3R9KA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, glu47asp mutant complexed with sulfate, a closed cap conformation
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
227
structure length
227
Chain Sequence
GSHMRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHDGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative beta-phosphoglucomutase
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 83
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3r9kA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3r9kA01
4HAIA 1L7NA 2PQ0A 3OCVA 2ZXEA 2IOHA 1F5SA 2OM6A 1Z4MA 1S8OA 2YY6A 5AVYA 4CF4A 3HLTA 3S6JA 5ALGA 1LTQA 4MUMA 4AS3A 3M9LA 1Z5UA 5AW0A 3AR5A 3ZTWA 2R8XA 5AVSA 4HGPA 1FEZA 5ALHA 3CNHA 3U7HB 1RDFA 3W5BA 3FM9A 3KOOA 4UAVA 2ZG6A 2IYEA 5AIBA 3QUTA 1YDFA 2YJ5A 2R8EA 2NYVA 2FPWA 5AKHA 5A3RA 3VAYA 3HYCA 3ZW7A 2EAUA 1YS9A 4EX7A 3N1UA 2GMWA 3W5CA 5ALOA 3FZQA 3QU2A 5AI9A 3OCYA 4EENA 1U02A 2HSZA 4UAUA 3ET5A 2QLTA 1ZJJA 4YH1A 4B6JA 2HOQA 3E58A 3KBBA 3BWVA 3AR7A 4HYTA 1L8LA 2GFHA 3AR6A 1WPGA 1Z88A 3ZVMA 1YMQA 4OD0A 4UW9A 1YJ5A 2ZBGA 1NF2A 4JDPA 3NANA 5AHXA 5AK4A 4CF3A 2WF5A 4DCCA 2Q4TA 3W5DA 3QYPA 1QH9A 2MSNA 1AQ6A 3ZTYA 1L8OA 3SLRA 5AI4A 4CE6A 3FPSA 3QNMA 4XE5A 5IS2A 5T41A 3OCWA 2W11A 3WK4A 2I33A 3L8HA 2MU1A 2B1QA 5AESA 4FE3A 4XQ0A 5ALRA 5AVWA 4I9GA 1RQLA 4EZEA 2WFAA 5AIAA 4YIHA 4Y2JA 2WF8A 5ALTA 2IOFA 3U26A 2B0CA 1RKUA 5ALZA 3AR4A 3WK6A 4Y2YA 2YJ3A 4UMVA 1WZCA 1RLMA 3I1YA 1EK1A 3UMBA 4ZEXA 2ZBFA 3SMVA 1Z4KA 4UU1A 1TA0A 2CFSA 3N07A 3CZ4A 2B8EA 3U13A 4G63A 2HHLA 5AI5A 4AP9A 3F9RA 2C8LA 5IT0A 1U2SA 4UATA 2YMQA 2O9JA 3J7TA 1T5SA 2AUTA 3SD7A 4Y2VA 3EF1A 3W5AA 1Z5GA 5ALEA 5AM3A 1CQZA 3NALA 4PNHA 2YMPA 3WK8A 2C88A 3L8FA 3GYGA 3ET4A 3QXGA 5AK5A 3QUQA 3L1VA 3A1CA 1TJ5A 3DNPA 3WK7A 3I6BA 3B9RA 2Q5EA 2B1RA 3ESRA 3ZX4A 4Y2UA 2B82A 2WF7A 2P69A 4BX0A 1QQ6A 1EK2A 2WM8A 5ALFA 3NAMA 5ALSA 5AW9A 3L8GA 2B30A 5AVUA 3A1DA 1U7OA 3ZI4A 4DFDA 2YMLA 2W4MA 1T9ZA 2YFYA 3WKDA 4KX5A 5AI8A 3DDHA 5AW1A 4HGNA 3OPXA 1RMYA 2C9MA 3EPRA 4E88A 1ZRNA 4L6AA 4MWOA 4NWIA 4Y2SA 3AR2A 5AW2A 2O2XA 3ZUPA 2NO4A 1N8NA 2FUCA 2HI0A 2IOFK 2YJ6A 3L0CA 1J8DA 4AS2A 1Z4JA 1ZD2P 2YBDA 4BEWA 4C4SA 1ZD5A 3ZVNA 2HEGA 2Q4RA 2JAOA 5ALLA 1L6RA 4UU0A 4EEKA 4KN8A 3ED5A 2HF2A 3E84A 3WK5A 4NFLA 3A1EA 3R4CA 2G07A 4YIKA 4EX6A 3N28A 5AVQA 2I6XA 5AM1A 2AMYA 5AM5A 3NASA 3U19A 2JAUA 1Z4OA 5AM0A 4HGQA 3L5KA 1N9KA 1ZRMA 4JB3A 3ESQA 3NUQA 3QLEA 3AR8A 3UM9A 5ALNA 1KYTA 3ZWKA 2YN4A 3L8EA 4L57A 1PW5A 4NAVA 4Y3UA 1JUDA 3KZXA 2AH5A 5A3SA 2YMMA 4UMDA 1J97A 1LVHA 1RRCA 3WKEA 2CN1A 3WGVA 4CNQA 4ZEVA 5AKXA 4FFDA 5AKYA 5ALUA 1RLTA 3U7EB 3DV9A 1SWWA 2QYHA 5AM2A 3FPBA 2GHTA 3QU5A 3RF6A 1X42A 5ALKA 2IA5A 3K1ZA 1RPZA 5AKEA 1YNSA 2PKEA 4KYTA 4Y2RA 3WKCA 5AK3A 2WF9A 3EWIA 3I28A 3BA6A 1S2OA 5AKZA 3FGOA 4Y2QA 3QUCA 5AVRA 3KDPA 4UMEA 4L6CA 3NIWA 5AVTA 1K1EA 3OCUA 3UMCA 4BNDA 2YJ4A 2AGVA 4RETA 5AVZA 4BBJA 5ALIA 4IG4A 5FP0A 1U7PA 1SU4A 3MN1A 5ALXA 2EARA 1Z4LA 1L7PA 4OFZA 2W43A 3AR3A 5AICA 3QU7A 2C8KA 4C4TA 2G0AA 3IRUA 4G9BA 1Z4QA 3WKAA 4BX3A 2JAWA 4GXTA 3I76A 5AVXA 4J2TA 3E8MA 1Z4NA 3R9KA 1RMQA 4KX3A 1XVIA 3SHQA 1WR8A 3QGMA 2FPUA 2RAVA 1RLOA 3OCZA 4CF5A 2P9JA 2JGAA 5AKJA 3OCXA 2I7DA 3SF0A 4H1WA 1ZS9A 4BNDB 4F72A 3L7YA 3WK9A 5AM4A 1VJRA 2I34A 5AW8A 3SKXA 3QU9A 3ZU6A 1SWVA 5AW7A 2GO7A 1ZD4A 4BEVA 1CR6A 2ZOSA 5AW3A 5AI0A 5ALMA 5ALPA 1Q92A 2HX1A 3KC2A 1O03A 3L0BA 2P27A 4YGYA 1NNLA 3QUBA 1IWOA 3FVVA 1VJ5A 1TJ3A 1XPJA 2HO4A 4HGRA 2FPSA 4BYGA 4BX2A 2HCFA 1QQ7A 4IFTA 3PCTA 2G80A 3ZVLA 2CFRA 3IJ5A 1RKQA 4XPZA 2OA0A 3WGUA 5AKKA 2ZBDA 1L7OA 4YCMA 1RQNA 1ZD3A 4OCZA 3D6JA 1L7MA 3QX7A 5AK6A 1Y8AA 2X4DA 4UASA 2FPXA 3B9BA 2G08A 1MH9A 2B8JA 5ALJA 4Y2TA 2HF7A 4OHFA 5AW6A 5ALQA 2D2VA 5ALYA 1NRWA 4KNWA 3MC1A 4UM5A 4BKMA 2BDUA 2FPRA 3QU4A 3P96A 3IB6A 5IT4A 4I9FA 5AVVA 3L1UA 1U2TA 5ALVA 3EF0A 1Z4PX 2GHQA 3PDWA 2DQSA 2RB5A 2FUEA 3A3YA 3ONNA 2I55A 5AKGA 4QQFA 5JJBA 4YCLA 5AI6A 3MPOA 4Y2XA 3L0YA 5A3QA 1T5TA 1Z4IA 3NRJA 3N5KA 2R8YA 2BDEA 2WF6A 2ODAA 3ZWDA 5E0OA 3R09A 2FI1A 4UM7A 4Y2PA 2ZBEA 4NABA 3OTQA 1VFPA 2R8ZA 3U7GA 5AKIA 3DAOA 2EATA 5AW5A 2FEAA 3WKBA 4O8CA 3SKYA 4UMFA 4KNVA 1WVIA 1YV9A 1QYIA 3ZX5A 4UARA 2JARA 3U7FB 2G06A 2OBBA 4DWOA 4FYPA 3UMGA 1Q91A 2BY4A 1QQ5A 2MU2A 4J03A 2C4NA 1TE2A 2NO5A 3M1YA 2RARA 2FDRA 3PGVA 4GIBA 2CFTA 3E81A 4C4RA 3MMZA 4YCNA 1O08A 1RC8A 1XP5A 1RMTA 3KD3A 4RESA 5ALDA 3TLMA 3RFUA 4ZEWA 4DW8A 3B8EA 3PGLA 1TJ4A 2HDOA 2P11A 2WHEA 4EELA 4QJBA 1RKVA 2PR7A 2OYCA 2VKQA 3AR9A 5ALWA 2G09A 2G1AA 3N8GA 5AKLA 2RBKA 4HGOA 4F71A 1ZOLA 4XOUA 5AW4A 4NV0A 2I54A
chains in the Genus database with same CATH superfamily
3TI9A 1F5SA 3ND7A 1NZDA 3TJZA 3GRCA 5EMNA 4D1YA 4WZZA 1PWZA 3QEMA 4LJ4A 2O8BA 2FZ4A 3E7XA 4W82A 1DIGA 3GBPA 3CIFA 4BJ1A 4EUNA 4TMYA 3WGTA 4A4DA 4OOEA 4EP1A 3WB9A 1CE8A 4I8DA 1G5HA 3LC2O 4GMFA 3PX6A 3H87A 4CMEA 5CA0B 4MRMB 2VK1A 4ZQHA 5H68A 1KETA 2TRSB 5L53A 1NMEA 1UC8A 1LSSA 2EGUA 3GLFB 2ZYUX 4RJKA 3VPAA 1NBOA 3FWNA 5J4VA 1G4HA 4RKYA 3LUAA 1W29A 3QVLA 3C8ZA 3EPPA 2OXIA 1EG2A 2GBLA 1EBUA 4C1BA 2WJGA 2AFHB 2A1TR 2ECQA 5H1YA 1Y33E 1XJQA 4MO2A 1M67A 1HOXA 1EMDA 2PWZA 1LNQA 3SVZA 1JTVA 3HYNA 1Y34E 4BU0A 2DAPA 3N75A 2VPZA 2PL9A 1NIPA 1YA8A 3QUQA 4Q4AA 3ZCTA 2YXEA 2E5WA 3TQFA 2ZREA 3ANSA 3F4LA 3FD8A 3TLJA 3EZYA 4JN6B 1RWQA 2M9MA 4FFOA 2OV1A 3NDPA 5HQ3B 2XZTA 2XTNA 5FUQA 4WX2B 4NZMA 3S7ZA 1GXSB 1B73A 2HEGA 1MV5A 4CEIB 2P41A 1G7CA 3L6DA 2P90A 2QUKA 4PWYA 4RPZA 3K16A 4EWLA 1XHFA 4N6GA 3G0HA 4EZ9A 4GKBA 2J3LA 4D3DA 4W8HA 5KTYA 1NNEA 2GK7A 5DM4A 4HN4B 4MUKA 1ZRMA 3JARA 4M0DA 2NSDA 3LKDA 3AIOA 4JBXA 2O5CA 3O1LA 5HMMA 3C7AA 1Q57A 1OU4A 2CVHA 4IXDA 3P2OA 1PQUA 4DADA 2WD7A 4D02A 4BMSA 3EGVA 5CGZA 3SHVA 2I2BA 2IA5A 5FUVA 4H18A 4H6VA 4YJHA 4F45A 4JVLA 2D59A 2HBKA 1MW9X 2WSSA 4RSHA 1Z38A 3NCTA 2CPRA 3AONB 4K3UA 1K98A 2O3RA 4A6DA 3MWEB 4KQIA 1YJAA 3LT4A 4I08A 3O3NB 5LZ8A 3GG2A 4BU1A 1M0EA 1V48A 1KFTA 4HG2A 4G81A 5JC8A 3I76A 4DL2A 1LJLA 5EP3A 3RABA 1IXSB 1V38A 3A36A 5BVGB 3EVBA 1WWUA 5KI6A 5EPEA 4BAUA 4X93A 1YBFA 5JSUA 1ZD4A 4GYKA 1M54A 1T2CA 2VF8A 2ZOSA 3ONWA 3MUFA 5HK8A 5SY9A 3RUPA 1L5HA 5I9SA 4OSPA 1TKRA 3O8DA 3GEMA 1N34B 4GT1A 2VFAA 3E22A 4DV3B 4DLAA 2V7UA 3GA5A 1F17A 4PFQA 5B4TA 2FMSA 2QRHA 4TRNA 3UMSA 4IYJA 1KHTA 2IZ1A 4KIFA 2HF7A 4WVFA 3N97B 2OXRA 5ALVA 4O25A 2PJDA 1ZQNA 1Y89A 4H7HA 5DH9A 1BFDA 3GFRA 4BMOB 3CO5A 3GXOA 2NYRA 3IMEA 3F2BA 4WA7A 4NCBA 3HKCA 2J1LA 2E5LB 3JYOA 2FR1A 3AV3A 1SZHA 3RC3A 1V35A 4FYPA 2I3ZA 3WLMA 1I3OA 3QXCA 2MHCA 3MGIA 3PC8A 4X41A 4DGQA 4KN4A 2DUJA 2QORA 5JEDA 1W0JD 2O7VA 4XI9A 2C57A 5EE9A 1E2QA 1LV8A 1SCQA 3WG9A 1VCHA 4C0SA 5T64A 3V4RA 4RXUA 3GA0A 1W5AA 1TD9A 1SCBA 4U8GA 4L02A 3AW8A 5KL1B 2D8AA 3BE8A 2KMLA 4YK7A 1OB5A 1T1EA 4PC7A 5AJTA 4CL0A 1H6AA 4JUAA 3U1BA 2BZ1A 2PUWA 1PR1A 4Q03A 1KBZA 3C3KA 1Z74A 3Q2OA 1Y4DE 3LY9A 4F04A 2ETXA 4LG1A 1XE3A 4HB2A 4BXOA 3T5AA 1JSZA 3ZU2A 3GPLA 1AE1A 2QXTA 4HYKA 4ECXA 3SQLA 3CGWA 3O75A 3DMTA 4I1VA 1MUUA 2AQIA 1Z6YA 8ICYA 4WEOA 4ECWA 1UP7A 2VS1A 2JF0A 1GKLA 4AYBC 2ODBA 2QN2A 1D2CA 2NTVA 4EW2A 2WJHA 1X1RA 5ABPA 4ISCA 1EH5A 1JI7A 1C7RA 5TE9A 4UXJA 3H5RA 1I6MA 1A5ZA 4EHBA 4CQJA 3QLUA 1ZFNA 3AB3A 4WXYB 1CQZA 2AEMA 3FCEA 4GXRA 4LBYA 3VU9B 4Y67A 1U6KA 3LQYA 1MRNA 2BFOA 1ZK1A 3QMVA 1Y1LA 3CVOA 3IXQA 5EJ2A 3TYXA 2ECOA 2B1RA 3ESRA 2WT9A 3CRXA 4PSUA 3AG6A 1U9JA 1B8VA 5IBPA 5JI3E 1J5EB 3CO0S 2AOTB 5HFAA 4HGNA 4C2TA 1PAUA 4AG6A 1KSHA 1R6UA 3OO0A 5TMDA 1J25A 4Y6GB 4KCGA 3F49S 4F2GA 1FF9A 3GUCA 1L6RA 3D5TA 1UKZA 4FEAA 3EULA 3ZBPA 3G9ZA 3I6ZA 1L8QA 4ED6A 4UVIA 1T9KA 1PV1A 2PLFA 1KC1A 5CJPA 2O1WA 3S8MA 4AMZA 2NADA 2E87A 4A0FA 5ALNA 3CX8A 4CM1A 3EEOA 3THOA 1EM8B 4GOND 1IDOA 4FUQA 5C5DA 1JZSA 3DV9A 2VVTA 5JARA 1GLGA 2B5WA 4DNXA 5HKBA 4Q7JB 4PO8A 3RUAA 4BNWA 1E1CA 5EJ8A 1G19A 2HDWA 4OP2A 2H1LA 4YCXA 1A8QA 5L3SB 1UJBA 3OCUA 5L4SA 2YVQA 3BRSA 1WB6A 3MCAA 2B78A 5FTKA 4A36A 1U0TA 3UMVA 2G9VA 5KFVA 2Q1UA 2BKLA 5F78A 5FNVA 1HX7A 3IUQA 4QUHA 3MA0A 2IXGA 2Y76A 3C1TA 4Y0AA 3O4GA 1UXKA 5BQPA 4M8LA 5CDUA 4IDEA 4IVRA 2R97A 4Q7EA 3GEHA 4G65A 1K5HA 4WGGA 3BQ9A 1C7YA 1NNLA 1MO3A 1XVAA 1O6ZA 3RYFA 1KNQA 4P54A 4L0QA 3M4YA 1WUHS 2H5XA 4NG5A 3ENQA 4YXJA 1MZVA 1SCAA 3QNWA 1WUIS 5ALYA 3JQCA 2VHCA 1NDQA 3KOUA 4TLAA 4QA9A 5DTRA 1ZXXA 4E09A 1D7AA 1B26A 3PFCA 4I3GA 1P44A 1CUXA 5B7PA 1FFCA 4XZ3A 2NUAB 3D0KA 4YHBA 4R68A 4F9EA 2ATLA 4G5SA 4ZU3A 1ZG3A 1M8GA 3NWBA 3RIMA 4GZLA 3VKFA 3EAFA 4OM8A 2AI3A 1NLUA 1E60A 1Q1QA 1JEQB 4ALKA 3DBRA 9ICGA 3B8EA 3WYGA 4HEA6 1W8IA 4CCSA 4U4AA 4HDOB 1RKVA 4YWJA 5TS3A 5JYDA 3IQGX 4EB8A 2QRKA 2NZVG 1ZOLA 3P8ZA 3KXLA 4D82A 3CLSC 4PAGA 2Z83A 3HI4A 1LC0A 3PWKA 1KZ9A 3V80A 3RUHA 1O95A 4RA9B 2HCRA 3DDZX 2R60A 2HQRA 3PHJA 4QYTA 1QLJA 3WP0A 5DHTA 5KT4A 3TNDA 3KD2A 1KMQA 4PAOA 1BWQA 2OHJA 2QLTA 3SI8A 4ED8A 5AJXA 1NDHA 4RS3A 1P2BA 3BQ1A 3LDAA 4Z7NB 4M36A 4TM8A 2R7NA 1EK6A 3TADC 3GFBA 1J24A 2Y6VA 1FXUA 4RENA 4V0LA 3UMFA 3ISTA 2IZ5A 5KWIA 1GNVA 1XHLA 2WE7A 3UT6A 3OCWA 2WVAA 3E27A 1A5BB 3L84A 1QTMA 3HNRA 1PHRA 1H1LB 2W37A 1TA0A 4O0MA 4NFYA 4MA5A 121PA 1ZYQA 1WCIB 3DL0A 5LP6A 4TUYA 1ORDA 3L7LA 3ZQ6A 3DBLB 4KZPA 4WFJA 2DR0A 1TKDA 3P2JA 1BDJA 5LM3A 2WD7B 1EWYA 4BUJA 3A1CA 1Z5PA 3BTVA 4QBTA 4YJHB 4GFJA 2HPZA 1E2NA 2P69A 1WCWA 4L5IA 4MKZA 5C7YA 2G1UA 3W2IA 4LKOA 2G5GX 2I3AA 2YWGA 5KQPA 3Q41A 2WABA 5G40A 1HPLA 2DBQA 4EGAA 2E4YA 4OQXA 4J9VA 1Z0KA 1HTBA 3C3EA 3CRQA 1E6UA 4L4RA 2NACA 3ILYA 2XBUA 1FYFA 4NE2A 2DERA 1DT5A 3C6QA 3UHOA 1GPNA 2CXQA 3EZLA 2EX1A 4WCFC 4J9SA 5IZCC 4HH1A 2Z43A 1E79A 4MIEA 3VJLA 3O1HB 1N9KA 3L4BA 1X7WA 4LJYA 3RVQA 3H11A 2WJAA 2WEKA 2AQ8A 2QE7D 2EWMA 2I1WA 3EXG1 4JJ6A 1ONOA 4ESEA 1AZLA 3C6XA 3GP8A 4RPCA 5F1PA 4WJLA 1KO5A 5K45A 4ZZIA 1DZIA 4I50A 3CYFA 3URKA 1ZVVA 4RA6A 1K1EA 1QDEA 1SNYA 3FCAA 1ZQYA 4IH4A 2GCOB 2WI8A 2VPQA 3S99A 4HT3B 2H31A 4IX9A 2DL0A 1ORRA 3FMFA 4WMLA 1DXOA 2Y3IA 3FUCA 1G63A 4AUNA 5MFZA 3I34X 4P6VF 5FOWA 3T5DA 2BSXA 4DQPA 4GI1A 4UEJA 4Q5IA 3IA2A 3CONA 1QVVA 3DTTA 5HWSA 2GO7A 2FZEA 3RBAA 4U0KA 2VJLA 1YBVA 2VT3A 4GL4A 5BR1A 1RFLA 3CU5A 2XVZA 2VI5A 3MB5A 5HR6A 1WZNA 2GCNA 4BX2A 3DFIA 4MI6A 1YBMA 1W46A 3RTGA 4M9RA 3OTIA 1GKKA 1C41A 1T94A 1JHAA 1KK1A 4XJSA 3PENA 2P40A 2C78A 3W9SA 2ORWA 3O8OB 3FUVA 4YMOA 3U16A 5GTHU 1GVNB 4DILA 1DC8A 4B9EA 3COYA 3EPHA 3DEAA 3OE5A 4G84A 2JATA 2ZBEA 4HJXA 1B14A 1YZNA 1YZYA 2C7BA 5A06A 1ZGGA 2X40A 1ATIA 4WACA 4DSNA 3GFPA 1KZGB 5E4JA 2NT4A 1HLDA 2ZM6B 4D8VA 4A16A 5YASA 4MEJA 3CPSA 4BP1A 2J30A 4HVTA 3TW4A 1B0PA 4JYMA 1TLTA 4IS7A 3HA2A 1SUFA 3Q0EA 4MTCA 2B21A 3ZXSA 4ZZ0A 2D4AA 3I5XA 1KNXA 3IBYA 1S8OA 4ER0A 1L4BA 3E3MA 4Y6QA 1ZNQO 4LDPA 4QYWA 3OEYA 2CNOA 4CF7A 3DDWA 3RH5A 2ENUA 2H07A 2H1IA 5E2AA 4ZQFA 4FS3A 3N3AC 5KYKA 3RAQA 1B0AA 1VJCA 4WZAA 2BVNA 4HMPA 1XHEA 4DXDA 3I2GA 4C6RA 3IQIX 2C95A 2PSHA 2QVZX 2OE2A 4RKRA 3WR5A 1GAEO 3HKDA 3IT3A 3TLXA 4XSHA 4QQKA 2QN7A 1M6VA 3A3NA 1A5SB 3HUTA 2W11A 4CIVA 2FKAA 1TQHA 5DYGA 2BCJQ 2BBWA 1XDZA 2XRYA 2B0CA 1CEZA 5T6BA 1P17A 1BHJA 3CIOA 5KYWB 3EUB2 1YZUA 3QV1A 4RLFA 4GVLA 3TQTA 2OV8A 2C8LA 4B9SA 4LRTB 2YHIB 1QBKC 1K97A 4N18A 1I4OA 4MDHA 1Z17A 5LQRA 2JHAA 4RORA 2PTGA 1WZ2A 2GWRA 1W4ZA 1SBIA 2WYOA 3DOCA 2F48A 1SEPA 1LPBB 1NMQA 2PZBA 4K6KA 1A2QA 3BJZA 3FXAA 1XTQA 5FT9A 3V3TA 4F3RA 4X5OA 1LH0A 3QWHA 5EMHA 1CY4A 1JJVA 2FUG1 3G82C 1NJ5A 4QSMA 1PZGA 5AVUA 3FWZA 1F2UA 1VIMA 3QXHA 3I12A 4NFHA 3ECSA 4J7XA 3MK31 4F2PA 3QLJA 1JFSA 3BD7A 1HFKA 3GRAA 4L6AA 2QEQA 4UXHA 2BFCA 1Y7LA 1RM5A 4AAYA 1N78A 4LZOA 2HTEA 4IQWA 1YVPA 3V2GA 1VPVA 1N1DA 1Y98A 3WK5A 2Q5IA 1O4WA 3ND9A 3JQDA 3Q7SA 3RJIA 4KHPB 1BYIA 2JAQA 1R16A 4CMBA 4P0QA 1NW6A 4MRPA 4N0DA 2VTBA 3HP4A 5FTMA 3V8EA 3JZFA 3OM1A 3UTCA 1N5WA 4QPPA 2G76A 4XH9B 1OLSB 5MN4A 3V1MA 2VBFA 3UJ6A 2VDOB 3KALA 3B51X 2PKEA 3D31A 1TDJA 3BA6A 1D2HA 5GJVC 1AZTA 5LB4A 3W04A 3BWBA 3GUYA 1U0LA 3INNA 5FTNA 1YCHA 1DAOA 3EUEA 2J08A 5ALXA 2X23A 2EARA 2WWIA 1KFEB 1E1KA 4UDXX 1JMVA 3NTUA 3T7DA 3DAHA 3M9XA 1KRWA 3HDJA 1MX5A 5FUBA 3ROMA 4W6ZA 3OQJA 2LI6A 1DC5A 2FQYA 3OCZA 1RLOA 2GNAA 5M5BA 1Z83A 2Y9MB 4ZQBA 1NBMA 2AR0A 4PO3X 3DKRA 5FFFA 3MDCA 4U2KA 1VL6A 3VC1A 4U9IS 2OZLB 5BOSA 3GJ5A 1R0BA 3C6KA 4KAJA 4CKBA 4JR1A 3MFIA 5IF9A 2C2EA 5JFTA 5K0CA 3N5CA 3AFHA 1KDZA 1AX9A 3O2JA 4I2EA 1CZKA 4YPOA 4A7PA 1AKYA 1GTJ1 3OLQA 3ZHZA 1QMPA 3U48A 5DPMA 4QZAA 4DLXA 1KXJA 4J7AA 1E3MA 4RMHA 2N9UA 3EFEA 4U9UA 3ANTA 1J1ZA 4KTTE 4LVOA 1JHVA 4RK6A 2Q2QA 3STXA 1XRQA 1QO0D 4UDNA 5LNK1 5LUBA 1RWPA 4OFXA 3GAFA 2L2QA 2A0FA 5E3HA 3ACBA 3ENWA 1H8HD 5JDCC 4XM1A 1EFDN 3BSFA 1PZNA 1Y3CE 3BMXA 3ZCSA 4IQUA 4YRQA 5HZHA 3OJFA 3M1YA 1JQEA 5G1NA 2CYBA 4C08A 3CUYA 4RESA 4UTXA 2OYRA 3AM4A 1E6LA 3RLFA 2B4KA 3AF3A 4XOUA 2PANA 3WLLA 1SQGA 1MRSA 2ZB8A 2P7HA 1R6AA 1SB9A 5IW8A 4TUYB 2ZR0A 5C8YB 5IM5A 2V45A 1Q0TA 3T7CA 5EL0A 1SBQA 3KXKA 3VBEA 1O5OA 3IJEB 4ARUA 3SSNA 5E9AA 1NJSA 4FT2A 4B74A 5BXYA 4TS3A 3W5JA 4N0QA 1G8MA 2XI4A 2FFQA 2FWBA 3D9QX 3W7BA 4G5XA 4NEHB 1QRAA 4BO5A 1VMIA 2ZETA 1Z2NX 4HNSA 4RH3A 4YYZA 1Y0BA 1Y8ZA 2P4QA 4LJ7A 2A0UA 5J4YA 3LFHA 1VYTA 1F8GA 1SG6A 5DP1A 2UXDB 4QXQA 1PCXA 4OGKA 3QHQA 4X6XA 4DVJA 2HDHA 1U8ZA 2A4MA 1F7UA 1D4ZA 1ZOIA 4IV5A 2FN4A 3IUEA 2B25A 4EL5A 1RQ7A 3MCTA 3SDZA 1U5BB 1YC5A 4PL2A 5B5EU 1PU2A 3QBVA 3N07A 4Y1RB 3R5HA 3KSAC 2Y0SC 3VZQA 1FP7A 3IYLW 1EUCA 5HHTA 1WUDA 2AN9A 4M0MA 4X45A 2RKOA 1WD5A 4UDOA 5BR7A 3W5AA 1NP6A 2YMPA 2J48A 5FO0A 3CW2C 1KK3A 4RE6A 4Z9YA 1KIMA 1KGDA 4ZN6A 2Y99A 3HKEB 2IJGX 4BO9A 4EO9A 4YN3A 3FW1A 3AW9A 4GMKA 2ZZMA 4AROA 2PWPA 1XEWY 5ALSA 2JANA 4KX5A 2JJYA 1L8AA 3QM1A 3EXIB 2EDAA 4Z6CA 2GESA 5A9SB 1PJRA 4K6HA 3LGXA 4TRRA 3MTBA 1NVKA 1GPUA 3ZDXB 3S8YA 1HOTA 4HZUB 3O4FA 1JHMA 3KU4A 2H2FA 3CSUA 1KFKB 3QI2A 3CRZA 5BR8B 5F2NA 1KI3A 2G07A 4OAQA 5BV7A 4ETMA 2AT1A 3AZOA 1OU0A 4WK2B 1WMEA 4P7BA 5BW8A 5AM0A 4J9QA 4FXPA 1VIVA 4OIMA 2N1BA 1M2OB 2A5DA 2D3TA 1Y3DE 3DE5X 4J07A 2FEOA 3LCJA 2CCGA 3UWMA 3OE1A 1J97A 1FDVA 2PVSA 3L1IA 2JGFA 1LBEA 2FEKA 1A9YA 1GCGA 1DHTA 2ONZA 2B99A 3G0DA 2ALZA 3PCXA 2IHTA 1T2EA 4B9TA 1SVMA 3HUUA 2AJ8A 1SIOA 1RPLA 4R7TA 2XW6A 4QJ4A 4ZVLA 1Q1ZA 1PQ4A 3UMCA 4XDYA 5ALIA 4MO9A 1X80A 1SXJA 1TK3A 4DXHA 2HGSA 4GO1A 2YQZA 1IM2A 3VTKA 4FFBA 4ASUD 2JZOA 1RYEA 3AZQA 3I61A 2VIIA 4P4TA 4CF5A 2UVRA 1TK5A 2C54A 2NPOA 3ZD9A 6ADHA 5EFZA 1TLLA 1C1DB 3O3CA 3WSVA 3V2HA 1ZUNA 3B82A 1A5TA 3EQZA 4KGDA 4JUIA 1J2TA 1RE0A 5JSQA 2G80A 2ZXUA 3DPUA 4N49A 5K8TA 1L7OA 4R1QA 3AQEA 2GT1A 1RJ9B 3GPDG 4MI3A 1ONNA 4FINA 2OP1A 3L02A 4BKMA 1OGJA 2AUMA 3U7QB 4IF6A 5CDGA 3L6RA 5C34B 1YCGA 2W8ZA 4YCLA 2GKSA 3MPOA 1W35A 3NXSA 3CEHA 1NIJA 2WV9A 4ZV7A 4G0YA 3PGMA 2AQ4A 3M4NA 3GU3A 2YOHA 1G8AA 4UNNA 4KNVA 4FBUA 4O2RA 1Z63A 3MW8A 2IEZA 4D42A 4M1MA 1JG7A 2JIDA 7ICEA 1UEJA 4J9MA 3OX1A 7ICLA 5EGNA 2ZJ5A 5ALDA 3IOEA 4XQGA 3RWMB 5F2EA 2QLBA 2OB2A 5TY0A 1PR9A 4JL6A 5KTQA 3TGLA 5BMOA 4IHJF 3RJMA 4RJ2A 5FBRB 3TUJC 1U3TA 2XUAA 3HSKA 4I9HA 2O3TA 3AL0B 9ICSA 1AQIA 4O5OA 4YT5A 4AICA 1ZRHA 5CA0A 4MRMA 5IYZB 5C5JA 3AR5A 1P9RA 2VYNA 1K9SA 5ICGA 3GLFA 1AB5A 3U4GA 5B3JA 1YL6A 1DDOA 3A4NA 5E7IA 1NQTA 5ALOA 1V71A 3BK2A 1DQPA 2X22A 5B2EA 2HOQA 2P5YA 1C7FA 4LXYA 3ZHVA 3LCMA 2AFHA 2QG6A 1CX9B 1Z75A 4CU5A 4EHLA 3V42A 4KLOA 3V7LA 4W7IA 4ECUA 1DX4A 3CFYA 1CZRA 4MWEA 1FJXA 1ZQLA 1BPZA 2WP8J 1D2GA 1N63A 4QAJA 1N3BA 1E2UA 4YIHA 2IV2X 5IVDA 1E1QD 4ERNA 2ERYA 5KMGB 4MSUA 7ICGA 2VPYA 1EG7A 2ETVA 2J7PD 2F1IA 3RVSA 1H66A 3PX7A 5J5CA 2I91A 2WWYA 4EHKA 1ZL0A 4MI9A 5IP5A 4FC7A 4QOEA 4LF4B 4MH0R 2X0EA 3WSTA 4C8NA 2I4RA 2NTYC 4QIHA 3STVA 1KQPA 3PRKE 1WMSA 3OUTA 2ZKLA 1FPQA 1P9LA 4QJ5A 2E4UA 4ZJPA 5L9AA 1GCUA 4MUXA 5HQ3A 1F8UA 3V2IA 1GXSA 1K08A 3AJ9A 1NTRA 1VE5A 4MIKA 3BRWA 4CEIA 2YS6A 2ZWOA 4HAWA 4D4IA 3HYSA 1DVRA 3D7MA 3P9IA 2BKEA 3VKWA 3HJEA 2VQDA 3VKUA 2NO4A 3OOHA 4ECSA 4MUAA 1JDZA 1W1WA 4EKDA 4OLHA 1N6PA 3ZVNA 3DEEA 1EWVA 2UUCB 1THGA 2WSIA 3H75A 3UZUA 2VEOA 3RFCA 1T1RA 1AN0A 3ETLA 4MRRA 3ZJUA 1PUZA 1N25A 1KYQA 4YJDA 1WMBA 3CF4G 2AZXA 3RVKA 3E23A 3NASA 1XMXA 3EIOA 2X5XA 2Q5CA 4TT3D 2W8KA 3JZAA 4JUFA 1FK8A 4ACOA 3SYTA 1SC6A 2WU3A 3RH4A 3I2KA 3ZD7A 4CKBB 4RAOA 4PXYA 3KR2A 2JEIA 1RWWA 1RLTA 1LUAA 3FPBA 3QU5A 3MWEA 3PW5A 5CLJA 2PI4A 4H2DA 4RPHA 3TAQA 1G2OA 2O1EA 3DWFA 3OEED 1Q0SA 4ZAVA 4F0JA 5AJYA 3KR1A 4Q3KA 4URXR 2ZT7A 4F4UA 4NZNA 3G1TA 4RTJA 1ESCA 2YJ4A 4PRYA 3BQNB 4GUAA 3CB4A 3EVCA 3MG9A 2PZEA 4NATA 1FLVA 2CXPA 3WYDA 1T25A 4GL2A 4MFCA 1TC2A 5DWDA 3LU1A 1T3GA 2XXJA 4GXTA 4CM6A 4UBKA 5BSWA 1PQYA 2XOEA 2K8BB 3DL4A 2A5GA 2YWHA 2YNMA 5K0BA 4IIVA 1IOLA 1RAGA 4BQEA 2GF0A 5HM6A 2OEPA 1DEOA 3F6SA 2ZW9A 1BH6A 1WQ1R 5EPUA 4BFLA 3IO5A 3NZEA 4MGKR 2F8SA 3U4IA 1DWQA 4TL6A 5K4LA 2ENWA 4FDLA 3KT3A 3WL8A 2R6JA 4GLBA 4WNAB 4CI0B 4N8EA 3TIFA 2B37A 4D81A 3RVMA 5F1OA 4QNMA 4HDRA 4P7FA 2DQZA 5LR6A 3EHEA 3MDAA 3VPHA 4LE1A 4Q43A 1NJXA 1Q0QA 3AI7A 5LMZA 1Y6JA 1R8QA 2HH9A 3B5EA 4I9NA 1HEIA 4P32A 4Y6PA 3KETA 4DQVA 2NVWA 2MTBA 3F97A 1G8PA 3FBGA 5A0VA 4U3JB 1L5GB 4HEQA 1L4UA 1CZHA 4WV3A 1M6EX 3AU8A 3LDGA 1FW8A 1UBRS 4K28A 3I45A 4CIWA 4S1PA 2D74A 4JXZA 3GJSA 3LG2A 1THTA 3GLSA 1GGKA 2KBEA 1V3TA 1L7NA 1KBOA 1Y5NA 4OBBA 3B20A 2IXBA 5DCLA 3NJ4A 1VPWA 1X6VA 3FDXA 5H7XA 2WUWE 1QU2A 2C4MA 3R7DA 4NLKA 3Q3JB 1Z0JA 2ZI9A 3ANNA 3E18A 4P92A 4BWJA 3MXTA 5BWMA 3W0LB 3Q88A 3AHFA 5DIFA 3BWVA 3F71A 3RJZA 2D1QA 3II6X 2RKWA 3LXRA 2JFZA 2LRHA 1IY1A 5JVDB 1RM6C 1H0HA 1N6RA 1P73A 2NV6A 4XE5A 4NCKA 3L8HA 1OAOA 1LF5A 3P2MA 3OIVA 4ZHQB 4LDQA 4PYIA 1T2DA 1GV1A 3VU9A 1W4BA 2XE7A 4Z6KA 1EXDA 5GP1A 3DOJA 2PX4A 2F2AB 4Q45A 2DR2A 4ARCA 3CQ9A 4QPDA 5IF3A 1NA5A 1VMEA 1F5NA 5KSOA 1C2TA 1SBNE 4HGZA 5JWRA 4RNCA 1MEOA 2ZSFA 3BZKA 2V7TA 1PR4A 3R8CA 2HJGA 2I2XB 3K5PA 1P2GA 1SELA 4QD3A 3LZCA 5C5CA 1OV4A 3SIWA 3HSSA 3LY7A 5ALFA 4M0UA 1JLKA 1U0GA 1VL5A 3U3RA 2C5HA 1ZH0A 2QUAA 1W7AA 4RQ5A 2I62A 3MIZA 3U81A 3VHLB 3KKQA 2B2XA 5CM2Z 1C14A 4M7RA 4CVNA 4L3VA 4HVAA 3WNCA 1NDUA 1ZA1A 1V0JA 2IH5A 2C07A 1UKCA 4I4NA 2O19A 2NW6A 1UA0A 3R3SA 4WKPA 1FFVA 2C1EA 3IUYA 1EM8A 5C1PA 3R7NA 3TCNA 5AJHA 3C1ZA 3ASVA 2KLHA 4P93A 5B2FA 3TE7A 3KLMX 3ZXUB 1KY3A 2V7VA 2Q8NA 2Y9UA 4V0SA 5BWBA 4QGGA 5C81A 4HGQA 5KAPA 1W6RA 5KTSA 3IILA 4OJTA 3ZCPA 1VOTA 1ZSYA 3LVRE 2M0NA 5HR7A 5L3SA 1HE8B 2AVNA 1DELA 1U2QA 3OWHA 2WD8A 3EGIA 1GT6A 1TIKA 1FCJA 2JL1A 2W2LD 2WM9B 4KN6A 5BNWA 2DUMA 2IUYA 4B6OA 4E5SA 4HNAB 1G4UR 1E59A 3IKMB 2DH6A 1J56A 2B92A 3M89A 5K8IA 4NIMA 4Q0MA 1S10A 3BRCA 3PVXA 5GVSA 1F48A 1EUZA 1SBTA 1VG9B 1RPJA 1QLNA 3L07A 2FR0A 5GV7A 1MABB 4IVNA 2HMXA 4D9GA 4S04A 4PYRA 3QPAA 4PU0A 2QPOA 4OREX 3PZRA 3THWB 3DZCA 4KUGA 1NQXA 1JWAB 4RZXA 3RLIA 4EI9A 2I7DA 3UJAA 4CDRA 2W3RA 3DMGA 2X6TA 5IH7A 4NC9A 3JWGA 4ELTA 4PG4A 2R6ZA 4QDTA 4CHTA 1A3CA 9LDBA 4PRZA 1M75A 3U09A 3D2SA 1RJDA 3WIBA 3AMVA 3PDIB 3LQQA 5EY5B 1YCDA 1N36B 3QE2A 2NUAA 3LSTA 4E4RA 1VIAA 1W9MA 4NMMA 2AJBA 5A7FA 2A58A 1YU9A 3LK6A 4BL5A 1U0JA 1F4PA 2ZT5A 1TCCA 2XNDD 3FTFA 4C6TB 4O4IF 3Q2IA 2R25B 4MWTA 1Z00A 4ZYYA 5JJBA 4FNGA 3DOEA 4G26A 1JEQA 2BDEA 5BV1A 5EUQB 1XXHE 4Z5XA 1YR3A 2D1YA 4RNOA 3O91A 1GO2A 4H1VA 2JJQA 2IXAA 1VZ2A 5JSFA 4H3SA 1F4VA 5HYVA 1E3LA 3ANLA 4YAUA 2WB2A 1I0IA 4OHPA 3H3JA 1EDEA 3DULA 2PGLA 4RA9A 3EY9A 4QYMA 1GG5A 3ICEA 1GLNA 1QHGA 2WHEA 2VJCA 1ZRSA 3WTBA 3JPQA 3N8GA 2OCAA 3P9CA 3NNNA 4R16A 4DRXA 4LJAA 5KYXB 5EMLA 3LFUA 5DN6A 3F74A 4HXYA 5K3SA 2JZBB 1ZL2A 4NLCA 3H9UA 1PKXA 1DQZA 1NSTA 3A1NA 2OCPA 3TLKA 3TQCA 9ICWA 2QJRA 3N53A 2XMZA 2NYVA 4ZTBA 1Y1KE 2GN0A 1DAIA 3LPAA 3PNYA 5KTOA 2NXEA 4PLTA 4WBXC 4CMGA 4IDBA 4Q1CA 1TM2A 3IVAA 3OAAA 4OV6B 5F9HA 4BVFA 1H1LA 1IHDA 4LWOA 2W2OA 4MR7B 4N54A 2BFFB 2A3NA 4NYIQ 3QSGA 1WCIA 5KFTA 3V7YA 1NATA 4C5AA 2JJ1A 4WFKA 1OFUA 1QDUA 3DBLA 3HH8A 3C5GA 4YPVA 4PINA 2XDQA 3JD0A 4M38A 1YQTA 1M9NA 1TYEB 3B8HA 2JEGA 3ICOA 2HCJB 3Q9NA 3NHKA 4G0WA 2M32A 4KPGA 2FSSA 1VSUA 1L0BA 2UVWA 1U8AA 3ASYA 4JWTA 3FOWA 4KZKA 2X58A 1Z6TA 4YRJA 1RP7A 2QENA 2P3OA 4F2SA 2FH5B 3N0XA 1TYDE 2CDRA 3BXGA 4FFLA 3SZOA 4FYYA 1RQRA 2GH1A 1TJ5A 3U60B 1LLDA 3F5QA 3PEEA 3NEYA 3B0XA 4MS3B 5I01A 4H6PA 1BU8A 1SJ9A 4YRAA 3ZY6A 4EG3A 1M33A 4J9LA 1J0BA 2XCTB 1M1YE 3BK1A 8ICSA 3UV7A 2DHQA 3R3YA 3WFZA 4DIEA 2JCVA 1VHDA 4UB1A 1VFNA 1I2BA 4FGUA 4WNIA 2IP2A 5GZ6A 2B5OA 5HX7A 3SM9A 5AM1A 2AN1A 1LD3A 3AG5A 4AKEA 2POCA 3RJHA 3UWKA 3W8DA 4YR0A 3GC6A 3VNBA 4F4JA 4UUNA 4D99A 1PLLA 3KAJA 2GCOA 3BICA 4DJDC 5B1YA 1C0LA 3HCRA 2ADOA 3I92A 1ZQJA 4DOBA 2O7NA 1FDUA 2ODWA 2V5VA 1V11B 3R6DA 3R9IA 4QOJA 4KFSA 2PVCA 4QZCA 4HDRB 3PHBE 2B94A 3M9OB 4NYJQ 1XEAA 2CNNA 2VJMB 3D8TA 2LM4A 4JI7B 3UO8B 4FBGA 3HA7A 2FZCA 3X44A 1QF9A 3JYHA 3AR3A 4AYXA 1SY7A 3IH5A 3W2HA 4LXXA 3GL9A 3W90A 5K0NA 3PFIA 3RPEA 4MW7A 1RMQA 3HABA 1CJMA 1Z8FA 5KNDH 4DV2B 3LHFA 5AR1A 1SC3A 1CWUA 2QR5A 3QU9A 5C1OA 3MTJA 2RCYA 5JMWA 3AZPA 5DBCA 4X7BA 1WKCA 4JEMA 5ALMA 1UQUA 3O8OA 4LZPA 2Q2VA 5A5EA 2JR5A 1VJ5A 3TFRA 1ISPA 1Z39A 2UKDA 4CZ2A 3IL2A 3RIHA 1ORHA 4KVAA 1MDBA 3VMMA 3HB4X 4KE7A 1AMOA 5U4XA 1XRSB 1S3IA 3AESB 4N3CA 4DZTA 1BE6A 1YGPA 3F7NA 2W00A 1NW7A 4MW9A 1UHUA 3T4UA 3KAKA 1RT9A 3ZCVA 5DNYB 2B2NA 5IAJA 2Z1DA 3CZCA 3H8MA 2VA2A 1GPKA 2XICA 4Y2XA 3L0YA 3Q1KA 2V1UA 4XDHA 1UM9A 1S77D 4D7AA 1O87A 1NJ8A 4I2FA 4S2EA 2Q9UA 1Z5OA 3WGYA 3Q3GE 3NUZA 3IUMA 4ARAA 1Z3EB 4QGAA 1FMLA 1E8NA 3EBPA 5EJ7A 2DJ5A 4MV7A 3RF7A 1ZW1A 1PGQA 1WCYA 3DE6X 4AKSA 3CLUC 4YFVA 4R2JA 3I52A 3IE1A 1F0KA 2N75A 2IF0A 2YTZA 2BT4A 3IDSA 2FXIA 4O1MA 4NU6A 4K6OA 3DD1A 1LBSA 3ELYA 3EVGA 3BQ2A 4MJLA 2J3JA 1E2IA 4GNRA 5AVSA 4YV7A 4EGCB 2R62A 4O1HA 4F6RB 4DE5A 5JOQA 3LQ2A 3CEAA 4C3OB 4NS1A 4C0KA 2P2CA 2NPFA 5J0QA 3EZ6A 5JLJA 3FZNA 4Q4HB 1JW9B 3PYXA 4YMIA 3BDAA 3VU3A 5KSZA 1IOVA 3HXKA 1IIBA 4FPXA 4R54A 5KYWA 4ZT4A 4LNAA 3A0BU 4LJ5A 3ISCA 4H15A 2Q6KA 4N7MA 4KR6A 3ZG6A 4QWMA 3RBXA 3M8SA 5B1EA 3E03A 5IASA 4DOMA 2E89A 2YHIA 3G0IA 1IIPA 2MU1A 4A8EA 1AS0A 3IS3A 5IWAB 1IM8A 2CLEB 3P2EA 5KFPA 4FYVA 1NPYA 1U4SA 3GJYA 3MCWA 4YP7A 4IIEA 3ZN2A 2IHNA 3PF9A 2PMFA 1Y7HA 2ZIWB 1RYSA 2GPAA 4CKZA 4M0AA 4EF5A 2PUBA 1PNQA 3UG6A 4MFFA 1R37A 3S2YA 4KGVA 2EW1A 3EC1A 3WHLA 2W03A 3IRVA 3HEMA 3SG0A 4CMKA 1O4VA 2AQHA 3PTZA 1N2CE 1ZIYA 1R0CA 3A06A 1NKBA 4BX0A 3VOBA 4L9WA 2OBFA 4I2GA 4XW2A 2PZFA 3KV3O 4RHCA 1XLTC 1N7JA 4CM7A 4DUGD 1EKXA 3ZUPA 4GMXA 5FWYB 4M99A 3RH6A 3Q6MA 3LBHA 1P1KA 3WBKA 1E7MA 9ICMA 1J8DA 1JFLA 4FFPA 3C4QA 2VZEA 4PLFA 1Q77A 2YZMA 3I39X 1OLSA 4IO0A 4R69A 2HF8A 3RRBA 4UZSA 4PLYA 2OV6A 3N8IA 4OJKA 2N1MA 5AHOA 9ICRA 1BWRA 3EQ7A 1L7RA 5LD2B 4BC1A 5ARCA 4F96A 1UM8A 1HRDA 4XR9A 3KL4A 1P6UA 2YZKA 4BGUA 2K2WA 1RRCA 3B1VA 1G16A 2VNKA 1SWWA 3OE7A 4F4IA 1PV2A 4DWWA 3CINA 3ASZA 1BX0A 2VTVA 4CBVA 1NQAO 3T7KA 4RNNA 4BECA 4IIJF 2GZHA 1QR2A 3IVRA 3CW8X 4TKMA 1VGRA 3D3KA 2ERXA 3AH8A 5JSKA 1Z00B 3MRVA 3KLOA 3SAFA 4D0GA 2B4YA 3RU2A 2IWHA 2E1PA 1KW4A 3QE9Y 3RG8A 1Y1QA 4BNHA 2OZLA 4RHYA 4KH1A 4PGMA 2HBMA 3ZGOA 1RHKA 3TIVA 4O08A 4GPBA 2UU9B 3A6PC 4ER5A 5EKDA 3P71T 3GJXC 3HWSA 2E8NA 2DETA 4KV7A 1JR2A 5KAFU 4L4YA 1PR6A 2XQJA 3HN7A 5CUQA 1QOQB 5F9LA 4U1RA 4BE9A 4BWGA 1KL9A 3IDWA 3KL2A 3VJRA 4D4KA 2YB4A 3G6VA 4Q15A 1WMAA 3PCTA 4CNBA 4P2BA 3I42A 2C94A 2J8ZA 4Y8VA 3RTBA 1CPYA 4L8WB 4DRXB 3U17A 3IP8A 3K70B 2IX9A 1G7RA 3D5EA 4E11A 2E4VA 4ZT2A 1UQVA 1ULAA 2Q3JA 4Y2TA 8ICPA 3KT8A 2WQZA 3OPNA 3VZBA 1KFBB 5J2JA 1Q83A 2YRXA 4D4MA 2XUZA 1FVFA 4EA9A 2XYVA 3N58A 3HJUA 2Z8YM 5E38A 4BP9A 1LLCA 4RHUA 2PS9A 4B9NA 2XSZA 2HRBA 3PVSA 4ITVA 1B15A 1E6EA 3CRMA 5A62A 1GP2A 4XB6B 1BGVA 1U2DC 3GNQA 4CWAA 1S8AA 1NVVR 3FJYA 3C3WA 3SZ3A 3RRZA 2CFTA 2L82A 5C8YA 3B12A 1PR3A 4Z6EA 1LLFA 4B6QA 1PRYA 3SHTA 4GVXA 2VDMB 2XDQB 1EGMB 3SEFA 3UA3A 4YMMA 5MGBA 5AW4A 2NSJA 5KG2A 4YI3A 4JYZA 2WJYA 3NBFA 3GELA 1XMJA 4LZGA 2YCLA 3IQHX 4V2UA 4YJKA 2WMDA 4DA7A 1ZMBA 3WL3A 3GEDA 2ZG6A 1NOJA 2YJ5A 4I36A 2F6RA 4CLDA 3EGEA 3EWSA 1JFFB 4R0NA 3WOVA 1UCFA 3PJRA 3KSBC 2PGAA 4HS4A 2HWWA 3DM9B 1CHNA 4N40A 2VDWB 2O0HA 3HB7A 3CZPA 1U5BA 4NDAA 2IYPA 2TMGA 1AMNA 4HQ0A 1C9DB 3ZOKA 4Y1RA 4WKCA 4YCAA 1Z0DA 2OCBA 4JBYA 2E4AA 1AQ6A 3TAPA 8ICQA 1U3CA 2HHQA 3GP3A 3K0HA 4PC3A 5AESA 3ABOB 4A2PA 3L4EA 4DB2A 4NJ8A 3IR5A 4JJ8A 3JZIA 2OHVA 3G79A 2G5TA 3K9LA 4XLZA 3HKEA 1Z4KA 1AIPA 1L3BA 3OQIA 4ZXPA 2OO7A 2Z2KA 4DA8A 3WQHA 4HRXA 4KQMA 4HYQA 3EXIA 2C83A 2Z9DA 2O07A 5A9SA 2A59A 4U2DA 4JX9A 2AZMA 3SY8A 4HZUA 4R64A 4KQ9A 3ZDRA 2ZVQX 4DV6B 2NTEA 4RPXA 4OGGA 3QA9A 4R3WA 4FTWA 1GTL1 2VDVE 3QOWA 1XMVA 2GEVA 4N03A 5FWXA 4BNTA 4QWBA 2I87A 4KR0A 2HL6A 1M2OA 4YRRA 4R81A 3RBVA 3HRKA 1IYZA 1JNYA 3RSHA 2FPKA 1SK8A 4ZGWA 3DAPA 5ILGA 5IKPA 1Z7GA 2DUNA 3VVBA 4BGEA 2NZ8A 2QZ9A 1ZQ1A 3Q12A 3KJIA 4C7JA 5KFDA 1KQ3A 3IV6A 4IXTA 3ZNPA 4OX9Y 2VCYA 2YN4A 3WRYA 3KT6A 1WSAA 4XVCA 1MA3A 1BD3A 2ONKA 2G88A 3I4FA 1TFUA 4J0JA 5E2IA 4GZ3A 3Q7RA 5D1NA 5HKKA 1TECE 2XTJA 4ELVA 4ESHA 1GA4A 2BHTA 1CQJB 5A0FA 2IHZA 2R4TA 4WESB 1E9DA 2HQBA 5KJFA 3DV2A 3H13A 3ICVA 2LTAA 2JLRA 5AJZA 1FS4A 3AOEC 4KLNA 5KWSA 5T14A 2XA9A 4KBFA 1GZ7A 4U7JA 4Z8YA 5FTJA 4HFRA 1C1DA 5FP0A 3GDGA 1Y3IA 5A0LA 4GVPA 3FYTA 2EQAA 4LRUA 3VR2A 4G97A 4OA5A 4F3CA 1UM9B 5LA6F 2KV2A 2QLMA 1S01A 4QW9A 1OX6A 3TRIA 2IHMA 1Y7IA 1OIWA 3MD0A 4L9SA 1WCLA 2C4HA 1OYYA 3W2EA 1XNJA 5BWNA 4LYAA 2OFPA 3RC1A 1D1QA 4CF6A 1RJ9A 2DFTA 4W5JA 2V3CC 1U7WA 1BRTA 3WQQA 3ITEA 5A3JA 1YDGA 1GUYA 3CISA 3N2GA 5SYNA 5T4EA 3U7QA 1TJ3A 1XPJA 16PKA 2DT5A 1BE1A 3W1VA 1V39A 4FDUA 4GI3A 4QEDA 4UD6A 2R8BA 3KPYA 3PX3A 1RQNA 5DDMA 1AN9A 2X4DA 3GI1A 4TLMB 4Y6SA 4EKYA 4EG7A 4QRIA 2D7JA 4PVCA 3R40A 1UT6A 3QQPA 3JQFA 1BWSA 5JTUA 3ER8A 2H57A 4OA8A 2A0XA 2DSNA 3K4GA 2DWOA 1QZXA 4R5HA 4YC7A 3ZDZB 4C03A 2QNRA 2QLLA 4TQUS 2EEZA 5AI6A 1DJQA 1Z4IA 5F1YA 3NRJA 2QK4A 5LVAA 3L5OA 1V6AA 1XR3A 4TTRA 2RGEA 2WYWA 2NP7A 1UZAA 4US9A 2I67A 3IKVA 4RMJA 3QEBZ 1STOA 4ELUA 2M9NA 2WM2A 3LA8A 1N61A 3HJGA 2H1FA 2W2PA 4KTQA 2BKAA 2FLVA 3NHLA 1XXHB 1YB4A 5MHTA 1I5RA 3OZBA 4CR6A 2BTQB 1TO2E 5IYZA 4LCEA 2QPLA 2NGRA 1EP9A 2EANA 3V1NA 5BQFA 4OFBA 2QZSA 2P9BA 1CT9A 3RW9A 4CIAA 1Z7WA 1JB1A 3RT7A 3GPCA 4BRUA 1QYDA 3ZI0A 1SFRA 5P8WA 4ANFA 4YWHA 3JD4A 3EEIA 3HCEA 1GYQA 3DNFA 1IY9A 4WZBE 8ICUA 4REMA 3MTDA 4Z7JA 1OWMA 5C8DA 4OH1A 1RYMA 2I4NA 1W5BA 2FWPA 1JQ5A 2C8VA 3G2MA 4NENB 1DC4A 1BKDR 5KMGA 1FNNA 1O57A 1J8VA 4LDNA 4M46A 2F8KA 1D6MA 1L7XA 2X4IA 2HUPA 4CR8A 3WMFA 4IFIA 4LXQA 3E9NA 1U5AA 2YR0A 5GIOE 1AV7A 5K03A 3IT1A 5CK4A 1EXNA 1ULSA 2WDPA 1SN7A 4FXOA 1AS2A 3KPVA 2ZVJA 1K68A 3E15A 5LQKA 4XCQA 1KF0A 3PWSA 5BMVF 1VI2A 4TLDA 2CT8A 4UB5A 1H5NA 1YS2X 4A6PA 4FYHA 2B8WA 2PLWA 2QR2A 2QD5A 2R18A 4IDFA 3KYCB 4M1QA 1KY2A 3WXMA 1BOFA 1UBSB 5JBIA 2VSXA 4IH9A 1DGJA 3V9AA 5A7GA 3NH6A 1EJ2A 3D8NA 4W5NA 3DLIA 4IJUA 2YMLA 2O8CB 2O8DB 4YFYA 4BEJA 3SR4A 2K4EA 1KK0A 1I30A 2YJ6A 5JANA 4NECA 4WZ6A 4BEWA 4FOLA 2IGBA 2B20A 2Z5LA 5IAEA 4QU5A 1SXQA 5B12A 1W581 1KSFX 4DQQA 3S1LA 3GLHE 1A88A 3KYIB 3U9LA 1WWVA 3ETRA 4YDHB 3KTAB 3VSDA 1J2JA 1E7WA 1QIMA 4QTXA 2F55A 1NVGA 3L6CA 1PGOA 4NU0A 1O58A 3NHWA 3MTQA 5DYTA 5LDGA 4EPRA 4JL8A 2JB9A 2F00A 3PXCX 1NK8A 4OJOA 3GJ8A 3CUVA 3NI2A 1V7PC 4I2VA 2ATXA 4HQLA 1FYVA 2EZ9A 5J0PA 5FLXA 1R15A 3V7NA 3PL5A 1AHNA 3EUAA 1O0BA 2FOIA 1NLYA 2ZPAA 2W4IA 4EF6A 3DLHA 2ID4A 3L7NA 3GAZA 2RGYA 1R0SA 3NBUA 4LN1A 3QE0A 5ERXA 1QGUB 1CVLA 2D8MA 1JXEA 2AOWA 3R5JA 5IAGA 1ZIOA 4G25A 1SUPA 4AZ0B 1JTEA 1IK4A 3ZWBA 4F5PA 1RP1A 3SFTA 3I3OA 2RGAA 5AQ1A 3C5FA 3TRHA 1SBZA 3QP9A 4MMZB 4X7MA 2OAGA 1M7HA 2QOEA 4WNAA 5FA6A 4KPYA 3NTOA 1JIKA 2O2GA 3A2MA 3FDFA 1YHZA 4FGJA 2WWTA 4R3NA 1K75A 4K9NA 2W7OA 4E07A 1UBHS 4CKXA 2VNHA 3L4SO 3E8XA 4N65A 4GGOA 1VP3A 1VJ1A 1MOZA 4RQ1A 3T1OA 2PSJA 4CKEB 5AK6A 1Y8AA 1MPXA 5KFSA 2WD9A 5AW6A 4MI1A 1CF9A 3T95A 4CDNA 1I8TA 4JR2A 2ICAA 5EIBC 2BDUA 2R3SA 2QTCA 1PDOA 2I0FA 2DC1A 4U3JA 4YJ2F 1U2TA 3UCEA 5TT1A 3MYRA 3IEVA 2F2TA 3NYIA 2XIDA 4Q7QA 3QI7A 3TKLA 1QRSA 4MYDA 5GM2A 4LF8B 4V39A 1FUYB 4POAA 4WXRA 4R2LA 3NRWA 2YQ5A 4WASA 3DZHA 3RUCA 4DM4A 4J03A 3DXZA 2QKQA 5DWQA 1VBNA 1V3UA 4G23A 4AXBA 3BGSA 3CPEA 3STUA 4G0OA 4GE0A 3GUVA 1A76A 4QZGA 1R6TA 3GBSA 2ROQA 4YMVA 4B17A 2QL7A 4RY9A 3K0KA 2JJ2D 3OQIB 4B7CA 5J5AA 4U7PB 3Q40A 5BUZA 2X5NA 2ODNA 2O14A 1CFJA 1UKEA 1TQ4A 3QELB 4DMGA 1TTQB 3WHPA 2V7QA 3RFFA 4M8SA 3ZTTA 4ZCSA 1JVBA 2QPTA 5JVDA 3CNHA 2PRIA 2BCUA 2XXBA 2NSLA 3KKLA 3RJEA 5CYFA 3N76A 4BV8A 1TMOA 4LOAA 2Y93A 4B46A 1Z8NA 3JAKA 3I37X 4JFAA 3RWOA 3NETA 5CBPB 2DMRA 4ZHQA 4YG2A 1N8TA 3ILXA 1TUBB 1NMZA 4WT7A 1EJBA 1VSQA 4RVHA 2BM8A 4CU2A 1RZRA 3PC7A 1N7IA 3Q7IA 1VECA 2JLQA 3SLGA 4XRHA 1SUBA 5G0SA 4HUQB 4KWTA 1H8ED 2G1JA 5FWXB 2NUPA 4EYIB 2ZRMA 1LB2B 4XM0A 3VZSA 2V8BA 2I5HA 4BCBA 2KICA 5TB5A 3MUOA 1ZA2A 5FUMA 3Q7PA 3UATA 4Q01A 5COAA 2EFHB 3UMBA 5EKSA 5A02A 2J07A 2B1IA 3H5OA 3LT5A 1WY5A 4UNRA 4KXXA 1T9DA 2RBEA 3EFOB 1CS0A 3EXFB 3CF2A 3LT1A 4LYFA 4F5WA 3ZR4B 3DNMA 5GTIU 4E3ZA 4RWZA 3PSTA 1ADGA 1JEJA 2JGLA 4OGFA 5GOZA 3C98A 1GY8A 5F51A 2ASDA 1CEYA 1J7JA 5JD3A 1EK2A 3EARA 1NVBA 2DUYA 4Z2YA 3ETDA 3EIUA 3OPXA 3PUZA 5EA2A 2GVDC 5KFAA 4X95A 3H1TA 4AO6A 3ZBQA 5CVEA 3T52A 3DZFA 1RVV1 3JQGB 5DULA 1NUTA 5AMXA 4KOAA 2HREA 4NH4A 1TMKA 1XU4A 4GLXA 3BHIA 3Q87B 1UJCA 3LVQE 3AU2A 3LTEA 5CT5A 3M6XA 2E1FA 2JGMA 2VUUA 4MW4A 2O1XA 3SEZA 4EK9A 4DUYB 4HWTA 4BFYA 5TEVA 1EHCA 4OKIA 5B6IA 1XQYA 1IPHA 5K0SA 4HNAA 3K53A 3N2GB 1AGXA 3OIWA 1ZUWA 3U4MA 5F2OA 5CP2A 1EQUA 1JHOA 4MZDA 1HTWA 2P78A 4IJ6A 3C8UA 3TZ6A 1MABA 5KU7A 3BTOA 3T1NA 5LKRA 4CM9D 3THWA 1W5SA 1PQPA 4PC1A 2ZUEA 3RAEC 2XMPA 5AYVA 1XDSA 3M6LA 2MIIA 3TTYA 3HBJA 1OHHA 3K2BA 3UIEA 2M2IA 3L7JA 3AM9A 1IZYA 2GYVA 2FJUA 1JHUA 4KRXA 1MOPA 4GXQA 3DXYA 2X7JA 3NUGA 1U6JA 4G9EA 4MFAA 3PDIA 2QN3A 3QEKA 2GRJA 3U40A 4MCAA 2HBJA 4YXWA 1MAVA 4O2AB 1MB4A 1D9ZA 2Y6UA 2ZUDA 3EQ9A 4FUTA 1KHHA 1YZVA 3K31A 4KWCA 2D0IA 4C6TA 4TMTA 2YDXA 1ZICA 4IILA 4BNGA 5H2FU 2AE2A 3ZGYA 1HNWB 5F9NA 3E7PA 2JW5A 2F9MA 3JWHA 3MTIA 2FRDC 2DHCA 1G7SA 1MG0A 5COBA 1XLUA 3CRRA 3VKVA 4GPIB 2PKWA 1UBJS 1RSZA 4JMPA 1XNRB 4V24A 1JX6A 2VJNA 7ICSA 1T4GA 3SBXA 4BJQA 5GJCA 5KYXA 1DAFA 3R3UA 4IDQA 4K9OA 2A7XA 3P27A 4O9MA 1TVMA 2JZBA 4JLDA 1OPXA 4B0OA 3U31A 1R4NB 2BR4A 4A0HA 5BSKA 2GFQA 4PTYA 1YSCA 2Z58A 5KOYA 1KMCA 4LISA 2W2QA 4PLPA 2Y27A 4ZJUA 2OG2A 1POWA 3RBDA 3T7AA 1VJ0A 4A6XA 3W3AH 4F9FA 4JI1B 1QB8A 2KFNA 1Z7YA 3M9LA 3WLFA 1VJTA 4MR7A 1C1HA 1V1RB 3CLKA 1Q0UA 2ZZNA 5AKHA 2EOAA 1MTZA 2HHVA 2BFFA 3L9WA 2VUSA 2PWYA 2WZQA 2C8JA 4YRMA 3ROQA 4AT1A 1AC5A 5DX1A 1N2IA 5AJWA 2KE5A 4KSBA 4KHZA 1LU9A 3U7JA 3OZ7A 2NAFA 2OC9A 2VP0A 1NV9A 1DIBA 1BVUA 2WPDD 4JLPA 1DLIA 1Z62A 3RVBA 1AK2A 3DMFA 4QEZA 4WY5A 1VL2A 4DXAA 2XJ4A 1JHRA 1WPRA 4KACA 1OJ7A 3QFTA 2E49A 2WSBA 4LDAA 3ESBA 3VC2A 2C1XA 4PM4A 2W4QA 1JA9A 1MJNA 4ES6A 2Q9CA 3MGBA 1KQNA 4MQUA 2P4HX 4MS3A 3JY6A 3K9CA 5CJ7A 2X4LA 3K20A 4MARA 3L7OA 3FJOA 3L1VA 4YUXA 5TARA 1U48A 2IHBA 2DF4B 4G1CA 4XGNA 5CEJA 4BVHA 2ORVA 4JGIA 5F33A 4HB0A 2QXUA 1R7RA 1U99A 2PUDA 3ABSB 4JV1A 2F4NA 4M9HA 3KPUA 1DIHA 2BFWA 2ZK7A 1UZUA 1ZJYA 1GZ3A 3SIXA 4MVJI 1JVNA 4O3RA 3EIQA 1W87A 2VRCD 4HNQA 4O5EA 2HNBA 4H17A 1KRPA 3WB1A 2CMHA 2VKTA 4I46A 1Z2CA 2QJFA 2IELA 1V11A 3BVPA 1ZGAA 2WJPA 3KZ1E 3M7IA 4NICA 2VJMA 2A92A 1P4RA 1JB9A 1OT3A 2B6GA 1ZN7A 2EFJA 3RAXA 3NTXA 4LSWA 3ROXA 4L3WA 1GWNA 2ZYSA 3KB6A 1SUAA 2TMKA 3PLRA 1ULHA 1DQSA 2BCRA 4OJPA 4RADA 1MDFA 4S1NA 3RRYA 5FI0B 1NVWQ 5THKA 1YUNA 1I7NA 4UDYX 3OA0A 2Y0DA 2GM3A 3F6YA 2XO7A 4N0EA 4QUJA 3V2UA 4IRDA 1BS2A 2VSYA 1M73E 4GPEA 1DX6A 1ZN9A 2GEKA 3AESA 1KMMA 4ICIA 4DL6A 3SAJA 2IHVA 4CL8A 1XI2A 2HMWA 3DGFC 3IOMA 4BEVA 1C7QA 4AN0A 4QZ8A 8ICNA 4C9BA 2B6NA 3P2YA 4BYGA 1BN6A 4M98A 2PK3A 4S24A 4PX5A 2LNDA 3M0EA 4M1TA 4WLNA 3FKJA 3RB3A 5TZVA 5IXYA 1Q1BA 1S0VA 1ZSVA 9ATCA 1XC9A 5C3MA 4J9OA 4K87A 5BYBA 5ED0A 3ZNQA 4PQYA 3N0VA 1YHNA 3WLOA 4UHCA 2FPRA 3QU4A 2R1UA 3WO1A 4GMDA 1Z4PX 3ONNA 5CB6A 1AV6A 1EFLA 3I05A 3WLTA 3JAKB 1T5TA 5KNDD 1MJFA 1QCCA 4TMWA 3EZ9A 3FLEA 3HSYA 2V4RA 2G9ZA 2J9XB 1SAYA 1IOZA 3WRWA 1F4LA 3DWEX 4DS3A 4RGVA 4UCQA 3GDWA 4XRRA 4DIDA 4LA4A 1LS6A 2NUPB 2H29A 2XLCA 1VHWA 4M55A 4P4GA 4F6RA 4PZOA 2NG1A 1QE5A 3LOUA 1TZ2A 2ZQ5A 1FTNA 4B83A 4Q4HA 3T0IA 3AC0A 1RQ2A 4F4DA 2J5RA 2FA9A 1H94A 4L7QA 1CS0B 3KHTA 4GNKA 4N5DA 3X1WA 5JZVA 3K73O 5IINA 5DYYA 1D2NA 4JC4A 1JHZA 3EAQA 1E92A 5J2KA 2W3SA 4PYOA 3BMNB 2WIJA 4QLOA 3QYFA 4ID9A 3GD7A 4TL9A 4F8RA 1S4MA 2WJ6A 2X1HA 2UYQA 1DKNA 3VPCA 3L06A 2ZIWA 4F56A 3CXUA 1Y63A 1E3SA 3DB1A 1O94A 2JHDA 3H0MB 4QRHA 3PVZA 1LFAA 4IP0A 1IZ8A 1ZNZA 1XV5A 5IUNC 2EP5A 4HI0E 3GZFA 3CB2A 1FFXB 4XIJA 4K8OA 3PBKA 5AI5A 4ND3A 1EX7A 3UCXA 3QIAA 1QCZA 1FSSA 1RYNA 3B1ZA 3K5HA 5LQNA 3H40A 2Z1NA 1DB3A 4PSCA 1S1CA 5ALEA 2XYQA 3CLTD 1XNHA 3L7KA 1IL0A 1DJLA 4KN5A 3WYEA 4L9AA 1LKYB 5FWYA 4Y9DA 1KDRA 3MFYA 4DN6A 2AGQA 3RK1A 2AI1A 1YVDA 1P74A 3SAHA 3OPMA 1CRQA 4FHEA 1WCXA 3M6UA 1HDXA 4LK2A 4M04A 5AI8A 1MG5A 2CHEA 4HL6A 2JEJA 2VAWA 3ZWQA 2AQ0A 4XTRA 4C14A 2FW0A 1XRNA 1L6NA 4DWJA 4KXQA 1F9EA 3QWAA 2DLCX 5K6TA 4BO2A 4P2HA 1IK6A 4EJFA 4ZDKA 4NPHA 1QVAA 3OC6A 3UAYA 3PFBA 4BZXA 5JRJA 2H0QA 3UMJA 3TLGB 3GJZA 1L3TA 2FK8A 4C5BA 4BDSA 3KXPA 2RFLA 4OSEA 4RMNA 3GLHB 5J59A 4LY6A 3TJMA 4M3NA 4OQMA 5IJ0B 1E2PA 1XTBA 4DEZA 3DYIA 4DA0A 4EMUA 1DMRA 5IT9A 3UPDA 1IOWA 1F44A 3ZV5A 4M4SA 2C2RA 4RMGA 3AVPA 3LP8A 1KYYA 3E4CA 3M9WA 3ZU3A 1TL7C 1VB3A 4PS0A 3CX7A 2JLYA 1PFKA 4ED2A 4D9MA 4P3XA 5J5VA 4B9LA 4ED1A 5EWEA 5TLSA 4MS1B 1MCZA 1KS9A 1I14A 3R9KA 5J2BA 4PBTA 1HUQA 1CUHA 2CHQA 2P0EA 2ZZKA 2PUJA 1VYUA 3OJOA 2QJOA 3WSWA 5CD1A 3ROPA 4OYLA 4Q9LA 5BP7A 3ZJ5A 1QCYA 1OTXA 4FS8A 1A96A 1G5RA 2FUKA 4D9BA 3FBTA 1M7GA 4EO4A 2ZUUA 1BDBA 4INOA 3W8FA 3A2LA 2VJDA 3I5AA 2KJ5A 3CBQA 2XMGA 1N1GA 3MD9A 2XZLA 2C96A 4BKPA 3UK2A 3U3MA 4K6FA 2L17A 1EVKA 5C35A 3VVLA 1LPPA 2XRFA 4PGAA 2HEIA 3T3DA 3OFNA 2RB5A 4YAIA 1T1JA 2HXGA 2RJNA 2A7QA 3ZZ0A 5F64A 9ABPA 3ZWDA 2J6IA 3JYQA 2C84A 3UOAB 1TA4A 4OJMX 2HSEA 3GRRA 1PYDA 3MS7A 2ZJFA 2OBBA 5FPTA 4OQDA 1NI3A 5KFWA 2RH9B 3E4DA 3UMYA 4Z99A 2RQ5A 2H7XA 4AKIA 1O08A 1JBKA 2PZJA 2HIGA 3DFUA 4IEEA 3WA6A 2ZBRA 3KD3A 1II0A 3TLMA 4AX4A 3UT5A 2P11A 1SBHA 1N7GA 2XX3A 2VKQA 5FEMA 1JFFA 1E1MA 5DVZA 3H8SA 1PJBA 5FPQA 5L3ZA 3GT7A 2OM6A 3PQ7A 4ZI7F 2VDWA 5DF1A 2P35A 2WSMA 4CQMD 3GLIE 1OREA 4EI7A 1BNOA 1YDFA 3BB3A 3CMMA 1RS0A 5E4FA 4DS4A 1CB0A 1QF6A 2QR3A 1M2VB 4XASA 1UK8A 1ZQRA 1PR2A 5K0GA 1IXRC 3OUUA 1JXQA 1LB1B 4G2NA 2I9PA 4ZARA 5EWGA 1P4HA 2P2ZA 4BPRA 3IX7A 4OQLA 4ER7A 2GN9A 2YRWA 3CEJA 2PWBA 4Y9RA 1P2FA 1T2UA 2C61A 4GDFA 2JV3A 5F2KA 3DMDA 3F3SA 1DWOA 5JZMA 5TXGA 4KIWA 4R63A 4A03A 4RU1A 4E12A 2ZBFA 3T5JA 3FNHA 1J8QA 1KEWA 5ITWA 3U13A 4XX0B 1X14A 1HYQA 4RQ2A 4IGEA 3T54A 4RLHA 5IT0A 4P34A 3PEWA 1JDJA 4BMNA 5B3AA 4L3OA 4RE5A 1PJCA 1IC6A 2F43B 1IY8A 1LRJA 1GRNA 2P6RA 1YK0A 2W6ZA 1MORA 4I2NA 3KLPX 3PQ5A 1MO5A 3ZY5A 2IYLD 5G0UA 1UCVA 3NIGB 3VAAA 1RPNA 1FFGA 4N3BA 5ULLA 1FC0A 1IBLB 4MWOA 3AR2A 3OJSA 5FPHA 3UJ3X 4D25A 5I7FA 3FG9A 3DFMA 4BNFA 4Y18A 1XWFA 4TXJA 4G3XA 4BUZA 3B5JA 1NT4A 1NURA 1S96A 2XZPA 3IKTA 5CGQB 1JTFA 3PIRA 2A30A 2CCKA 2QV0A 3DZKA 2A1AA 4JLOA 3ZIAA 2BZSA 3LUJA 4R2HA 3MQ2A 2X77A 2CJPA 1CQJA 4Q4DA 4WESA 3VYRB 2QW8A 3KZNA 1SUDA 3W77A 1Z8HA 2QGNA 3A0RB 5AKXA 2J5BA 1SD5A 3OWXA 2CK3D 3QBDA 1ODLA 2RG7A 2IUSA 1NRIA 2KJ8A 2OP0A 1PEKE 1S2OA 3IUSA 3MILA 3IEXA 3BE6A 4ILEA 1F2TB 4XVQA 2VBGA 3QTLA 4C7BA 4QNLA 3THVA 2XWQA 1KDOA 2PO5A 2D5CA 4S0XA 2X13A 2YVAA 4C78A 2VQFB 3OX2A 5AKJA 4M7PA 1NTOA 3UV6A 5HPYB 1SHUX 3RC2A 1USWA 4RTRA 4HNGA 4E6PA 1DO8A 4X66B 2FGKA 4J16C 3T3HA 1V26A 2HO4A 4PG5A 4J43A 2HCFA 4TSFD 3EA5A 1YZGA 2ZIVB 1ST3A 2JI8A 1XZ8A 1QHEA 3BPSA 1W5EA 2RD2A 1SCDA 1GARA 2W2VA 1G42A 2OK7A 5JCJD 9GPBA 3P96A 4I9FA 5AVVA 4GGMX 3VZCA 4ZI3A 1GDDA 1PE0A 5J43A 1XXHA 3DE0X 2BTQA 1YQXA 2C9OA 5IXSA 1CY6A 3MERA 4BO8A 5JJCA 1FNCA 1F7VA 3PE3A 4C05A 5BN3B 3FSJX 4IJQA 1ORVA 1ZJ5A 1HBJA 4E33A 1BVRA 1U9IC 5L1JA 3D4NA 1UKVY 1AGNA 3N39C 3JALB 2CF6A 5HUJA 2I99A 3ZCQA 2JDIA 4PZPA 8GPBA 2YTUA 4CJXA 3FMOB 3AJRA 3HL0A 2OPHA 4B8YA 3ZCRA 5IVHA 4BNVA 1CUBA 4ZOLF 4LGYA 1QC5B 3ZHBA 4MKIA 4PYLA 1EGVB 3K05A 1LTQA 4BATA 1SCNE 4F4YA 4AS3A 4NENA 2O48X 4DV5B 4OFWA 1DC7A 2FLPA 4JUBA 3VH2A 2WM3A 1UA1A 1BFKA 5L6LB 3UJDA 4CTNA 3GUZA 4K9KA 1DOZA 2E5SA 2NU6A 3UT0A 4MS4B 4C0ZA 3CJTA 4EZ6A 2GWHA 2BOVA 3HCNA 1V8DA 5CVTA 1SXEA 2ZBGA 3MAJA 4AM8A 4I27A 5IN5A 1U2EA 2BDPA 5SYMA 2GHIA 3FWHA 3JVUA 1U4OA 2WDZA 4QGBA 1XUOA 4JOBA 4C0QC 4LWPA 4F97A 1BPBA 4B6EA 3QF7A 1YWGO 3I9NA 3KYCA 5ADHA 4YO7A 1DXHA 1W8DA 5KNLA 1MB3A 1CY2A 4HWRA 4PPXA 5FX2A 2OXFA 4P4SB 3NHUA 2P3QA 1FE8A 1RJFA 2O8CA 2O8DA 1G2QA 4N8DA 5AM3A 3NALA 3H1BA 4IIYA 2QRQA 4MF8A 1KI9A 2YXDA 2A9PA 1M8JA 4JFRA 3BQMB 1N75A 2ZRQA 4FI3C 2NAPA 3A4MA 3I6IA 1R64A 4B9UA 2WM8A 8ICXA 1KOJA 1NL3A 3PC6A 3G8BA 1PK7A 1WW8A 3KTAA 5BNFA 4KL8S 1IUOA 4A8JB 3HA5A 3ESXA 2C97A 1KZYC 3MIIA 3AEXA 5JXJA 2Q99A 1E8MA 5HJ5A 1NN1A 2PFPA 2SHKA 3M3HA 3U61B 4REOA 3ZK7A 4RY2A 5CW1A 5BVHB 5DK4A 4BLOA 4NEGA 3BBLA 1AMUA 4NCHA 1XX6A 5I45A 1IN7A 3BC1A 1KMHB 2ZI6A 4TV9F 7GPBA 3OQMA 3ZJYA 5L3VA 4ZDWA 2Z08A 1SOVA 2YJGA 3WFJA 3UTDA 5IZ4A 3NJ8A 4ZMSA 3TEJA 3V4OA 4DOAA 3WKEA 3H5WA 1EXVA 3LBIA 4TTJA 1QGUA 1VGVA 3KSZO 4JBGA 4GI5A 1OT5A 1W75A 3QJ5A 3UUEA 5AK0A 4AZ0A 1I0LA 4B73A 4B32A 1PK9A 4C07A 2JAPA 2EQ5A 3HGMA 3ZNNA 1P0IA 2KPOA 5EKUA 3MJVA 4EDFA 4B34A 1ZR2A 2VOJA 3BZCA 4NH0A 3B7WA 5FQNA 2G28A 2VT7A 4EJSC 3A27A 3WP1B 5D3KA 3HWX1 3P4YA 1HG0A 1ZINA 3O3MB 2GZSA 4QREA 2YV2A 2WTBA 1N2BA 3B1KA 1BVHA 4CKEA 5EN4A 1U63A 2GZ3A 3HACA 1SMKA 2VDRB 5FAKA 3BWYA 3QUBA 3SGLA 3UT5B 4WBSA 4PNZA 2WLTA 2AGPA 4YCMA 4IHKA 1X9HA 2Q3EA 2B8JA 1W4LA 1ISJA 3PG5A 1SKMA 1VKNA 1IH8A 2VDUE 5EESA 3BJRA 5SZIA 1BJRE 3HDTA 3OCJA 1JSLA 5EXSA 4ZU6X 2XEDA 3KZMA 1ZQXA 4G4IA 5ECWA 5JDIC 2O4CA 3LUHA 2GA9A 1YZ7A 2QRNA 4RIEA 4DKXA 1D4AA 1ZZGA 4UMFA 2UVVA 3GLQA 2QRUA 4CLRB 1J6UA 2PMWB 3NAQA 4IAOA 3LJKA 2EZXA 3QELA 3VXKA 4QIWC 3G2PA 3MQFA 1V5FA 4O4LF 1MC1A 5EWJB 5FQOA 8ICKA 4FZ5A 4ZEWA 4X97A 4O3OA 2DH5A 2XUPA 2HLPA 4HGOA 1XTSA 5CBPA 3LRPA 1QH0A 1O9GA 1TUBA 2XF2A 3OLYA 9ICNA 5EVCA 3E2IA 4GM1A 4BUCA 4I4CA 3ZTWA 2J46A 2WU1A 2Y1FA 4DIBA 2IYEA 3V8BA 3QUTA 5DB9A 4YQWA 4HUQA 5CDTA 4IZHA 5DKFA 4EX7A 1SHZA 4YMNA 1ORIA 1C9NA 5FA8A 3SJCA 5E9QA 2JIBA 2YASA 3EOZA 3B3JA 2HGZA 2V0NA 3EFOA 1U94A 4IIJB 3VPSA 3EXFA 1Z34A 1J0DA 1TK2A 4WUTA 4KO8A 4EVRA 1LDGA 4GBED 4LIPD 2VPTA 1E1LA 5C4IA 4QJFB 1M0SA 5CXXA 3I9FA 1CUJA 1KEEB 1UDXA 2F3UA 3HB5X 3ND8A 1E4OA 2V6BA 4GC9A 2RI6A 1ZM9A 3QE4A 4PNHA 4BB0A 2GWSA 1Z26A 3LBNA 3K4HA 4PL1A 4HXFB 5AK5A 2E82A 1DXQA 1PJ3A 3JQGA 3WS7A 3CNOA 4L4UA 2JGIA 2HLNA 5KJ1A 4OU4A 3T35A 2ZXIA 1XZCA 1KFSA 2A9FA 1QQBA 1T9ZA 2PSDA 5CLIA 5LMUB 3MSXA 1WEHA 3O26A 5ES4B 1XMSA 4KC0A 3TB4A 1WZIA 1LX7A 1Q12A 3GLTA 4FJ0A 4GICA 1Q44A 1RI1A 1U0BB 4MQMA 1JALA 2ZTEA 3BG5A 3CVUA 3UPTA 3B6JA 2HQ1A 2O2DA 1E3IA 4QBIA 1Q84A 1T2NA 3DBHB 3KJQA 1IAQA 1QVWA 2EL7A 4I4TF 4WD3A 1DI0A 1E99A 4ZP1A 1Q3KA 2E8OA 1LQTA 3M7DA 3U7RA 3PGA1 4PN7A 3KWFA 5ELMA 1PN3A 4LV6A 4UTRA 1S0MA 2WA1A 1HY3A 1G59A 1X66A 2H2HA 3VR6A 3HHEA 1NUPA 4EBEA 1D1SA 5KT2A 2KNJA 4ALNA 1T26A 4OO3A 2D1SA 3VSEA 4OGWA 5BNTA 2JRZA 4O2AA 3BQTA 1XT6A 3L1HA 3PXXA 2PKCA 3IRUA 4TZ6A 1KI1A 3TZHA 4ID3A 4AJ1A 1NN5A 4B31A 2HBRA 2FMXA 1Z1BA 4MB2A 2XRZA 2IEBA 2MYPA 4LZAA 4RW0A 3MT9A 2RDIA 3MLBA 1LWOA 1G8GA 1SL2A 3QX9A 2BHNA 4UCXA 3HKZC 1N60A 3MHTA 4KVZA 3RC7A 5CFRA 4UAWA 5JH7F 3W8NA 4F4XA 1B6RA 4IR9A 3VR0A 2IL1A 3NVWA 1E5TA 4PHGA 1T1IA 3IP5A 3IJ5A 2HOFA 4IV0A 1QLWA 1WSDA 2EFEB 3B9BA 4RZRA 5ALJA 1U3WA 4CL3A 2J6TA 5KT6A 4HRAA 3EMVA 5AJUA 3KJHA 4MGHA 3I1JA 3V4FA 4WJKB 3HDYA 8LDHA 2OQIA 1EFKA 2OORC 3PEFA 1T13A 2J33A 2IS4A 1ZCJA 1KLNA 5E0OA 2NU6B 1R4NA 1KPIA 3A4LA 1PP4A 1MXHA 4U7HA 1MSWD 2WHYA 1RYFA 4J0FA 2A88A 3ETNA 3AY3A 3A8TA 3K6KA 4PYMA 5EOZA 3I04M 2KX7A 1SKYE 2VJYA 4OK5A 3T9FA 2FMQA 2CXHA 1V1RA 3VISA 2FP3A 2Z1MA 2WSLA 3JPSA 4IX1A 3FRIA 2D5BA 1CR0A 4PQFA 2DTXA 3C1AA 1CLEA 1KO1A 4R8UB 7ICTA 3K0CA 2K60A 2VHZA 5EUMA 1UPHA 4DARA 3VOTA 4GD3Q 3VO2A 4N41A 4FHDA 2KOBA 5ESXA 3O2NA 3HBMA 1FTQA 3FNQA 3TSOA 3SQIA 1Z8DA 4NPAA 1ZJJA 3L7BA 1M1YB 1UWVA 2OLKA 3GLIB 3IUJA 3JWIA 2EHDA 3H0CA 3N59A 3EXHC 2K87A 4BFXA 1G5PA 2NYAA 3A9WA 2H0RA 3ZE8A 4ACBA 4ND4A 4JHXA 4EQZA 4BLRA 3UV3A 1MVNA 3FZEA 1DE0A 3NU1A 4TYYA 4RTPA 1RXYA 9ICXA 3W3AD 4Q6BA 4BWYA 3HJTA 2DECA 1XA3A 3KOZA 4LHXA 3CKLA 2AFVA 5KYUB 1YE8A 4TV8F 1DJNA 4JCOA 4CMEC 3OSUA 4YJ3F 4P33A 2MWMA 4PHDA 1W34A 4X61A 2AX3A 3OM8A 2PFGA 1PJLA 5LSAA 2DVMA 3R4VA 3RJFA 1CUZA 4ND1A 3K6RA 3WBJA 4GYYA 1SC1A 4J6EA 2PAFA 1ZOPA 3QH4A 4BYMA 4FJ1A 3DDSA 2QUHA 1UDRA 3NIBA 2GBLC 4RQTA 1ZWKA 4DSIA 2BJWA 4TUQA 1PL0A 2IY7A 3PKIA 2Q4RA 4WXMA 1TCBA 3MS4A 1JPJA 4LF5B 1UBFA 4G8JA 3INTA 7ICKA 3PDCA 5CNIA 4GQIA 3BF7A 1N1EA 4YXMA 1WF3A 3PUWA 3VHXB 8ICHA 3GJ3A 1F1BA 5I9IA 3UWOA 4ZOQI 1RBMA 3K1TA 3FHLA 2AG5A 1BZYA 4KIJA 2I2FA 2I7CA 2ZE5A 2HMTA 5BOMA 1FMJA 3PQ8A 2BMVA 2ECFA 5FCDA 2AG0A 3KQYA 2IZ0A 3QFSA 1OH8A 1X42A 3EZFA 1NC3A 3IVGA 3L6BA 1T3ZA 5DZSA 1U7ZA 1WDWB 1ODFA 3EPKA 1XTVA 1N5LA 5J2IA 4PSVA 4B35A 5KC8A 3NS1A 4Y6OA 5LCXA 4A0GA 4ZO9A 4OFZA 1JYFA 5A4MS 2A33A 1CUDA 2JAWA 5H59A 4B47A 5AVXA 1X39A 2CYAA 3W5HA 4D9FA 4HX2A 1Y4UA 4LYJA 3TQOA 1B0ZA 3A3OA 4NAHA 3UAWA 5E6RB 4PR3A 3BXPA 2Q2NA 1HT3A 4JJ