3R9KA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, glu47asp mutant complexed with sulfate, a closed cap conformation
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
227
structure length
227
Chain Sequence
GSHMRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHDGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Putative beta-phosphoglucomutase
total genus 83
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3r9kA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3r9kA01
1RQNA 3QNMA 5AW2A 3SKXA 3MC1A 3UMGA 3KC2A 4EENA 5ALUA 1U2TA 3PCTA 3PDWA 5AI8A 2P27A 5ALEA 3QGMA 4UAVA 4JDPA 5E0OA 3ET5A 3SLRA 5AIAA 3U7GA 5AKKA 3IB6A 1CR6A 3ZX5A 3L8GA 4YCLA 5AM4A 1TJ3A 2G1AA 2PR7A 2FEAA 3WKBA 2WHEA 2IOFA 3ZWDA 5AW6A 1Z4QA 5IT0A 3ONNA 5AICA 2JAWA 2WF5A 1QQ7A 5A3SA 3E58A 2GMWA 1YJ5A 2YMPA 3QUTA 3FGOA 3NALA 5AKIA 2NYVA 2GO7A 3MPOA 2YJ3A 1QQ5A 5AM5A 3WK9A 3EF1A 4L6CA 5AKLA 4UW9A 1S2OA 4J03A 1O03A 1NRWA 5AKXA 2OM6A 3KD3A 5AW8A 1JUDA 1SWWA 1LVHA 3N5KA 5AVYA 4BKMA 2R8ZA 1Z4JA 5FP0A 2CFSA 2ZOSA 4XQ0A 5AVTA 3P96A 2FI1A 5AIBA 1Q92A 1RKVA 1Z4NA 4XPZA 1F5SA 3ZWKA 4E88A 5ALTA 2RAVA 3R09A 4KYTA 3A1DA 4UU0A 5AVVA 2IOHA 3BWVA 2C8KA 3OCWA 3NASA 4OFZA 1XPJA 2QLTA 5AK5A 1Z4LA 2JARA 2ZG6A 2ODAA 2RARA 1XP5A 3M1YA 3R4CA 5AVQA 2FPWA 4YGYA 2O2XA 1RLMA 1TA0A 3NRJA 3ZW7A 5ALJA 5AVRA 2W4MA 1ZRNA 5ALZA 3DV9A 3W5DA 3AR3A 2YY6A 5ALNA 5AHXA 3NIWA 2CFRA 3PGLA 4Y3UA 2C8LA 2YMMA 4OCZA 2C4NA 4KN8A 4CF3A 1Z4MA 3BA6A 2AUTA 1RRCA 1MH9A 5AKJA 3PGVA 1T5SA 2CN1A 3S6JA 1ZRMA 3WK8A 4EEKA 3A1CA 1WZCA 3ED5A 4DW8A 4RESA 2Q4TA 1Z4KA 1Y8AA 4HAIA 5ALQA 3L5KA 3U7EB 4I9GA 3NUQA 1S8OA 3WK7A 4UMEA 3ZVLA 1Z4OA 4Y2YA 4Y2QA 1ZD3A 2HOQA 3L0YA 2MSNA 5AM0A 4KNWA 3OCVA 1AQ6A 2Q5EA 4L57A 5AKHA 2WM8A 3FPBA 2C88A 5AVSA 2G0AA 1LTQA 2JGAA 3WKCA 3QU7A 2PKEA 1SWVA 4UASA 1YNSA 3L7YA 2AH5A 3UM9A 3I28A 2EATA 4XE5A 3MMZA 4DCCA 4PNHA 3E8MA 4KNVA 4NAVA 5A3RA 3B9BA 2D2VA 4Y2PA 3KDPA 4XOUA 4DWOA 5AVWA 2MU2A 4J2TA 2IYEA 2WFAA 4KX3A 4YCNA 1TJ5A 5AM3A 3AR4A 2FDRA 2IOFK 5AKGA 3ET4A 4IG4A 5T41A 1X42A 4MWOA 2FUEA 4Y2VA 2HO4A 4G9BA 1ZD5A 1RPZA 1T9ZA 1RKQA 2BDEA 3N8GA 4C4SA 4UM5A 4AS3A 4C4TA 1N9KA 5ALDA 4NV0A 3DDHA 4NWIA 3QU5A 2CFTA 3OCZA 5ALWA 5AM1A 3WK4A 3WGVA 2WF6A 1L7MA 1Q91A 3J7TA 2B8JA 3AR9A 1XVIA 4HGNA 1U02A 3HYCA 4UM7A 3FM9A 3AR2A 3L8FA 4RETA 3I6BA 3N07A 1ZOLA 3B8EA 2YFYA 4F72A 2YJ5A 3QYPA 4BEVA 2GHQA 2FPRA 4O8CA 3WKDA 3W5CA 1U7OA 3UMBA 2WF8A 4BBJA 2X4DA 2I33A 3ZVMA 3U13A 4YH1A 2P11A 1RQLA 5ALPA 4BX3A 1YS9A 4C4RA 1WVIA 1Z5GA 5ALYA 4HGPA 4UU1A 5AI4A 2I34A 3SHQA 1O08A 1QQ6A 4CNQA 3CZ4A 5AI5A 2HEGA 3R9KA 3A3YA 2OA0A 1WR8A 4GXTA 3QX7A 5ALHA 3F9RA 3OCYA 3SKYA 2B8EA 2O9JA 3CNHA 3WK5A 1ZD4A 4UATA 3AR8A 1QH9A 2W11A 5AW5A 1Z88A 1YV9A 4CF5A 1RMYA 3SF0A 3NANA 3KOOA 5AI9A 2YJ4A 3W5AA 3EWIA 1CQZA 1RKUA 2ZXEA 1ZD2P 2B1QA 2R8EA 4Y2UA 5ALVA 1KYTA 4BNDA 3L0CA 3IRUA 4ZEWA 2WF7A 1VJ5A 4EELA 3MN1A 5ALLA 5AW9A 3QU4A 5AKZA 2BY4A 5AKYA 1L7NA 1WPGA 2AGVA 2I55A 5AM2A 3U26A 3TLMA 5ALIA 4YCMA 2OBBA 5AK4A 3OTQA 3QUBA 1SU4A 1YDFA 3I76A 1TE2A 4YIKA 1L8OA 2W43A 3I1YA 3L0BA 5IT4A 3L8HA 1TJ4A 1J8DA 1Z4PX 2G06A 2R8YA 3FZQA 1RLOA 2FUCA 4BEWA 4EZEA 2JAOA 4BX2A 2VKQA 3ZI4A 4UMDA 3WGUA 3QXGA 4UARA 4NFLA 2G80A 3AR6A 2G08A 4B6JA 2GFHA 2Q4RA 3A1EA 4BYGA 1PW5A 4F71A 3KBBA 1ZS9A 2PQ0A 3VAYA 5ALMA 3U7HB 2C9MA 4I9FA 3OCXA 3M9LA 3QUCA 1U7PA 5AKEA 1YMQA 4Y2SA 4Y2TA 4IFTA 1EK2A 4YIHA 1J97A 3QUQA 1K1EA 1T5TA 3N1UA 3ZTYA 3WK6A 3EPRA 2I6XA 1RMTA 1Z5UA 4HGQA 2I7DA 2RBKA 1EK1A 2NO4A 1RDFA 1RC8A 4GIBA 2YMLA 4HGOA 2G07A 5AI0A 4UAUA 3L8EA 5ALOA 3U7FB 3FPSA 3AR7A 3ZTWA 4BNDB 3QU9A 3IJ5A 5AW1A 1NNLA 2IA5A 2QYHA 1L7OA 4JB3A 4FFDA 2DQSA 3QLEA 2YMQA 2HCFA 2B82A 2P9JA 3NAMA 4QJBA 3L1VA 4UMVA 3KZXA 5AVZA 3ZUPA 3D6JA 4KX5A 5AW4A 4H1WA 3WKEA 4FYPA 4OD0A 3RF6A 5ALRA 3RFUA 5AESA 3HLTA 2ZBFA 2AMYA 3N28A 2B1RA 2HF2A 4CF4A 1L6RA 5AW3A 5ALKA 2YBDA 3FVVA 3EF0A 1RLTA 2RB5A 5AVUA 2HSZA 4L6AA 2MU1A 3WKAA 2R8XA 5JJBA 3ESRA 2B0CA 4UMFA 4DFDA 1L7PA 2YN4A 3ESQA 1IWOA 2G09A 3DNPA 3GYGA 2GHTA 4Y2XA 3K1ZA 1FEZA 3E84A 2WF9A 1Z4IA 5AW7A 4NABA 4AS2A 5ALXA 2EAUA 1L8LA 2FPSA 2HF7A 2ZBGA 5IS2A 3OPXA 2ZBDA 2FPXA 4ZEXA 1N8NA 3SMVA 3UMCA 2ZBEA 1ZJJA 1U2SA 5AK6A 3OCUA 1NF2A 3B9RA 2OYCA 5ALSA 2P69A 5ALFA 4FE3A 2HI0A 5ALGA 3E81A 1RMQA 2NO5A 3L1UA 4ZEVA 3W5BA 4Y2JA 4QQFA 4BX0A 5A3QA 2JAUA 5AVXA 4OHFA 1VFPA 3ZVNA 3ZU6A 4CE6A 2EARA 3QU2A 2I54A 2FPUA 5AW0A 2HDOA 2YJ6A 1QYIA 4EX6A 4MUMA 3ZX4A 4AP9A 4HGRA 4HYTA 2HX1A 1VJRA 3SD7A 3AR5A 5AK3A 2BDUA 2HHLA 4G63A 4Y2RA 4EX7A 3U19A 3DAOA 2B30A 5AI6A
chains in the Genus database with same CATH superfamily
1DHRA 5DGTA 2DE0X 3CWQA 3LUJA 1G16A 1H4TA 3IAS1 1BROA 1L4FA 1XYYA 4IRCA 2V8BA 3DOOA 4L8WB 1GNVA 1MD9A 2HMYB 3AHJA 3TK1A 2PFSA 4ZHQF 5K7SA 5MFZA 3D2AA 4LJ9A 4F4YA 3HKDB 1NOMA 1KC1A 1M0SA 3PCTA 3E5RA 4IHAA 3ZKWA 4QZHA 4EKDA 3EIWA 5IP5A 3GZFA 1GNSA 4AYBF 1LFDB 1CS0A 1LSOA 1QZTA 1E9RA 1E5LA 1QSSA 2IP4A 3I6IA 3PUKA 2V5AA 1BFDA 5DRTA 2XQVA 3MSCA 3PHIA 4DRXB 1EESA 3UTDA 1L7BA 4KLSA 1M2GA 3ZHQA 5KBYA 3GJ8A 3EIEA 1W4AA 1EA5A 1JAZA 1EFTA 1I9CA 1JQAA 3DAHA 1SCQA 3KVVA 3D3QA 3TW6A 3W6NA 3GJRA 5JSZA 3VJRA 3MELA 2G1AA 1AXEA 3D4PA 2R7AA 1NPDA 1CNFA 2YCLA 3P0IA 5TE9A 4ML3A 1E1RD 4KI7A 3IE2A 2PDAA 2XRFA 2JAWA 4M1TA 3S55A 2HU7A 2C77A 2IMWP 3SR4A 3KYCA 1EFCA 2HSDA 3HR7A 8ICWA 2AMJA 4ZH4A 4X8LA 3UUWA 5KU1A 1DQZA 4ECXA 1KPIA 2CDBA 2X1VA 4KIFA 1KI3A 3TZ6A 4P32A 2A14A 3WAJA 3LY7A 2JI4A 2NT4A 3SQDA 1H66A 4G5YA 4IWXA 3AJRA 4L3OA 1I33A 1JYFA 4NEGA 4F0JA 4DRYA 1EFRA 4L9RA 2W6MA 2Y1KA 3T95A 2IJGX 1QZUA 1FNCA 1ULZA 3U5TA 3CVVA 1V37A 1D4ZA 2QV7A 4JLBA 3CE9A 3OLQA 3KD3A 1N2HA 2VOJA 3TFQA 3VMFA 3WGOA 3HFSA 4INZA 1R0SA 3ZWXA 3LXXA 2VATA 4TVOA 1P1FA 1HFKA 2YZNA 9ICUA 4BKMA 1JIJA 1W76A 2RH9B 4NH0A 4XDGA 3VC3A 5FO0A 5HDQA 4HSGA 2R11A 5FEMA 2HWWA 1S2DA 4RXMA 3B6ZA 3W9SA 1P7PA 4OJLA 3G8BA 2BEJA 3WE7A 1Z63A 1GSAA 4XWGA 1G0NA 1KE1A 2F43B 4PZLA 3LHSA 3V6LA 3ZU3A 3SEAA 4EITA 1R0BA 4KYTA 3K9QO 2JK1A 1XRRA 3H2YA 3SBXA 2C8KA 1WHSB 1XPJA 1UQUA 1BU5A 2HDWA 4YUVA 3VNSA 1KIAA 5EJ9A 4MW6A 3F4KA 3R4CA 1PZXA 2QTAA 3T3FA 1STOA 1QVAA 5KINB 3ZD9A 4U02A 3MJSA 4FR2A 3SF8A 3VDQA 5JZBA 3I1FA 4IDDA 5EP2A 3GFFA 1VJCA 3EXHC 3W06A 2HADA 3GCDA 3K0SA 1IN5A 1EZ4A 4XUEA 3DPIA 4PHEA 5KKAA 1YQWA 3ZW7A 1JG6A 1RBZA 2W4MA 5HE8A 4ZCMA 2HPVA 2IW3A 1WG8A 3CO5A 3MGKA 3HE3A 1MDBA 4OHVA 1K06A 4R8SA 5DYWA 5AOVA 3WNBA 3IBGA 5J47A 2ZJFA 1U0HC 2HJGA 4Q44A 1B41A 2E8NA 3BK1A 2LD4A 1N2EA 3HCRA 3I1JA 2Z1MA 3ILHA 4NZ9A 4CMAA 1GRNA 5B3LA 4JLSA 1YXMA 4HR7A 1CJMA 3V3TA 2DPYA 4WOJA 4YQZA 3V8MA 2FSPA 3DTVA 4KLAA 3K4QA 4CCHA 4UDNA 3EGOA 1DK2A 2BTQB 2X4LA 3KXPA 1OA1A 1J8FA 3LKZA 2ARKA 3PEFA 4KIJA 2AUTA 1V45E 3ID6C 3GRRA 3GLGA 2R44A 2OXRA 2DU8A 4S1NA 3K1YA 4X1KA 1L4MA 2Z3VA 1M67A 3SVZA 4C07A 4YRNA 3CX8A 3F90A 4OREX 3CISA 4BZWA 3WNZA 4UEQA 4H2DA 2J31A 2I3AA 1H65A 4BQSA 1GTZA 3HJCA 5JS8A 2WA2A 1NXXA 1IZ9A 2WY2D 1DG9A 2QSYA 3F6BX 3GBPA 4M98A 2LIVA 4PANA 1HTBA 3GEMA 1T3QA 1P0CA 1W5EA 4M1KA 3VC7A 5JNLA 1IY8A 2IIQA 2IPAB 3IV6A 4NDNE 3AMZA 4FNGA 4D0SA 4ECZA 1J06A 4P0QA 4KLQA 3L0YA 3O8LA 4DMLA 1Q77A 5BWOA 3KQLA 1DKQA 5LDHA 1C9NA 4CM6A 4NL9C 3OESA 5LZ9A 1DAKA 1P6QA 4A1OA 4DN6A 5I7FA 2RMKA 4BB6A 5IJZA 4ASUD 4HX5A 2G8NA 3B9JA 1FTWA 1NXWA 3OBIA 4P3KA 3EWNA 3DVLA 3BE8A 4YJDA 3S40A 3PQ7A 3VHQA 4HCJA 4KAAA 4PW0A 2XQJA 2A9VA 3RB0A 2P3SA 2XCLA 3DCJA 1U7HA 2P6PA 2ONZA 2GEDA 1BJRE 3G8YA 1XRPA 3OZVA 3M3DA 1U90A 4JUIA 4U7HA 2QTGA 1LLCA 2UYYA 3GWGA 1L7XA 3AM3A 1VG8A 3GPBA 4AF7A 1GUZA 3PRHA 4KNVA 1ORDA 2GA8A 3MT0A 1U48A 5CVCA 5IH3A 3P20A 5DB6A 1EFHA 2J5XA 4X71A 5SY9A 5IYZF 2GBFA 3B0XA 3E82A 5TPZA 2OCBA 3RO7A 4UTNA 1XBTA 1IN8A 1KC3A 1XWFA 2FX3A 2Y93A 4ETIA 3M4YA 2FDRA 3DE7X 3PNCA 3FB4A 4X7PA 2DZDA 2NP7A 1Q8KA 4MKZA 3RRXA 4YY3B 5K9ZA 2DKFA 4ENTA 1V11A 3DXXA 3K9CA 2UUAB 2ZITA 1MQ2A 2O8EA 2V45A 4MQFA 1TYCA 3HUTA 5B37A 1MO5A 3V8NA 1EP3B 1KEEA 3JYNA 3GJTA 3DWEX 1FNDA 1EVJA 5LB2A 3RM3A 3V4VB 4EHNA 3N8HA 2AK2A 3O83A 3QVLA 2XDWA 1Q7RA 1TKDA 2IQIA 3INTA 4ECWA 3BOSA 2XSZA 4TTSA 4ZOHC 3E7XA 1E63A 4R8VA 3TEJA 4Y1GA 4ZCSA 4HF7A 2ZR7A 2C5HA 2WF6A 1JXLA 1NYQA 1XUOA 3EFOA 3G3EA 3GFGA 4GX1A 4PZZA 5CVUA 3AHGA 3IH5A 3TNJA 1OCEA 3O3CA 4RA6A 5FLEX 2R4QA 4D4HA 3E9RA 3Q88A 1DWQA 4WXYB 3VR2D 3ZGNA 1XE3A 2BJHA 4B47A 1YJAA 4GRIA 2D2FA 4JA2A 4NZZA 2HV9A 5KX5F 2EX0A 2LM1A 1UDWA 4JU9A 1B2RA 3AVVA 3RVMA 1IY0A 4LF8B 4KO1S 1WKBA 3CX6A 3VZDA 3QMPA 4B4KA 3B8EA 4R8KA 4JVNA 4F4IA 4CMEA 3ZY2A 2E8OA 2VHJA 3D4IA 1K88A 5JTUA 1ZNZA 1P2TA 2VAMA 5AXBA 3U4MA 2GD1O 1P77A 2FWPA 4GX2A 3NTXA 4E33A 5B7PA 4XIFA 4BBJA 2FFBA 1V5FA 4A0HA 4L15A 1JVSA 1M1NB 1SC1A 3Q40A 2A9FA 2PFNA 4DUYB 3N4MB 1I6LA 4I5IA 4MRMB 2VCHA 3K7EA 5LN1A 2CVPA 2NX2A 1YZYA 2CVHA 5KC9A 4Q43A 3MUOA 3BMNA 4C4RA 1WZEA 1Z82A 4PXYA 2H1VA 3AU9A 2Z57A 3BIXA 4MCHA 4YACA 5BSRA 4QW8A 3S1AA 4TUSA 5JFOA 5KVSA 3WP0A 1CEYA 3KXKA 4O3RA 4KUHA 5CD1A 4GL2A 1NJZA 1SKRA 3SG0A 1DC4A 4GXTA 2V7WA 5C18A 4XWKA 3UATA 2XMRA 3K8ZA 1ZUD1 4NULA 1L5RA 5DNEA 2FSVC 1LSSA 1GL3A 2XUZA 4H1HA 3R24A 5D6OA 5EUCA 5EJMA 5DB9A 2PV7A 5LP6A 1UCVA 3DMDA 3EQ2A 2QTWB 3G0CA 4AW9A 3O2QB 3Q85A 2XIJA 4OXQA 3RU7A 1GRQA 5TMEA 4DV1B 4QWCA 4QIWF 1TYEB 2A1AA 1VP3A 1VE5A 3BGVA 3EEQA 5AHOA 2FEOA 4DS3A 1CR2A 1VLJA 3KT6A 1FUKA 7GPBA 4Z4FA 4YRBA 2BCSA 1PR5A 2C2HA 1ZD2P 3MJVA 5G4KB 4FHEA 2I9GA 3HBFA 3QUSA 4LYYA 4MPDA 5J5CA 1GPKA 3NBKA 3GMSA 5HXAA 3OE4A 5HHIA 1RCUA 1NM5A 1WZIA 1XD2A 2Z2IA 2YQ5A 1L5WA 3O8OB 4EF5A 2UZ4A 1UXJA 4RD0A 3DKKA 4EELA 3SSNA 3SFZA 1BKYA 4F1WA 1IOZA 2NADA 2GKGA 3DXFA 1L2TA 4F5OA 3A1NA 1U0SY 4YP1A 1SVWA 1PVPA 1E1QA 2UVWA 2JLRA 4XTRA 5DTIA 5AM2A 1N8KA 4IQTA 3K2EA 5AO9A 3N76A 3OE7D 4C7XA 2RJOA 1LDYA 3G2PA 3KUUA 1FFBA 3VVLA 3KWJA 1WCYA 2EBFX 2DETA 4LDQA 2BZSA 3DOIA 3ZG6A 5JNWA 5H1YA 2O4UX 3PD0A 2NN3C 4XGIA 2P2DA 4FYHA 1YOBA 5ISMA 1H2EA 1XTPA 3T5DA 2ZB4A 5J0OA 4PV7A 1TC1A 3GLIE 4JJIA 2ESRA 1I4LD 3VKWA 1JNXX 4UBIA 3T5MA 1Z2EA 5KNIA 1IVYA 1TGYA 2YVQA 4TL8A 5TPWB 3AJEA 3GFVA 2PKQO 1J0XO 4NC9A 2ES4A 5CHGA 4NBLA 2W6OA 1W1UA 4ND3A 1K5GA 1UJ6A 2ZIUA 2VA2A 4IOMA 3TIGA 4Q05A 3ZLVA 4X92A 4XIIA 4DVGA 3AESA 1IEQA 4E51A 1E7SA 3WGQA 4JLAA 2HWKA 3UHAA 1Y81A 4AO8A 1DAPA 4GRDA 2ZBUA 3DAYA 1SCUA 4DL2A 4IJQA 1UOOA 3GVXA 4F3RA 1WQ3A 5MGBA 1JG3A 4G0UA 1EKXA 2GFHA 1Z7WA 4I1OA 3TUZC 2MYNA 3BFKA 3MT7A 2RGYA 2PQ0A 3W9UA 3Q3CA 4YAFA 1B7GO 3BZBA 1H6DA 2AX3A 3P2EA 5TT1A 4CQLA 4YRSA 4V0QA 3C1ZA 3OU7A 4RM3A 4V39A 1X19A 1JIUA 1Y8RB 3M9LA 1CX9B 4KPFC 5C35A 1N2ZA 1N4DA 4GLBA 2EP8A 4RHXA 3TTSA 2O2JA 1J39A 1KJYA 1RWVA 3CPHA 3LT5A 3NHBA 3QOWA 4KVGA 4C01A 1C1XA 1MU0A 1H2HA 2MA1A 1T3ZA 3CVOA 1SCBA 3IP9A 4NY1A 4R40A 4F8JA 4RTKA 2O1WA 1X87A 4AROA 1XA4A 1RLJA 2GKOA 4FZNA 3EPRA 3EVNA 2HHTA 3QPWA 4OHXA 3V48A 5KYUB 3U3DA 1T9KA 1JWBB 1L1EA 2AYZA 5CJJA 5EHZA 2BTQA 1F2UB 1NFQA 3KQVA 4O59O 1O95D 4L27A 4Q8EA 4HAUA 1CFZA 2XNCA 3RFFA 3VJLA 4BO2A 1RC8A 3G68A 1BKSB 4YAGA 1YUBA 2VYND 4UEWA 3FYUC 2G07A 3K3PA 3UTCA 4UFOA 3VPGA 3Q7PA 1WCIB 3A4TA 4UEKA 4NYJR 5JXJA 4QECA 1ZRHA 2DUJA 5JAUA 1E0SA 4JYBA 1ZJZA 3THRA 1XDGA 4OQ4A 4GC7A 1BGWA 5BW4A 4BNDB 4QRIA 1CUXA 3G0BA 2C0PA 4QXOA 1Z47A 1PWZA 1NNLA 2UV8A 4Q8FA 2Z98A 3Q9NA 1V8OA 5LZ8A 1M5RA 1Y80A 2IKQA 1B1CA 3AINA 4G01B 4DMKA 5KT3A 1YT3A 2O23A 1AS3A 3SR3A 3RC7A 1ULTA 3VZCA 3PQ8A 2YMQA 4L75A 3RH5A 4D81A 5HQTA 3MVEA 2CD9A 2ZRNA 3RTDA 1X7ZB 5SZIA 3BQTA 3AF0A 5AW4A 1P4HA 1KY4A 3LW8A 5C1BA 3U37A 5EJ5A 1MDFA 4JP5A 1R9JA 5B1DA 4OD0A 2J9ZB 5C5CA 4FSDA 1TM7E 1WW2A 2EIHA 3VKVA 2Q3DA 2H5LA 1UKCA 1ZMBA 3KB1A 1C4KA 4MR8A 3UXMA 2C7RA 4M9RA 4O29A 3T15A 5LMZA 4W8GA 4FYVA 3DNFA 3EK2A 1AKMA 4LK3A 2XTMA 3EF0A 1PW7A 4JN6B 5T3YA 1J20A 1GZ4A 1ULUA 4JCOA 3BE6A 1TO6A 5LD2B 4HQFA 1EDEA 3SPXA 3OQOA 5F4BA 5FOUA 2A5GA 4QTYA 3UPUA 1SKMA 1CS0B 2WHQA 1N7IA 3T52A 1RXEA 5GZ6A 4M7PA 1OPXA 4ZQCB 1EG7A 1FNSA 1P81A 1KDHA 2XF8A 3FF1A 4FGZA 4CGYA 2PZMA 2B5VA 1K68A 1IHDA 2QXTA 3PCRB 3PT9A 3TN7A 4BNKA 1IHYA 1XRJA 5DLDA 1TQHA 1YJCA 4N5MA 4TKUB 4UTRA 5J58A 1JMSA 3NCTA 1JTVA 3CPJB 4YRDA 3VVBA 4L4RA 5FEUA 2P4SA 3FE2A 3VYWA 1IIRA 3KYDA 4OQPA 8ADHA 3PVXA 3HQ4O 4WKPA 3MMXA 1VHWA 1NK5A 1E6UA 3H4DA 1J8QA 4AZSA 4B74A 2A3VA 4E5YA 4ZMSA 1NUHA 5IILA 3RS3A 2X19A 2TRSB 3QVSA 4LOAA 4I2AA 1ZQNA 3I9LA 5K0ZA 2FFHA 1YE3A 2ZBEA 3KZMA 1JA1A 3HPRA 4I08A 4PHTA 3D8HA 3U81A 4C4AA 4WLUA 4DPMA 5I5EA 3AL0C 5IM4F 1CVIA 3OQPA 4KTQA 1DEHA 1JA0A 2FFRA 3STVA 4QSHA 2P41A 4BNTA 1TT5A 5KPJA 4Z4EA 4ECEA 4PIPA 1L4EA 3ZWVA 1HQDA 2JC3A 5M3BA 1BPBA 4C7BA 3E7FA 2XA1A 2XD4A 4YASA 4X1YA 3Q7QA 3CUEF 1LNQA 4R7ZA 3UV3A 1UEJA 4C6SA 1YRWA 3A10A 3FCCA 2VXBA 1ZD8A 2HBRA 3MTJA 5IXJA 2ROQA 4UDXX 3ANYB 3C7TA 4BVJA 1Q16A 4WOPA 4DR5B 2ANCA 3GRFA 3NTOA 4OVKA 3LCMA 5ILGA 1NZPA 1Z45A 1E3DA 3NHWA 1THMA 5HIJA 4AYXA 5FTWA 4TZ6A 4NOJA 4XUSA 5J40A 4EPWA 5CDHA 2GPNA 1BXGA 1IBSA 3IQXA 3DFUA 4ZOBA 4BZZA 1N92A 4DBLC 3CRXA 5BMOA 3PNOA 1CC1S 3PB3A 4N12A 2ORIA 4U6PA 1UINA 1E2FA 4PS1A 3MMNA 2MSWA 3BL6A 5E6SB 1QV9A 3B6MA 2Q46A 2QVGA 3RJTA 3UOWA 2NSYA 3NTRA 4WT7A 4PSAA 4RVOA 4G89A 4XJVA 3ZY5A 1B0PA 3GJZA 4WCFA 4YDRA 4XJXA 4CLHA 1XPRA 4Q82A 5B36A 2O6HA 4EX7A 1OH6A 1EX7A 5F77A 2PFKA 2ZDQA 2NUPA 2IPNA 3I05A 4JJFA 2QGFA 2W7PA 3AY3A 3OMLA 4RVGA 3RS7A 2F8SA 3SKXA 4FT2A 5AJXA 3B9PA 4EJSA 1USIA 3SCZA 5B1SA 3DQZA 5CM9C 5JIBA 4C6TA 3KC2A 1MQSA 1P4RA 2DWCA 5K8TA 1FCJA 1L7AA 1FRVA 3FWKA 2JS7A 1NR1A 4MV1A 5AI8A 4PWZA 3E35A 3O4IA 2IVZA 2Q8PA 4HADA 3NDBB 4LVOA 9ICCA 1RYEA 3WL5A 1SO8A 3ZGZA 3AL2A 3PTLA 3HXPA 5LB4A 1N61A 1OWMA 1Z6AA 5JY6A 5JJLA 4K05A 3DTVB 4FFLA 3HO8A 4BMYA 1NDUA 4OYLA 4DJJA 3DUFB 1U8UA 3AEUA 4OF4A 4EWLA 4HWTA 1YQXA 4BNFA 2VAWA 5KFQA 3ENNA 5HBRA 4WY2A 1Q1EA 4HMPA 1H8EA 3E9QA 2IOFA 1F8FA 1XD2B 2C2YA 5DMHA 1PZEA 2A5LA 3WBKA 8ICEA 1KAMA 1W93A 1RI4A 2QAGB 1D5WA 1VCHA 2IXDA 1DRUA 2P30A 3F3SA 2VJ4A 3QKSB 4WDQA 3IKLA 3CHYA 4YMTA 2KIWA 1E94E 1G59A 1H4QA 4UCWA 2JHFA 1T3GA 5KMGA 4DSUA 1QP7A 4FZJA 4GNRA 3O0TA 5CMLA 3CZCA 3D7MA 4GP9A 1ZXXA 1Q21A 3AEZA 2BR4A 2YXPX 3PFGA 2GO7A 3E0QA 2F76X 3V7WA 4A8HA 2JHGA 1JHXA 2DR3A 3IALA 5KEIA 3LRTA 4K8OA 1FF9A 1HTWA 2H2DA 3C5VA 3VNRA 4LX8A 1WXIA 4LF6B 5DX1A 3W4IA 4DSJA 2ZJAA 3T3GA 5A6SA 1VGRA 1NRWA 3E18A 9ICSA 4UBMA 3TQIA 2HCBA 5EZ5A 1ZQGA 9ICOA 5D3MA 3TDKA 1NUSA 3AH8A 1BDMA 1GZHB 2N47A 3PD7A 3PXBA 2ZTHA 3HA7A 4H31A 4L8LA 3K92A 2HLDD 3AILA 4DREA 2YXBA 3RU9A 5C3UA 3WBFA 3D6VA 2OXTA 3GJ6A 3G2OA 1RXSA 4I50B 4DLBA 3H8WA 1R10A 3GELA 3OI7A 221PA 1Q19A 4O1MA 5H3HA 3QVMA 3H2IA 1L3IA 4MLPA 4I66A 1Z8HA 1E1YA 2CHQA 2ISSD 2VKTA 2REXB 3OEEA 1PTJA 3RYTC 3AUYA 3MWJA 2AUMA 5FWYB 3TTWA 4Z5XA 1YBMA 2B9EA 4YONB 4RGBA 2IE0A 4X44A 3FMIA 4U7GA 3W5UA 4YAIA 3C6YA 3LXMA 5TQ2A 1CJVC 3DM9B 2PH7A 5JROA 2G1KA 3SZRA 2OM2A 5AVJA 4OK5A 8AT1A 4AMBA 4I1SA 4IF4A 2DJIA 2IBKA 2WSLA 2J9FA 2OXEA 4L8YA 1ZM9A 1CTQA 4EUFA 4C1BA 2BCGY 4F12A 4Q7QA 3RAQA 3P9YA 3CRNA 1HIWA 1SY7A 4P98A 5EMLA 1TB4A 2GNOA 2HWXA 1JEQB 2ZSAA 1KEZA 3HI6A 3FXAA 3OLVA 3EA4A 4K5QA 4MINA 3VJMA 3O4JA 3WBJA 4CR8A 3BE5A 1E7QA 3UXPA 1IXYA 1G38A 2QY9A 2DXIA 3LYLA 3G13A 5CNKA 4KN8A 2B0JA 3FUTA 2CBGA 1K66A 2GBCA 2XXJA 2I67A 2VPTA 4YRTA 5IHXA 4QPZA 4CU2A 3D4LA 2BBSA 1JX6A 2C7PA 5IIKA 1TJYA 4JITA 3TZKA 2VJDA 2ZDHA 3G9QA 4TWAA 4AG6A 2OZLA 1ZMTA 3PGVA 3UBTA 1E9VA 1KBZA 1W1IA 1W8IA 4S05A 2BOVA 4LJ8A 2ZR8A 1DNPA 1ODIA 2W48A 4J90A 5LBIA 2MYTA 4KN9S 3K09A 3CLRC 3WLPA 2Q5FA 1QIDA 2UZ1B 1TEXA 2GCGA 3JS5A 4N4AA 3LQYA 5K51A 2HYDA 4TMYA 3A9TA 4FDLA 3MSXA 4WERA 4WN9B 4XLTA 2RGDA 1SCDA 2CB9A 3KKKA 1JDUA 3C2QA 1FMJA 2ZSKA 4JV5B 1A97A 3ND7A 4RF3A 1MN8A 4FHGA 1KDYA 1EP9A 3NUQA 4DY4A 3ITNA 2R0QC 2AHOB 4RVNA 5EAIA 3QKRA 2OYRA 4MW9A 2G4CA 1ZOIA 2J48A 1Z6QA 3G6WA 4Q0MA 2ONJA 1GY8A 4F8RA 3BJEA 1GVNB 3PZRA 4PPYA 5I7UA 1D09A 5CD9A 4TTVA 4WFIA 1L7VC 4GKVA 3ZE1B 1KVTA 5L3RA 1TMOA 3GN2A 1XL1A 1QTNA 1Z19A 4GPZA 2EV9A 1HEKA 1XZAA 2GPTA 3GPCA 3GP8A 2ST1A 2LBPA 3R5FA 4PSDA 3P2MA 4L3WA 4LXUA 4ZYLA 3RRBA 2WAAA 3FYSA 1PL7A 3H8MA 1YVPA 1MQ8B 3ISTA 4C43A 1ZNYA 3EIHA 4OOFA 2PFOA 1KKXA 1VG9B 3HJUA 5E6RA 1N5WA 4NAVA 3ZCVA 1V8ZA 1U81A 1VE3A 1WMSA 2QNRA 1O94D 1KDOA 1KHHA 3IQWA 4XOUA 4DYVA 3NH9A 3LDGA 1G17A 3PVCA 3HYSA 1QP8A 3FNBA 4L07A 4GVLA 1NI4A 5G0UA 3DHEA 3RRZA 2V98A 3S3TA 3AT1A 3K16A 3L8DA 1K7CA 2QJWA 3G17A 2C04A 7REQB 2AX4A 2AFIE 3H4MA 2WTAA 4C7KA 4TZ0A 5KG1A 4L08A 1J07A 4JBLA 4KBFA 4MLZA 1C2TA 1NVTA 4NX2A 4XDZA 2WJ4A 6AT1A 2Z4TA 4XFJA 5A5DA 4Q1CA 1BWSA 4DQSA 4FMBB 4MWCA 3DTYA 2YQ4A 4PYLA 3LPMA 5CLFA 3TIXB 1DTWB 4PLCA 4M8NE 1N6HA 1A2BA 4G0QA 3N3BC 5DT2A 3QVXA 3G5TA 1XCJA 2EZ8A 4G26A 4BNMA 2DPJA 2QLNA 4FS8A 2PFQA 1QCCA 4QGSA 2AD1A 1SQ0A 2HLHA 1F6DA 2ZDGA 5ARCA 4FONA 4N7BA 5CX1A 4ZOLA 2PA0A 3JQRA 3LIPA 3KWMA 4X97A 5KYKA 1D8YA 4I0WB 4W5WA 2CNWD 2QRVB 1MNQA 3EIOA 4OU4A 3UT0A 3ZHVA 3G82C 5D5QA 2KE7A 3FR8A 3FM9A 1H2BA 4B3SB 1UJCA 3HXMA 2ZJ7A 4D79A 3Q8RB 3E3AA 5FPKA 1FMTA 1EXVA 2JLXA 4JSTA 3JYLA 3M70A 4JSYA 3PY8A 4WD3A 5E4TA 4EZ6A 3AOEC 3PBKA 5GONA 1W5AA 2O8CB 4MUJA 1AIPA 2R6ZA 1CVRA 2SKCA 5A06A 1N2OA 1QRAA 2W2LD 3DE5X 4UHHA 2QN7A 3FJ1A 3D8RA 3EBPA 4WMLA 4F4JA 4DG5A 3W5CA 1P4SA 4JWTA 3UMBA 3VSBA 5IZCC 2DGZA 3T5KA 3KJGA 4ZREA 2I33A 4OP1A 5EWJB 4JLOA 1EXNA 1ND5A 4M9JA 1P60A 2PT5A 3TQRA 4P0QB 1RQLA 1PP4A 3EAQA 4J94A 1CUIA 4HFJA 4BX3A 4WCFB 3D5EA 3CLSD 2HHWA 1XAJA 4I1YA 1TPZA 2J6CA 3WQRA 3DKPA 1VMEA 1GNPA 3H6KA 4YUYA 1F1BA 4BAZA 4M36A 4WXEA 3SHQA 1CV2A 1N7GA 5IZ4A 3F98A 4PHCA 4ZA2A 1LSJA 2OBYA 2G77B 4RK7A 2AKYA 3VH4A 4KQ9A 4DS4A 3DDSA 1N1MA 3RR2A 3PI7A 3NHJA 2WYHA 3QEAZ 4XCXA 5JWRA 1C1XB 4HAYA 1I4OA 2C54A 3ZHCA 3F2BA 1Z17A 2IKSA 2PXAA 2KJ5A 1YV9A 1ESEA 2VYFA 1KRHA 1LI4A 2D1YA 3M8KA 4DRZA 3EGXA 2GYVA 4RLSA 4CUJA 4HLQB 4FCTA 4E5PA 2DFTA 2XV1A 3B6EA 4AMZA 5JAOA 1YGPA 1GGKA 1WP4A 2M2IA 4GE0A 5KYUA 3ZLTA 5EE3A 3OQVA 4DBLE 3OM9A 2VHUA 2HOFA 3P27A 4K9NA 3U6BA 3TLBA 1IAQA 1M2EA 1M1ZA 1H22A 1YZQA 2RCNA 3L6EA 5G3YA 1M2FA 3MRTA 3PT5A 4PZ9A 2VAVA 4ZEWA 3DHNA 1P4JA 4MRSA 4HWOA 1NJ5A 4V3BA 3QFCA 2VPWA 2OMEA 1J2JA 3FPFA 5BN5B 3A9WA 4KLHA 3ROEA 4C0JA 5L3ZA 1C1HA 5L1MA 3MJEA 1Q0RA 3Q3EA 4F5WA 3GJXC 1EGQA 2FU5C 3U62A 3UCXA 3DMYA 4GYJA 5ALIA 2ZYIA 3C1TA 1D2EA 2FW6A 3ZH9B 4YXMA 1YDFA 2GK3A 1U4NA 2UZ1A 3GK3A 4B6FA 2BFWA 3NGMA 4PYIA 3OJLA 1NVGA 3EXFB 1FDIA 5JH7A 2XX3A 3N6VA 4K9LA 1N2XA 1AU9A 2XXAB 5JU6A 3GRUA 4U4AA 2Y6UA 3MGGA 4ZT6A 4IH1A 1FRNA 3KFUF 3C28A 2EG5A 4JBWA 5FFNA 4J0IA 3DLTA 1F2VA 1FDWA 1NJ2A 4RAQA 1U9YA 1ZCJA 4GQBA 2YRWA 5K45A 1NY6A 4GWLA 4K2AA 4BEWA 2UVRA 3OF5A 2K7ZA 1CDOA 1PGJA 2R8RA 4FR5A 4O4LF 2IPLA 3H04A 2KKVA 4PTYA 2X8AA 7ADHA 1S0VA 4NFLA 5C0OE 1LBSA 3FUVA 2BPGA 3INNA 3ZCUA 1TVCA 2J6UA 1Y48E 2BFBB 4Z6CA 5GADl 4KFRA 1CY6A 2QW0X 4MJ7A 4GSYA 2AA3A 3GWZA 3A3KA 2NM0A 2RGAA 3U40A 2GFIA 3ZBTA 5DDYA 5ALMA 2Y77A 3HKEB 4YUWA 2R7NA 2O0KA 5JECA 4I9FA 4OHYA 1P1KA 4RQ6A 4GLFA 1HNZB 1Z0FA 4TS9A 3UMSA 4C2UA 2Q3EA 2OORA 3JPNA 1BIFA 5CR9A 3S0JA 1E2EA 3JZDA 5AKEA 4J7UA 2ZM6B 3GFTA 3PR1A 3Q7IA 1Z5VA 1U1GA 2GN9A 5HOEA 2V9WA 4U2DA 3R3ZA 1XSNA 1AVTA 1T5TA 2HMTA 3EN0A 4WZAB 2PLWA 3D9QX 4F60A 5LBTA 2PZKA 4C7OA 2HA7A 1XXLA 4P0PA 5JHHB 1GM5A 2KB0A 4RE6A 5IKEA 4ILEA 1R9GA 3JPPA 1Z5UA 1KKLA 5KFKA 2BHNA 4HTFB 1KK1A 1FK8A 2RBKA 4L5BA 4QWDA 4EJ2A 1GAXA 4M99A 1ZK3A 2XICA 3QVJA 1NVBA 1P2DA 4OI0A 4HGYA 2C9BA 2E4VA 2X0RA 1TZMA 4GMDA 4N41A 5LA6A 1BDJA 3B2EA 3ZZNA 1WCNA 2PVCA 1G2OA 1V6CA 4QWMA 4J4BA 1P1BA 3U9LA 4BXOA 2D7JA 4EBCA 3G02A 5JAPA 3IJ5A 2EFYA 3DOEA 3F3YA 1MT0A 2NYUA 2WFLA 1PUIA 2OP1A 1GILA 2XUFA 4DOBA 4MEBA 1XVLA 4OB6A 1K8ZB 2BPCA 3JVVA 1HZZA 1Q74A 2WU4A 1WB5A 3CX7A 2V0NA 4D42A 4YDHB 4Q1BA 2EXXA 5AK0A 5HKAA 3CP8A 4YUXA 5CH8A 1L5UA 1SH7A 3NGDA 3ZZ0A 3T7DA 2O2CA 3TLGA 2FSFA 1T0JB 4D41A 1O0CA 4C8MA 2Z4RA 5BY2A 1NZBA 3MTDA 4Q6BA 3WKEA 4R9RA 3SYKA 4EH1A 2FQQA 3A7DA 5PGMA 5JUWA 1UR5A 3X1YA 3ADKA 5TQ0A 1K6JA 2B36A 3HB5X 2ODPA 2JDID 2Q3MA 5FL7A 1SQ6A 1MO4A 5EZYF 4FFSA 3N28A 1DT5A 5EY5B 2HJVA 3RFCA 1ZU4A 2GM5A 5H02A 1EYZA 2PLAA 4EQZA 1L6RA 3AYZB 5ERXA 5J2BA 4YRJA 3AERB 4AKGA 4QQNA 1DTEA 4KGVA 4B9MA 2IIVA 3FI9A 3GC6A 5KFXA 4RNDB 5DM70 5KNLA 3OA0A 9MHTA 3GARA 7ICKA 1XZDA 2MSDB 4IC9A 4DJFC 3ADDA 3IDOA 2HO5A 4E15A 1DEKA 4Y2HA 2HOIA 4BQIA 1T0PA 3HB9A 2WJAA 4PYKA 1PJBA 3IPYA 3CS3A 1JT2A 3SXPA 2BQRA 4DLEA 1WV0A 2QT1A 2UUPA 3NRCA 4AL4A 2RC5A 2HRZA 3HU2A 5IAJA 1S7CA 4Y2XA 2QKQA 1XC9A 5EE5B 1QGOA 3E84A 4K7JA 4S3MA 5DE3A 4E5MA 4ZMRA 3JAWB 3PFBA 4UUMA 3P45A 3MWYW 4RD4A 4D45A 5MN6A 4KLOA 5KYXA 1CEEA 3GEHA 2J30A 3AF2A 4P80A 1PQ4A 1G8PA 4ZJZA 2BGJA 5DB4A 4I2HA 2O06A 3GB9A 5F7OA 2M0NA 3RRGA 2Q6VA 4LZOA 2VPIA 2XZDA 4L4SA 5T4BA 3WDSA 3HN6A 4W6ZA 521PA 5BVHA 2G17A 3V7UA 4IGIA 2PZGA 2PL1A 4H7EA 4NYJQ 5BMVB 2NZWA 5BXYA 2OBLA 3V6HA 4H3SA 4BMPB 5KTOA 3LXUX 1NBHA 3NIGB 2K8AA 2WHPA 3Q3JB 4MVJI 3TSWA 4J29A 3QBEA 3JQ8B 2EZXA 4QATA 4BX0A 1O58A 5BN5A 1Y7PA 4BVEA 2XJ9A 3S68A 2EJBA 2YIJA 1TYDE 4DSTA 2FHPA 4KUEA 5EUQB 3R0IA 4US0R 5KYYB 4N6GA 5I5GA 5CLJA 4TYNA 3H5NA 3PEEA 1AH2A 2YJ6A 2GZ1A 4OL0A 1X8LA 4EX6A 2HHVA 1ULAA 3Q6MA 2GSWA 5LP6B 1CY8A 1U80A 2CCKA 2HK9A 2BIFA 3R3XA 1ZQMA 4UCXA 2VNHA 1OWPA 2HX1A 4D02A 5FD8A 3CBQA 3II6X 1GN8A 2XGSA 1RYMA 4I8IA 4PIMA 1TUBB 1RM5A 1YK1A 4RHFA 3ME5A 1WTCA 3ACDA 3V2GA 3WVNA 2P9GA 3SC2B 2HHLA 1W46A 2Q1TA 4D9GA 3EE6A 3KB6A 2YC4C 3DMTC 4R01A 4TM7A 2FK8A 4R2IA 3CO0S 3GX1A 3M83A 1TZBA 3IAUA 2WTBA 4DLUA 2J0UA 2ZBVA 4UB1A 4RHYA 3FX2A 5U4QA 4MGEA 4Z7QB 1MP0A 1Z33A 2RBEA 1KO4A 3TUIC 1XTZA 3EEIA 1UBTS 1YAJA 2C82A 2H00A 4EENA 1PS8A 3DJYA 4PG4A 3O8CA 4FBMA 1E7WA 1QYDA 2JPDA 3RT7A 2YDYA 4TVSA 4JKYA 2FMFA 2NOAA 2JGDA 2QG4A 3AY0A 3HKEA 3DFMA 1UZAA 4YT8A 1DOQA 2QRPA 2OEPA 2ZAYA 2BUBA 2UAGA 2WB1C 2WHRA 4KSCA 5BPFA 1F4LA 5JEEA 3A9SA 1EFVA 4KREA 2QLMA 1X7HA 1WNTA 2YFKA 1JW9B 4GVPA 3AEVA 2R84A 2H3VA 3UXOA 2CLIB 2BMAA 3KSRA 2P6NA 1CUUA 2VUTA 3IT3A 2HSEA 4KVAA 2XDYA 2WHXA 4AWAA 1L4UA 4JXJA 4KFCA 3H4IA 3WFJA 2R3SA 1FJHA 1V7QA 2INGX 3FYUB 5JCJD 4X91A 4PZNA 3IP3A 1A6SA 3IMGA 1XTRA 4OXXA 1J90A 1I6MA 4QPDA 1RTKA 4R2LA 2D4HA 1CZRA 5GZ3A 4S1PA 4NMWA 1S77D 1ZUWA 2JR5A 1GPAA 4GPIB 3ZQUA 6Q21A 1A8QA 2H18A 3WMFA 5HHHA 4P5PA 4E0BA 5A5EA 1WLSA 4F2GA 5C8YF 4IY1A 1TZKA 2ZLBA 1NK8A 5JRDS 2O52A 1A4XA 4K6OA 2P2YA 4D96A 1Z7YA 5BSGA 1EE1A 3CR7A 5CLHA 5IJAA 5HPYB 4XQCA 1XTVA 5L6LB 4I2IA 1I5RA 1JUDA 3BDAA 2R8IA 1JDVA 4Q3EA 3ZGOA 4W7HA 1UBFA 2RGRA 1V16A 2PD6A 5EKSA 5JZSA 3H3JA 4G0XA 4CFZA 3D3WA 4CIVA 3ENVA 3K9GA 1UJNA 1U2ZA 3NVVA 3AGQA 3P96A 8ICSA 2QL5A 4A8TA 2F44A 3R0QA 5THKA 5D1HA 1UL1X 2EIXA 2GZHA 3OZEA 5EJIA 3RC3A 2BFNA 1SRQA 3AG6A 3TB6A 3VOAA 4QSMA 1XCPA 5ELXA 5HEKA 5C8ZA 4RYLA 3PW2A 4CYMA 2I9PA 3LSTA 3MFHA 5F98A 3OCWA 2GLUA 1JGTA 1X7XB 4UE3S 1P62B 1LB1B 5KL8B 3H7AA 4YRCA 1JG7A 2PT7A 1ZYQA 2G5PA 1D9DA 3TTVA 1W29A 2WJ3A 4QDJA 1WWUA 3LJKA 3QELA 3ER8A 4TYWA 3VRHA 4O3SA 3HABA 4CCYA 2VJLA 2H1LA 2ZU6A 3QFSA 5DZSA 4OAPA 3CF4G 5DBGA 3SZ2A 2JGKA 2Y1FA 3KDAA 3ROQA 1AGNA 4D26A 4YHHB 3DV9A 2IYXA 2Y99A 4LZDA 1O96A 4MZDA 2P4UA 4BNXA 2YY6A 2F2TA 4EJSB 2AMLA 1UBRS 4YR3A 1ZQIA 1OBHA 2CFRA 2QGZA 3OKPA 1QRDA 1SFRA 1VLBA 2FPIA 2G82A 3FDZA 3MCUA 4RF5A 5FCDA 2J3HA 1EUCB 4OSOA 5CA0B 3H84A 2F67A 3E9ZA 3UXNA 1OX4A 1TCUA 4EOGA 1SVNA 2CK3D 1QPZA 4E3WA 3G8DA 1TO2E 1VYUA 1CG6A 4UUPA 4UTVA 3NHZA 1E1LA 4XWAA 1P9NA 1EK0A 4PC7A 4UHKA 1AX9A 5LDGA 3EFHA 3TMKA 2IRWA 2JD1A 2YV4A 5SZKB 4Z9AA 2BCQA 3IKTA 2G9VA 4H7PA 5JXIA 2B20A 3F73A 3ED5A 1KZ1A 4DW8A 3BHMA 4PINA 1VSUA 1EK6A 1MAWA 2C2EA 4KXNA 4Y0AA 2EQYA 1Y42X 1MZPA 1MIHA 1GPNA 2AR0A 1H8HA 3WSTA 4QT4A 2JFHA 2PZEA 5KOYA 5F35A 3B1KA 3BHIA 3IEMA 2XCAA 3ZVLA 1U8CB 1HT2E 3KL4A 4U0KA 1CZUA 2O2ZA 2Y2VA 3EA0A 1T8EA 1XZPA 3JQAD 1UBHS 3KR1A 4P4LA 5CURA 1RQ7A 2Z9DA 5FOSA 1G5RA 2YUIA 3TQSA 3OCVA 4L5AA 4LC0A 4GICA 4BMZA 4YT2A 2Q5LA 3BQ2A 3RH4A 4HWGA 4EQ6A 2DX7A 4HN9A 1KJ9A 2R1VB 2VT2A 4I8XA 3RSGA 3WKCA 3TZCA 3K71B 4PZDA 4EY8A 1OY1A 1XLWA 3IR7A 5JD4A 1VSQA 2B8TA 2VP9A 1Z0ZA 3H5TA 4TKVB 1YZVA 3PR2B 4CUKA 2AN5A 2PX3A 3TTYA 1E2DA 3PXEA 3OSPA 1ZONA 3AM4A 5JZVA 5K0FA 3DGEC 3VZQA 4QIWC 5KCZA 1B3RA 1RAAA 1JI3A 2ID8A 4RNMA 2CJWB 3IKVA 2GX6A 4TKLA 1DDOA 5EHNA 4LI0A 4CHTA 2R8OA 2RKWA 3RASA 4CRXA 4HDMA 1I1OA 4MHVA 4EY5A 4YMUA 3HWTA 5AVWA 5JMOA 1W85B 2FQYA 4N3AA 1OI7A 2IOYA 3F6YA 5CU7A 5DEIA 1NSTA 2FDCA 7ICOA 3PSTA 3IIIA 5EA2A 2HW8A 4RANA 1HFJA 2ZRHA 4F2SA 1M72A 3OEED 5LFAA 2V1UA 4E2ZA 3TM5A 4BNWA 1Z0JA 4D80A 1X1SA 2AKAB 2HO4A 3I0ZA 5HFAA 2PH1A 2VBCA 5C51B 1T9ZA 2K8CB 7ICGA 2BDEA 4GR9A 2PEZA 2B69A 3V4ZA 5HK8A 1S2GA 2AJDA 3DE2X 3NLLA 3ROFA 1EXWA 5H80A 3BHNA 4RHUA 5LMCA 3GDGA 2JJ8A 3QU5A 1NC3A 4DQPA 2BFFA 3PS9A 4JJKA 5ALWA 4YP6A 4ZYZA 2XRMA 4G4SP 1XNQB 4BFVA 2PYZA 4FYWA 5LWQA 1R0CA 1F2TA 3GJ3A 2XTJA 4DV4B 1D4OA 3LCVB 1HLFA 3UJPA 1XVIA 3IV9A 3DBLB 4UU8A 4Y9TA 1J9ZA 1M2OB 1OHHA 2HBLA 4ARZB 3EPHA 4YD2A 2VH1A 2JLSA 3BIJA 5FPTA 4WTOA 2J3IA 3EMVA 2AG0A 4BV2A 2RDJA 1OH5A 1A9TA 1KSJA 3HO6A 4G24A 2F8KA 2IU4A 2Q2NA 1ODKA 1LZKA 1HI9A 1VG1A 4MUIA 3DVAA 4DLRA 3GUZA 1K97A 4TTAA 2V5VA 1WVGA 3OP4A 4BOYA 2P77A 4K9SA 1NIPA 2WWHA 3VU9B 4KW7A 2A9PA 3AN1A 2ZRGA 1U7OA 2Q29A 3EZXA 3RIXA 3QEMB 3ZLBA 1TKCA 1OAOA 1NLYA 1TUBA 2B98A 4P34A 5K0JA 2NVUB 2OCDA 4CCSA 5F4ZA 3P0EA 2DG2A 3PWTA 5EI5A 2EEPA 3MXTA 3PC4A 4TRRA 4ETMA 1JHQA 1GPMA 4BVKA 2IZOA 1U3UA 4WZZA 1F7UA 1OQAA 2YS6A 4Q9AA 5C81A 5H8WA 3M6XA 3E3NA 3MEQA 4RTMA 2DHCA 4X61A 4F8EA 2V4QA 3FFAA 5EIXA 3PLNA 1CRPA 5AI5A 3Q4GA 4WE3A 3GMDA 5IJ0B 4KE8A 5E9WA 5CTAA 4O08A 4GGMX 1JEAA 2NTNA 2AW3A 2QTFA 4CQMB 1PFGA 2ETXA 4JL5A 3OEHA 1FFDA 1ZFNA 1XQYA 3T5GA 4EMTA 2AOVA 1DCMA 1FZQA 3PNKA 1UWVA 1VJTA 4F7DA 4ZDKA 1QG6A 2ICAA 3OUUA 1NBIA 3KOOA 1WO8A 5I8ZA 4E2XA 4GXNA 4CKCA 5ER9A 5K0TA 1Z7EA 4U9IS 3KT0A 4Q12A 3LYHA 1O7JA 1CQZA 1RKUA 3B5EA 3FZNA 1NKSA 4FPXA 4ZWNA 2IELA 2IS1A 3MCVA 4D98A 3M6ZA 2W0MA 4TROA 5FBVB 2EZ4A 7REQA 3PP8A 5CIWA 4Q3BA 3KTQA 4LX0A 2X9VA 3GLIA 1EUCA 5J63A 5CA0A 3LLSA 5FL3A 2P9FA 3W5HA 4R2XA 1G5IA 4ED6A 3BCSA 2RDMA 3CNOA 3RBEA 4PSUA 2V1XA 3Q6IA 1M7GA 1VPTA 5AW9A 1JVBA 1JN0A 1QE3A 4IHJB 4MP3A 4BGIA 2EAMA 1PJQA 1T5DX 3FUCA 1L7NA 3H11B 3OJOA 3ZJYA 3WXBA 2P4EA 4X6UA 3WGLA 5B58T 4KXXA 4GZ3A 4ACOA 1T6NA 2VUHB 3NDJA 3ITDA 4V2UA 5AK4A 2Y1GA 2WE8A 2Y2UA 3I8SA 3NOVA 3EWAA 4YJ3B 2YASA 3H2SA 2DBYA 1T94A 5ADUS 2YHSA 4PPNA 5C7IO 1VHLA 4MOWA 2OKCA 3C3BA 4EYOA 2GJ4A 3CX3A 3VPSA 1H1LA 1P1HA 3EXHB 5KFDA 2L82A 3OUZA 4B6QA 1RYSA 1VE7A 3DDOA 4B6OA 4M7OA 4CFYA 2V6GA 2HQSA 2R8YA 3N59A 1KK2A 5AHRA 1DC5A 1SQ5A 2FPPA 3F5SA 2SBTA 4IILA 4N0PA 2IHMA 4JV1A 5E2BA 1KXJA 4XZ3A 3I2KA 1WXGA 1FQOA 1OAKA 1XNSA 2A4KA 5E95A 5E6UA 3TUJC 4F6RB 2V6IA 2J4FA 3EZGA 4FEEA 3M4ZA 3V46A 2I8AA 3KBBA 1GR1A 3CZAA 3ELBA 3JTMA 4Y7CA 1GPYA 4L4ZA 2QTNA 4AZ3B 2CZQA 1AXGA 2FLNA 4QNLA 2VJAA 3DC7A 3GAFA 3K0AA 2OYYA 3OCXA 3A6KA 4JOBA 4TLEA 3T3PB 5BV8A 5L7WA 5CFZA 3KQHA 3ZK8A 1TK2A 3FKSD 3ZVMA 4MWSA 3H42B 1ULSA 3R41A 2PBRA 2JFFA 4HB2A 2FEWB 3LFTA 2JMGA 3R0VA 4PLGA 1DEXA 4EG3A 2EVWX 3DE4X 3HJTA 1UT8A 3AIKA 1QCYA 4XW2A 3BS4A 1QIGA 4OGLA 2IT1A 3EGDB 5FTNA 4IDNA 3I04M 1R15A 1Q3TA 1QSLA 5TMDA 3LL4A 4EW6A 2GPAA 1R0LA 4G1VA 1HPLA 1OB5A 8ICBA 1MVLA 4EHFA 1TEHA 2Q99A 3LQ1A 2BGKA 1E3EA 1JR4A 5DHAA 3RU2A 4DCPA 2GN2A 9ICGA 1US8A 3PNPA 4P2BA 2Q0ZX 2CF6A 2NU6B 3HZHA 3THXB 3HGQA 2D5CA 3RPEA 4YQYA 4B4DA 4QAJA 2QB1A 4FOLA 3QU9A 2VJYA 3VPDA 3AB8A 5JD3A 4NLNA 2F1JA 1W0KD 2CZCA 3IODA 1VFNA 3M49A 5FF9A 4PEVA 4IGKA 3TJZA 2GJSA 4GNKA 5EHXA 4ENWA 4DR7B 4LRUA 1PV4A 3OX2A 4ARZA 2A1JB 2AJBA 3IKMB 1ZQTA 1XRSB 1G8YA 2QJRA 2JHDA 3NAMA 4G56A 1D9XA 4J0GA 4NQRA 1VYVA 1P45A 1VSVA 2AI2A 5EMHA 3UEOA 3KZXA 3HI4A 1LKZA 1V35A 3Q5GA 1E9AA 3L4JA 2E9SA 4HRXA 5L4NA 3R7DA 5FBZA 2QX7A 1M8FA 3Q3HA 3AHDA 4BATA 1OZ0A 2FWMX 1I2MA 3HLTA 3IQEA 2L42A 4B8ZA 4B3TB 1PR2A 1VE9A 2ODNA 2VNKA 5EIFA 4RMNA 4BO8A 2G5GX 1Y89A 1DX6A 2XWQA 1C0KA 4HZUB 3O8QA 4IQUA 1Q6YA 4JJ4A 2M6SA 4AMVA 1HE1C 4AY4A 3G59A 5ALKA 4HTAA 1RLTA 4A5SA 1PT5A 3A6PC 3D4BA 4MTLA 2XAUA 4C0QC 2ZTUA 1VLHA 2YYZA 3MUNA 3IUSA 3I39X 3OFJA 2ZIVB 2YN4A 1UKBA 2VEOA 2AR7A 4X45A 1L3SA 5LXTA 5COBA 1R88A 5KTYA 3DVRX 4YRQA 3MD9A 2XPCA 1PVQA 3GMTA 1KZHA 4GW3A 4IINA 2IHYA 5DTMA 4BTEA 1X2BA 2GEKA 4MR9A 5L4LA 1P1JA 2O3UA 4XXHA 4AZ0A 2RDIA 4KOEC 3GDHA 2GWSA 4X20A 3E9EA 2H8KA 4HEQA 3KAPA 3GJ7A 1PYGA 2CLHB 2PXCA 1I5OA 3TNDA 2Q41A 1Q0LA 3S2SA 4ALNA 2ZBGA 3JQFA 1A8SA 2XCOA 1HKHA 3PUWA 3OPXA 4B5LA 1J2TA 4ZEXA 1P2UA 1S10A 3UV7A 5TF4A 4HKTA 5HQJA 2XT9A 4PO8A 2OZPA 1GN9A 4IUCS 1BD4A 4RMGA 5HOQA 1MA7A 2QPLA 3VISA 1NF2A 2QF7A 4HDCA 4MJLA 1TV9A 1EFDN 4Z49A 5KYGA 2WJZB 4DUGA 5JDIC 1GGNA 3O3NB 4J75A 1NE7A 4YNBA 4ONEA 3WY9A 4J9RA 4FINA 3WHLA 4GDMA 2HI0A 4R4JA 4IGEA 2RGBA 3PSAA 1F17A 2DY1A 4R7TA 1VPDA 4UDYX 5F3RA 5IW8A 1Y5NA 4GZ5A 3RADC 2ZIWB 1EK5A 2JAUA 2IS6A 1Z2AA 2IZZA 3W2GA 3FOZA 1QQAA 1COZA 1OLUB 4IIHA 3V32A 1MXHA 5JSYA 2EARA 3BULA 3NWEA 2CB0A 4MVJE 4X84A 1ZRSA 5CVDA 4Q3OA 3Q5DA 5EMMA 2I1QA 5B53A 1P2GA 1F48A 4RL6A 4AK9A 3PFFA 2VQEB 2HA2A 2CVQA 2D3TA 5JNRA 3E7DA 2FRVA 5IRCD 3HXLA 3C16C 4HYTA 4WNCA 1T5HX 4HX9A 2GDJA 3DEZA 3TSYA 1XOIA 5T8KC 4OBWA 3KQKA 1LW7A 1WRBA 3GZ4A 3I12A 4O3NA 3KB8A 3DW3X 4EG5A 4NYMQ 3DLPX 1X7WA 1OSNA 3BIFA 2IYRA 1GU7A 3ZJTA 1T1GA 2F3QA 1P73A 5BQ3A 1EINA 3DKVA 3BWBA 3QNMA 3AEUB 3C6BA 1NU8A 1R4ZA 4FCVA 2NZ2A 3OIDA 3Q0EA 2EWMA 5CIQA 5EOZA 5CHEA 4WOCA 1QSGA 4WJZA 3I73A 3V7YA 1OC2A 1T8SA 4EYHB 1BCSA 4CQMA 2JD0A 1NVXQ 1E96A 1ECCA 1JYSA 1UQTA 1UWCA 3LQ2A 4E5NA 3U4HA 4J7AA 5BSVA 2JEOA 1C0PA 2Q2WA 1JF8A 1FQJA 5HIMA 1PYDA 3WQQA 1Q15A 2Y0SF 3FMVA 3FCEA 2WM3A 2P40A 4Y2GA 5KFVA 3JQPA 3ESXA 1SXJE 1G6Q1 1A88A 1KNQA 2J6HA 1X1RA 1RWWA 1IPHA 3IAM6 1KOLA 3U3JA 4DF3A 3JYOA 2XHZA 1VL1A 2DCUA 2RHOA 1TJ3A 2IUYA 3BSWA 3H1PA 5EKUA 1SV0C 4AFNA 2J87A 1M34E 3CZRA 5COQA 2Q2QA 5EIOA 2EGGA 4O2BA 2CSXA 1QQ7A 1Z37A 3FVQA 3ONEA 4NCHA 5JD5A 1REQB 5BR4A 5JZMA 4EA7A 3FHLA 2WAOA 4IHJA 3SNHA 1M66A 3C3XA 3FKJA 4NLKA 3E8SA 3K30A 4HNHA 1KZGB 1W2WB 3ONFA 5EINA 1FDRA 3NALA 1JQBA 1TQ8A 3FCAA 2OKGA 2YVKA 1XU7A 4WJLA 2GBPA 2G5CA 4QO7A 4LS3A 4JI0B 3UYLA 1N1GA 1TZ2A 4AURA 3BYZA 1N2BA 3MGAA 1A5SB 2IITA 4KXVA 4PAGA 3UB4A 2XVXA 1O03A 2ZWOA 3LQRA 4TXHA 4B40A 5FH9A 1ODCA 2GEFA 4PCVA 3TZLA 1DOHA 3AU8A 4AP5A 3ZD6A 4P4TA 3IYLW 1T13A 3L92A 2WPDA 4LHVA 1VL0A 3UUFA 1Y9EA 1COOA 1BPEA 2JZBA 1GQRA 3LKDA 3ZBUA 1IMOA 2QD3A 5JISA 1RXYA 3B0YA 2W2MA 1M2VB 1RQPA 1BH2A 2XA2A 2CHVA 1JL3A 1M3SA 1XT6A 3IT2A 4JMLA 1OKKA 4PSVA 1Z4NA 1JEEA 1VIDA 3KOWA 4IOLA 2KVCA 4BX8A 3Q12A 1GSHA 5ALTA 4OQZA 3HXTA 2RK4A 5DHTA 3V1LA 1CUDA 3R09A 1Q44A 5A5GA 4UU0A 4QDZA 3RYCA 1FUIA 4GP7A 4F50A 2Z5VA 4I6EA 3S27A 1WDLA 3EPKA 5AMXA 1A2OA 1NOKA 1Z4LA 4OHRA 9ICNA 3A0HU 2XOEA 2ZWAA 5DBCA 4P82A 4DBZA 3UXYA 3K0AB 2OUIA 5DN9A 2ADFA 4U8GA 2P9TA 3W7BA 4E32A 1DL5A 3FFBA 4XB2A 4EATA 4K2HA 1FXWA 1TW3A 5H16A 1I4EB 1OI3A 4MGKR 1IPFA 1D0IA 1MX3A 4F3YA 3ZYZA 5EFOA 2EFEB 2XYQA 2JJMA 3GRKA 2P0EA 3CVYA 4P1ZA 5FUBA 4HGZA 1T26A 2E4WA 4WV3A 1WUIS 1FFYA 1YJQA 5L1LA 1FFXA 1VE6A 2RHWA 3WLRA 4AUNA 1YI8A 1N48A 4RWEA 3EEOA 1V4BA 4R81A 1KMHB 3U60B 3A1SA 2FKAA 3TGPA 3DTTA 3PRKE 5J0PA 1S0NA 3OHAA 1T3LA 3C2LA 2SECE 2VHTA 3FMOB 1SC3A 3H1FA 3PSHA 4Q03A 3ZQKA 2XTNA 1LF0A 1ZG3A 4KTVE 1CF9A 4TT8A 1RWNA 1ECJA 4F5QA 3DBLA 4KK4A 4XUDA 2VUSA 3F4LA 2OHFA 1KKUA 5LWHA 4ZVUA 5MN5A 4DKJA 1J8VA 3VSEA 1KL9A 3COVA 3D7SA 5J8YC 3CYMA 3N70A 5F5LA 1Z28A 3O31A 3RLIA 3W90A 2I87A 3WR5A 5ICMA 3UJNA 3VBCA 2OWOA 2QROA 2WVAA 2XYGA 3FW1A 3QPDA 1YQEA 4HXEB 2YZKA 4G0WA 1RYBA 3U4CA 4DNOA 4M83A 3OTOB 7ICVA 3ZEAA 2A1TS 1Q6ZA 3NHPA 3DZBA 3EC7A 4QA9A 2ID7A 1G63A 2YX8A 1C1YA 2JF0A 2QUBA 2HXYA 4YHBA 3R75A 3MS2A 5DG7A 2PG3A 2ZRIA 3KVYA 2IYAA 3UWPA 1HE3A 5HR6A 4EI8A 4JBYA 1KVQA 3HKDA 3OTHA 2GEJA 3ZKWB 2BR0A 3RT9A 4C4XA 5HJ7A 1Z0SA 4AO7A 4DQIA 4MCJA 4N8DA 4YWHA 3I52A 4YMOA 2AFIA 1UBNA 2K2QB 4PWYA 1NP3A 3GLKA 2G8LA 2WIDA 2QMZA 4QG3A 2FMTA 3AHHA 3PJDA 3GFRA 1NJXA 1B8VA 1NN1A 1Z6TA 1F14A 4COOA 2RGNC 4W5NA 4AJ1A 4LQDA 4ND8A 4ZQBA 2DWQA 3VI3B 1BD3A 4IVRA 3IIKA 3L6RA 5J1SB 1DQSA 5I7SA 1OROA 2ZI7A 3TAQA 1FY2A 1MOPA 2YHUA 3D54D 3IBSA 1OXUA 1QAOA 3JQ9A 4ZGBA 1DBRA 4M21A 2I78A 1U99A 3AR4A 3CB2A 4HSEA 5BMVF 1Z1VA 2QN1A 2ZROA 1UFQA 3M81A 2Q0XA 1OXKB 2ECFA 3EMBA 2IY7A 3VYVA 2ZUVA 2NUBA 1X42A 2QVCA 3M5DA 4JBHA 1R4NA 4Y2VA 5IX8A 1NVKA 1ZD5A 3BD7A 4PPGA 3UAVA 2UVUA 2GN0A 3PZBA 4DQUA 4FBTA 4H0FA 3T1OA 1BS9A 1MKYA 4POOA 2QR5A 4EPVA 2XMGA 4JJZA 1VTKA 1HNNA 2J9RA 5KHLB 5KNDD 4MDEA 5TB5A 4A0FA 3TQ1A 2VN8A 3OIGA 3OCZA 5TVGA 4DVJA 5LLDA 4PX5A 2PRJA 3LHIA 3A1UA 3K75D 1T3SA 2PMCA 4JXKA 4Q9IA 1NYRA 3JQGA 1N2SA 1RRKA 1M1YA 1ABBA 2FG5A 1DRJA 4NE9A 3DOCA 1BVYF 2H06A 4PBRA 2VP4A 4MICA 4Z0NA 3ZIDA 1V1MB 4GR5A 4IBOA 1HDXA 1MH1A 1KEVA 2W71A 4YXWD 4W8HA 1ZD1A 3MWEA 5JJ5A 1LPAB 2OAQ1 3ZNNA 4ZHSA 3F5QA 4MLDA 5LQDA 4QZFA 2D1QA 1MVNA 3U4QA 4GMKA 3N07A 4QPNA 1ZOLA 5AOCA 3NRZA 4D4LA 1IBRA 3G6XA 4MAFA 2XADA 4BV3A 4HDAA 1EVIA 1QXSA 4GI2A 3VDMA 3WA6A 3I5MA 5CXQA 3S8EA 3RAFC 3Q7EA 3IAEA 3CN9A 1RC0A 3IP8A 4EKGA 1ZW6A 2VA8A 1DXQA 1EB8A 1GPBA 2DLDA 2P78A 3E2EA 2QMUA 4R1TA 2MWMA 3D8TA 3MFYA 1CRLA 3A1TA 4UNSA 4X41A 4CLDA 3I72A 4OQFA 5T4HA 3P52A 2HGSA 1ZESA 4IOJA 4Y9SA 5F3DA 2WMNB 4RZHA 1N77A 3G5LA 1JKJB 1QNFA 5HDBB 1RC1A 2P9BA 5ALYA 1E1KA 1RFGE 2EFCB 4UU1A 5JPDA 5AI4A 3LGAA 2B3DA 1YZGA 3I4CA 3A58B 4FMCF 4KWHA 2Y9MB 4MI3A 4AZ3A 4FCWA 3BEOA 4PPQA 4BVLA 5G0WA 3VPXA 1FXSA 3W78A 1GQSA 1WR8A 3IHLA 1QG2A 2YVLA 3F9RA 3O4FA 4I4TA 5DNAA 3RK4A 4UE2A 4WACA 3RYCB 2O9JA 3NATA 2G7ZA 4XD7A 3SQWA 3VSCA 3CW9A 4HWRA 3GLQA 4G1UC 5KWJA 2E5WA 3K0HA 4DR3B 1R27A 3GDXA 2D2EA 2R2GA 4BB0A 1F3OA 1VPVA 4FC6A 2Z6VA 4IIJB 5GVRA 3IKJA 4DILA 1E58A 3WHIA 3WGMA 3A0BU 1C9KA 2H3EA 3NDIA 5ERGB 5KNCA 3UPDA 4X8OA 3K05A 3FZYA 1A5ZA 1R8XA 4MVJH 3KSZO 1LX6A 1IXSB 3E3OA 4KGXA 4TV8F 5ECDA 3ICWA 5CFMA 1BEEA 4Y2UA 1Z83A 2B8NA 3SEZA 4IZHA 4LFAB 4QLAA 2WZBA 3RIHA 2O8BB 1GYPA 4U7CA 4AMUA 2DFVA 2X8WA 2P65A 3NHKA 1R5JA 2JVKA 1VJ5A 1SKYE 2QD5A 2X76A 2TS1A 4AZWA 3AF3A 3GIDA 4JJ8A 1FP6A 2AQ4A 2PX5A 3JRXA 4RSHA 1HDCA 1X8JA 5KFYA 1XLTC 4LF9B 3GOHA 2PD3A 4FQ8A 4MS4B 2JZNA 4OLBA 1GGFA 2IYOA 4GS5A 6NULA 3RKRA 4MW7A 3V8PA 2A9JA 3FYHA 2NAFA 5EEHA 1XD9A 4M9CA 2A1JA 5BSUA 3GILA 2J4DA 4TT3A 3OT1B 3NVYA 3K0CA 4HQNA 1JHAA 1XZBA 4TL7A 9ICHA 1RBYA 3A3OA 1D0SA 3UT5B 3BRSA 3VR4D 4C29A 1QTIA 2PU7A 4IH4A 4CM7A 2Y6VA 3JWJA 2Y1IA 3PTZA 2NU8B 2QV0A 1FFEA 2KSOA 2QKYA 4Z4IA 5HYVA 1TTPB 1JEJA 1YUNA 4GAEA 5C7YA 2JG3A 3EUEA 1AN9A 4L4YA 5KAFU 4M9UA 3RAXA 4AU1A 1HX7A 1Q0ZA 1DFHA 2QQ0A 4UMDA 3ESDA 4BLSA 2WTUA 4BDSA 1W75A 4AD8A 2BSXA 1JNYA 2V4UA 4ECAA 2R4TA 1WWKA 4MJXA 1GITA 2G08A 4YPVA 3VC8A 4B6JA 5JCJA 2LRHA 3MJFA 4Y1RA 3WC4A 4X65B 4C0LA 2FFJA 3G2LA 3RNOA 4ESHA 4F71A 1FIQA 1F6BA 4TV8A 2PWBA 4DLYA 5A5VA 1WWVA 1IJEA 1GTL1 1A04A 3KZVA 1LI7A 3FOWA 3C3JA 3H5RA 3TQHA 5LNK1 3W2IA 2D3WA 3AVPA 5JOQA 2Q62A 2OGSA 1VJ1A 4QPPA 5CEJA 1U7PA 1IQRA 4HDQB 4QU5A 1V97A 2B4AA 1Z0UA 1KJZA 3C39A 3C4QA 4G9GA 3RVDA 4DQ0A 2QRZA 3LBHA 4D4MA 3BX1A 1BPZA 2BCVA 2KBEA 1C7IA 1NZDA 2ZFUA 4HQKA 5FYDA 1QFMA 4YR2A 1GFSA 1EGMB 3VYSB 1UDRA 2ABWA 3GAAA 2QZZA 1ZJNA 2CHFA 1C3OA 3DF7A 3LE8A 3NXSA 4H77A 4LQCA 1Y9DA 4S1VA 1RZ3A 1L5QA 4NAHA 4CM8B 1PBNA 3RBDA 1FDVA 3GRAA 3KVNA 4OQXA 4TRNA 1S8FA 5HJ5A 4NJMA 3D7KA 1RDFA 1R4NB 3MCZA 3BTOA 2RG7A 1ZYUA 3H16A 4QUBA 2WB2A 3D3EA 4OJOA 4K6KA 4DTIA 2A67A 2EDCA 3GAZA 1LQUA 3BGIA 3FPSA 3U1TA 2RI1A 2WKWA 3ASYA 1CUGA 3ZIUA 2NU9A 4P58A 4N7MA 4CW7A 1CLEA 3PFKA 4N0QA 3U80A 1BXGB 4XWWA 1JJIA 2FF5A 2ZBRA 1L7OA 3N7SC 1QF6A 4IH9A 4R0VA 1RAEA 2H0AA 2O6LA 4H0CA 4ZV9A 3KEMA 5FOVA 2Y1JA 4ZYWA 3HCCA 3BTVA 2QJTA 4PRKA 5K8UA 3NTQA 4V3CA 4I4CA 4KLUA 1W6RA 1OGIA 4N3BA 4UNQA 4ARUA 1AMOA 2HW3A 1P2FA 1U8EA 4EYEA 1NTRA 3ESYA 3EC1A 1OU0A 5HKKA 4Z4GA 2PQ2A 3KQOA 3RNLA 3ZUPA 4RDCA 2B3TA 5REQA 1BJTA 4LOKA 4B85A 2AG1A 1A8HA 4CMHA 3MWLA 1FQKA 1U3FA 2XBUA 3FMPB 4B2LA 1S9HA 1P0PA 2FUKA 2JRCA 3L0OA 4PG8A 2E1FA 1NF3A 3OY2A 1G9SA 2O3JA 4CF4A 1FSFA 1K8XB 3DFIA 3Q3GE 4LJKA 1QU3A 3FNEA 1F06A 2V7VA 1JDJA 5AVUA 2C58A 3D2CA 1UMBA 5EZSA 2BGGA 1UDAA 3WKAA 1X9HA 2A59A 2M6RA 3B3AA 3LDUA 2ALJA 3MJCA 1HNWB 5E2IA 3CWZA 4DFDA 3ESQA 1SJ9A 4CKYA 2Z2YA 4BGUA 2W6JD 2B2XA 3FC4A 3GYGA 3I45A 2W04A 4O25A 3PW7A 5CVJA 5BMVA 3NEYA 3TAPA 2R97A 2C96A 5CCEA 5EXXA 3CFYA 2FEPA 2FZGA 1G8HA 4I46A 5JBNA 5CB1A 1CQIA 1EEHA 1YCDA 3WV5A 2GCIA 3QYFA 1ZCZA 4B9AA 1XJ0A 4MB2A 1JILA 1KEEB 4MQFB 3V7KA 3PTAA 3O75A 4M0MA 5DNUA 2ZBDA 5DDIP 1BMDA 4ALLA 4AG5A 4ZYXA 1CJSA 3WL3A 4EPRA 3P9ZA 3BE4A 3O94A 2IZ6A 2IVFA 1QVVA 3FPEA 4PFSA 2GYUA 3OCUA 5IEBA 3WRXA 4W5JA 1SUWA 5HG0A 3T94A 4D8TA 1V9SA 4PGYA 1F4VA 4GOND 2W4QA 3DDZX 4EA6A 1IZ7A 1L4KA 3KZNA 1XU9A 1S5PA 1F9AA 1UPBA 1YULA 3G1TA 3HU1A 4Q18A 3A28A 1KEPA 3SZOA 5CBKA 3EVEA 3W5BA 2JBAA 2IDKA 2IK8A 1VL6A 1FPMA 1UFVA 3TBHA 2CV1A 5KYTA 1J8MF 2QMOA 3QTTA 1ZNWA 4ABTA 3FTEA 4WCVA 3Q87B 5J5AA 4BRSA 3UJAA 1YRQA 4KWTA 1E2BA 4UBCA 3TGWA 2FHSA 1C3EA 2JJ1A 1UHUA 1YFJA 2DSTA 1ISMA 2GM3A 1R8YA 2EU8A 2RKBA 2FZWA 3E2MA 1EIWA 2PUBA 4C0AC 3ZX4A 4DA8A 2WIFA 4KO8A 3ZHYA 3C7DB 5DIZA 4DIBA 1B8NA 1RIFA 2BFOA 1N25A 2NO1A 3KOMA 2Q3LA 2VF7A 3TRJA 5KIAA 4FK8A 3L07A 4FYXA 4RZ3A 1M1NA 1N33B 3AR5A 1JBEA 3S8MA 1MB2A 1JPVA 2PSEA 1IZ0A 2ASJA 3PNQA 4BLQA 4DA6A 1R18A 1Y4DE 1H8HD 2WUDA 2JH1A 1PZNA 1FYVA 2QVXX 1OT5A 3JQFC 4QVKA 4TKUA 3V6MA 3QXCA 1QP4A 2F3TA 5FR1A 4JEIA 1OJLA 1F2UA 1UFRA 1VDVA 1E20A 2ZWMA 4UZFA 4EHJA 3IGFA 2KKPA 3H2JA 3K0CC 4X1IA 4LDZA 2FPKA 2FLWA 1ZK2A 3EW7A 2LYHA 4FN5A 4A4DA 4DIFA 1C5KA 1GL7A 2AGQA 1TRKA 1G18A 2IU3A 3E1GA 1JR3D 3HMQA 4HPXB 3AHIA 4UJ3A 3VI4B 2CRXA 1PK1B 5C46F 5JDCA 1W0JD 4I2NA 4B17A 4ATNA 1M9NA 2LGJA 2EQAA 4WLOA 2VTBA 4C0KA 4U9UA 1QO7A 3TVYA 3LZCA 5HX7A 5AIAA 2Q07A 3UC5A 1FFVA 3HCNA 4BX9A 5JEDA 1S0UA 2CHUA 4XJTA 1H94A 3G0GA 5BVGB 4DV7B 5F1PA 4OEHA 3MBYA 4HH1A 1MRNA 1Q7CA 2HBMA 3V7JA 2HD4A 2PAFA 4RK5A 5AM4A 4MKXA 3NJ4A 5HTOA 3UAWA 3HYNA 3GYBA 3REQB 3FVTA 1EJ0A 2VQFB 2KBFA 4P84A 1YIOA 4Q1DA 2GHIA 1KQFA 4B7ZA 4AICA 1NQVA 3A3NA 3DBIA 4CBVA 3ONNA 1K89A 1S3GA 2CLCX 2H85A 2JKVA 3TM4A 3PPYA 3D5TA 1UM9A 4S12A 2ACWA 2ZUTA 1QZZA 4RFVA 1NSYA 1KAQA 2GBGA 3DPSA 2ZUFA 3I1IA 1HV8A 2W2PA 4MS4A 4O02B 3A1FA 1JPUA 3FTNA 5A3VA 3S70A 3OFSA 3V97A 1WXFA 5AKIA 4XFDA 4MQMA 3QPUA 1K92A 3IX7A 4TTTS 5FL7D 2BP7B 4F5PA 2W0SA 2WJJA 2Z95A 4P7BA 2VC2B 2JJ2D 2HN9A 3HY4A 4N1AA 3PFIA 2FVYA 1CB7A 4PPFA 2W90A 1K8QA 1T1RA 1YR1A 2YC2C 2ZB7A 4I55A 4EA9A 3NIDB 1LDEA 2JZOA 1E1MA 3NX4A 4M1EA 3NVZA 1P75A 2O7NA 1XC7A 4DG8A 3NM4A 4L50A 2O59A 4XH9B 4K81B 2PS1A 3FI0A 1Z4JA 1IN4A 1ESNA 5A6VA 1IL0A 2V6JA 2W42A 2R25B 4QHSA 4PGMA 3USCS 5EJ6A 2ZUBA 4BX9C 3A04A 2HNKA 1RKVA 1GKIA 1Z06A 4WESA 5B6JA 5L3SB 2EZ9A 1NR5A 1U1DA 3B6IA 3K9WA 1NNI1 3PPXA 4FMDF 4JIGA 4M89A 5ITWA 2RAVA 4L5CA 1TU4A 2DPIA 4YK7A 5E1MA 4A5OA 3J80A 4E22A 3G9XA 2FWRA 1AN0A 1EFKA 2V03A 4B0OA 2FFQA 1XK6A 3GLRA 4ZEOA 1NI4B 3UMVA 3KOZA 3BWVA 4LCEA 4BGVA 4WA8A 2PCLA 2FPIB 3FDZB 4MGYR 4BJHB 5FBLB 4BEBA 2OFXA 2MSKA 4CEJB 2VT3A 1TOAA 3DLAA 2JEZA 4UAGA 2P1RA 4UFPA 4W5RA 2D0OB 2P2LA 3DXYA 1X39A 3RS4A 2FPLA 1TA0A 1DJLA 2PWPA 3KQNA 1HFWA 3HA3A 1D9ZA 4Q39A 1O9BA 1W5SA 3A11A 3GUVA 3IURA 3JXEA 1HMYA 2YWXA 3ZCXA 3S44A 5K6TA 1JFFA 2LW7A 3KQYA 1L5HB 4LY6A 4G9EA 4LMBA 3ZVRA 3KJQA 3Q8MA 2AEFA 3GFQA 1XFDA 3AXSA 2GBLA 3PUJA 3GY0A 2JLQA 1KZ9A 4BKRA 2QE7D 3FNFA 2PUVA 4R9NA 2G25A 5IKXA 4CDRA 1HDEA 2AS0A 2WUGA 2WZDA 1YA8A 1N78A 5CAEA 4HD8A 2KPOA 3LYUA 2HH9A 5AKJA 1BRTA 5KFZA 4GUDA 1X13A 5EOVA 3PW5A 4XR9A 3LRXA 3V00A 3LZDA 2H1HA 4FZ5A 3TL6A 5E6SA 3ZBQA 1SCJA 1WZCA 1FPQA 2G0NA 3IS3A 1CJKC 1FVFA 2Q7XA 4IDEA 4LE1A 1L5NA 1BQEA 1JLMA 3VXKA 4IQ4A 3A27A 2JJ1D 2I4LA 3KLBA 3C6KA 5CYOA 4II7A 3M9MB 3KHUA 4J9OA 1B74A 4WBXC 5AOAA 4JP3A 3L8YA 4AJJA 1TA9A 1GNTA 1ULHA 3A4VA 5K3AA 3L06A 4YRFA 5K3DA 5KFUA 2NXCA 4RUAA 2QAIA 2ZIFA 5F2KA 3VO9A 2H2WA 1L7RA 3AUTA 3C3PA 1ELOA 2A9RA 1DUVG 1IZZA 1W0KA 1ED1A 2Q4OA 3HKCB 5DBHX 5FTLA 1C30A 5KWEA 2EYQA 1JU4A 1XPOA 3R6WA 2G6BA 5KAMA 2Q2VA 2C94A 2I8CA 3ZKAA 1FSZA 3F8SA 2C5FA 4XGKA 3OD5A 3EVDA 2JJ2A 5A4KA 1YNSA 4KYIB 3JD4A 3L8ZA 4NCXA 4CN8A 2JZBB 3KPUA 1YL6A 2GRAA 5GINE 2K2WA 3WYAA 4XE5A 3ZH2A 4LCJA 3MMZA 1WCXA 1ZSYA 4MPJA 2PYIA 4Y9RA 1CUYA 3PZPA 1JG4A 1OVMA 1W5TA 1Z56C 2QXUA 4MS3A 5HBGA 2ALZA 3B9BA 4IV8A 5FX2A 3AMVA 4EY7A 1A9QA 2BFEA 2YZ7A 2OAP1 3M4JA 2I8LA 1FS5A 5DYNA 4DUGD 5K3CA 4OPMA 1X1CA 4DL5A 1X3SA 5JJIA 1MSWD 2X8LA 2BH9A 3T4XA 2BUCA 2G40A 4UUBA 4TKZA 4ZKDA 5J2UF 1LFAA 4B5KA 4B4UA 1AUQA 1XJ5A 2DQZA 2VF4X 1H85A 4FS1A 1PR0A 2ZQYA 1K5PA 2JNWA 1YVRA 4RTNA 1OXXK 1TIKA 4TN5A 1SU7A 1VIAA 4U5QA 4BMSA 2W9BB 2IZ0A 2W2TA 1CERA 2P9EA 2VO1A 2XUDA 3IVMA 5AJWA 2H5JA 3MTGA 1DS6A 3IO5A 1QLWA 2AZDA 4CM4B 1VHJA 1W59A 1PLKA 2VAPA 4V0LA 2EL7A 3L82B 1I2DA 1BC5A 4XPIA 3ZWBA 1ILEA 1A5TA 1AROP 4F9EA 3U4DA 3GUYA 3MGVA 1DC7A 3NT2A 4RD6A 4W1PA 1F44A 1QMPA 4MR7A 4NU8X 4QGHA 5SV2A 2QXYA 4GBGA 3C5WP 2ZYAA 5DF1A 3JRWA 1E59A 4E03A 1I7SB 1ZJWA 3M6VA 1RRVA 2H51A 7ICMA 1D03A 1RXUA 3DKRA 2TMKA 5CT5A 4L0CA 5A04A 1R00A 3L7JA 4R9SA 1JKFA 4TRJA 1BMTA 1XKLA 2IXEA 3OMXA 4CG0A 2XQGA 3OKAA 1Q5PA 4X1OA 2DR2A 5KFFA 1S9FA 2C29D 2X1HA 4JUCA 1XAHA 1B16A 2JFBA 4YLYA 4K03A 4QOEA 3B12A 2ZXFA 5K0EA 3QVGA 2CV0A 3UMYA 5HMMA 2GRJA 3FNQA 3HUUA 2BUAA 3U49A <