BH2A 1Q1BA 2WBLC 3OFNA 4E07A 2XZLA 2C04A 2Z83A 1IN8A 3CX7A 3KQUA 2JLWA 2RGCA 4C2UA 2YOGA 5J4VA 3T1OA 1DG1G 2WMOB 1H8HD 3B13B 1D2EA 1VMAA 4C0AC 2VTKA 1ZYUA 4F92B 1IQPA 4JIMA 3ADCA 4FMCB 1TADA 1YR7A 3K0EA 2IEYA 2ZI9A 3PEUA 2NO1A 5LDDC 3OEEA 2XB2A 3E1SA 3GLIB 3CPJB 4DSTA 2G0TA 1E79D 4KYUA 1G21E 1V43A 1KJWA 1IJEA 1AKYA 1E99A 3R20A 3NBYC 2H92A 5KSPA 3PJRA 5TVKA 4C7OB 5AR1A 3QXJA 1ZU5A 5IRCD 1YR6A 3SU8A 4EAQA 2O8FA 1IHUA 521PA 4B34A 1NNEA 5KTYA 1T5LA 2ZREA 1KI9A 3TNFA 3OESA 1XMIA 4CEIB 2W58A 1NLYA 3M4YA 3R9XA 4QM6A 1GL9B 2XTMA 3VQTA 1X1RA 3EPKA 5FBVB 3PUZA 1KTVA 2CCKA 1NMXA 3W6PA 1CJMA 4Q19A 4Q4HA 2GVDC 1S9HA 2CK3A 2NO0A 4DUGD 1XMSA 4G01B 1ZD9A 4F7WA 2OFWA 5FPSA 4UKDA 1P9NA 5TB5A 3KL4A 1ANKA 3JVUA 3U7FB 1KI6A 3K0FA 3K0CC 4D82A 1OT3A 4TYPA 1NN0A 3QQ5A 4XD7A 4US2R 3O8RA 1JNYA 1ZNYA 2IXFA 1FQKA 3TLXA 1K6MA 2EFDB 3I4LA 5H68A 3Q7QA 5TY0A 1Q12A 5DSZA 1KO4A 3CIOA 4LV5B 5EUMA 4M1KA 1N2CE 2CHQA 3K0CA 2VRWA 5CM8B 4BQSA 4DCVA 3KTAB 4D0LB 1VCMA 4AYWA 4A9AA 4IDNA 4NP6A 4LV6A 1FP7A 2UKDA 5GJVC 3X1ZA 1FFHA 2VP6A 1N6PA 1GL7A 4D4JA 2RGGA 4RJLA 5DH9A 1NMYA 3U7GA 2Q0HA 5FUWA 2QM8A 2VHJA 5BN3A 5FPTA 1G8FA 3CX6A 3DMNA 3K70C 4BGDA 5A4JA 3QPWA 2RAPA 2BMDA 4C3ZA 4ASUA 4NBSA 2QROA 3DEFA 3QVVA 2R44A 5KNCA 1G7RA 4OKSA 4Z54A 3WHLA 4F4JA 1Z83A 3MJHA 1W36D 1EFRA 1JQLB 3ZQ6A 4QKQA 2ZRIA 4LBVA 4M1WA 3DKPA 1FQJA 1NY6A 3CNOA 1XU4A 4M1TA 3AGQA 1VPLA 1Z0KA 2J0UB 4JVNA 1VCNA 4PPQA 1IY2A 4D26A 4IVQA 4UNNA 4KVGA 3AUYA 5AJXA 4EPVA 4NCJA 3WRXC 1NL3A 3DHWC 5J40A 1RRGA 4XWOA 1ZMXA 2IHYA 3K0AA 4HDOB 4DCTA 2CLDX 2FGKA 3CUEF 3Q5DA 4JVSB 1T8TA 1OH6A 1GRQA 4KV9A 4BZXA 3OAAA 1XEFA 1RIFA 2XTZA 3EWAA 4MKHA 4NCNA 5J4HA 1KGDA 1ZM4A 1RC8A 2F1JA 3NDBB 2GK6A 1I2MA 1NVVQ 2GJAA 4JBXA 4F93B 3R7WB 2V6IA 4LC0A 4PR0A 2CE2X 1XTQA 3FKSD 5CDFE 4TQUS 2H57A 1B23P 1VHTA 3TRFA 4QC2A 5J5CA 4TYYA 3P32A 2IW3A 4MRVA 4URYR 1VG1A 4DDWA 4QXAA 1P2UA 1FOEB 3TSWA 1KJYA 1G20E 3A1TA 5CM9C 1E1RD 5P21A 1S3SA 3A1VA 4QGHA 1AA9A 4QBHA 2VQSA 4URWR 4HYYA 3I1FA 5KDDA 1IN6A 4O2LA 3LV8A 1G3MA 3TUIC 1Y3AA 4RKFA 1W47A 2IYQA 4LBWA 5CIWA 2VHQA 2JLVA 1T0HB 3C15C 1XD2A 1D6JA 4TMTA 2ZANA 4UXJA 3W90A 3U5ZB 2TMKA 5FOSA 3GLIE 4QNRA 3IBYA 4PZYA 2WWFA 2GXUA 1Z28A 1WP9A 3M6AA 4MGZR 4A1FA 4WZ6A 1KI7A 5FH9A 1KZ7B 2WWWA 3AUXA 1N5LA 3U6BA 2C99A 1FTSA 1ZM2A 1QRAA 1G6OA 3Q9LA 2FEMA 2FGJA 4LSGA 4JBWA 1OXVA 5D3MB 4B3FX 2XXAB 5L8VA 3U3RA 1YKSA 1KNXA 1U0LA 3HPRA 3K70D 2XNDD 4TL6A 4JSYA 2KSQA 3PIRA 2G88A 4BLQA 1YHNA 2BEJA 2B92A 2AKYA 5FOTA 4PC6A 3GJ5A 2BV3A 3LW8A 4PO1A 1VCOA 2Z4RA 4TL9A 4XVRA 3SI7A 1Q1ZA 1S96A 1Z29A 4P31A 3IKJA 4X8MA 3A4NA 2CCGA 4FWIB 4HAXA 5F9HA 2XX3A 4HAYA 3TE6A 1J90A 2N42A 3LRPA 1GILA 1W4BA 1XNJA 3AVQA 1Q3HA 4BEJA 4MUAA 4BFSA 3QG5A 5KSOA 1NRJB 1Q0UA 2A5YB 1I4TD 1SGWA 4DT1A 2O8DB 3LVQE 3TQCA 4DLWA 1Z6AA 1XCGB 1ONBA 1AZTA 1XTKA 1JR3D 2X2FA 1OFHA 2VO1A 3QE0A 3OEHA 4LX0A 4JLNA 1D9XA 1RKBA 4GSYA 5FUVA 1JEDA 1H65A 2V54A 4O25A 5HZHA 5KNBA 3RAPR 4A0FA 5CK5A 2XOKA 3ZS8A 2NZJA 2ZRHA 2PJRA 2ZSDA 4D80A 1GZSA 2KWIA 1XTJA 4L9WA 4LHXA 1N6NA 5DN6A 4AG5A 2ZS7A 1II8A 2IWHA 2O52A 3BXZA 3RRYA 3D6TB 3T5GA 4HLUC 4A82A 4EPXA 2VSXA 1E94E 5G40A 3U4QA 3THYB 2V9PA 3QF4B 1ZNXA 4MUBA 3W6OA 3QY0A 5TARA 2X8AA 2ZRPA 2OLJA 1DOAA 1ODFA 3BORA 5E7IA 1PLLA 4OQLA 2E87A 4L16A 2J7PD 3A4MA 5J4LA 4OHZA 1Z0IA 3B1ZA 4AK9A 2FV8A 4LUCA 2YNMA 4BRUA 3I5XA 2FZLA 2Q3MA 1G7SA 3LLMA 2Q9BA 2DFLA 4JLKA 2D06A 2ZJAA 4LHYA 3FMOB 4M22A 3TAHA 221PA 4NYIR 1UKVY 2BBSA 2LKCA 2X1VA 2GTPA 5BXQC 5CB6A 1W36B 2ODEA 3VR3A 3FGNA 2JEOA 1VYVA 2GEDA 3VAAA 2JDID 3TSOA 4JYCA 1GL6A 1KSJA 1OKKA 2DPXA 5FTJA 3REFA 1OHHD 4B3BA 2IUUA 4CYMA 3VR2A 1MT0A 2RGNC 1DAGA 4J0QA 3GEIA 3HU2A 1KSGA 2C95A 3GLHB 2WIBA 2LWIA 1L7VC 4E03A 4HAWA 3ZYCA 2V3CC 5JS8A 3FWYA 2W2TA 3IHWA 4BUJA 1LS6A 1XMJA 4MQBA 4JSTA 1K5DA 1T91A 3SHWA 4HLCA 2FPKA 2Z4SA 4Q1AA 3C5HA 3IO5A 4H1VA 3SC3A 1KI3A 3NHBA 4LYJA 4QOSA 4R9UC 3W5JA 3PEWA 1R5OA 2YINC 2ZUBA 3CNNA 1VTKA 2NPIA 1SVMA 3VU9A 5C4MA 1W0KA 2B21A 2DCUA 2QTFA 4TYWA 2QPOA 3GFPA 1DBSA 5CYPA 1XCMA 2QM7A 3K8YA 2XZOA 3AVWA 3CF0A 2I1VB 2WJJA 2ZJBA 3L2OB 4D6PA 1XEWX 5CDFA 3QEOA 3F5FA 1P9WA 4NYJQ 3AVVA 5K8UA 3I5YA 5C46F 1M1YE 4IDPA 1OH8A 3CO5A 1Q3TA 1QHIA 4YMVA 1IN7A 2V4ZA 2ZJ8A 3GFOA 1XZPA 2NGRA 1R6BX 3DOEA 2REOA 3QSYA 4WXRA 2YWEA 3FB4A 1UKYA 3BRWD 3Q5EA 5E7JA 1XEWY 2IYWA 2GZDA 3WMGA 1GUAA 1Q57A 3SE0A 2QP9X 3KJEA 4OQMA 4JLDA 2BCJQ 2GXAA 3S1AB 5GJCA 1CR0A 2MMGA 3IIJA 1CR1A 1VECA 3B1YA 3QKRB 4M9ZA 5EXTA 3UKDA 3GLIA 3A6PC 1F6BA 4TN1A 1HQYE 1HE8B 3FYHA 1CU1A 4ERNA 3LXXA 4A2WA 2AK3A 4LYHA 4C0SA 1QF9A 4C7OA 3UMRA 1A82A 3UWOA 2GEVA 2OBMA 4PC2A 5IT5A 3NEJA 4FCWA 2XNSA 4Q7LA 1OV4A 3SS8A 3QI2A 2ZJYA 4PPGA 4BZPA 4X8LA 3M0EA 3U3MA 2F3TA 1II0A 2Z0MA 5EE3A 5FOUA 3CPEA 4EPWA 3IPYA 2QSYA 5KYKA 2ZRMA 4PX9A 1E2MA 2DWQA 5AK0A 3FPAA 3UMFA 2ZAMA 3BB4A 2HF8A 4GOKA 4P4UA 2J0QA 2R8RA 5DO9A 4RD3A 1Z0FA 1ZRHA 1OJLA 3D8BA 2VLIA 4B35A 3C4JA 2WSSD 2O8CB 2OESA 4GPTA 2XEXA 1JALA 4LJ8A 4TMWA 3WBJA 2C8VA 4FCTA 4DEYA 5JMTA 2AL7A 4BEBA 1FX0A 2LCFA 2WJYA 4E22A 4WIAA 3AM1A 1W0JD 2NQ2C 3L0PA 2J87A 1GKUB 3U44A 2VP2A 4MKFA 2DHRA 3NHAA 4NE2A 2O8BB 4OHWA 2ZROA 1QZXA 4FIDA 1XPUA 3KB2A 1SZPA 1VKJA 2AK2A 4BASA 5FL7D 4Q18A 2YKGA 2Q6TA 1W1WA 2R6GA 5ANRB 2BMEA 4DIEA 4CW7A 4PFSA 3ZZ0A 3NVAA 4HLDA 2QP3A 3B7GA 1NG1A 5EE0A 3DDCA 4OI0A 1DAIA 1QHHA 2ZJOA 3KXIA 2GILA 3ZZTA 4HAVA 3W8NA 2HT6A 1XX6A 5IK2D 2IYUA 1GNQA 3ZD6A 1OFUX 4HZUA 4W7SA 4AIIA 1VIAA 3U3OA 4EDHA 5A0FA 3GMTA 3ICEA 2BBWA 2FN4A 3T1QA 2C98A 1ZUNB 4Q4AA 4URUR 4TLDA 2N1BA 2J41A 4KFUA 1M7BA 2WWHA 3SN6A 1VG0B 3GJ7A 4PQFA 2RGBA 1QVAA 1EX6A 2C03A 4U7DA 2PL3A 2WJIA 1KSHA 2F1HA 3Q72A 3QF7A 3WYFA 1S1MA 4Q01A 2IUTA 3GLHE 1TEVA 4ZCLA 4I1SA 1MO6A 1Z47A 1ELOA 4ZIRA 4JT2A 5CJPA 4KLZA 4HDQB 1HQCA 2H1LA 5K8TA 4V0OA 1PLKA 3EW9A 1FUKA 3GJ3A 1NG9A 5AWFC 1US8A 4DDUA 2ODNA 5FL3A 1M74A 2GESA 4OJKA 4BLSA 4XVUA 1E9BA 2ZRJA 2V1UA 4D0GA 3RS4A 2FH5B 2EWWA 1P3JA 3CH4B 4IEIA 4LHVA 2BM0A 5AUQA 4GOJA 4ILEA 1FUUA 2OV2A 3C16C 5HZKA 3THWA 1GTVA 1T5IA 3I61A 1NVUQ 2XJ9A 1WCV1 2CMKA 2V7QA 4Q1EA 1XDBA 4V02A 4A0GA 1UAAA 4EPYA 4G5RA 4EJSC 3ZDQA 1Q44A 3X1XA 5EP2A 4II7A 6Q21A 4LPKA 1U90A 4HB4A 1CIPA 3NIBA 4PHTA 4EJSA 2R6CA 2NO6A 5KHOC 1KOFA 4TL7A 1G3UA 3RYTC 2HUPA 3AF2A 3D3QA 1ZC3A 2QGNA 2CJWA 1RW4A 1CULC 1IOZA 4IXMA 1WA5A 3LA6A 2A9KA 2H5EA 2AXPA 1H8HA 1XJQA 1N3BA 4TZ0A 5F3WB 1YZQA 1IXRC 4HUQA 3NTUA 3GJ0A 1TUEA 2OHFA 1Q1QA 1Q20A 1FNMA 4LOAA 2ONKA 2OBNA 4Q9LA 2WM9B 1UKZA 2H18A 2EYQA 3R9WA 4URZR 4YMSA 1F2TA 1DAHA 4KU4A 3CM0A 2CLSA 2MMCA 3DM5A 5AJVB 1E79A 1DO0A 3MAAC 2WHXA 4P3YA 2B7CA 2JIZD 4RY2A 1E9SA 3B8HA 4DRZA 4HZIA 2ZSBA 1KI8A 2IC5A 4PQRA 2D7DA 3L43A 3NWJA 2KBFA 2R6DA 1RPZA 3LNCA 4KXFB 4OQXA 1Z6YA 2NOAA 2XZPA 1QG4A 1JR3E 4NPHA 5FPHA 5LD2B 4EFLA 5L3SB 1S0UA 4IOJA 3BWDD 2HYIC 2G6BA 3H86A 3PITA 3K1JA 2F1IA 3MWYW 4DSUA 1KI1A 4IDHA 4Q7MB 1U0JA 2QU8A 2C9OA 3ZIAD 1Z0DA 2MSCB 2WKQA 4POAA 3ADDA 2B7BA 4A15A 4DUGA 3H2YA 3DM9B 1Q21A 3CRMA 3WNDA 4M21A 1E0AA 1ZM3A 2ONJA 2GBLC 2QAGB 1CR4A 4LJ9A 5TMPA 2ATXA 5DIFA 1LY1A 1F2UA 3SBDA 1E2HA 1R10A 1KNQA 2BM1A 2XSZD 2ZI4A 4LI0A 4Q47A 3AVUA 1K8RA 1RYFA 2OLKA 3EIHA 4M9XA 4MRPA 1N6HA 2RGXA 2ZUCA 5C1BA 2IYLD 3I32A 2G3YA 1IONA 1UBEA 2QORA 4PANA 4Q9HA 3VR4A 3A58B 2BMJA 4DBLC 5ELXA 3QG1A 4DVGA 4EIWA 5JS7A 2PZEA 5M04A 3UK6A 1BIFA 2BEKA 2ASEA 3QF4A 4Q9KA 2W0MA 3BFVA 3C14C 2ZQ5A 3EASA 2IYYA 2C2HA 1CKEA 1Z3IX 3I92A 4PPFA 4UJ5A 4JLMA 1W5SA 3CRQA 1G5TA 4B3XA 3KB1A 4A8JC 4LPSA 2VPPA 5AJWA 3ZVMA 3U61B 4GMDA 1XPRA 1W36C 4DHEA 1KHTA 4MGYR 2OCBA 4MYUA 4QNMA 3JZAA 3OIYA 5FTNA 4IOLA 5KOYA 2DFTA 1R0ZA 2VEDA 4A8JA 1WDTA 2ZRDA 1PZNA 3N2EA 5FBRB 5K8LA 2ZRNA 2OAP1 1A2BA 5CK4A 1XPOA 1E2IA 3OIVA 5JJKA 3H0KA 1J8YF 2FSHA 4F91B 4A6PA 1KY2A 2CDNA 4BLTA 3UATA 4RKEA 1G5PA 4URVR 5B64A 3B1VA 3AVOA 1ZUIA 4M1MA 2DYKA 4ARZB 5GJBA 3G0HA 2Z43A 1Z2CA 4Q4JB 5EZ6B 3IUYA 4NDZA 1OXTA 3WY9A 4B3DA 4ESVA 3GLGB 1W2GA 4S2EA 1XRJA 3AF0A 3EIQA 2IYXA 3EZFA 3LAWA 4WBSA 2B8WA 4Q66C 3N5CA 2IS4A 3TJZA 3TSZA 1CJTC 1LFDB 1JXMA 3R8CA 3C7KA 621PA 1Z07A 3GLFB 2ZJ2A 2WJVA 1J8MF 3EC1A 2R65A 1PVOA 2HEIA 3NBZC 3MMPA 2ORVA 2H8KA 1GG2A 4Q9IA 1OIVA 4PO9A 4DC9A 1NBMD 2P5SA 5KNDA 2O8EB 1XEXA 2EU8A 1E1RA 3KJHA 4DLXA 2G77B 1P61B 3CF2A 121PA 5G41A 5BWMA 1E69A 1MO3A 1P75A 5CJ2A 2P65A 2GJ8A 1ZCAA 2JLSA 1G8GA 2WVJA 2XJ4A 3RWMB 4XWKA 2GJ9A 2OSBA 1YE8A 1QHXA 4HI0E 1KK3A 1T0JB 3RS2A 4B71A 4DLYA 4NTZA 5C4GB 4LJAA 1AGPA 1P4SA 2QBYA 1BMFD 3P4XA 1FMLA 4D81A 2QL6A 4TTPA 1P6XA 1P60A 4ABYA 3RS7A 2JATA 4EQ6B 4XTRA 3DZDA 2RCNA 2GDJA 2ZJ5A 2V55B 2P5TB 4FINA 2YJTD 4LC1A 1A7JA 4GFDA 4IFBA 5D3QA 4AYTA 3UANA 1CRPA 3LFUA 2BMFA 2BVNA 1CJUC 5EZ5A 2W6ID 4WXPA 2XNDA 1XXHA 2GJSA 4QJ3A 3VMFA 5L3QA 2V8OA 3TKLA 2KBEA 5AJYA 4M0LA 1SXJB 2FPLA 4UNQA 3SYKA 4KHZA 5FBWB 4JT4A 1S9DA 4L9SA 4OJQA 3MGCA 4I1OA 1E9FA 2GCOA 4V0MA 1TL7C 1SHZA 4NKRA 1MABA 3BGWA 4B3GA 4RD1A 4WVFA 1CTQA 1RRFA 4MA4A 4G5OA 1DEKA 5FTKA 1CBUA 3FFBA 2QY9A 2GA8A 5IF9A 4QG7A 1LVGA 4A6XA 1R4AA 1ZC4A 4PQYA 1VYUA 4ZDWA 3TR5A 4G0NA 3N70A 2Q9AA 3K9LA 2QSZA 2W2VA 1E0KA 2ZE6A 2FFHA 1U8AA 1JBKA 1XFAA 1CJKC 3BH7A 2IHBA 2LKDA 4AI6A 3FMPB 4B33A 3AP2A 4TLCA 2GKSA 1TEXA 3QOFA 2ERXA 2WIAA 4JJKA 3VKWA 4AC9A 4JLPA 2ZPTX 2AD1A 1S4QA 2EYUA 2DFNA 1E2KA 2DR3A 3MUFA 4LHZA 1WB9A 1YZGA 3QKSB 4IDOA 4TYNA 1ZCBA 3I3SR 1NSTA 1WXQA 4GMXA 5JHGB 2D4HA 2AWNA 2BBOA 2FDCA 2L0XA 2CK3D 1MRSA 3KDSE 1KMHB 2ZE7A 1GM5A 3T61A 5BYJA 2PZFA 5JJLA 1FTNA 5KUTA 3NH9A 1L2TA 3W6NA 5SZKB 5JI3E 1P5ZB 5DYGA 1BYUA 3GEHA 5EE1A 1OH5A 1JAHA 4WZAE 4MKGA 3TH5A 4AYXA 2OO7A 5EJEA 2ZU0C 1Z2AA 2F43B 4KBFA 2J7PA 1P62B 1SKYB 3QBTA 3WP0A 4HDCA 3WMEA 3PQCA 3NC0C 4AKEA 1IXSB 1HT1E 2R6AA 4HB2A 3AKDA 1MV5A 3LLUA 4L5BA 1RZ3A 1DO2A 3F3YA 3KJIA 2ZI7A 3B1XA 3OE7D 3AKYA 2IX3A 2PJZA 5FBLB 1NN5A 2G83A 5JRZA 4KFTA 2PCLA 3CB4A 4JKIA 4XIGS 3Q8XB 4MH0R 2G1KA 4U5XA 4CDGA 3GLFE 4YDSA 4ZO4A 1OHHA 1YJ5A 2ZXUA 1R5BA 1SKQA 1TQ6A 2IUSA 3OHMA 4MRNA 5HKKD 1JXOA 3CPHA 5EP1A 1M2OB 4Q1BA 2ZRGA 4QBFA 2XTNA 4DCSA 2VHTA 1YR9A 2Q9CA 3LVRE 3THXA 1G3QA 2ODWA 2IK8A 3A4LA 4LBYA 2JAQA 1DPFA 3GCGA 2HLDD 821PA 3IBGA 3LBNA 4P4SA 1KAOA 4RSGA 4YXWD 2OEPA 3IIKA 1YR8A 4CEJA 4GBMA 1TF7A 2FA9A 4DLTA 4Q9JA 1FP6A 1E3MA 3RWOA 1PUIA 2FFBA 2GAAA 3ETLA 1W7AA 4RFSA 2GETA 4HB3A 2NMVA 3T35A 2BIFA 1VG9B 2QNRA 1KDOA 3DMDA 1OB5A 3LQRA 2FJUA 2ZR9A 1IBRA 1P72A 2CVHA 2ZJZA 1E9EA 4IRUB 2BHRA 4A0RA 3SBEA 1BKDR 3KUDA 3X1WA 1ZNWA 1QHSA 4FI3C 2A3RA 1RJ9B 1W48A 3T12A 4NYMR 4Z51A 2QE7D 1T3SA 4OHXA 3EPHA 3QJYA 2OXRA 1Z0JA 1T8UA 5JSZA 3IQWA 3QUSA 3HPQA 4XH9B 4HLUA 3DO6A 5KDLA 1GITA 5TXGA 2QQEA 1LB1B 1SXJE 3BH6A 4HATA 4N1AA 4V0NA 1X6VA 1E9RA 1EFCA 2F7SA 3E70C 3V9PA 3W34A 1XTIA 1ZBDA 3RC8A 1NKTA 4KBGA 1NY5A 1CS4C 3PR1A 4KSBA 3IEVA 3CWZA 2WSMA 4BFTA 4FWTA 3EG5A 4NYIQ 4M8NE 1G16A 1H8EA 2CBZA 3IIMA 5CB8A 4JBYA 1E2LA 2ZRFA 4KJZA 2GK7A 3A8TA 4KVAA 2OZEA 3EA0A 3SYNA 5KDOA 5JWHA 1JI0A 5FOVA 3ZZUA 1SVOA 2ANCA 2ZAOA 3K0SA 2FOLA 2IYZA 4D4KA 4DJTA 4JVLA 1RE0A 2ZR0A 2CCJA 2QAGC 4RZ2A 2XGJA 3MWJA 4Z8YA 3MSXA 4R71A 1YZLA 3EARA 2BJVA 4OHVA 4TMVA 1G7TA 3B5JA 2XB4A 1F5NA 1JEEA 2GVZC 2ZETA 4GI7A 2RGNA 4BFVA 3GPLA 2O8FB 2QAGA 2V6JA 2VSFA 3AP1A 4QFMA 4Q1CA 1PUJA 1Z0AA 4LHWA 4WZBE 1DE0A 4C0KA 3J81k 1EWQA 1E2QA 1S1CA 3I8XA 4E5UA 1YZNA 3LX5A 5DHAA 4PSKA 3KQLA 3VKHA 4KCGA 4W5JA 5DI3A 4CEHA 4TZ6A 3CF6R 2YWGA 1TF5A 1KMQA 4M4SA 1W0JA 1QHGA 3SFZA 4KLNA 3LD9A 2A78A 3MRSA 1HURA 2WAXA 2UZ3A 3HU1A 2OFXA 1E1QD 2F55A 2PT5A 4D4MA 2ZVPX 1SKYE 1ZU4A 4DEXA 1XD9A 1NLZA 5DLQC 1C1YA 2QMUA 3PENA 5FL7A 4EKDA 4LJ6A 2ZVQX 1T3HA 1KK2A 4Q21A 1KI6B 2YYZA 3K0FB 3L8ZA 4FCVA 3SFVA 3SR0A 3SHFA 1ZW6A 2ZTSA 2B6HA 3HR7A 5FUYA 3RANA 2RHDA 2A5DA 1SVLA 3KFXA 2QMOA 3RSLA 2W0SA 3LX8A 3LBIA 2ZRBA 4IHQA 4B48A 4UQOA 5IK2A 2WJGA 2CEAA 2JLZA 1HE1C 5DI9A 3BC1A 1OE0A 2QT1A 2QGZA 2EFEB 2OBLA 1M8PA 4M2LA 4MKIA 3KQNA 3CZPA 4LJ7A 4JMPA 2GF9A 3L8YA 4KODA 2IF0A 3UG7A 3V4FA 2CVFA 2GF0A 4Q48A 1G17A 1Z06A 3B82A 1TU3A 4NCKA 3PV0A 1AS3A 1E0JA 1UM8A 3JVVA 2ZYVX 2RGDA 3MWLA 1AM4D 5FBQB 3RS0A 3UPUA 4A92A 4ARZA 3RVBA 3EPLA 4Q4JA 2JJ1D 4CEIA 2ZYTX 4QL3A 2WAYA 4ZV4A 3UXMA 4B76A 4C0HA 1LW7A 2FX3A 3ZD7A 1NLFA 2VA8A 3KQKA 2VL7A 1R5NA 4TMXA 2RGAA 1NBME 2QN6A 1U94A 3K09C 3QXHA 4ESHA 3MLEA 3SEAA 3V00A 4JLOA 3GLFA 4TSFD 4JL6A 1ZIPA 4DZZA 1UDXA 1A1VA 4D4LA 3VHXA 3ECCA 5EP3A 3K09A 2QAJA 4Q03A 4BE7B 5HE8A 3K0AB 1HYQA 3GQBA 2ZRAA 3EZ7A 1N5JA 4PXAA 1GNPA 2OILA 2ZRKA 4BLRA 4Y0AA 2AN9A 2ZR7A 3QXXA 3KTAA 2GAOA 4DCNA 2O0KA 3TVTA 4B2PA 2O0HA 2UZIR 5FTLA 3KXKA 4AKHA 1C9KA 1G8PA 3A1UA 2QI9C 3TAUA 5EUQB 4O0MA 1Z63A 4IDQA 1DAMA 2WPDD 2HYDA 3UIEA 1U0HC 2VP0A 4PO8A 2FEOA 4TQAA 5LBIA 1W0KD 4LZZA 1KK1A 3BH0A 3OIWA 4YONB 5A5GA 2Q3FA 3QNUA 3K9GA 4P0TA 4YMWA 3QKUA 3ONWA 2E1RA 4QGAA 1IN4A 5H70A 2J0VA 2RB4A 3KXLA 1VCIA 3PUYA 4JZKA 5DE3A 1R8SA 1KDRA 4OK6A 1QVRA 2IA5A 3KKQA 1GVNB 3L0SA 4R7ZA 4F4IA 3I62A 3W3AA 1XD2B 3CLVA 4PZLA 1MKYA 2JIZA 2QMHA 4KI0A 2J5XA 3AVPA 1E2FA 3D31A 1U9IC 3N2IA 1DAFA 3M1IA 2J0UA 4LDJA 1MRNA 4IW3B 4O3MA 2AHOA 3LW7A 1Z6GA 3A36A 2FSIA 1N6IA 1U9IA 4BZQA 3AF4A 2ZIAA 1Q22A 2ECKA 4KAXA 2ZSEA 8OHMA 2JLXA 4RFVA 1G7CA 2C96A 2HDNB 4B47A 1JJ7A 2EFHB 3EC2A 2BOVA 1AQUA 2ZRCA 3H4MA 5CIQA 3TR0A 4TQ9A 4ZKDA 4URXR 3ZIAA 3R7WA 2MSEB 4C0LA 2P0EA 1EFTA 1N0UA 4HEJA 4QHTA 4CVNA 3IEUA 2VH5R 4AKGA 4B44A 2QPTA 5GJWC 2J59A 4C2TA 2VBCA 1D2MA 4BWYA 5IHPA 2AWOA 4D0NA 1A5TA 2XSZA 3HYTA 5F98A 1E2DA 1KI4A 2FF7A 2WZQA 2KI5A 4XWAA 4DT1B 1KO1A 1AJEA 4XJXA 1L4UA 2H17A 2ZUDA 3CRRA 4Q5IA 3NEYA 1E9CA 2PEZA 3EIEA 4W9MC 5CLLA 2NZ8A 3WYGA 3KKPA 1IM2A 3MD0A 4P32A 1KK0A 1XWIA 1LNZA 1M7HA 4Z1MD 5FFMA 1ZAKA 3FE2A 3PCRB 5G3ZA 4KFSA 3VNVA 3HJNA 4C9BA 1NN3A 2RKOA 3IILA 4ACBA 1RRPA 2CNWD 5AUOB 5D3MA 2VIIA 1I4LD 3IHLA 3TW8B 1KO8A 4AURA 2XXAA 4JJZA 1II8B 5FR1A 3TQFA 2ZSAA 2EW1A 3BAFA 4HLQB 1ETUA 1Z8FA 3U4QB 1G4AE 1L4YA 1NSFA 1GKYA 4US0R 1SXJD 2REXB 2JJ2D 5FR2A 1N5IA 1P2SA 4NL4H 2DWPA 3AGPA 2HF9A 3VR5A 4DLVA 1KJZA 2VHUA 1JAIA 2O8CA 2V1XA 3L0IB 4IEEA 5KPJA 3U60B 3H84A 1MR3F 1R2QA 1NIPA 2QZ4A 3CR8A 2P3SA 4M9QA 1SVWA 3SJCA 2JASA 4PC1A 2O8DA 3EZ9A 1CR2A 1FPMA 1W2HA 5JCPA 1XJ0A 1U8YA 3VTKA 2ZI3A 3DKVA 4UXIA 1B0UA 5H1YA 2G1JA 3B85A 1E2GA 1W46A 3QKTA 4CZ2A 4EPRA 1OPXA 2ZYUX 4D2IA 5AJZA 3AKEA 4ZKEA 1XF9A 4M1SA 5DISB 2OM2A 3LH5A 3G82C 3ZGXA 2C9CA 1FZQA 3CBQA 2OCYC 3PVSA 4GNKA 4US1R 5JEDA 1EG7A 2F9LA 1NBMA 1E6CA 4H1UA 1CLUA 3R8FA 5FI0B 2GHIA 2GBLA 3QPVA 3NBXX 1NF3A 3DL0A 3CW2A 4FMBB 3KZ1E 4FMCF 1FW6A 1T6NA 2EFGA 2ANBA 1RVDA 3C5CA 4U00A 3IQXA 4EFNA 4PC7A 1GRRA 3THYA 2V7QD 1VHLA 1E2NA 4UJ3A 2H16A 4MYTA 4P4TA 4UNRA 5C2JB 5HTKA 4B43A 2FZ4A 1L8QA 1OYWA 3VU9B 4ZI3A 2GZAA 3PUWA 4DSNA 4TT3D 4RZUA 1AS0A 2FSFA 1U8ZA 1NN1A 4TTRA 2SHKA 4GDFA 4JLAA 2CHGA 3LDAA 1JJVA 3RS3A 4K81B 2P6UA 1DVRA 3TVDA 3ND9A 5K8IA 4M1OA 2PLFA 3A1WA 421PA 5HCNA 3RNLA 4DLRA 3HR8A 2GRJA 5E3HA 1COWD 2W6IA 4MDEA 3T15A 1JECA 2FMXA 2R9VA 1UDWA 3RDPA 3TGPA 3O47A 2PT7A 2MSDB 1KO7A 5JWRA 5B58C 3D7MA 4U02A 2WWYA 3KKOA 3E5HA 3GEEA 4NCHA 4B3CA 3T1TA 3NKVA 2D3WA 4D25A 4GRAA 3AH8A 3EWSA 4OK3A 4DIDA 3LWNA 2ZITA 4CF7A 5KSYA 5B57C 5SZJA 3CR7A 1MH1A 2XAUA 4JL5A 2R62A 2C9YA 4H9GA 4NU0A 4OYHA 3GLHA 4LYAA 2IL1A 1ZM9A 4WOPA 4ZDIA 4ZDKA 4AWXA 1ZUHA 2IS6A 5LB2A 1ZP6A 2JJ8A 4PAQA 1G8YA 4LYFA 1G291 2AX4A 1YU9A 3L82B 5SZHB 3SYLA 1XTSA 2JLQA 1UJ2A 3FKSA 4DXAA 3T34A 2QRNA 2Y8EA 1QDEA 2CXXA 3K9NA 4I1VA 4S35A 4X8OA 4NHOA 1JQJC 3A1SA 5CITA 2FWRA 1W49A 4MYCA 5HE9A 1YQTA 3VX4A 5BN4A 3GFTA 1N0VC 2CL0X 3B60A 4YC7A 5J47A 4DSOA 1DG3A 1JPNA 4XSHA 3AP3A 4O2RA 3RRNA 5EXPA 4UXHA 1G19A 3BFXA 4IVRA 3BERA 3BIFA 4NCIA 4HB0A 4I99A 3GD7A 1IXZA 2EVWX 4B32A 4YQFA 4PHFA 4V03A 4TLEA 3ZLJA 1ZNZA 2W6JD 1KIMA 2Z6VA 1A2KC 2ZU6A 3LXRA 3NC1C 3W9YA 4EUNA 1I4DD 1FX0B 2AR7A 2ZE5A 2KB0A 4TLBA 3S1AA 2J45A 4WA7A 4Z8XA 4ITRC 3ZQJA 3U44B 4C30A 3QKRA 4C4PA 1P9RA 2Q21A 2ZSFA 3ZJYA 2VP9A 3CRVA 1NJFA 1OIWA 1C4OA 2BKEA 5DHFA 3OFND 5BN5A 2QPAA 3NH6A 3P27A 3SJBA 3WHKA 5E4FA 1IAQA 4Q7JB 3ZH9B 2QQ0A 5HPYB 3SOPA 2NIPA 1U2RA 1DAEA 4JYBA 4AG6A 3VX3A 1QHHB 3OE7A 1KO5A 1TQ4A 3EXAA 2YHSA 3C41J 4GP6A 3V4RA 2J0SA 4JLJA 4HZUB 3CX8A 3OEED 4JVMA 4L4UA 2CLCX 1TQDA 3BFKA 2CL7X 4Q4AB 2WWXA 4G3XA 3PG5A 1V5WA 5B2ZA 3U3KA 1QG2A 4EPTA 1HV8A 2FNAA 1CJVC 2DBYA 5HKKA 3U7HB 1VDZA 1HUQA 3BK7A 4V0LA 4UNSA 4QJ5A 4A2PA 1X86B 2WKRA 1QHNA 1UBCA 4RVCA 3K9HA 1AZSC 1E9AA 5KSZA 4IOKA 4MYHA 1SVIA 4QJ4A 1JR3A 1OFTA 3FMIA 1NJGA 1AKEA 5GVRA 2D2FA 1YVDA 2R2AA 4ZIRB 2ZI5A 3OZXA 2JLRA 3OIUA 2BDTA 4LV8B 1OF1A 2C77A 4BFUA 1DTSA 2HLDA 4ZDJA 3LY5A 3KX2A 4YXWA 1G3RA 1EESA 4MITA 1E4YA 2D2EA 1BS1A 1E4VA 3SQXA 2K5UA 3T06B 5TDHA 1US8B 1NVVR 4BFXA 4RD2A 3QVUA 3VNUA 5JRJA 2O8BA 4CT4B 1Z5ZA 3E2IA 1AS2A 2A5JA 1TMKA 1T4GA 1AN0A 3B1WA 1DADA 4DCUA 1OXSC 3BS4A 1TPZA 3O8BA 4W5HA 4XD7D 1WBDA 1G9XA 4GZMA 2EWVA 3THWB 3AB3A 1X3SA 1Q1EA 2PX0A 1CEEA 2KJQA 3MG9A 4DLUA 2QE7A 2IYTA 3LO5A 3CRW1 5FOWA 3GJ6A 2KE5A 4FMDF 1P73A 3G5UA 3IPXA 4OQNA 4GL2A 5EQTA 4PSVA 2BCGY 2IT1A 1XMVA 4B2IA 5BYKA 2RMKA 4DB2A 5FOXA 3P4YA 3NG1A 2YC2C 1TF2A 3RRMA 1UADA 4EJSB 4QGFA 5J4YA 4C0QC 3AVYA 4Q7KA 4YMTA 4M1YA 4LJ5A 1JB1A 2GCPA 4IXNA 4B6FA 5KO2A 2CJWB 1FNNA 1DAKA 4ZPXA 3W8RA 1TX4B 2ZYWX 3GLGE 3BE4A 3SNHA 1X8LA 4IVPA 3U6KA 3CH5A 3WXMA 5HCIA 5L3VA 2QRZA 4Q1FA 4HUQB 2JDIA 4A2QA 5FTMA 1JPJA 4ASUD 2QT0A 2J7KA 1YZTA 3UG6A 3VKGA 1ZD8A 1W4RA 4Q02A 1WRBA 2OT3B 4YLGA 2E9SA 3W3ZB 2JLYA 1F2TB 1NMZA 1GRNA 2FU5C 2I4IA 3EAQA 2PH1A 2HXYA
chains in the Genus database with same CATH superfamily
5C3MA 1LZLA 5EP4A 2F1RA 3OX4A 3TW4A 5JNSA 4ETNA 1QHEA 2ZYGA 4WTOA 3W7VA 4CRWB 1U8TA 3G89A 1HDEA 5A1TA 3UAXA 1CP2A 2BJHA 3IUPA 3KKNA 2R60A 4IYRA 4H7IA 5I8WA 4R3NA 1QBKC 4TYMA 1UM9A 2ZP1A 3MCTA 4NBVA 1NQXA 3SX0A 1D7AA 5G02A 5MN4A 3IL2A 1XZLA 2R8EA 4ZVSA 1EVQA 4KOAA 5A3JA 3L7LA 5IUJC 2PCJA 2NU8B 1P4RA 1DAOA 4XWWA 4P22A 4BOYA 5TQ0A 2WYIA 2Q5HA 1DS6A 4JH0A 3SIWA 2C5EA 1T8RA 2B83A 1E1CA 3O83A 4WFQA 5JCZA 3IVGA 3T4UA 1EGVB 3ZN2A 1NQ5A 2UUPA 3TMYA 1P7CA 2J46A 2PGJA 2HBYA 3GFBA 5K3FA 3NV7A 4B75A 5JZVA 2WWGA 5JSHA 3K31A 1A5BB 4L0DA 4TOIA 1CDOA 4L5JA 1TNDA 3NWBA 1W4AA 2FQYA 4HYQA 1XL0A 3A9SA 4LCBA 1XRLA 1UPTA 2EKPA 3MLBA 4LYDA 1IY0A 1OBOA 3LVBA 5AVVA 3HA7A 1Z4PX 1B6RA 1XJCA 2G4LA 3HJTA 1F2UB 5LPNA 2VQ3A 4HDSB 1AT1A 4MMXB 4E1AA 1BCSA 4XCQA 5FFFA 1QNLA 2PQ2A 4M7OA 1PO7A 3KOXA 3AXSA 3H9EO 4G36A 1EB9A 1XB2A 3R6TA 4WK6A 4M8IA 5LMCA 1MHTA 2E89A 3A2KA 5A4KA 1RQXA 1SQFA 2LBPA 4DMFA 4C7JA 5KZMB 4MKZA 1P2VA 4KE8A 3LECA 3G0BA 4HUTA 4KO8A 5DBFA 3M6VA 3QMWA 2FZWA 5EE5B 3WGKA 1WOMA 4CIWA 3MAGA 4UD6A 5HILA 4OHYA 2NP7A 1GV1A 3UAWA 2BC9A 1RAAA 4HQLA 2D4AA 1JQBA 1BWQA 1IK4A 5LD2C 4RCZA 2YZ2A 1UBNA 2V7EA 2ZBUA 2BE9A 2GI4A 4PY2A 5EKSA 1TEZA 1V35A 3H04A 2D62A 1IPHA 3IEIA 4GI5A 5HUHA 4Q00A 4RTJA 4BO7A 2ZIVB 1HDYA 4HVTA 4LSMA 1T3TA 2NG1A 3BHMA 1SCAA 3HDYA 3OMLA 3V46A 1ZJ4A 4BEWA 3UBTA 1OJ7A 3OCXA 5CFZA 4MULA 1R8QA 5KNLA 2QTHA 1NT2A 4MI1A 4WY8A 5GWXA 5FPKA 1BU8A 3AB8A 1O5TA 3ANYB 4E5PA 2PQ6A 3X2SA 3VKFA 2BM9A 4DMRA 1PEKE 1R9NA 4FN5A 5AXCA 5EHXA 5LQAA 2DR2A 1FFBA 1C14A 1RABA 2X5JO 2I29A 2QXTA 1L5ZA 1MXHA 4CN8A 3AEUB 1F2DA 1JZQA 3DVLA 1Q74A 2WP8J 4TSFA 3WR5A 5BOSB 1IDN1 1A8QA 1U02A 3GRFA 1QP0A 1MEOA 1TI7A 4R5MA 4O1IA 5LKRA 1BA2A 1DIAA 4J9VA 1OX5A 3EAGA 4JXZA 2FN7A 3E48A 4O4HA 3HXKA 4YWHA 5A6VA 4MGIR 2A9JA 1XZKA 3FIJA 4GQAA 4J90A 3B6IA 3NNSA 2PBRA 1JJFA 2PL1A 2YW2A 1CXZA 4Q4HB 5DIZA 1LQTA 5CA0A 3VOSA 1ZVQA 2PTGA 2VRBA 2GTIA 2XQVA 4QBTA 2QMEA 1X7YB 3NWEA 2NO9A 5TJ9A 1SKUA 1B6SA 3B48A 2BI7A 4WNIA 3VHLB 2OGUA 1MVLA 4LK2A 1SOUA 2LVBA 3D59A 2XQFA 1VE3A 4LSZA 1QYWA 3H3JA 5F2EA 2H7VA 1MLDA 5EN4A 1VKHA 2ODTX 3EZ6A 1WW8A 3THOA 1SUBA 4AT1A 1GUBA 3SJAA 3DVAA 2G7MC 2W4QA 3TM5A 3A70A 2Q49A 3IR6A 4P2BA 4J2TA 4QICA 5HM8A 4G1UC 1KS2A 1QONA 4J1SA 4WLFA 2P6PA 1TLLA 3OLZA 4G5QA 4F9GA 2WUDA 1M54A 3O1JC 3FPCA 1Z6XA 4X7MA 1U98A 4X8HA 2I34A 3IE2A 3T5DA 1L7RA 2C4HA 4BMZA 3O4HA 1DCKA 2AUMA 4K1XA 2PE5A 4GNRA 4WXMA 3DLHA 2ZSHA 2H7XA 3SZRA 2QBYB 1N25A 3FXAA 3LT1A 5HIIA 4HTFA 1G9TA 2WSBA 3ZLUA 5BW8A 1XF1A 3TJMA 3SEQA 5CB4A 4A36A 3S5UA 3ONFA 4YDHB 2WWTA 1H3FA 2I8AA 3O90A 3QY9A 4JMLA 2EFCB 2Y0CA 3CKLA 1ZN8A 4NH0A 5KEIA 3ICQB 3P2KA 2PK3A 1WHTA 2EZUA 1CQIB 4QBIA 4BO4A 4UE6A 3ZWBA 1IZ8A 4MQEB 4CM5A 1FL9A 2P6NA 4K9QA 1GRVA 4D96A 1E8NA 3PFFA 1CJCA 1OXXK 3B9PA 3T3DA 3L5OA 1DKOA 3QBEA 3I23A 4KQ9A 4ARVA 1KYXA 4AWBA 3K70B 1T36A 3U31A 1N6RA 3GVIA 3N2GA 1H8ED 1Y3CE 4RYLA 5DWVA 3DR5A 4FNGA 2PU7A 1CY7A 1RYZA 1E9DA 2BGJA 4JXXA 3FOWA 3RD5A 3GP8A 2YXPX 4DM3A 3IVMA 3MJDA 4PCLA 4B3RB 1JZSA 1ZMOA 3WNBA 1M1NA 2GN2A 1AGYA 3L8EA 3Q7PA 2OQ2A 2JCSA 3X1JA 1Q0LA 4A0HA 1PJSA 4PAOA 3TDNA 4CU2A 1IN1A 1XN1A 1MABB 5EUCA 3VR2D 4JLBA 3WSWA 1OA0A 1RNLA 3TK1A 4BP8A 4IBOA 4OJTA 1GKIA 2OV3A 4ENTA 1NAIA 1O4WA 2VJQA 4C4XA 2OCAA 3FN4A 3QPUA 5KKCA 5BQ5A 4ZTZB 4EWLA 1GDHA 4FR0A 4OI2A 4RS4A 3VDRA 3KR2A 3PQ4A 1LZKA 4M0PA 3RO7A 4HAZA 3VYUB 5ES4B 2C9DA 1KWGA 4B79A 2MTBA 3ZHRA 2HJSA 4G0UA 2QR3A 2GEUA 3ZCRA 3II6X 1WCYA 1UEJA 2AXEA 4RD6A 5ECDA 3T5AA 1E7RA 4PZZA 3ZCTA 3BIXA 2XCSB 2BZSA 2HO5A 1G6HA 1VG8A 1K66A 2REQA 2YOFA 3CGGA 3D7NA 1NJ8A 3HYRA 3OVMA 4C5CA 5JFGA 3NHMA 1YJXA 3ENKA 5EXEA 2WV9A 4RPGA 4CMIB 1QGAA 2BFOA 5ALMA 1JIUA 1TAGA 4N54A 4E7PA 1SVUA 1ZA1A 5IYZA 3FKQA 4YJFA 5CT8A 3IO3A 5EPUA 5JIBA 1EBFA 2E5LB 1BH6A 2CNWA 1A96A 1U3FA 5DLEA 2XH8A 1LWNA 1RZVA 4TTAA 5DXJA 2O4CA 3URKA 1GZDA 1WO8A 3I37X 1QVVA 2VS1A 4DKXA 3KYBA 2VNHA 2Z4TA 4M0KA 3DMTC 2ZM6B 1ITZA 2AEFA 1GGHA 2Q5IA 1RJWA 2OCPA 4XPIB 3TX6A 2GBPA 4FD2A 4KW7A 4OAOA 3SCZA 4F72A 2OWDA 1RRCA 1I3OA 3MS7A 2YWFA 8MHTA 1PGOA 3GU3A 4WV3A 3B6KA 5IN5A 3WDKA 5K0TA 1XSEA 4JUFA 3EY9A 5H80A 3DMTA 1HT2E 3DO8A 3I0ZA 3KJNA 3UC5A 1TA0A 5AP9A 3DE1X 4UULA 3DBLA 3Q7SA 3RYIB 1QHYA 4NPCA 3RS9A 1DT5A 2G0NA 2P67A 2CFRA 1ZVVA 2G0AA 1WE2A 3D4BA 1HKUA 2KLBA 2XIJA 3HVUA 1N2SA 1NLUA 1M6NA 1X8JA 1YBFA 1HLFA 1N75A 3GEBA 3GYGA 4BRWA 5K0GA 3DAPA 4B74A 4BP3A 4OX9B 1WSBA 1R4MA 1VE5A 4PYKA 4BVBA 1M34E 4ZI2A 3VJRA 1D0VA 4IWXA 3NUGA 3FHOA 4R31A 4YCJA 3UT6A 2JVJA 1OUMA 3LKDA 1YVPA 4BY9E 3AJEA 2O19A 3S70A 3IQFA 3HU3A 1K6IA 3INYA 4QA9A 2I2CA 2BKUA 2V6GA 4XLZA 1GG8A 5B5SA 4R1SA 1LPSA 4YCBA 3PUJA 1VI2A 3LFHA 5AYVA 1SBTA 1YOVA 2QTVB 5JSFA 5CEFA 1XBTA 1R00A 3E7XA 3ZW9A 3QKSA 5J2TB 2ZOSA 3ASZA 3AIMA 4ZZ2A 3RHTA 3GBPA 2BSAA 1FXWA 1VRCA 2QTGA 5JG7A 3W4KA 2D7CA 3F8WA 1UWKA 2FMKA 3H5OA 2OG2A 3AYXB 4FTWA 4ZEOA 2B34A 4EELA 5EHQA 1IC6A 1KKLA 4ON9A 4L15A 1QPGA 2AKAB 2G9RA 2QRPA 4UEOA 4ND6A 1BKSB 1SBCA 1R4NA 2A0XA 4OJMX 4ZYVA 3NLLA 4J4TA 2BBTA 4RPLA 3AF1A 2AEMA 2IEZA 1G64A 4G86A 3U56A 1AHNA 1SURA 1Z8HA 2P1RA 3AUSA 4J0DA 2CXUA 4P4SB 4RTLA 3EWIA 3C74A 1ZY2A 3I6MA 2F43A 1VPWA 3B9RA 4CEJB 3PFBA 3QE4A 5JW6A 1G4UR 1REQB 4RZQA 4DWJA 3PYLA 2Q4RA 1WXWA 2EATA 2B1JA 2QG4A 2N46A 2BR3A 4X63A 1PJRA 2DBZA 2FSPA 4UM7A 5CW2A 3W5DA 1GQQA 2ENWA 2N9UA 3O2NA 2IF2A 3SDZA 3BMNB 3GZNB 2QG6A 1MEEA 1S3GA 3H2KA 3LCUA 1COWA 3BHIA 4QHSA 4WECA 3PXGA 1T5TA 1Y6JA 1MIHA 2DFKB 2VSOA 2EBWA 4RF4A 3UCEA 3HCBA 2PWPA 2NNWB 2G06A 3KQWA 2IIPA 1VE7A 1X7WA 1GLNA 3MCAA 4NATA 3KZKA 3V34A 2NU9B 9GPBA 1QKJA 4OQQA 1OLOA 1XXHE 4XTCS 3OH8A 5GOZA 2GD0A 3KVYA 2OB1A 3VISA 3CF4A 5KWVA 3BCRA 5UKDA 3WBKA 2VWGA 3N75A 4FXPA 1FRVA 1QLWA 2IXGA 1HY3A 4EKYA 1QQ5A 2PLRA 4BFWA 1XA4A 3MWKA 1Y8AA 1BGVA 2W37A 3PGXA 4YP0A 4GKVA 3RGGA 3IHTA 4DHWA 1XL1A 1RFGE 1PJLA 1VE1A 5GPBA 2AFHE 2YXNA 2IITA 2WKSA 1AKTA 1MVNA 2V98A 3KS9A 1M2OA 3NYIA 4HXEB 3AUFA 4MV1A 4E5YA 5DNYB 2HJGA 5A03A 1IBLB 3HUFA 1UF9A 4TLAA 1TKAA 2F3RA 5FP0A 5BVGB 3GF4A 2BWJA 4UNPA 1RC1A 2ADFA 1FJHA 1FEZA 2Y1CA 3RUPA 4ABTA 3PUVA 3SMQA 5EJIA 2NU8A 1THMA 1Z4OA 1E3LA 2VCEA 1JDPA 1R7RA 1T9HA 3F9RA 3IGFA 4YMUA 1NXQA 4BE9A 4BECA 1E2PA 1ZXBA 3BL6A 4YY3B 1EX7A 3OLVA 3WMWA 1A3CA 1SMKA 3SKYA 2Q8PA 5K4AA 2SCUB 2VP3A 2Z1NA 3EXHA 4ZEMA 5IU6A 4Q3CA 3I72A 3W4JA 1L3BA 4OXNA 2A1UB 3CRZA 1N6KA 1YTUA 3F8TA 1CP3A 4RM2A 4YFVA 2FSUA 1KZGB 3EEIA 3WMFA 1ZSNA 1SC9A 4Q9NA 4ZV9A 3KKMA 3ZTYA 3RUHA 1DNPA 5F7ZA 1GT6A 1J70A 3BVPA 3CUSA 3JRXA 2M1ZA 4W82A 2PSSA 4U7PB 4DWOA 1EFHA 5HKAA 1O3YA 4KVZA 4M7PA 2WM3A 2C3YA 2RGEA 2YYSA 4JLVA 4MPJA 4HVLA 3ZVKA 1HG1A 2HX1A 1T1GA 3PNOA 1XXLA 2B25A 4W5QA 1T1JA 3WWEA 1VBMA 1ZK3A 1Y9ZA 4YGXB 4GEKA 5JT1A 2BKVA 3GJ4A 1PR9A 5HGJA 2GZ1A 4CEHB 4FFDA 3PQDA 4FGLA 4H3VA 1T5SA 4O4IA 3EVBA 3NP7A 1R3DA 1ECLA 1QC5A 1YCGA 2VH1A 3CX4A 2IWRA 4EO7A 2IHKA 1Q0PA 4B4VA 2EFYA 3V1YA 3B9BA 2CLFB 1A7AA 2CE7A 3AVTA 2ERYA 2PRYA 5TGZA 2YWHA 2OXTA 2YMLA 1G41A 1SNYA 2WBLC 4A4DA 1QK4A 2C04A 1VHWA 1S01A 4MV4A 5I6DA 1TJ5A 1PFYA 3NVMB 3ITKA 2GRUA 2RONA 2CZCA 4D46A 3LP5A 5IJ0B 3A11A 1H8HD 3AMVA 3D7LA 3EGWA 4A27A 2AHRA 2I7VA 1R15A 3GHHA 3KQTA 1ISHA 2HD4A 4ID9A 1L9KA 4KXXA 4HVCA 3FH0A 4DY6A 3HXOA 1K6XA 1QZ3A 2MWMA 1J20A 1W9HA 3NBUA 5I7RA 4AF7A 4OFBA 1H2AS 4W8OA 2XB2A 3E1SA 3GLIB 5DT9A 3DFUA 3PNVA 1QU2A 2G0TA 2BGMA 3F74A 3M89A 4FR2A 5AW1A 1NHWA 5K3CA 1N92A 1KJWA 2AJTA 3P9YA 4OXQA 1KEVA 2Q0QA 5E1MA 2VF5X 1DRVA 1E99A 1UC9A 2VJKA 1QANA 2H92A 1EMDA 3NBYC 4XYGA 4OUDA 4QSHA 5AM5A 5TVKA 3UUFA 1KOLA 2HH9A 1KYZA 2O8FA 5KYYA 4B34A 3EW7A 1XO1A 5KTYA 2WAOA 2ZREA 4C1NA 4F6CA 3N6RA 4OLBA 2VNSA 2P9GA 4C4RA 4CEIB 1XMIA 2QTTA 2W58A 2JBHA 3SAJA 1L1FA 3HDQA 2IPMA 3O4VA 3EPKA 3ED1A 4RPHA 1KTVA 2QI9F 4Q3BA 3W6PA 1UXKA 1WP4A 4Q4HA 2GVDC 3RGWS 1S9HA 2ZYHA 3BILA 1M6VA 2WZDA 3U17A 1X7YA 4WJKB 4ONEA 2RI1A 4EX7A 1P9NA 1FQOA 4Y2RA 5IJ9A 3EUFA 1ANKA 1Y5NA 3JVUA 3MB8A 4IIEA 3UXEA 5JH7B 3A3PA 3H1FA 3U7FB 3K0CC 3IVXA 1OT3A 3GFGA 1NN0A 3QQ5A 1AO3A 4HH0A 4TYPA 4XD7A 4KK3A 2ALJA 1K0UA 1IWBB 1UT6A 2GCEA 2VHZA 3CSDA 3WWCA 1ZAYA 4DV6B 1C9EA 3I4LA 5H68A 4N6NA 3Q7QA 1PE0A 2PD4A 1Q12A 4G1VA 4YJGB 2I2XB 5TY0A 5TQ2A 2UVDA 5CFLA 4D4GA 4CG3A 5L7WA 1V26A 3U3ZA 4ZT3A 2OWEA 1U0OC 4M1KA 2Z58A 3K0CA 3KQMA 1C7QA 4BQSA 3K4QA 5A3VA 4CMCA 3A2NA 4HFNA 1X70A 2B6NA 4D0LB 1N78A 2HFKA 4IDNA 1NVDA 1BVYF 1NQVA 2OV4A 3LGAA 3S1LA 4I9UA 2I54A 3X1ZA 2UKDA 1DC8A 3ONDA 1AQIA 3LUFA 5EKDA 4K3UA 3I4FA 1PX0A 3TD9A 1C8VB 1TZ2A 2OBFA 2Q0HA 3QLJA 5IXJA 1BGXT 2VHJA 1N2ZA 5BQPA 3JQ7A 5COAA 5FPTA 3HZZA 1J1UA 3WGTA 4JBHA 5E38A 4X1IA 4YIKA 3K70C 3O7WA 3QA3E 2RAPA 2BMDA 4NBSA 2WV7A 5KNCA 1CQIA 1G66A 1G7RA 1XLUA 3KEMA 2H7YA 5DYNA 1BJKA 1Y82A 4Z54A 2VTBB 3SDBA 4EITA 2VDWB 4ARUA 4BNNA 5CAEA 5KNBH 1NNUA 1V8PA 2C0QA 3CKKA 4FLMA 4B3IA 4A03A 3EGEA 1EFRA 1N3IA 1W36D 4ND5A 3R7BA 2C2XA 1FXWF 3GGOA 2ZRIA 4M1WA 4PFKA 3RJMA 1FQJA 2W22A 1XU4A 4M1TA 3ZHSA 3ZWQA 1WVMA 4JBGA 5DT2A 1W8IA 4PPQA 3PFKA 4XWYA 1R9MA 4BNZA 4ZI7F 3AHCA 5B53A 1LDEA 1PRYA 3CVYA 1Z75A 4DE5A 4NCJA 4UHFA 2N1MA 3WRXC 2FW0A 2HI0A 4Y9UA 3VV3A 1AQLA 4C76A 5JO9A 3KJFA 2IHYA 2H1HA 4R3WA 2CFOA 1T8TA 4JI1B 2NTVA 2O1XA 1HX7A 2HLHA 4G37A 1N3YA 3DFZA 4NCNA 4W8GA 1JDBC 3WRXA 1KGDA 3FPLA 2PYDA 2VNJA 4MAFA 5LMUB 3AJ8A 2F2TA 4KUHA 3V1LA 2J3QA 3EGOA 3HA5A 3R7WB 1UEXC 2V6IA 4LC0A 4PFJA 5BUZA 3FJYA 5DTEA 1TYEB 5FWNA 4XX0B 1VHTA 4Y1RA 4N3GA 3EZXA 1BE1A 3P32A 1UOQA 4MRVA 4ZAZA 3VMMA 4CMKA 1P2UA 3Q2OA 2WF5A 4RMGA 2AN5A 2BUCA 2NVUA 2I1LA 1KJYA 1G20E 4ZEVA 4QDOA 5CM9C 4H6PA 2Z8YA 3GAFA 2FUEA 3JASA 3A1VA 4H7KA 3E7DA 3RC2A 1FDTA 3U80A 3DEIA 4N01A 3JAWA 3ZHTA 4ECEA 5AW7A 1TFUA 2YJ6A 3ASVA 4URWR 3OJEA 4Q3NA 3MT7A 1DBRA 1G3MA 2IDZA 1CUEA 4C3UA 3L4KA 4RKFA 4EJFA 1R6TA 1XQYA 5CIWA 2JLVA 2VHQA 3QWBA 3W90A 2ZANA 1JHPA 2R47A 2TMKA 1NTOA 1NZJA 3K4HA 4RF5A 1KZYC 1YAHA 4RIHA 1PJCA 4FFOA 4F45A 4W9RA 4IX9A 2VSQA 4I50F 1Z28A 1WP9A 3VVMA 4EG1A 1IEWA 1JHDA 3K0HA 1KI7A 2W2NA 3GRAA 1YL5A 3AUXA 2QJWA 4WOBA 5EZSA 2HQSA 2J32A 1DJNA 1XKTA 3MJFA 4D9GA 2ZVDA 4X1KA 5EMHA 2AN3A 5KJ1A 2HIMA 2XE4A 1G6OA 2JGEA 3GGSA 3Q9LA 3BGOS 3RYIA 2FGJA 4K28A 4Y6QA 5DNWA 2H06A 2JH9A 2CLLB 3G2KA 5FLXA 3L6RA 1KNXA 2C7RA 4W1PA 1LQUA 3OMXA 1KAQA 3NCTA 2JRCA 4J2OA 3ME5A 1HE4A 1I2BA 1H1TA 4JSYA 4K87A 4CCAA 1S5PA 3PIRA 2AJ8A 2FPWA 2B92A 2GGSA 4LMAA 2CHEA 1RMQA 1NFQA 2I8CA 5FOTA 3VC7A 2PWAA 5JVDA 4PC6A 3LW8A 3I9MA 5FHQA 3TTVA 4L51A 3SI7A 4QEDA 1ILWA 2HPVA 3A4NA 2HJRA 2CCGA 4FWIB 4D3FA 4S05A 3GMIA 4HAYA 5HBRA 3U7JA 4JUBA 3LRPA 4I1RA 5KJ6A 2JCBA 2PRJA 4BS9A 2M6KA 4O4LB 1EM6A 5P8WA 4CXMA 5J2TA 4G56A 5C53B 3QEAZ 1FDVA 4X65B 1OZAA 4KDRA 4BFSA 5EJ6A 2DC1A 2AJCA 4LZJA 1EVZA 1UR5A 2A5YB 2YHIA 5EEHA 1I4TD 2VWHA 4BNVA 1XV5A 4OFZA 1C4KA 1DIOB 3LVQE 4F11A 1TDJA 3QW2A 3B1KA 1Z6AA 1DWPA 1A9YA 1LBQA 3LK7A 3AEKB 3JQ9C 4YO7A 3SHTA 2JIQA 2FDRA 2EJVA 3IDSA 4H7EA 4O4IF 5LMNB 2BPOA 3ESZA 3QKWA 5DMHA 3OQMA 1JR3D 2PMFA 2HJ9A 1GGFA 3GLUA 1T8WA 2DHQA 3OEHA 3Q1KA 3DEKA 2P2YA 3DDWA 4JLNA 4EYKA 2E4ZA 1DXYA 2GPWA 5AXDA 5CPBA 3JQ9A 4URFA 3OTGA 2XBMA 1JDJA 1U9ZA 2RHOA 4OL9A 3AW8A 4GPIB 3RAPR 1BVUA 3ZS8A 1TE2A 2Q99A 1LEHA 2ZRHA 3AR4A 3GP5A 2WFLA 5LCXA 1O9BA 2OO5A 3ETNA 1N6NA 3OZEA 1U2TA 3TW8A 2R4UA 3PJGA 1UJMA 3AF5A 1II8A 3GFQA 4QYIA 3K15A 1CC1S 1IB0A 1ZWLA 2HPZA 1MF7A 2LTAA 1KEPA 3L6CA 3RRYA 3T5GA 4IIJF 1RHRA 3I04M 1EA7A 5ALLA 3AERA 3P5BA 2C1ZA 1ZNXA 4AY6A 1W581 4BO3A 2HLPA 4ROSA 2JL1A 2Q07A 2NU9A 3BORA 1MC8A 3G9TA 1UC5B 4M0UA 5EIHA 1JU9A 3PS9A 1WXIA 4J0FA 4B84A 5LZ4A 4C87A 3BGSA 4L16A 5DHQA 3CZMA 4GM1A 1OX4A 3EIUA 1U5BA 5J4LA 4NG4A 1RXWA 1JA0A 1VJCA 3B1ZA 4CT0A 2FV8A 3WI7A 1Q0RA 3RVQA 2Q3MA 3SZGA 5HIAA 5ICSA 3KQOA 2RJNA 1H0HA 4LHYA 4RWEA 5DK4A 1TYCA 3SF8B 4X45A 1UKVY 4J91A 3FNGA 1F5SA 4QECA 2FEAA 2GTPA 2XT0A 5HBGA 1IBKB 2YRFA 2ODEA 1RDFA 1V16A 1KRWA 5BVGA 3C39A 1J2YA 1GLGA 3GLRA 4MUYA 1U0BB 2O05A 3PHLA 3V80A 4EG3A 3PPWA 2P69A 1GL6A 2SECE 3MQFA 1OKKA 2J30A 3ZW8A 4D4IA 2Z5GA 1XZMA 4LZPA 4CCSA 5CXUA 5LP6F 2IUUA 1N2EA 1WNTA 1ZN9A 5E9AA 3ZTTA 4CYMA 2VF4X 1O6CA 1RS0A 3GEIA 4J0QA 3RREA 1KEEA 1Y37A 1B43A 3GLHB 2WIBA 1I9CA 2QVGA 1GPDG 2ON6A 4JC4A 3ZYCA 3SQMA 4JR2A 4UEWA 3IVAA 2ACEA 1LS6A 1XMJA 4G97A 3L06A 4JSTA 4MQBA 3JD2A 1BGWA 4Y2PA 3SC3A 3ZY6A 2FR1A 4H1VA 1KPHA 1KI3A 4QOSA 1H4SA 2DWCA 1SRRA 1R5OA 4DGSA 2YINC 3O21A 4MS4B 3P2JA 4I5IA 1TK9A 5KTKA 1C80A 1SVMA 2PHZA 3EFOB 1I51A 3UJ6A 1IMJA 4IPTA 2DCUA 2ID9A 4DLAA 4R3UC 1DBSA 3C1OA 1WD7A 3F7TA 3K8YA 5CRIA 5CYPA 3AVWA 3CF0A 2UXDB 2DTDA 4U2GA 4E46A 2AOTA 4ZCPA 5BN4B 1JN0A 3QEOA 2WTXA 4GKJB 2UU9B 4C4SA 5C46F 3I5YA 4E0BA 4X85A 4INAA 3CO5A 3L0DA 1Y7TA 2JI7A 3VDXA 1V5EA 4DIKA 1BRTA 1C9NA 4NAUA 5C32A 3R4VA 3UVEA 1XZPA 3AI2A 1QBGA 3DOEA 3K96A 3SM9A 5JSQA 2GS9A 2REOA 3EIXA 2VSYA 1T15A 4KIJA 5EI5A 4CNBA 4F1WA 4IHKA 4ZARA 2YWEA 1P4AA 5E1OA 1J6UA 1KQNA 3SLKA 4M8LA 5KX5F 1T6ZA 1BD3A 2WTNA 1XZIA 3IBCA 4WFKA 1ECBA 1XEWY 2QT9A 4EW6A 3G49A 5CTAA 1GTJ1 4I08A 5BSGA 2B3TA 3DB2A 1E6WA 2Q50A 3KJEA 4JLDA 1I3MA 4JEIA 2JBAB 4RLSA 4NZOA 2NSHA 3GA0A 3PGJA 3STTA 2MMGA 4J03A 3GLIA 2G80A 4RZHA 2ZUEA 5AVTA 1F6BA 3TSYA 2WSIA 4XUGB 5B1YA 1C9DB 3JVDA 1ZH4A 5BN5B 2PR7A 4P8RA 3MTIA 4ERNA 3JD1A 3LXXA 4PW0A 2Y0BA 2AK3A 4A2WA 4C0SA 2FMTA 2EKQA 3JYPA 1A82A 1LI4A 2HWUA 2OBMA 4KO4S 4PC2A 4H1HA 1RXYA 2YVLA 3JCZA 1FB5A 1VPVA 3AUJB 3PD7A 4OLAA 2DMRA 1OV4A 1P0MA 4YJ3F 1V37A 3BG5A 3U3MA 2P6MA 1MG5A 3OU6A 3A28A 4DA0A 3LUJA 1II0A 4FGSA 5EE3A 3CPEA 4DZTA 1UAGA 1GPBA 3LBAA 3GEDA 4FHDA 4EPWA 2I4RA 1D2GA 4LDPA 2QQ5A 3PHJA 1T9ZA 3E3AA 3UMFA 3U7RA 4X97A 1TJYA 1Z0FA 4JUCA 2GZSA 1L4KA 1UC8A 4U7TB 1S7CA 4BQEA 3KT0A 4B35A 2W8ZA 4L8LA 2LXNA 3C4JA 3QNMA 2WSSD 3RK0A 4GPTA 1TA4A 1XK6A 4N12A 2R5FA 2WB4A 1YR1A 1HNWB 2WQ6A 4DEYA 4GL4A 3MCUA 4RDXA 2DTXA 1FUIA 3DMFA 5REQA 3EFHA 4D0SA 2WNSA 3BXFA 5E2BA 3N8IA 1FX0A 2LCFA 1OBHA 1Q83A 4WIAA 3CUVA 1C0PA 2HSEA 3L0PA 2G4CA 2IPOA 3C7TA 4H4EA 4KVFA 4EAAA 4Z4CA 3U44A 3HM2A 3L41A 1FNDA 2B98A 2O8BB 2ZROA 3ACCA 4FIDA 2Y99A 1T35A 1SZPA 1VKJA 3KB2A 3KWLA 4QAJA 3EWNA 2FWPA 2Q6TA 4YRFA 1T9GS 1KE2A 3K0BA 1TM4E 1NUAA 6REQA 4RTKA 1NBHA 3H5TA 4B8WA 4PFSA 1W85A 3E3MA 1UKBA 4YBRA 2FW6A 1BE6A 2DUNA 2QP3A 4FYKA 4AJPA 2HTEA 5ALOA 3MTBA 1R8XA 1S2IA 1DAIA 1QHHA 2B1IA 4H4DA 3STYA 2Q8QA 3OPYA 5FNZA 2EDCA 3OT5A 3UJAA 3W77A 4NR0A 3KZXA 3Q5GA 5L9AA 3KJXA 2WU3A 2KM1A 2HJWA 1QYCA 2I4LA 2UZ1B 4AIIA 3PIDA 3U3OA 3IOMA 3AIKA 3GMTA 1RAGA 4YPOA 1QAQA 4NULA 3WAJA 4TLDA 3OX1A 2XCQA 2WWHA 3GJ7A 1N0IA 2YQZA 4J7UA 3VI4B 2BHNA 2RGBA 4DA4A 1QVAA 3IVCA 1EX6A 3JTMA 5C8YB 4BO0A 3EDOA 3F5MA 1JDVA 4AX4A 2CHFA 2QL7A 3FZEA 1UP4A 3Q72A 4HQ0A 3B2QA 2YZNA 1S1MA 3EVNA 2D2VA 2VYVD 3OJOA 4GW3A 3HB5X 1U2PA 3UB2A 2F62A 4ZCLA 1OROA 3DT8A 1T9AA 3LC2O 4ILKA 2G36A 3VR4H 4GRIA 1HQCA 1PL7A 2H1LA 2IXBA 4MQ4A 3G3EA 3MQ2A 5IKMA 5D3KA 1KARA 3I4CA 1IFXA 1PLKA 4JUDX 3H8JA 5CHEA 5HQ3B 1JL3A 1FUKA 3VGPA 4DMGA 1QMGA 4L7QA 3QU7A 2RHGB 1ULBA 5DDIP 4MJXA 2I87A 4KX5A 4DDUA 1OX6A 2ODNA 1V8BA 3HKBB 1WV0A 2WVGA 5JADA 4OJKA 1DZ3A 1RCUA 1TM3E 2HMVA 2ZRJA 5AM1A 5LBTA 4D0GA 3R3YA 8AT1A 4XGRA 2FH5B 2VOEA 1V8ZA 2X22A 2EWWA 1XVAA 2Y68A 3CH4B 4LHVA 3DTVD 2QTWB 4AICA 2GM4A 5CYGA 1FUUA 1GUZA 1IMOA 4WNAB 5IXSA 1NVUQ 2AI1A 3HR4A 7ADHA 4IIFA 3X1XA 1C1XA 3W9SA 5JAOA 5M29A 2V0GA 1PR6A 2XBLA 2QLLA 2HHCA 4Q7EA 4TXNA 4PRYA 1JHAA 2MSKA 1HK7A 2O07A 2ECOA 4K6MA 4PHTA 1MGPA 5GY7A 3I2YX 5DHTA 1SBQA 2Q3LA 2OCDA 3H2ZA 1EFDN 1WZUA 2FSSA 5LWHA 4Q39A 2NO6A 1KOJA 2WR8A 1ISJA 2WINI 2UUAB 4NXNB 3RU7A 4WLUA 2PS3A 3IAM6 1J0BA 2JRLA 1C2TA 3UPUA 5EHGA 4M46A 2Q4TA 3EEOA 1CULC 1PWYE 2FUNB 3KV1A 1AD2A 4QQFA 5JV5A 4IXMA 3SR4A 1WA5A 1Z35A 1TW2A 3LA6A 1K3UB 2A58A 4HZGA 5CBPA 2FPPB 4J0GA 2Y1EA 3DMPA 3V1NA 1XJQA 4ZYTA 3G0CA 2JAXA 4ZVVA 5G1NA 1E4OA 5IKXA 2VCYA 2HSDA 1Q1QA 2NXNA 2OHFA 4LMRA 4L72A 1Q20A 4OQDA 4Y67A 4F8YA 3O8OB 4KR0A 1QGUB 2FR8C 2DERA 2I1WA 3IAHA 4OHRA 4YMSA 4RTSA 2EJUA 3W2FA 1DAHA 4KU4A 5AHXA 3DVQX 3TQIA 2QK4A 2MMCA 1WQ4A 3OOHA 1IHPA 4M3NA 1LA2A 1N9GA 1DO0A 4FOPA 4LQ4A 3RC9A 3QU4A 3TIGA 4XCXA 3H87A 5HK8A 2WHXA 4GBGA 2JAPA 2JIZD 2DOKA 2NV0A 3C87A 1PVVA 1NNLA 3FX2A 1ZH6A 5DX1A 3GNLA 1NX9A 2FR8A 3B8HA 3FMVA 4HEA6 4RY2A 1GZ4A 2ZSBA 5DCYA 1ODSA 3IMCA 1SUCA 4BO6A 1EKXA 5IXYA 3L43A 3MERA 3NWJA 5AW9A 1MH9A 4OLHA 1Z15A 2I6GA 5CA1F 2G5GX 1RPZA 1YBAA 3C3DA 4K2AA 3SXUB 3LNCA 1BN7A 3VBCA 4NWIA 4DMKA 4EABA 4WNCA 1Q6ZA 2WYUA 4HDAA 3VNBA 3GQVA 1JRLA 1YZ3A 1R9GA 1R3UA 4P54A 3OX2A 3DOIA 3QLEA 3R0JA 5CLHA 2BM8A 3UH0A 3GNQA 3IP7A 2YUIA 3EG9B 5CJJA 5KYVA 2ZXFA 3CLRC 1HSZA 3PA8A 3DKIA 1EQUA 1E3JA 4G9GA 4DSUA 2BD0A 4IDHA 1M5UA 4LIPD 4C29A 1FYVA 4UZEA 3TRIA 3HE3A 4F71A 1SRQA 2C9OA 3DDNA 3ZIAD 4E30A 3LRTA 3ADDA 4V3BA 2WNHA 3KLBA 3DM9B 3VH3A 3CRMA 2BAGA 1T5OA 4MB0A 3D9QX 1M73E 4B1FA 3NGLA 3CVJA 4GOMD 1QIKA 1NTRA 3C70A 3LGSA 4H15A 1M2VA 5BSEA 2CXNA 1G0OA 4RQTA 5G0TA 3EIHA 4C43A 4RAOA 3N86A 4AXXA 3K16A 2QVLA 2M6RA 3O8QA 4LI3X 4QDKA 2IYLD 3OZBA 4BN0A 3HV2A 1ZK4A 1UBEA 1T9KA 3R6LA 2HFJA 3HDHA 1UZAA 2YWBA 3OECA 3RIYA 1RWMA 2BMJA 2B30A 1GU1A 3AM3A 4FX2A 4NVRA 5IKOA 3ZI7A 4B4OA 4OQ4A 4F3CA 5M04A 1TIKA 3UK6A 3NJRA 4Q9KA 3OBBA 2I6SA 3VH2A 4PQEA 4MNTA 1JLMA 2C2HA 2FSVC 1Z3IX 4EO4A 2DFDA 1JLKA 2HA7A 3MTGA 1G5TA 5JRDS 3S8YA 3TQOA 1O97C 1NOIA 2VPPA 5AJWA 5T4HA 1XPRA 3V33A 3KBBA 1KHTA 1PNQA 2OCBA 4MYUA 4KHPB 1MNAA 1J5XA 1O57A 3V8BA 5I45A 1KMMA 5IUKC 1XFDA 4TZKA 3KVOA 1NM5C 4IOLA 1R0ZA 5B6IA 1PL6A 1PZNA 5FBRB 3LKZA 1MJGM 4FB5A 3S4YA 1B2LA 1PNOA 4RHUA 5JZOA 1ZXXA 4KZKA 1A95A 1U0FA 4XYMA 5JJKA 4BBZA 5JSYA 5LQCA 1NM5A 3E9DA 4JR1A 3KR1A 3E9RA 3N8KA 4RW0A 4DQXA 2Z8XA 3B1VA 4OUKX 1RWOA 3G0HA 2Z43A 4FCCA 3RB8A 3DZGA 1QAOA 3OQNA 2IZOA 1NUTA 2B35A 1OXTA 3DGEC 4MUJA 3LBFA 2VUIB 3QRWA 1W2GA 2NSDA 1XRJA 2BONA 4XFDA 2GAIA 1A4IA 2IYXA 3EIQA 3TOXA 1LU9A 2B8WA 4Q66C 2IS4A 4ZOEA 4AS2A 3BM5A 2HA3A 1CJTC 1LFDB 1EEXB 2VJBA 4BBJA 1RPNA 4G1EB 4MW4A 1CE8B 1GGJA 1MXFA 5LA6B 4WCFA 2C07A 1NU8A 4RDHA 4QLAA 2HEIA 3RSGA 1YV9A 3LUAA 4MS4A 5DGDA 2H8KA 1KDVA