3R9KA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, glu47asp mutant complexed with sulfate, a closed cap conformation
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
227
structure length
227
Chain Sequence
GSHMRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHDGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Putative beta-phosphoglucomutase
total genus 83
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3r9kA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3r9kA01
3IRUA 5AM5A 1RKQA 3MN1A 2YBDA 4Y2VA 4L6CA 3MMZA 3R4CA 3UMBA 1U7OA 4HAIA 5AM0A 5FP0A 2B8EA 4OFZA 1Q92A 4DW8A 2W43A 3TLMA 1L7PA 4Y2YA 4UMVA 3SLRA 1VJ5A 2ZG6A 2B0CA 3S6JA 2IOFA 4HGQA 3K1ZA 1L7MA 2WHEA 3E58A 4Y2TA 2I33A 3ZTYA 1XPJA 3ET5A 3L7YA 4EENA 1IWOA 4MUMA 2ODAA 3QU5A 3ET4A 3QU4A 4IFTA 2AH5A 2B82A 2JARA 4C4SA 2P27A 1RKUA 5ALXA 4J2TA 5AM4A 5AI6A 2DQSA 1RMTA 1SU4A 1RQNA 2C9MA 5AVWA 2WF7A 1EK2A 1S8OA 5ALRA 1QYIA 2PKEA 1Z88A 1ZD5A 5ALUA 2R8EA 4FYPA 1YS9A 3WK6A 3SMVA 4G63A 3L5KA 2YMMA 1ZJJA 5ALJA 4KNVA 4UM5A 3QUQA 1Z4PX 3NRJA 3ZX4A 3L8FA 4DWOA 5AW0A 2MU1A 5AVQA 4DCCA 3W5BA 2FEAA 2EARA 2YJ6A 3D6JA 4Y2PA 3A1EA 3N1UA 3AR8A 3QUBA 3L1UA 2NO5A 1J8DA 3ZWDA 2YY6A 3U7GA 5AM1A 2FUEA 3KD3A 1Z4JA 3WKDA 4YGYA 1TJ3A 5AKIA 4HGOA 4Y2UA 2G0AA 5AM2A 4NV0A 2GHTA 4C4TA 3SKYA 4XOUA 1QQ5A 4BEWA 2YJ3A 1RKVA 3N28A 2I7DA 3FPBA 1Z5UA 5ALFA 3AR3A 2ZBEA 1FEZA 2I6XA 4I9FA 2OYCA 5AKLA 2I54A 3RFUA 2BY4A 1RRCA 3W5DA 2QLTA 4PNHA 1VFPA 4XQ0A 1RLMA 4H1WA 2IOHA 4AP9A 4UARA 3I6BA 4CNQA 2W4MA 2ZBFA 4RETA 3DNPA 4RESA 4BX2A 5AI0A 4OHFA 4UAVA 5ALQA 2GMWA 2HF2A 4YCLA 2AUTA 3L0CA 2EATA 3W5AA 5AW9A 3NIWA 2HO4A 2ZXEA 3ZI4A 1LVHA 4UU1A 4EX6A 4C4RA 4J03A 3MPOA 4I9GA 3M1YA 4UM7A 4KYTA 3I76A 3KC2A 4CF3A 2OA0A 3ESRA 2FUCA 4AS3A 2D2VA 3AR5A 4XE5A 5ALHA 2WM8A 5AIBA 4NWIA 4HGNA 3QU9A 3CZ4A 3WGUA 4BBJA 3L0YA 3U7HB 4FE3A 5A3SA 5T41A 3UMCA 1LTQA 5AI9A 2NYVA 1T5TA 3KOOA 4B6JA 3ZWKA 3OCVA 5AW6A 2YJ4A 3WK5A 5AVUA 1CR6A 1AQ6A 2PQ0A 1KYTA 3N07A 3KDPA 4HGRA 3PGVA 5AI5A 3I28A 2CFRA 1YNSA 1F5SA 3U26A 2G09A 4OCZA 3PDWA 5AVRA 2WF6A 4GIBA 1ZD4A 5AVZA 1CQZA 2BDEA 3FPSA 1Z4MA 3A1CA 5ALPA 1RPZA 1TJ4A 3B9BA 2B30A 3WGVA 5AVTA 3UM9A 1Z5GA 2FDRA 5AHXA 3WK8A 5AKKA 3EF0A 3EF1A 4EX7A 1K1EA 4QJBA 3QUCA 5A3RA 5E0OA 5AVXA 2IYEA 3QLEA 3U7FB 2YN4A 1Z4IA 1MH9A 4HGPA 3GYGA 1VJRA 5AK6A 2IOFK 4BKMA 1QQ6A 3F9RA 1NNLA 3R09A 2FPUA 5AK3A 2CN1A 3OCUA 3OCYA 2FPXA 5ALEA 1SWWA 2C88A 1RLOA 5AW5A 1L7NA 5AW8A 3ZW7A 5ALSA 2R8XA 4CF4A 3MC1A 1YV9A 2G1AA 3AR2A 4KX5A 1T9ZA 5AVYA 4Y2XA 2P11A 3ZVNA 3NAMA 5IT0A 4KN8A 3QYPA 1ZOLA 1U02A 2Q4TA 2X4DA 3FZQA 3E8MA 4ZEWA 5AKJA 3AR6A 2I34A 2YMPA 3SF0A 1Z4KA 3B9RA 4Y2SA 2G06A 1TA0A 3FVVA 1ZD3A 1QQ7A 4MWOA 3ZX5A 2R8ZA 5AKGA 1NRWA 4YIKA 3A1DA 3AR9A 2Q5EA 3L0BA 4NAVA 3QNMA 5AKEA 2NO4A 5AVVA 3QX7A 2ZBDA 2AGVA 1X42A 4OD0A 1RMYA 2QYHA 2HF7A 5IT4A 2W11A 1L7OA 2Q4RA 1Q91A 3DAOA 5IS2A 5ALKA 5ALYA 3RF6A 2R8YA 4NFLA 3ONNA 3SKXA 4KX3A 1XP5A 2P9JA 5AKYA 1RLTA 2MU2A 5AM3A 2JAWA 3FM9A 2OM6A 1YMQA 2GFHA 5AESA 5AKHA 3P96A 3WKAA 2I55A 3HYCA 2G80A 5AW1A 3A3YA 1WVIA 3L8EA 4E88A 1SWVA 3U19A 3W5CA 1J97A 4Y2JA 2B8JA 4IG4A 3U13A 2B1RA 4Y2QA 3WKEA 3N5KA 3I1YA 2O2XA 1WR8A 3EWIA 3QU7A 1WPGA 2JAOA 5AKXA 1L6RA 4YH1A 4BNDA 3ZVMA 3ZUPA 1JUDA 4CF5A 3E81A 3VAYA 4JDPA 1U2SA 2FPWA 2VKQA 4QQFA 3B8EA 3SHQA 3ZU6A 3L8HA 2WF5A 4UASA 3WKBA 5ALNA 3J7TA 1S2OA 2AMYA 1QH9A 3NASA 4CE6A 2GO7A 1RMQA 4EEKA 1ZRNA 5ALGA 4UMEA 3CNHA 3SD7A 2MSNA 4JB3A 5AVSA 3R9KA 3QXGA 3EPRA 2JGAA 4ZEXA 3E84A 2G08A 1RC8A 2YMQA 5ALTA 2FPRA 4NABA 3N8GA 4ZEVA 4EZEA 2WFAA 4UU0A 3OCXA 2FPSA 2HCFA 5AW2A 1YJ5A 2HHLA 4GXTA 1TJ5A 5AI4A 1O03A 3IJ5A 3DDHA 1YDFA 5AW7A 2YMLA 5ALWA 3UMGA 4XPZA 2RAVA 1Z4QA 2ZOSA 5ALLA 4UW9A 1WZCA 2HOQA 4L6AA 3BA6A 2RB5A 2HI0A 2YFYA 1RDFA 2YJ5A 1RQLA 2G07A 2CFSA 2C4NA 2RBKA 1NF2A 1TE2A 3KBBA 4UATA 5A3QA 5ALMA 5AW3A 1Z4OA 5ALOA 3QU2A 5AKZA 2HX1A 3BWVA 4BX0A 3HLTA 3AR7A 4BNDB 1XVIA 1N8NA 4DFDA 5AI8A 4YCNA 1O08A 1ZS9A 3L1VA 1Z4NA 2CFTA 4G9BA 3ZVLA 4UMDA 1PW5A 3QUTA 2B1QA 3OTQA 5AICA 4KNWA 5JJBA 4L57A 4Y2RA 2OBBA 2ZBGA 3ZTWA 3PCTA 1T5SA 2HSZA 3DV9A 4BEVA 3PGLA 4UAUA 3AR4A 3OCZA 5AIAA 2GHQA 3OCWA 1U7PA 1Y8AA 2HDOA 4HYTA 4FFDA 5AK5A 3WK7A 5AW4A 3OPXA 4F72A 1L8LA 3NANA 5ALDA 4Y3UA 1U2TA 5AK4A 2HEGA 2FI1A 2O9JA 5ALVA 4BX3A 3WKCA 3NUQA 2C8KA 3FGOA 2WF8A 5ALIA 1L8OA 1ZD2P 4UMFA 2IA5A 4F71A 3KZXA 4O8CA 3U7EB 3WK9A 4YCMA 3WK4A 1Z4LA 3M9LA 3ED5A 2RARA 5ALZA 3IB6A 1ZRMA 2EAUA 3NALA 2BDUA 3L8GA 2PR7A 4YIHA 2JAUA 3QGMA 2P69A 1N9KA 2C8LA 4EELA 2WF9A 4AS2A 1EK1A 3ESQA 4BYGA
chains in the Genus database with same CATH superfamily
1KFBB 3SEZA 2Q8QA 1EUYA 3SC2A 1D4OA 3DHEA 3GGPA 2H4ZA 3MMZA 3D4PA 2QLNA 4F9GA 2DAPA 8ICVA 1JG7A 4EBCA 4K9PA 4AO7A 4FS8A 2AW5A 1K1QA 7ICEA 1C30A 3ZVKA 1UM8A 4IXWA 1PJQA 3SXUA 2RAPA 1MBZA 4P1ZA 4RADA 4WK0B 2AFHE 4HYQA 4M1MA 3VBEA 1RAEA 2W6CX 3GPIA 1XZDA 1HEKA 3H7IA 3Q2IA 3UUGA 4C4AA 7YASA 3X1XA 1PDVA 2YRWA 3JAMA 5HK8A 3HKBB 1JFFA 3GLSA 2DZDA 5M29A 4BPBA 3QVMA 1WV1A 1YZVA 1ZAKA 2ZRLA 3I6YA 4LHEA 4DRXB 1WCNA 1VI6A 2GWRA 1GU0A 1TNDA 5DMHA 2NUAB 3NORA 4GGMX 4NONA 2EKQA 2NZUG 4F4UA 2G5GX 3TZQA 4Z3KA 1U0JA 3IVMA 1D5CA 4FYHA 2AI3A 2C7VA 1TTHA 3B60A 4N41A 1TT5A 1SZCA 3A70A 4BV2A 4LG1A 1JQKA 5AI6A 4XUEA 2NIPA 1V35A 3O93A 1RMTA 3M1IA 2LKCA 4E51A 1O0CA 2HZBA 3SZUA 1ZONA 3FPLA 4RHXA 4CG2A 2R8JA 5FEUA 3TNLA 1BPDA 2JFVA 1NFRA 4AXXA 1OX4B 4FHEA 4I4LA 3E4DA 3A1SA 4QGHA 1VSBA 4HPJB 4AUKA 1MF7A 5TQ2A 821PA 5IM4A 4U02A 4BO8A 4PG7A 3OE7D 1IBCA 1OXJA 1AUQA 1C20A 1BS9A 1IAQA 3PDIA 2CLKB 2E3TA 4RPKA 5A0FA 3T34A 1NNI1 1M5RA 2AGQA 2D5AA 2I65A 2QL7A 3A6JA 4NIMA 2C4VA 5D85A 3WNVA 4CLOB 3L5KA 3HT3A 3THYA 3GCZA 1PNTA 2XY7A 1U0RA 1NVBA 4LJ9A 3B1KA 3S2YA 2NNWB 3TIFA 1T1EA 3FYUC 2I87A 2VDNB 2EERA 3ER6A 4R5HA 4WY5A 2IWRA 3H9GA 4D4KA 4LBVA 4K2AA 4XM2A 5BN3A 4F4CA 4C0ZA 2IIBA 2OC4A 1BXKA 1FLVA 3QFTA 2W2MA 2VLIA 1CJUC 2DR3A 4I8DA 3SNHA 1ONNA 1CPYA 2XVAA 2XWQA 3AYZB 1UOEA 3PC8A 1W76A 4WLEA 3SYRA 3CISA 1NAHA 4PTYA 5JY6A 1W5EA 3AIMA 3AKDA 2WM2A 4XUSA 2CJPA 2ODPA 1HRDA 3O8LA 4FD3A 4MS1B 2HN9A 1MZVA 2ZJ7A 2V96A 3GZFA 4J7XA 4NJMA 4XTRA 1LC0A 4UHEA 3WL6A 3I9V6 2QMHA 5GY7A 4E08A 3IDQA 2AHOB 4YP3A 3H16A 5C31A 1N5RA 1XZKA 5JCXA 3U7GA 4CKCB 3HJBA 4OUDA 5B2ZA 4GC6A 1JIIA 2C1XA 2L18A 3B52X 3WG9A 1LK0A 4HEA6 2GZDA 2R8RA 3ACDA 4UUNA 1M8GA 4DQKA 5FWYB 3VMFA 2PGOA 4Q4CA 1P4HA 1PN3A 1I5OA 1M2VB 3QG5A 2AXQA 1T91A 1L5UA 3C2LA 3HGTA 1AHHA 3GT0A 4IIYA 4X1KB 4ZALA 4BQRA 5H9WA 4MVJI 1Q0RA 2WAMA 2C1EA 2JIPA 2I3AA 1YQWA 3M81A 3OUTA 1RKVA 2CHFA 1JFLA 4FYJA 4M89A 3VX4A 4GVXA 2WOJA 5ALFA 4RE6A 1XELA 3RNOA 1BX0A 5BQ3A 1C7RA 1EPUA 2J4CA 4MRRA 2WA1A 4NJEA 3D6FA 1KWGA 1Z12A 1RBZA 5T3YA 5A4MS 1X9WA 1RACA 1BCRA 1QG0A 1AZSC 3GGOA 4QQNA 1OT3A 3FLAA 3MILA 2A0YA 2BQUA 2CW5A 4GXQA 4I50B 2GUWA 4PNHA 1AMOA 1O0SA 4J3FA 5DNUA 4I27A 1UWLA 4IJ6A 2IUEA 1TIPA 2V74B 3F6PA 4QD3A 5AQ1A 4JJZA 2FMPA 1ULTA 4LHWA 4QO8A 4Z4FA 4XUDA 1SVWA 2VOEA 3F8TA 3BHNA 1FFXA 2FZVA 3PXCX 1MKYA 3IAM1 3VPFA 3ZQ6A 2G7ZA 4BLRA 3THXB 4RVOA 4WUVA 3F2CA 1U0NA 4UAVA 4LX0A 5EKDA 2Q7DA 3S55A 3SQOA 1MX9A 5K3BA 4LSZA 4YTEA 4AU1A 2JXJA 1PFGA 1W94A 5CLFA 1XKLA 5CYPA 3ZE2B 3EQ9A 1GZSA 3KTFA 3O8OA 4L85A 5L40A 4OB7A 2C4UA 1SQSA 3ZI4A 1Y48E 3HA2A 1LVHA 3AEZA 4MPTA 3SS9X 4P2HA 3HSSA 5CK4A 2D0IA 3MPOA 3JASA 4BO6A 2DFDA 4RV4A 3VOAA 5CB4A 2PUJA 3M1YA 4ECVA 1AE1A 1V43A 2ZULA 4LHZA 1MVOA 3GJZA 1FCJA 4N6OA 2VQ3A 3LECA 5KAFU 5DI3A 3PNMA 1M2JA 2CCKA 2FUG1 3NJ8A 3U3MA 1GGHA 1IZZA 3JPWA 5DX1A 2IDZA 3OPYI 5DW0A 2VP4A 3LC7O 4CKBB 1YZQA 2M6RA 2WM8A 4RCZA 5AXDA 4FBLA 4XFKA 2B7BA 5J4KA 4X95A 1HDXA 4Q1EA 1TRHA 2YOGA 3L0YA 2E8NA 4QVKA 2DPIA 4GMHA 4Y6OA 2Y76A 3GAZA 1LTQA 1V38A 4OHBA 1YNOA 1D2NA 2FNAA 1GGJA 2QVXX 5AR1A 2TMKA 3OE1A 4RM2A 1E8MA 3VVCA 5CX1A 3LNTA 3V72A 5JV5A 1CRLA 2AD1A 3T4UA 5AVUA 1OZFA 1P7VA 4PXAA 3EXG2 5GTIU 1KYTA 2WQZA 4KK3A 5CMLA 4B2PA 4QGSA 4YRFA 2H51A 3P71T 2G9VA 2PGXA 3IAAA 2CXYA 1ADYA 4WBXC 3E3OA 2CDAA 1SXGA 2J41A 1KMHB 2ZIGA 1CZRA 1JG3A 2ZWAA 3NGMA 4M0DA 3AHGA 2RB4A 4RLHA 4UAZA 2R1VA 1YI8A 3RJTA 2XE6A 1KEEA 1AJEA 5FBLB 2GILA 2H3QA 4DOCA 5EWLA 2N1MA 4CGZA 3LZCA 2XHEA 1M72A 2O5VA 3EMVA 4RBNA 3AWDA 4ALMA 4HN9A 1HV8A 1W4AA 5HP4A 3IDAA 1A2OA 4LYDA 1PJ2A 3O4IA 2VTEA 1OOEA 1YRQA 3ENKA 4I08A 4RQAA 5INTA 3KSAC 3KQLA 4OU5A 4CLRA 3PE6A 1BIFA 2HA0A 5AKKA 2H18A 4D79A 5L4LA 3EF1A 3KXDA 4KRXA 5E1OA 1RM0A 1OBFO 2PT9A 4EJSB 5AVXA 3VZCA 3QLEA 4Z9YA 1DAPA 1NPTO 4IDPA 5J0SA 5LMCA 4IM7A 1VJRA 3DAYA 3O83A 3FMIA 4IRXA 4JENA 3M3DA 2ZSFA 2AFIE 2R60A 2DPGA 4XR9A 3SN6A 4IS7A 1NNLA 4JC4A 3ND6A 5IIIA 4MGHA 5CNJA 1Z1BA 3FB4A 4KITB 4EF5A 1W88B 2I0FA 4BKRA 3HM9A 4TTIA 1WDWB 1YJ8A 3KQHA 1UJ4A 4XGRA 1CZLA 1ZH2A 4LYFA 4HB2A 1SXJD 2WPNA 3LSYA 3DWIA 4Q21A 8ICEA 1RLOA 2POCA 1P2BA 3JVEA 5ALSA 4NK4A 2ZJFA 3JWHA 3ZW7A 1E2NA 5FO0A 1SKYB 3JCZA 1QF6A 2HCTA 1YSCA 2HIHA 5FTMA 3RGGA 2NRVA 4LV8B 4E6EA 5LPNA 1OKKD 3BQ9A 3H1TA 2FP4A 2XDQA 3ZIAD 4CMBA 2NACA 2QT0A 2X8LA 4NRDA 1QTRA 4FTWA 1XF9A 3ZK9A 1KDRA 3PJEA 2IV3A 3LFUA 2NU6A 4ZOLB 3UYLA 1WEHA 4ZEWA 3ZXXA 1GPDG 3LKVA 2HMWA 3PX2A 4CLHA 3IGFA 3AM3A 3PZRA 3P9NA 4I2GA 1TZBA 3NVDA 2J07A 4B3XA 2PRIA 3WIVA 1G5QA 3PP8A 3VNRA 7MDHA 3N0WA 4OL9A 4YAFA 3IYLW 1W25A 4RKWA 1XEXB 1U0BB 3QZUA 5E6SB 1OXSC 2G3YA 3ENVA 3MJSA 3JD4A 4G56A 1MXHA 4WK2B 5I7EA 1QFZA 1VRCA 4N6GA 4UEKA 5F51A 5FUBA 4DJAA 4YDHB 1DBSA 2V7XA 4HAYA 4OF4A 2IGBA 4UD6A 5F64A 1N3BA 1ODIA 1OLSA 1RMYA 2O4CA 2QYHA 3K0CA 3KQPA 5BW4A 5EVCA 2I3BA 4DQIA 1G42A 1YU9A 4PBSA 1NJSA 2XQIA 3QEOA 1WPXA 4MWGA 5ALKA 1G4HA 3T9AA 3W05A 2X6RA 4DL5A 4NFLA 5AQEA 2C7GA 4DO9A 2VAPA 5DJ5A 1QYXA 1W47A 4EMSA 5ICMA 4M9JA 4AQ7A 3K09C 2VUIB 4G0PA 2D06A 3GA0A 3GK3A 1K7EB 1YQEA 4L28A 1DLIA 2DHQA 2ZRHA 4P3OA 4COKA 4PHEA 3ELDA 3GLGA 4KBFA 5DQGA 2BFEA 4YRPA 1YBAA 4NLKA 1L8XA 5HKAA 3L2OB 1ICEA 3D31A 4E46A 1OUQA 4A2PA 1K7SN 2Z1MA 4O5EA 4B44A 2J7PA 2I55A 3R24A 4L2IB 4DQUA 3BSFA 2QXYA 2AKYA 1OSNA 4FKBA 3A3YA 4C7ZA 1WZUA 3ICPA 4I46A 4PYKA 1OVMA 2I6FA 2BQRA 4TQUS 3SEAA 4LF4B 1AURA 3UPUA 4Q4AB 3HU5A 1FQJA 2FSPA 2YC2C 3DBRB 2PFOA 1ZVJA 3ZUGA 4QJ3A 1SRRA 5BVHB 1K68A 4UCWA 5DRYA 3RIMA 4Z4GA 2CNDA 3CLRD 2G6TA 4AUEA 1JPJA 4Y2JA 1NYRA 1GSIA 5K6RA 2B1RA 3GJ4A 4KIGA 2XVTA 3ND9A 3OZSA 4L5CA 1ZO8A 2ENWA 3IHTA 2QBYA 1T6ZA 3TD2A 3PFNA 5IC4A 2IEDA 4X7RA 1REQB 5K0EA 4XA5A 3DMRA 3L4SO 1BGXT 5FJIA 1V9LA 3PYLA 3HILA 2OSVA 3AM9A 5EUMA 4NYIQ 3ABSB 4RNDB 1ZJZA 1VYTA 4EF6A 4HNSA 1I36A 3BWMA 3CCCA 3H87A 5ALNA 3AG5A 3NASA 1U2QA 5G4KB 1PV4A 1JHVA 2E1EA 2P3OA 5BPCA 4H3VA 4CQJA 4DKJA 3X1YA 5CAEA 4HAWA 2Y0SF 3H9JA 3DB1A 1TLTA 3TXXA 5T7BA 3D1LA 8ICTA 4HWTA 1PJCA 1SOWA 3IVCA 1L5KA 4RD1A 2PUAA 1XROA 3NHJA 3QXGA 2I5PO 3VOTA 2D1QA 4NYJR 3AUUA 5HHIA 1ECFA 3E7XA 1DFGA 1NLZA 1LBIA 4MUJA 5KI6A 4J94A 1DJPA 4AMVA 3IP8A 4K03A 4WJZA 3HTXA 1SUBA 2J3QA 4AWAA 2UVPB 4OXNA 1WXFA 1XPOA 3T3MB 1EGQA 1QG4A 4QPZA 4ELVA 4GLLA 1XSLA 1SVIA 4QSHA 1GSAA 4ENUA 3N2IA 3FWNA 1UANA 4ZO9A 1UFOA 2HHLA 3EOAI 3OAAA 2ZIXA 4CIBA 1C29B 3TBKA 5EG5A 5FAXA 4EZIA 4RQNA 2PAFA 1P6QA 1EBBA 1PJBA 3ZE6A 4TLLB 2GVNA 3R5SA 1L4BA 3FPGA 3VNAA 1AQYA 2FV8A 3I64A 5LOVB 3C3WA 3BK2A 1RZVA 4JMUA 3JQFC 2G1PA 3L3FX 1SQ0A 2AW3A 9ICIA 3GRYA 3GLHA 3KOWA 1HYQA 2GSWA 5DB6A 3ZXUB 4L6AA 1H2HA 3H2JA 1Y8CA 3WWEA 4KQHA 4F4YA 5WRFA 4QW9A 1G8KA 2XXAB 3E70C 3DLHA 5B5SA 2GEDA 3PW7A 1PUXA 4Z2AA 2Q5FA 3IAM6 3ZQUA 2ZITA 1TE2A 2QPLA 4FYWA 1ODKA 4RPCA 2H29A 5NULA 3GZJA 1P2VA 2FPIA 3M89A 2I3DA 3PQDA 4PCUA 3GUUA 4X60A 4W7SA 4WK6A 4B3TB 3JTEA 2ORWA 1ZJ4A 3NHKA 3C0KA 5FR2A 4BX0A 3HLTA 2FW8A 3DE1X 3B82A 5LQUA 2CVPA 3ANNA 5B4TA 2PH7A 5CFNA 5JAOA 5LD2B 3ROXA 1DEKA 1CEYA 1WM1A 4MA0A 4MVJF 2FFHA 1GQOA 1G5RA 2XTAA 3G9UA 4EYHB 4L72A 2QOEA 1GLNA 4IXNA 2WU3A 4QUDA 1WLYA 2GPBA 1ABBA 2N0SA 5C7OO 1DS6A 1N2OA 2PXHA 2ANBA 1KGSA 1ONPA 4K46A 5KAMA 2Z58A 3DJYA 3WV5A 4AJ9A 4ARVA 1J56A 1XV5A 4DIDA 2AV6A 2QRLA 4DILA 1EB8A 1Y3BE 3FNIA 3NGXA 4U7TB 4UHJA 3GDWA 1KY4A 3KHUA 2OBBA 5K0SA 1U8YA 3AVPA 4MCIA 1WMAA 1B4FA 5J3JA 3MELA 1H4QA 2WE8A 4BB9A 1ORVA 1WHTA 2BFDA 3JYNA 2RHBA 5CNIA 5E7MA 1GA6A 3OCWA 5DDIP 2JFQA 3MABA 1P0IA 3ECAA 1A8UA 4X92A 3FCYA 3VMMA 1VI2A 3EZ7A 1P4AA 1T8PA 2FUKA 3RF7A 5KYWA 3UATA 3RTAA 2X2PA 3ZVRA 1RRKA 5CHEA 3GLVA 3QVTA 3SSNA 5ALDA 5CJ7A 3MBKA 3CW2C 1OV4A 4OJNA 5FPYA 4Q3BA 3BQTA 5AK4A 3NC0C 3HYNA 4QG7A 4OHVA 3BZWA 1FZTA 1UKBA 4J1TC 3TOSA 2R00A 4TSFD 1UC5B 3QVJA 1JYSA 1PZXA 2IEGA 4GO1A 1BE8A 3VZRA 4D3YA 1X8XA 4J9KA 2ZTVA 3LPLA 1JRLA 4TUPA 3DR3A 3IUSA 3QQPA 4EYSA 3JZIA 2GAOA 1WZNA 1ESNA 3WK9A 3PXXA 4ML3A 4MRVA 1EXVA 4NAHA 4JI0B 2B1JA 3V6LA 1ORTA 3ED5A 4PPFA 2HA3A 5GVRA 4U3JA 2BTQB 3SDSA 5I7RA 1RABA 3H8SA 3NHPA 4F5PA 1QHEA 3GBVA 2P9TA 4R0VA 2G9UA 3O4VA 3UMVA 1FBTA 1KKXA 3GNQA 4J3JA 3GV8B 2I8LA 3L8GA 3O9ZA 3ZLUA 4CIAA 2P2NA 4LHYA 1T1RA 1SXHA 2GHIA 2NSLA 4YD1A 3OC0A 1XFAA 2DQNB 1CUKA 4QECA 2HWXA 1NNEA 3AJ9A 3JXEA 4PZEA 1T3HA 1RYZA 4ACOA 3EQ7A 1C4OA 3SEIA 2ROQA 1A7AA 3L6RA 4HYKA 2K8AA 4OHWA 4TMYA 3QSYA 4HLUA 2P35A 1A7UA 2QRQA 3AI2A 3AUOA 4PQYA 4XA8A 3EVBA 1TD9A 3O4HA 4L6CA 4HXYA 3U4DA 5KFWA 3CEJA 3PWTA 4MLDA 3FLEA 5T4HA 3RYIA 4CFZA 3RKRA 3IEPA 1NASA 4FI3F 5CT8A 1KFTA 3SIRA 4F4DA 3ZNNA 2B98A 2PT7A 2W4IA 2VAWA 5B7PA 3QVVA 5IINA 3QPDA 4KFRA 4KO3S 5KAIU 5F2NA 1ED1A 2XCOA 1U3FA 4FZLA 1TZKA 1HRKA 2E18A 2ONYA 4IWYA 2E5WA 4MS3B 4QWCA 3HEMA 4KPFC 3UPDA 4KGDA 1XNRB 4EZ9A 4F5QA 4O4IB 1YT5A 1E7MA 4I2BA 5CW2A 1T2NA 3IE0A 1VP9A 4YUWA 1Z47A 1IWOA 2J4DA 3I9V1 3NHBA 4MUMA 3QU5A 5F2EA 1T3GA 1PP4A 1WDLA 3ET4A 4HUQB 4B9UA 1GZDA 4MUNA 3ONVA 1D09A 5HPYB 2FTKE 5TQVA 1UZMA 3FJOA 3ZWQA 4EJMA 1KC1A 2E1FA 2P6PA 3QNUA 1IWBB 1CVLA 1U7UA 1A04A 4BMYA 3UQZA 4LVNA 1NR1A 4JC0A 3LQ2A 4Z6EA 3WLQA 5BSGA 2VIIA 1N4DA 1RT9A 2HPAA 1Z88A 2REXB 5IKPA 1N2EA 5DBEX 5KHOC 4UQOA 4DCGA 5BMOA 5JC1A 5A0LA 3EULA 1HT3A 1A8QA 3GDGA 1IUPA 4L75A 4FUTA 4BPRA 1H0HA 5LR6A 2MSEB 1L7DA 3RB6A 3ER8A 2LM4A 3H5TA 2R6DA 1JROA 5KFUA 4HSEA 1X92A 2I4RA 2EYUA 2HHSA 1QIFA 2CNNA 2Q21A 1SBQA 3BXXA 1L5HB 5DEIA 2H00A 4CHGA 3V6HA 3LK7A 3T41A 5ESWA 2D6FA 2C58A 4Y6GB 1PSZA 4OREX 3V4SA 4EBDA 2PRZA 4FWTA 2WAQC 1RFGE 4OHRA 4YO7A 4DL2A 3EXEA 4BBPA 1L6IA 5TR9A 1LZKA 4BX9A 4EO4A 3DBIA 4JX8A 2JASA 4ARZA 4EG7A 5JRJA 1N7HA 2QQ0A 4YR0A 1MO6A 1SHKA 3QUBA 1UZNA 3AUXA 3O8OB 2F67A 4WW0A 5ES3A 3BUSA 1SKWA 4EEXA 3RFXA 4ZTUB 4MVJP 1CEEA 4J0EA 4JBLA 1X6IA 1VIVA 1AKQA 1K6MA 3VZBA 4REOA 2JMGA 1C3OB 5EYPA 2N9UA 3BULA 2QSYA 4N18A 4YJ3F 1TZMA 2HC9A 1I7LA 3G7NA 1OWMA 4V02A 4X62B 2YJ3A 1Q44A 4URZR 2V0GA 3F0TA 2FRVA 3GT3A 5DX0A 1Z5NA 3KPVA 5DHAA 5BRJA 4ZC8A 2GF2A 1R8XA 2F3TA 2IWHA 3RKUA 5KZMB 2JLWA 1YXMA 5HNKA 2QSZA 5EXPA 1B42A 3ISCA 1UPHA 3OLYA 2ISQA 3MM4A 1JDBC 1UQTA 3HPQA 4XIFA 3GPCA 3D8BA 3OLXA 2VZ9A 2BR3A 3MGBA 1C7JA 1E69A 2BKXA 2E85A 5HYVA 5JNVA 1QRAA 4L27A 1GIAA 1O89A 2BGRA 2BZ0A 1CF4A 2PUDA 3QVKA 4CCYB 3B9JA 4NBWA 1NBME 4B5LA 1W8IA 1P1HA 4IL6U 2CXSA 1E66A 1HXHA 1LPPA 4ADSG 4RESA 4LSMA 3EGWA 3T3FA 1NW6A 2O7QA 3MT0A 1F06A 1JZQA 4RJLA 2ZUDA 2X4IA 2ZREA 1IPHA 3BMCA 2ATEA 1JJBA 2X41A 3IQHX 3L7BA 2JR5A 1BG6A 2QRHA 1UODA 3MBIA 4K88A 4L9WA 2X1LA 2KBEA 4RVGA 3TOCA 2EBFX 5KOYA 1EDBA 4EPXA 5KQRA 5KTKA 1Y42X 2W8LA 4DLUA 2EOAA 3ZWCA 1OXTA 5IBPA 1KZGB 1CHDA 3B6IA 3AWIA 4TLBA 2X2OA 3CRMA 5B7GA 5TQ0A 3ZDCA 4H7PA 3DCJA 2ZFUA 2HWYA 2IEBA 1RPLA 3Q85A 4AN1A 2J67A 2BGIA 4J2HA 3URMA 1A1SA 4I9GA 1R74A 2GN0A 5JARA 4M9XA 1R4MB 4Y9DA 1ZJ6A 2GR9A 1K5DA 4AG5A 2ADFA 3MFIA 3PX6A 3DOEA 4YQWA 3TM5A 2FDCA 3NEYA 1DZIA 2JBAA 3I1IA 5KAPA 3ZHTA 4A82A 3EVDA 1KJIA 3CE6A 2YFHA 2JPDA 4H0NA 1P9RA 4FFOA 1EBFA 1BMDA 2ZUVA 3REGA 4LHSA 1G8YA 1WHSB 2XMRA 3BRCA 3A10A 3N76A 1OT5A 3FCOA 1Q0SA 3EGXB 4D3SA 1L1EA 1VLMA 3M4ZA 5HOQA 2I9PA 5J2JA 2QTHA 2YIVX 2W3SA 1ZQTA 2RK4A 1YFZA 1A9PA 1KI7A 4L73A 1EHYA 4UCFA 2HPHA 2FN7A 2QXTA 1YR6A 3BWXA 3HBMA 1AQ6A 2CWDA 3OZTA 4HADA 4LDPA 3PUIA 3SQNA 2Q28A 4PF1A 4CMIA 3C3PA 3FI9A 1QFSA 2D0DA 2QTRA 1K0FA 4YWJA 1KRXA 1U7ZA 2E37A 2QZPA 1OJ7A 3GA5A 3KV1A 2KE5A 3KKQA 3E03A 3PUVA 3QOYA 4JZYA 4GWKA 2G09A 4RF3A 3UOGA 1J1UA 2L2QA 3K35A 4WKBA 4L9RA 3NVYA 3CTPA 1IDOA 5DKFA 5C80A 1XHEA 2PU5A 2ZUSA 5E2AA 4DUYB 1UEXC 3FPSA 5DLDA 4EHLA 3KR0A 1LB2B 1EJ0A 1I10A 3TLJA 2DBVO 1F8YA 4YBZA 3FHTA 3CX7A 1KAEA 3CO0S 5CM2Z 3TK1A 1ZM2A 3UCFA 5B3AA 5EIXA 2YTZA 3M9MB 4TN5A 2NZXA 3QQ5A 3UM9A 1ZOIA 2VUUA 3WGMA 2V6BA 2DFKB 1REQA 3PNBA 1MQ2A 2NRXA 4MQEA 3VPSA 3ZDXB 3FWPA 1ZK0A 2A0FA 4WKGA 5TZVA 3NHSA 3DUFA 1N2CA 1TTPB 5ERXA 1X80B 4ZICA 4GOJA 4L4RA 5HKOA 1VDMA 1JLMA 3OX1A 4LHVA 3W5UA 3HN6A 3SXUB 3ZWNA 1L1RA 1D2EA 1M8JA 1XGKA 1O97C 2AR9A 3OKPA 1YDHA 5CHYA 2HU7A 3RYFB 1WCV1 5JCOA 4B7XA 4NECA 2IH5A 4NLLA 1WIWA 3P2EA 1UAGA 2GEFA 2WWWA 4Z6DA 3E82A 3KUCA 4TKUA 3OCUA 1ZN2A 1YZ7A 4B3BA 3ZDDA 2HIGA 4M6WB 3NT2A 3CBGA 5EXXA 5JAQA 3V8QA 1SURA 3DT6A 4GU5A 4Y1EA 2AQ0A 2XE7A 2YS7A 3LCUA 1ZCAA 2Q2WA 1Z6AA 4Q0MA 1VL8A 2Q1UA 2R8XA 4LYHA 4Y9TA 1YV9A 2O8BA 2D8CA 3CSDA 5BXQC 2WUWE 3VC7A 2C4HA 3AZOA 3HXTA 3EW9A 3LYSA 2Q3JA 1KDHA 1K92A 2O1SA 2X3FA 3R5HA 4QU5A 3RU7A 3A2LA 2BHRA 2G8LA 3OQVA 4HXFB 4ZAWA 1C50A 2AOXA 2P9BA 5J2AA 5DBGA 1SXJE 1Q7EA 3NHAA 4OLBA 3INNA 1JILA 2FEWB 5BWLA 1YQGA 2I34A 2VT2A 4OXQA 5DBAA 1UZLA 3KWLA 5LP1A 2B5WA 1OAOA 1PR5A 4ZOLA 1E1DA 3Q8QB 1CUUA 2RHOA 4FEGA 4M9CA 4KN5A 4YREA 2BGUA 5C7LO 3FTPA 5F7XA 1YOBA 1ZXLA 3OY2A 1VJCA 3ZTTA 1OX5A 2AFVA 2PMCA 4YCDA 4JV5B 4KP7A 1CUDA 4M53A 2BEVB 3CINA 5KDDA 4WOCA 4B6GA 2VBCA 2MAXA 3ZC3A 4YV0A 1SCNE 2P2SA 3B6EA 3PK0A 4H6PA 4YRQA 5JYEA 3K0FA 2REBA 1Z26A 5LOVF 3SR6A 2PTGA 4YASA 4ESHA 3HLKA 1VCIA 3H9EO 3MPUA 5I3ZA 3TG8A 9ICXA 1W4ZA 4U7JA 1XRJA 2WUGA 3HUDA 1H94A 4S3MA 4U63A 1XKQA 3PNYA 4V3CA 2P2LA 2PKWA 2DBRA 4HQKA 3RVPA 4J6FA 4C7BA 1G16A 2PZGA 1KC3A 2WTBA 4ECEA 4W63A 4P0PB 4FFNA 1MAVA 1CZUA 5F7ZA 4HNQA 3CRXA 1FQKA 3EHEA 5A2QA 4TTAA 4TTSA 1LPMA 3C97A 3OA2A 1JX4A 1FX0B 3HLYA 3L6UA 3RYFA 2IBSA 3NDBB 2DWOA 3RJFA 1ATZA 1G8HA 2HQBA 1ISIA 4HLQB 4LXXA 1GZVA 2OG2A 2X5OA 3UXNA 2EBHX 2BEWA 4IO1A 2POQX 1SU8A 3WIUA 2IXTA 2XOEA 2C2WA 4A3SA 5KFPA 1BA3A 3M8KA 2E6KA 4DV7B 1IXKA 4LJXA 5A3JA 1F2DA 1ZNZA 4DFMA 1N2ZA 1G8JA 2DECA 5HDQA 4EY5A 2DGDA 3IG8A 1I6MA 2PZEA 3ABZA 3NDIA 4QRDA 5AP9A 2AYXA 5EZYA 3DO6A 4C2AA 3C1ZA 4KLDA 2AE2A 2OCKA 3LA6A 3IT2A 2QZZA 3RJMA 4AZ3B 3KTQA 1EX1A 3E7WA 4H60A 1GHTA 2HREA 4HDNA 4IG4A 3EQ6A 1Y1QA 1E3LA 1LRLA 2FPPB 4WCFB 5DTEA 2EIXA 2OV2A 4I2VA 4AF8A 4ECYA 2DPJA 3TR0A 2FVYA 3K0KA 4UM9D 4RTRA 1G21B 4RD4A 3DLCA 2XQJA 1DCFA 2QU8A 4YRSA 2JI4A 3L0DA 1ZN8A 3ZCXA 2D7DA 4C5BA 4FW8A 4Y9SA 2EDAA 3D6TB 1DRUA 2WG0A 1MSWD 5CJPA 2ZZNA 3GLGB 4I14A 3C1YA 2FWNA 4JYMA 1U4BA 2DH5A 2JA1A 4KVFA 1J22A 3ASUA 3ZE0B 2AMYA 4L1KA 4YYZA 3I5YA 2A6PA 1NK4A 3DNMA 4NZ9A 4ECZA 3BF8A 3CB4A 4LRWA 1MT3A 4MKFA 4B73A 2CEAA 9ICEA 1USGA 2GN9A 1VHQA 2WLTA 4FGZA 4MUIA 5ESDA 1TAMA 4N82A 3EC1A 4BJ6A 3P4XA 3PGJA 1ZQQA 3MWKA 2FPKA 5DISB 1CP2A 3SMQA 2IBMA 4CN8A 2PCJA 4QFBA 1EQUA 1M34B 1AUOA 3QIAA 4MEBA 4RV9A 4XI9A 4XWOA 8ICSA 5J2IA 1PGQA 2XIDA 3GMSA 5I5GA 1NE2A 3CGWA 1HLFA 3AEUB 2ES4A 3BJMA 1IL0A 4JB0A 1TUBB 3SLKA 2OZPA 4KO8A 1RC8A 5ALTA 3ORFA 4BN5A 1OA1A 2O8EB 1T4GA 1WKCA 2LTAA 2OAEA 1XXHB 4PS1A 3R7WA 4CRXA 2PX4A 3ZY6A 1HFJA 3GG2A 4MW2A 4QJ4A 3WICA 4I1OA 4XWAA 4BV9A 4LF5B 2G1JA 4JT9A 3AHIA 2I2XB 3IJ5A 1DELA 2QMZA 5F3WB 4GI2A 1AN0A 4IZOA 3KOXA 1D2AA 3T12A 2ZZKA 1YDFA 1UKVY 1QLJA 3KPJA 2C9ZA 1TK0A 3TLGB 1AIPA 3LLCA 4PG6A 3H4DA 5IYZF 5ALLA 3C4VA 4URHA 3COVA 5KNDD 2GAFA 4UW9A 1F6BA 3SYTA 4ZC1A 4KLJA 3RYTC 4ECWA 2EAPA 1ODCA 3VR4A 1E2LA 3ZKWB 3JPTA 5HX7A 3OEED 4XDZA 2OOKA 3E0FA 2HV8A 1E2PA 1GL6A 1G5PA 1TYEB 2PL9A 3OY7A 3U37A 4N65A 3UOWA 1FX1A 2DWPA 4K40A 3X43A 1XN1A 2JA2A 1DGQA 1ZL2A 4DGSA 2P41A 5BMVF 1EP3B 4C8MA 1K4KA 4OPMA 4US2R 1N36B 4I2FA 2PO5A 3VR5H 2PMEA 2R47A 4BMVA 2B8WA 2WMYA 4BWVA 1OLUB 3M7DA 2A4KA 2PLAA 3GEDA 3NRWA 2JLSA 3DOOA 4WEQA 1WW2A 3KUXA 5J47A 1DINA 1ENPA 3G85A 2AOUA 3C3DA 1R9NA 3LBNA 4H4CA 4EGCB 1O08A 1X2EA 2Q2QA 2O5RA 1KO7A 4PZLA 2HW8A 3D3NA 1VGQA 4RHYA 1SVKA 3GUHA 3IV6A 3K6RA 5DNEA 2FFQA 3KJEA 3G9XA 1NSYA 1S1CA 2BUCA 4RY8A 4WFIA 3ITNA 1T6XA 3EBPA 4IR1A 3QLUA 2RHHA 2XH8A 4PQGA 1I0IA 2DLNA 5FJJA 4DQXA 3CWQA 4LRXA 1HDOA 3F74A 1XNSA 1G20A 3AXSA 4MP6A 1NQWA 4NR0A 4WTOA 3GZNB 2FB9A 3E5NA 3QLUC 1BKSB 2H1SA 3M4YA 5HFAA 4E5SA 3AM1A 3UMJA 2QWXA 3AR4A 2XWPA 2ZSBA 5AOVA 1NU8A 1LSJA 3OJFA 1JJ7A 4TL9A 4QREA 5KNDA 5BT8A 2XTZA 1JE0A 1X9MA 1LRKA 3BXFA 1U7PA 2QL6A 3H05A 7ADHA 1KZ4A 1CKEA 3L7IA 4H3KB 2D0PB 5JVDA 1KSFX 3TEJA 3VKHA 3E9CA 3A11A 2ZIAA 5TB5A 1MOSA 4F6RA 3UWDA 2MMCA 1M1NB 4F60A 5A5DA 1PK7A 1RBYA 1Z3IX 4NU6A 4TM8A 3RJEA 4DMKA 1E1YA 4XRRA 3HH8A 1LRJA 1TRKA 3ITDA 2NQ8A 3L4EA 1I8TA 3NBUA 3PSFA 4RFVA 5GIOE 2F4VB 3KQMA 2AGPA 4C05A 1PT5A 4ZGGA 2IUYA 5DW3A 2AJLI 2WUDA 4KQEA 3RC2A 2R6FA 4UAYA 3CLVA 3IDSA 4LJ7A 5C4MA 5DASA 2I4IA 5DTRA 3BAZA 4KODA 4ZHQF 4PAOA 2IS6A 4CDGA 2JLQA 3JQ9C 3OHSX 4KUHA 1XK7A 5KFQA 1YBVA 1E1LA 3PU6A 1WTAA 4KU4A 4R1MA 5DK6A 4Q1AA 5ERYA 5A2GA 4CKWA 1NMEA 2A59A 3HB5X 4RAQA 1R8YA 1U4NA 4AJ2A 1G8AA 5D8DA 1UT5A 4UHCA 2VNAA 2BHLA 2ZWVA 1M10A 1D1QA 4ZEMA 1VE1A 4LC9A 1KXZA 1LBTA 2WI8A 4E5KA 1YWGO 2FZCA 5C35A 4J0QA 5BNFA 3ITKA 1UWKA 4G0MA 4R3UC 5KKNB 4KN7A 3I37X 4NBTA 3OEWA 4EJ2A 3OOHA 5B1YA 4F56A 5C1DA 5KNCD 3G0GA 1JS1X 3RFAA 1W5FA 4NHOA 4URYR 5C8YA 3ESQA 3OQOA 1I7QB 1IQPA 3SJCA 1Q6YA 4XVRA 2GBGA 1C7ZA 2NU7B 2FF7A 2YBDA 2HQOA 1HDGO 4C2UA 3S44A 3R4CA 3TR6A 3VR1A 4BB6A 3K8QA 4JBGA 4BB0A 4I5IA 4JJEA 2HSGA 4QZHA 4DLYA 4HAIA 4EI9A 2N1BA 5JZVA 2R6GA 4REMA 3G2OA 5A05A 1N6KA 4G4IA 1T5BA 3W3AA 5DP2A 1EH5A 1KEJA 2Q5LA 1EGHA 3IUBA 1R00A 4J9PA 4Y2YA 1OC2A 3E2MA 3VHLB 4DLEA 3KWJA 1JKIA 4FQ5A 4OK3A 2B0CA 2LZ0A 3JWEA 3LI2A 4Q4HA 5JAPA 4MDEA 3HZRA 4HGQA 4R2WA 1ZCJA 5KCZA 3A3KA 3ROEA 2IYYA 4N54A 3E35A 1HOXA 3PRYA 1BU5A 2O1XA 4YRLA 5EKSA 2PZKA 5JDIA 3LVBA 4WSOA 3NUGA 1BVUA 1T8EA 1IHOA 1Q3HA 2HLPA 2QF7A 3QPWA 5DB9A 4BGIA 4C9BA 4NM2A 2OWOA 3ZDBA 4LQDA 1XU4A 2J09A 2ZANA 2HSEA 4IX9A 4WASA 5TX7A 3PFKA 2WMOB 1HL3A 1L3CA 3D7KA 3NXKA 5BOLA 4FLFA 4RTKA 4EGJA 2IBTA 3CV3A 2OUKA 3HI4A 1SELA 2H1IA 4HRVA 2HOFA 2B8NA 1PTJA 4Q3AA 1XLUA 4RY9A 3KHTA 3TCKA 1FJXA 1XA4A 3QOXA 1RQNA 3AP3A 2X8BA 4A26A 5ITSA 4RQ7A 4PYOA 1VJGA 2JCBA 2PSJA 1TU4A 4D4MA 1QH0A 4PX9A 3NNDA 1ZD5A 4PC1A 3NVZA 4IQ8A 1FOEB 2YJZA 4XVUA 4BX8A 3D5TA 4OYRA 3ZLJA 1R0SA 4TMVA 5BO5A 4RU9A 1YS9A 3ZH2A 2ZSAA 2WD7A 2YDXA 2C22A 2W7OA 2OBNA 3FA2A 1JKFA 5CFQA 3EMKA 4I8XA 5JSQA 2C20A 2FE4A 2AU0A 3KJZA 3HO1A 2R4QA 1PK1B 4M1TA 1ZQHA 1FXUA 1WPRA 1AF4A 2DUNA 2NLOA 2Q8NA 2SCUA 2Z2ZA 1GCIA 3GFQA 3ZX4A 4ZMBA 4LWZA 2NXEA 4NCJA 4LTDA 2Y1XA 4AT1A 1DX9A 4C7VA 5AVQA 3SEFA 3RB8A 1Q46A 4GRIA 4NMHA 4EFMA 4DADA 3BDIA 2FEAA 4OXKA 5B36A 5JYCA 3TIXB 1EEXB 1NP6A 4CCHA 3QMVA 3RRHA 3MYYA 4P4MA 3KPWA 1XTBA 3QHQA 4ASUA 4GYJA 1OH7A 4K26A 2NO5A 1QPGA 2E4AA 5TS2A 3HJEA 2EP8A 1TMGE 5JXHA 1N6OA 4O25A 1OYOA 1R6XA 2Z8YA 1I7PA 3AU8A 5BY2A 5GONF 4FMDF 1WMDA 4BFXA 5C8YF 1IULA 1UKAA 2ZATA 1OU4A 4E15A 4C6RA 1EWRA 3D7SA 3OLCX 2IKSA 5IX8A 4F4KA 1FS5A 2EZXA 1OAOC 4LTNA 2A5YB 3OLVA 4D5EA 1DXYA 4JK3A 1BEUB 1UDWA 2R1UA 4WY8A 3EXFA 3V6JA 1L3VA 4MVJE 1KPGA 3JQGA 3G23A 5K8UA 5FI3A 1N5KA 3LE8A 3NOQA 3JARB 3I34X 2SKCA 4HN4B 3DUFB 1KGDA 2IXBA 3SIWA 1ZIPA 2HJSA 1FEZA 1F1BA 1BRMA 1G7CA 2W6JA 2X1HA 1NXPA 3QV1A 3R7DA 1W7AA 1HX7A 1RQPA 1XDZA 1Z6TA 3RFUA 3N70A 1KQ3A 3QVUA 1JG6A 4H1WA 1W1WA 3I83A 1RLMA 1UBMS 2C5BA 1ZQWA 2KOBA 1E2JA 1WW8A 4RIEA 3HCWA 4BO1A 1T8RA 3MR5A 1M7HA 1X3LA 1YJQA 3D8HA 1NVTA 3MLBA 3V4LA 4TWJA 3AF0A 4LFAB 2AK3A 2D59A 3CXRA 1TW2A 4DSIA 1YCGA 3NJRA 4IDDA 3ZIUA 3AV3A 1N3LA 3N2NA 4DG5A 5AI0A 1NNSA 3DZ8A 5JXIA 3BBPA 5KTSA 1LA2A 5ALQA 2YQZA 4HQNA 3PC3A 2XRYA 4YRTA 3IEIA 3IPXA 5IJAA 5A1TA 4WNIA 4Y9RA 1B23P 2I7VA 2W2OA 1R6AA 3NTQA 5C8ZA 2AYYA 4YRAA 1P9WA 3P5SA 3MXTA 3V48A 4L16A 5KFTA 4LFBB 3MUFA 4MFAA 4WXMA 3KUDA 4DOAA 1Z2EA 4DL9A 2DJIA 4INZA 2A1JA 3OIYA 2VJDA 3SJBA 4UTXA 3LT4A 5HKBA 4Q3OA 2LNDA 3F6EX 4DVJA 1UBTS 1YR9A 3EDMA 1F44A 5ALHA 3BFKA 1ACMA 1WB4A 1JR3E 2I4TA 1J0BA 3HA3A 2X0DA 1Q6ZA 3CVUA 1A97A 3LWDA 5IMBA 3O4RA 4DR4B 1EWKA 5LZ7A 3HJNA 2NVOA 5T41A 2EGUA 2IZ0A 4LS3A 4AQDA 4ENRA 5G3ZA 3UPTA 3QLVA 2J0SA 2PRKA 3KOOA 4XJXA 1CB0A 3T99A 4E21A 2YQEA 8ICOA 3F9IA 5JYBA 5B1SA 5KSOA 3COJA 2E4XA 4YN3A 2J0UB 1OBHA 3OKAA 3R3HA 4OUKX 4TYPA 1P2TA 4N6NA 1KMQA 1JGTA 3IOCA 3DO8A 3RRJA 4CI9A 1T9AA 2VCHA 2V5UA 4WZBB 1E3JA 1P29A 1WMSA 3Q8PB 1E9FA 1P60A 1S2DA 3C6QA 2OHHA 1ZXIA 2W22A 3PHHA 2BGLA 2BDEA 4NJEB 5LDGA 2GT1A 3WLEA 1U6IA 1L4HA 4XUGB 4FR0A 2C96A 2FAXA 3DFIA 3E05A 4GM0A 4TPKA 3AY7A 5EJ2A 3D6NB 4B3RB 4F6CA 3KSMA 4DA7A 1UBEA 2X2EA 4L0CA 3ROFA 2MINB 3Q41A 4KG7A 1V9PA 4K0RA 4DL6A 1RWVA 1RXCA 1U3UA 2OB2A 3N8NA 1KFDA 1OMOA 4B8YA 3A9VA 3F53A 3TADA 1IIBA 4M1YA 2M98A 2Y1FA 1CP3A 4IR7A 4ZCPA 3UUEA 4BMSA 2FDXA 1N6LA 1Z4IA 3Q40A 2XNKA 2QB0A 1FIUA 4D41A 2CUZA 1Z7YA 3GR6A 4ZXPA 2ZB3A 4ON9A 2XGOA 1J0EA 4NU0A 2QMUA 2VTVA 1JLSA 3L49A 4FCVA 4G8JA 3BS4A 1YRHA 4GQAA 4MVYA 4OBXA 3PF9A 4DQSA 2MTBA 2CN1A 4K8OA 4NBVA 4Y6SA 2VJKA 4D81A 4RANA 4L78A 1NUUA 3TNYA 4D4IA 4ZT4A 4GYKA 4F96A 2NYAA 3BJRA 4QZVA 4FM9A 1QR2A 3DGFC 4BO2A 2WHPB 5CH8A 4DLAA 1KVSA 3RSSA 2X7XA 4BO5A 4BJ5A 2PM8A 1RJFA 4KX5A 1IE3A 1UZUA 5KL8B 2GD1O 4H7DA 4L02A 4MIOA 1WP9A 3ANMA 4R9SA 3HUUA 5DBOA 2P11A 3WIDA 3ZVNA 2V03A 3PQ3A 3RUHA 2GFIA 3GO4A 4HRYA 1WZ2A 4GBJA 1J24A 4KN8A 4V0RA 3OX4A 3PDHA 3WFIA 1ZOLA 1U02A 1GU7A 4MJXA 5A06A 4X6XA 2OT3B 3RUCA 5E7JA 4DREA 1E7RA 4MMZB 4FI3C 3R4VA 4KPYA 3PT5A 3MRSA 5BSKA 5KVAA 5HZGA 2W9MA 4URXR 2PU7A 4B46A 2BLNA 4OH7A 3SC2B 3K1RB 1RWKA 3HCEA 1S97A 2ZIFA 2EFJA 1GSOA 2PS1A 3GL9A 4QATA 1EFLA 2W03A 2FOXA 2JK1A 2Z1NA 2J59A 2KSOB 5L1IA 3F90A 4CKWB 3VRHA 4YPVA 3KAQA 2HB6A 3DBVO 4DZTA 4E6PA 2ON6A 1ND5A 4B7AA 1CC1S 2XTJA 4M9GA 1CJVC 2O5CA 3VYRB 1ZCFA 3AXTA 4GOMD 4TTPA 3PX4A 4RIIA 5C34B 1JQ5A 3SVZA 3L46A 3WFJA 3WB2A 1DWQA 2FHSA 1XP8A 4Q4DA 5F7OA 3OZ7A 2PCLA 2WNSA 5CDGA 3UN1A 4F3RA 3JYPA 4K2HA 1SIUA 1BHQ1 4KLCA 3F7TA 3VTAA 4BGUA 4YJFA 3WGKA 3KSUA 5CIQA 4G3IA 4RLFA 5HR7A 4BOYA 4LF9B 7ICPA 4NG4A 1RLTA 3R3UA 3KOYA 1F0YA 4E12A 1HMPA 5HFJA 5B1IA 4PG4A 1KKUA 3M70A 1IJKA 5K5EA 5K2OA 3FRIA 1VA5A 3OZCA 1HETA 1WQ3A 3RFFA 2R751 1LDBA 4R1SA 3T6KA 4A27A 2GFHA 1MO2A 2H31A 4I2HA 1J39A 1Q12A 2HU5A 2X0RA 2XCQA 3KYIB 3L8CA 4NCXA 3T4PA 3K92A 5EPEA 5BQXA 5J0WA 2HK8A 2RG1A 2J6TA 4KTVE 3HYCA 2G80A 1KORA 4D9CA 1SA0A 5C2JB 3V3KA 1Z68A 1WVIA 4IQWA 2VDWA 5L1LA 1JHPA 2YV1A 4MYCA 2IZ1A 5E79U 3FDFA 2Y1KA 1A69A 4O5AA 1ZQCA 3IP7A 2HMTA 3SZ2A 3MGKA 3INYA 2X4LA 4MZDA 2NU9B 1DUSA 3TCNA 4D43A 3TAUA 4P3NA 4KI7A 1ZMRA 4LGMA 4TV8F 2PRYA 1X94A 4JDUA 4CW7A 3ADBA 2IH4A 1KPIA 1JUDA 3R23A 1N25A 5LSAA 1KL7A 3GRVA 2B4YA 2H5XA 1P72A 2FHPA 4EI2A 2VO1A 3P8ZA 1CFZA 1OLSB 1QZTA 3STXA 4CMJA 2VTDA 3BXGA 3E18A 2DMRA 4WINA 5EAIA 3A0UA 4G9EA 2X3UA 1O2DA 3JR7A 2ZIZA 3SHQA 1OYVA 3SX0A 4WBNB 4F9FA 4G0OA 3ENZA 3JPRA 3OTWA 3NDRA 2HBYA 1N4AA 5JNLA 4OX9B 3D2BA 4HS4A 4UVHA 5HF6A 3VZSA 1UQRA 1ZRNA 1LDGA 1WEKA 2B8TA 1ZSYA 2QYOA 3K0AB 3ID6C 1ZQRA 2H8GA 3V46A 3CNHA 1QFXA 2J6HA 5CFLA 3DE5X 1J6UA 4Q4AA 5IC5A 1RYEA 3ZJYA 2YVUA 1AM4D 1P0FA 3PUYA 4NMLA 4QPNA 4LFCB 3KQKA 5C5IA 3KXLA 2CDRA 2ZJ2A 4J9LA 1ZISA 4ZEXA 2X0EA 4WT7A 3TYXA 4CFSA 4D92A 3L0OA 5JEEA 2WW8A 1Y6RA 4TV9B 1AA9A 2R1TA 2OORA 1RAIA 2ZKLA 2FZKA 4L51A 1Z82A 1X6JA 4PFSA 1CJKC 1PGPA 1VOTA 1DADA 2QNIA 4EZ6A 4DTIA 5LQAA 3AFIA 3QKRB 5COBA 2WFAA 4UU0A 1UBFA 2FQYA 4EFLA 5BYAA 3WYDA 4R8UB 2CDCA 2RHCA 2RJ3A 1Y8QA 3KEQA 1T0BA 4J0CA 4PFQA 4FGJA 4YY3B 3QOWA 4Q3CA 4GXTA 2XZOA 1W4BA 4BQNA 1EE2A 4DMGA 2H4WA 1PV1A 3U3KA 4US8A 5C7YA 5TPWB 1S4MA 1X87A 3MWJA 4IQ4A 1XT6A 4XGNA 2NXWA 4B80A 1DTEA 5CX4A 2VQFB 5K1ZA 2UAGA 1Y1TA 1RAHA 3PZBA 4EUEA 5AW7A 2EW1A 2HRZA 3VI4B 3T54A 2YX8A 3HN7A 3THXA 4QU0A 5FFFA 4BU1A 5K0CA 4GKJB 1HFKA 1H9BA 4CMAA 1EXDA 1SIWA 2O0KA 2I2AA 2ALJA 4M9LA 1P74A 1PFVA 1QOQB 2C9DA 3F78A 5C32A 4PEVA 2UUBB 1TPZA 1Y5LA 4A6DA 2NO9A 2FWJA 4M1WA 3ESDA 4QBIA 4EUHA 5KG2A 2EWVA 3ISBA 3KHRA 1SC9A 3TAQA 1NBEA 3GD7A 4MQ6A 3W6UA 5HRUA 2K4EA 2BTEA 3CX8A 9ICSA 5F4ZA 4DC0A 1B3BA 1Y63A 9ICGA 1R6VA 4XJVA 1J06A 5I4KA 1BW9A 2WU0A 2BCRA 2X13A 1KI1A 1V97A 5KTYA 3MTBA 4OSOA 5L3QA 2O6KA 1RSZA 3L1IA 1Z8NA 4LYEA 4X64B 1RC1A 4HN2A 3Q9LA 1RVDA 4BB5A 3AHFA 3MGHA 3Q2KA 2W6NA 1F4VA 2ZTHA 4L8LA 1WXHA 3KVNA 4S2EA 4DARA 3CZMA 1FQOA 1ZS9A 3ELUA 1ZJ5A 4DWWA 1KI6B 4GL4A 1GQYA 4EWLA 3F47A 4KIFA 3REQB 3ZVLA 2ZRIA 2GF0A 2Q4BA 4CR8A 1TK2A 4F93B 1V1RA 4EW6A 1FFDA 2ISSD 3HXPA 5CEEA 3EDOA 1KEVA 3GJXC 4YI3A 4MV0A 5SZHB 4NVRA 1Q1QA 1K75A 1VPWA 2Z6AA 3WB0A 1E6MA 5GVSA 3BWCA 3KTAA 3S7ZA 2JBAB 2YYSA 3EC2A 3L0ZA 1RZUA 4RZXA 4YRRA 3T7KA 1UDBA 1DCMA 3RJ5A 3ZQKA 1PZMA 2CLIB 1YKGA 3WIOA 2B7CA 2QN1A 2AOWA 2NV2B 4RZHA 4BEVA 1P8AA 1KJ9A 1QIJA 4QIWC 1HK7A 4O8ZA 4PFKA 1FDIA 2OSBA 5EJ8A 3UQYS 4BNKA 4UQGA 4D3DA 1ZJYA 2P1DA 5L7YA 3FTEA 2GBCA 2J5RA 4ZAFA 1Y8AA 1TQ6A 1X1QA 4UHKA 4ZCLA 3UUFA 3BQ0A 3EYWA 4JEIA 4E94A 4CDMA 4N12A 4I1YA 1Q5PA 3MNFA 3OPXA 3IM1A 2DF4B 4LF7B 1NPYA 4ZRDA 1ZM9A 4MINA 4ROTA 3TZKA 4G0NA 1SQ6A 5FUVA 2AJBA 3WMRA 1AS2A 4B74A 2WPDD 5EHGA 1Z74A 2EFDB 2ASVA 3WKCA 1RWXA 4BX3A 4BVAA 3U81A 1HM5A 4LZOA 1ZKMA 1IHUA 1ZH6A 3GCDA 1HE5A 1M0WA 2ERCA 1JTFA 1HKHA 3JPNA 4KR7A 2FCRA 3VYVA 4BQEA 4RZUA 4Y67A 3D8RA 2DHEA 4N8SA 3RRFA 2OEPA 4OAOA 1Z4LA 3F97A 4CIYA 4X44A 1JA9A 3F7OA 1Z22A 4F4XA 5ED4A 1TQHA 1Q0TA 1N7IA 3H1AA 2P4HX 4DEXA 1G59A 1F9EA 2BDUA 1R37A 4RDIA 5T3UA 4YX9A 1X0XA 3AK4A 1P0CA 1UDRA 3GU3A 1DB3A 2JJ2D 1GTZA 4BV3A 1A3CA 1OBOA 1GAJA 3GJYA 3I9MA 2OLEA 3NWPA 5LZ8A 4AMYA 2WF9A 3NEJA 2J30A 3WI7A 4F3NA 4BWGA 3IRUA 2BI8A 3R0IA 1M67A 2QTVA 2QD4A 4NY8A 3OPYB 4LCJA 1E20A 3NMUF 6REQB 1VZ3A 2DWUA 1A9QA 4YBRA 4D74A 1GTVA 1MEOA 2IZZA 5FLYA 1KFEB 4V1CI 1TU0A 4N8EA 3L7NA 1DQPA 2ATVA 3EVCA 4YUZA 3CZ5A 1T8UA 1EWVA 2W43A 4DW8A 3K9BA 2ZM6B 4X1KA 5JWHA 1YQXA 5EHZA 5IW8A 3QPVA 4CRWB 5ITWA 4DDKA 4KAJA 3UGKA 1WQ1R 4KXQA 5HR6A 2Q27A 4RFSB 1NXVA 2IIPA 2JI7A 4PCVA 1GYQA 2RH8A 4H7JA 4LJ8A 3RODA 3ZZTA 3GARA 1I01A 1EEHA 4W5WA 5HCUA 1NG1A 4ZJZA 2ACEA 5EKTA 5JCJD 4NJMB 1SKQA 4XJTA 3TW4A 1WKBA 1GN8A 3OSNA 1JVSA 3CJRA 3H84A 4FCWA 4FZNA 3N2GA 2FQQA 3LLMA 4M54A 4BLVA 1B41A 1X7WA 1CJBA 3WMWA 4ER0A 3PHIA 1QQAA 4AKSA 1Z0KA 2JARA 3FTQA 4QZIA 2P27A 1M6YA 1ZBDA 1Z8HA 5ALXA 3FJYA 3LK9A 4J2TA 4URWR 5T6BA 3R75A 3UJ6A 1DC5A 4G41A 3NHFA 1WBBA 1QTNA 2IV7A 4M1OA 5J5CA 1DV1A 2WSSD 4IO0A 4EHDA 5AHKA 3GGGA 1KJQA 1NWHA 3A06A 3F5QA 4YI5A 1WMBA 1CEXA 3C5WP 5AVWA 5DHSA 4P5PA 4RD0A 3O4FA 1ZNYA 4M1QA 1RXUA 2YVAA 1J1ZA 5THKA 3OKCA 5J2DA 3NI2A 2HHTA 1EFRA 2P68A 2YASA 3MQ4A 3O91A 4BTLA 2XUGA 121PA 3A4YA 2DTXA 3SZLA 4Z5XA 4MA5A 1URJA 5TQ2B 3U4CA 4DS5A 3URKA 2O19A 4ZO4A 4F3CA 4M88A 1JHAA 8LDHA 5DWVA 3KP1A 4D45A 3I2JA 4RPYA 3TX6A 1IB6A 3EIFA 4U9IS 4CKEA 1V11A 1P39A 5CTJA 4PC6A 3F6RA 5BSWA 3DEYX 3P9RA 1W36B 2C5AA 4WXPA 4CV1A 1MJ5A 1XRPA 2JIRA 3D0OA 2O8CB 2UZ4A 1GOTA 2EVWX 1E59A 2YJ6A 5J8YC 4CQMD 3K0CC 3I4LA 2P1ZA 4FU0A 4PX2A 4Y2PA 2W98A 3ETHA 3LU1A 1W87A 3UJHA 4TUYF 1BPZA 1NXTA 1JI7A 5DN9A 4X3PA 1SG9A 5IJWA 4RDXA 2VBGA 2QTTA 1J8DA 4Q44A 3B1VA 4UM8B 4CTJA 4PLTA 2E6UX 1UAYA 3RYIB 2FUEA 2JD2A 2NXJA 4Y30A 4GEKA 4ZMRA 2IOYA 4FKMA 4M8KA 2E4VA 4G1MB 4BNIA 1E60A 1W88A 4XGQA 5AKIA 1EA5A 1UXHA 1Y7LA 4DT1B 4DBVO 1XTVA 2N46A 3A2MA 4LNAA 2YH2A 1C9JA 4C4TA 2FJ0A 1ZIOA 2ZYTX 3BWDD 3L4BC 3PICA 2R6CA 3ROZA 4CM5A 6GPBA 1U94A 3QELA 1NG9A 1GFSA 3C1UA 5IPFA 3EVEA 1KMNA 1RJ9A 4KO1S 4Z7JA 3V7JA 2I6XA 3VBCA 1GL3A 4FGSA 3KKLA 3ZGNA 4ENQA 4QWEA 9LDBA 1QAMA 4MEYA 2XT6A 3I9KA 1Q3UA 3W5DA 3C3EA 4GPIB 3ILSA 4IFEA 5ITZA 1G41A 1N2XA 1UC9A 4HWOA 5J40A 3I6BA 1B73A 3F7NA 3ME5A 4M36A 1S76D 5IXJA 1HH4A 1LK5A 4FZVA 4HKTA 2O8FB 1WDMA 4K9QA 5IAGA 1V16B 1DDGA 1CJTC 1E2UA 3LUDA 4PZUA 5BSTA 4DF4A 3GT4A 2HHAA 3KFVA 4W8HA 1BQ4A 3SI8A 2JLYA 2XA9A 4OMCA 8ICUA 3R7BA 4DR3B 2Z5FA 1S01A 5DDMA 3HVHA 3CVXA 1UH5A 2AFIB 3DL0A 2YWDA 3RK1A 1W34A 1HE8B 3LHFA 2GXAA 3FOFC 2BCGY 2G9ZA 2QRZA 3PEUA 4G89A 3REOA 5J0PA 1CZOA 3KJXA 3Q10A 1KKMA 5A4DA 3Q0EA 1DC7A 1AN9A 1GGFA 1E2FA 1THMA 1PG0A 3GRAA 3PUWA 4D96A 4DMUB 3E4CA 3WHIA 2H1LA 2R87A 4GLFA 4BLUA 4YV2A 1GRCA 2C5FA 2XOXA 4FHCA 5DSTA 4GPD1 5K99A 3BK1A 1QKJA 3DCNA 4MV5A 1U49A 2IPOA 4M6WA 2MSKA 3VJLA 3BORA 3SYKA 4MRPA 1ID1A 1JVBA 2LUOA 2RH9B 5A3SA 1R9GA 3AOEA 5DHTA 2PEYA 4DRZA 1GQSA 2RAFA 3TLCA 1D0SA 4PL1A 5TY0A 1OROA 5L3VA 2HBQA 4Q19A 3BDAA 2QLBA 3QX9A 5ECDA 3RS8A 4FSDA 3CTMA 2ORYA 5HTKA 4YCCA 1JALA 1JDNA 4RGQA 2B25A 2AMJA 4P4NA 1YH3A 3T3OA 3N07A 2ZBUA 4GF5A 2YFKA 3PQCA 2BE7A 3EBOA 2R1ZA 5FR1A 1W581 1SHJA 3TRDA 5E6RB 3AP1A 1UWVA 1KEKA 1ODFA 3NVWA 1RAGA 2ZSHA 4KR0A 3GFBA 3IVAA 3JWGA 3SPXA 3WGZA 2HJGA 4D8UA 3IAFA 3F98A 4TYMA 4MTLA 3M6MD 2A58A 5HHTA 1GRQA 3CUUA 4O63O 9ICBA 4KQMA 4XGIA 4BYMA 4DIMA 1VXOA 2R18A 2GASA 4F7WA 2JLVA 3CWZA 3L7LA 4MQEB 2GNPA 3LBHA 3MTAA 3DAHA 1P4SA 3IAS1 1NHWA 2AC4A 4O3NA 1AZTA 1H1DA 1LW6E 2RI6A 3L1JA 2UUPA 1XSEA 5LNK1 5TGTA 2UXDB 2QN2A 1Z5GA 5TF4A 1A9TA 5EIFA 2NMVA 4XASA 5DXAA 5EHQA 4ZYVA 4JXZA 1N5WA 3UMFA 4YEDA 5E6UA 1L4NA 2N1RA 2GBPA 3C5VA 1N5DA 1C9MA 2NV3A 1H85A 2XODA 2A14A 1JVNA 1FTSA 2JFPA 3QVGA 3T4EA 4O4IA 1NUAA 1RFLA 2P8SA 4PYIA 5A0TA 5L3ZA 1S8AA 2HNKA 3N8KA 1OFHA 3E0XA 5HGJA 3U80A 5IWCA 4P38A 4AZTA 1OAAA 3U2QA 2JKZA 3DKRA 5HM6A 2BWJA 4V38A 1DMSA 1NVDA 1PG2A 4HQ6A 1DOHA 5A9RA 3LPCA 4DUPA 1N6IA 1XA3A 2QZ9A 3ORQA 3L43A 4C4PA 3CS3A 4IHJA 4JV0A 1NVXQ 1SUDA 3D4NA 4PQFA 3KYCB 5ALEA 1U9CA 3AESB 1JH9A 3RTVA 2F77X 2ASJA 1E64A 4RJJA 5LQSA 2BFBA 1SBNE 2G82A 2R9VA 2KN7A 1QP4A 1A9RA 2Z5LA 3KT0A 1TYCA 1O5IA 2HNAA 3I2YX 4MV3A 4QLOA 1UPFA 4WA7A 4Y2XA 2H16A 2XYRA 5CK5A 4R84A 4BV8A 1N60A 2G83A 1BOOA 1ENOA 1KHTA 1PG5A 1T29A 2CFOA 3G49A 4NZPA 4EVSA 2ZJ4A 4Y1GA 2JGRA 2XX3A 4QTYA 2FUG6 4OJTA 4WBSA 3BGDA 5JAUA 4BRSA 2GCOA 3W1WA 2QVGA 3D8UA 4O33A 4KLIA 5KFGA 1N6PA 1A6SA 2IW1A 3A14A 4AIRA 3DEIA 4CTKA 3GD5A 4MUKA 1NDUA 2QBYB 4JJKA 4PM4A 2Q7XA 1N0IA 4RIFA 2KSOA 1HT0A 3QITA 3L0BA 4GOLD 1J2TA 5AKEA 2JNWA 3AEYA 2Y66A 4A1FA 1TC2A 2WMDA 3AUSA 1C5KA 1PO7A 2B92A 3LQ4A 1QP8A 4EDHA 5JSHA 5D86A 2P1RA 3IUNA 3RR2A 3BD6A 1B00A 1G5IA 1WXWA 3X1DA 2IS2A 1F3LA 2VI5A 4DLNA 1ZUHA 2ZW9A 5A3VA 5E3HA 2M6KA 4XYBA 4Z6CA 3C6XA 1I9GA 5ADVA 2AFRA 2CVQA 1EM6A 2O7VA 3MT8A 2CCJA 3O8BA 4JGIA 3ONDA 4PLFA 1KYXA 1U8AA 2IE8A 2Q1YA 2WZBA 3GI1A 4YK7A 3Q5GA 5J2HA 3TLXA 3UFXA 1DIGA 2DUYA 4FILA 2A9KA 3NTRA 1TYDE 4AULA 4DV3B 2ESEA 1CZKA 1UMCA 2IGTA 3R77A 2R7LA 4R7TA 4X9XA 1W73A 1JXAA 4IMJB 1GFIA 1R64A 2O8DA 2IHBA 3DFKA 4M3NA 4YCXA 2EJBA 3HHPA 4H3HB 4KFUA 2A0KA 4TROA 4J9UE 2C2HA 3C28A 2ATXA 4NEGA 5K51A 3ISDA 4J7UA 4ZHQA 2D1RA 4N1AA 4RW0A 4DQQA 3VISA 2H07A 3CLUC 4RQ6A 4AY2A 2J9FA 1TCBA 4YJHA 4ESEA 5L6MB 3ADOA 4H7HA 2V8BA 3QKIA 5EY5B 4Y2QA 2CLMB 4GXKA 3JQPA 2JW5A 1Y89A 2R8PA 4L95C 4PLVA 1QIGA 4LY0A 2WKQA 5MFPA 1N56A 1WPGA 3GHYA 3BXPA 4HLNA 1X1AA 4KW7A 4D9NA 1NN3A 2EZYA 1MNQA 1ZQLA 1BNPA 1FRQA 2GO1A 3C1AA 4ZCSA 1CY8A 1AGRA 5A5EA 1S2GA 5IILA 4MV1A 3AUJB 2H3VA 4LQLA 4ZI2A 1A8IA 3R0ZA 1XTRA 4CL8A 3E22B 4S0XA 4QE3A 2ZRNA 5KG1A 3C4QA 1BH2A 5EIBD 5EJEA 1NK6A 1DI0A 3O38A 4LK3A 3C3JA 3TIGA 3EBLA 2QKYA 3OT1A 1FL9A 4MUHA 2QT9A 2AFHB 4AF6A 4J3NA 4D9KA 4DMMA 3GPDG 1XZBA 5BYKA 1L5OA 2VXOA 3LGSA 2H6EA 5EZ5A 1QOZA 3NV9A 4UHDA 2MSNA 4AZVA 3NWEA 3BF7A 3QW4B 4A8JC 1N9GA 1DPFA 2QUHA 1E6CA 1TM5E 4U2BA 3K32A 4B33A 4PRLA 4N3NA 1J70A 2BELA 1LCIA 1ZINA 3GXOA 4JWTA 5NLLA 1EVZA 3PMLA 2RIPA 4KLFA 1YFJA 1VCNA 1X40A 3BE8A 1NW8A 1E3IA 3G82C 1BRTA 4G0VA 1E1CA 2CJYA 4KQ2A 1C3LA 1W6UA 2HCJB 3QY0A 4GRAA 4O4IF 5SZKB 2OBXA 3ROKA 2VT7A 3A9TA 2VRCD 4CQLA 3Q8KA 3CF2A 1NBIA 2W6PA 5TT1A 2VUTA 4RF2A 3RIYA 5J2UB 4N48A 4D8TA 1KFJB 5DDYA 5JWOA 2J3IA 5EMKA 2XGMA 3UK0A 3WADA 1WXEA 3BQMB 4C0LA 1Y5IA 3Q5EA 1FFAA 3OD5A 4UU7A 4XPZA 3P0IA 2XY5A 4CR6A 4D4LA 10MHA 1ZQNA 1Z2OX 2GZ1A 4QARA 1YKSA 4REQB 2AEJA 4GR4A 4PZAA 2QT1A 4UVIA 4ZJUA 2ICAA 2C94A 2GKOA 1C0KA 2B4KA 4KTTE 4V0KA 4JBWA 1T8TA 5CT5A 2G07A 1YUBA 2AG1A 3V8RA 1U1EA 3C29A 4DVGA 2EP7A 4HZGA 4J75A 3LF2A 5FWXA 2NPIA 4EK9A 3ZCTA 1JPVA 1WSBA 1QB8A 1RQ7A 3AGQA 2VT3A 3D2SA 4TRJA 5I7OA 5THQA 3C3XA 2DH6A 4HNGA 4Z1MA 3U56A 1RLJA 3D8SA 2BFWA 2QQFA 4M9NA 1O96A 5EP3A 4JYCA 2HT1A 1JQ3A 2JL1A 5GWXA 4QWAA 3O4GA 4HR7A 5KSZA 2R0QC 5AI8A 1MB9A 2P3LA 1E3EA 4UBNA 4ZOBA 5JXGA 4RE5A 5D49A 5BR7A 5JH7A 4OHYA 3IAEA 1TT5B 1U7WA 3I53A 3L1VA 1EDDA 1BO6A 3FAKA 2D1SA 3QFRA 2X1VA 4DL3A 2BTQA 5B6PA 1D8BA 1URPA 2NO0A 5IZCC 3R8FA 1E3SA 2A9PA 1UMBA 3QI2A 1C2TA 4E2ZA 1N5IA 5JIBA 3V97A 4QXQA 5DT9A 4KNWA 5JY1A 1VKOA 5JJBA 2I66A 3N0RA 4JUZA 1OXXK 4L57A 5B5EU 1MT0A 3AY0A 1JEJA 4BFSA 3QEMA 4BUZA 2WK1A 3KU1A 2XBUA 4YS6A 2ZCUA 3VPCA 1COWA 4DA8A 1UBSB 3T7EA 5UKDA 5CNKA 1FFVA 1USKA 1VJDA 2IE0A 3I0MA 3JWIA 3U0VA 4B40A 3WOHA 1J20A 3IOYA 3LA8A 1HUOA 1X7ZB 2V4RA 3B3AA 3CNQS 3MAJA 4FMCB 5DLQC 4DA4A 2W6OA 1GG8A 2WUFA 4K0KB 5TRTA 1CR4A 2P9FA 3IE1A 4X94A 4P4TA 3QF7A 5B1DA 1KZYC 1AX9A 4O4JF 3SQDA 2YCLA 4LC1A 1ZQVA 1DAHA 4G0ZA 4YRIA 1SV4A 3DE7X 3ETCA 1CFJA 3I0NA 1GTG1 4LOKA 4IGEA 2WUVA 4K87A 2HEGA 3AHDA 1B93A 1N6RA 3EAGA 2PX8A 3KEFA 4IFBA 4IGKA 1N2IA 2C8KA 4BUJA 4KWCA 1L5HA 2OESA 3RR7A 1YQDA 4OK5A 3UNXA 1ZD2P 2Z6VA 4WNAB 4ZVVA 1WG8A 3EXHA 3QBTA 4DM3A 5A1JA 3R7WB 3P7MA 5J63A 5KG0A 3WV4A 4LEIA 5IVIA 3N6VA 3ZZNA 4P3PA 2JGDA 2P6NA 1XHFA 2VYQA 3Q88A 3IR7A 5B30A 3G6KA 1HTBA 3OT1B 2PLWA 1PT7A 5A0VA 1I1NA 4B9EA 1PJAA 2YWCA 2IUTA 1I33A 4GR5A 4IKOA 4MV7A 4PLZA 1IG3A 2YYZA 3OPQA 3QA3E 2HL6A 2JFFA 5CD9A 3EEQA 5T8KC 4TYWA 3GMDA 2IKQA 3DMHA 4EB8A 2PR7A 3H3XA 3PC4A 5FQNA 1PZHA 1V9SA 4Q7LA 2IYAA 2Q4OA 2Q5HA 2RCYA 3G68A 2WFMA 4KQ9A 1ZJWA 4MCHA 4AMGA 4EELA 5K6TA 2JJ1A 2W8ZA 5J5AA 2ZJZA 5AHOA 1ZICA 2V58A 3ZY3A 1TVMA 2JLAA 3BTVA 3BQ2A 1GCAA 3H5AA 1HZZA 1FTWA 2KLHA 3MTJA 4NPHA 4JI6B 1QB7A 4N40A 4YC7A 1IJEA 5JNUA 5K05A 3WGIA 3J7AC 3KVRA 1BJRE 3MCZA 1ZQBA 4NOJA 5FF9A 1I30A 3L8YA 3AF1A 4OQ4A 1M3SA 2JGKA 1EJ6A 3ZY4A 1T8SA 3LOUA 2RI1A 4DMFA 3H11A 3GEMA 5K7SA 2QTWB 4K9MA 2O54A 4WLUA 4HDRB 4WCFA 2PIDA 4WLFA 1NZJA 2CNBA 2XV1A 3IP6A 1XR3A 3DULA 3ES9A 2YJNA 2FQXA 3E58A 2F6RA 3PL1A 2BPOA 3CG4A 3BRWD 3SVTA 1XPJA 2ZS8A 5IIKA 2FPGB 4Q39A 1NATA 2ZJYA 1JR3D 3KQQA 4HYYA 4DSJA 1X13A 3L4JA 3STHA 3QU4A 1NX9A 2PFKA 3ZU2A 1DRWA 1PHRA 1EFCA 4PO3X 5KWVA 3RJJA 3LDFA 5I7FA 2FQ1A 4PICA 3Q3IA 3QEKA 1BKYA 2DQSA 2J85A 4C4XA 3UAOA 2QENA 1DRGA 3BCRA 1PAUA 2JH8A 3NBYC 1QCZA 4MW9A 4MW0A 2AF3C 5IDVA 1VIDA 2C9MA 3DDSA 4DA9A 2REQB 2LYHA 1EK2A 4GECA 3L04A 4UNIA 5DU2A 4C2BA 3H4IA 2P67A 4BRUA 4O1MA 3T7IA 2B78A 3W06A 1RE0A 4ZIRA 4XX0A 1A4UA 1XK6A 3EG5A 4NATA 2GARA 1K7FB 3O21A 5IU6A 2V6FA 3FHJA 4JODA 4TS4A 5IEBA 2GRUA 1E0DA 1M6EX 4MKRA 2P2ZA 4O1IA 4PZCA 1SZJG 5K3EA 1YFLA 3MGVA 1BDMA 2EGHA 3Q87B 4DCSA 2GK3A 5ECYA 4JQYA 2XVYA 3E3MA 3MFQA 3TOZA 3K0BA 4KNVA 4UHBA 4IQVA 3LT1A 2BBWA 5JCJA 2OKCA 4URFA 1F7VA 3EVNA 2WHRA 1NA5A 4HC4A 1XKTA 4W5HA 1N2GA 3RV3A 4H59A 1PEAA 4WRRA 3SOZA 2HA4A 4QXRA 1R9MA 1M5UA 3ORSA 3OJ0A 5AXBA 4AO8A 4BP9A 5JSZA 4CM1A 3FUWA 1W36D 2HPZA 3AEVA 2D2XA 1W0KA 4EFNA 2RHWA 4IGFA 4JASB 1NLFA 1U81A 3E22A 1YVEI 4U1RA 4RZ3A 4OYLA 4R65A 1M1NA 4WXYB 1S3GA 1ZSNA 2VJOA 1T2VA 2V6JA 1MO4A 1PR3A 5LWHA 5J0RA 1V1MB 3R9IA 5KWSA 1VM6A 3EH2A 5P8WA 4BQIA 1QF7A 1EZZA 2PKYX 1IG6A 4TMKA 3WKDA 4L2IA 4BWYA 4BECA 5CG2A 2HU2A 4I4NA 2IZ5A 2ZUUA 4ZD6A 1JXLA 4OXRA 4KAFA 4YCJA 5H0IA 2QV0A 1GU1A 1V3TA 3LFHA 4J16C 4EEZA 1RKBA 1I2BA 1II8B 2D2FA 3CYFA 3FXAA 4FEAA 2I7DA 4XQ9A 3UTCA 4UTNA 2YB1A 4XSVA 4JT2A 4D9MA 5BWCA 3F2VA 3DG9A 3JX9A 1YQQA 3EZLA 1VYUA 1YRAA 4UTOA 4JOSA 3CMMA 4M1KA 5AJUA 3ZEIA 4YLYA 2J46A 3D2NA 3G8AA 3HJTA 3N7TA 3UZUA 2XZLA 4JUIA 1MNAA 4K6HA 4XARA 5J0TA 1NN5A 5BYJA 2GQ0A 3NT4A 1UQVA 1KAOA 1Z2DA 3HCFA 1QO0A 3O2QB 1CYDA 5LU8A 4GOXA 1O4VA 2Q1TA 3CEHA 3KWFA 4I2JA 3T5HA 3MRVA 3TPCA 5TE9A 4E2FA 2Q46A 1JR4A 4HEHA 4G0QA 5GAJA 1FLDA 4LVUA 4TZTA 4F2PA 2DQYA 3HBLA 3PSTA 4OKSA 3HO8A 4JI4B 1ODTC 2EW2A 1EFAA 5GONB 1Q2XA 2KKVA 1EGAA 3L8ZA 1FUKA 1D1SA 2XUPA 4S1WA 1JLLB 4G9GA 3KKMA 2A9OA 1D0IA 3GIMA 4FGUA 4RQTA 5I7UA 4F4ZA 4IIFA 2NM0A 1SG0A 1CLEA 1W5TA 3SVLA 5DNYB 2NUTA 1VMIA 2W48A 2BW0A 4G23A 1XTSA 5JADA 5TLSA 1YACA 2QUZA 4CT5A 1U9LA 2WHQA 1EB9A 1CQJB 2A9RA 4O2BB 3HWRA 2P62A 4MI9A 5K0FA 4A8EA 3NIFB 4J0IA 2HWWA 4RAOA 3ANLA 5LOVA 1WULS 4L6IA 4TXMA 1YU6A 2D8AA 3DOFA 3UXHA 2PUBA 2P79A 1QCCA 5EWEA 3COWA 2JFNA 2KZZA 1P62B 1Y5NA 1P5FA 1Y7TA 2D2VA 2H5LA 3Q7PA 3RT7A 1QDUA 4BGEA 4ZCMA 1MW8X 3BC1A 1VBKA 1SV0A 1H2RS 2A33A 3JZAA 3OJCA 5G2OA 1T0HB 4Y98A 5H70A 3KTDA 1LLUA 1N1DA 2B6NA 1G7TA 2GXUA 2W2TA 4MV6A 4MVJA 1U4SA 5IF9A 2P8JA 2BRUC 1N1MA 3M3HA 1WS6A 4KE9A 4GPBA 1ELOA 3FNBA 3GV0A 5A04A 1OKKA 4EHHA 4NYMR 4CKXA 2PS3A 2ZE6A 1GG2A 4BMZA 1XJWA 3CH7A 3MWLA 2XF8A 3OCVA 4H16A 3RABA 1C2YA 1HE1C 3DKVA 3L84A 3NV7A 3CNEA 4O29A 4Y2HA 8GPBA 5IVPA 4I55B 4O2AF 3NJ4A 4TTRA 4HGRA 3EY9A 4JELA 2GEKA 3VTKA 4H7FA 3LUJA 2EV9A 3DDWA 4B81A 4NX2A 3LWZA 3I28A 2ATLA 4HTFB 4YCSA 4UQLA 1MAHA 2BE9A 2ZRPA 3ZLBA 4QW8A 2B69A 1OB2A 5AVRA 3K70B 4GIBA 3I4CA 4MWBA 5F3DA 3HRHA 2GAAA 1A77A 3D3JA 2E4YA 5JU5A 2XYQA 2YZ2A 1IHPA 3FDSA 1XTPA 4XWYA 4Z3OA 2Q3EA 1R5NA 3VPGA 4IHJF 3DS8A 1Q84A 5EJMA <