3R9KA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, glu47asp mutant complexed with sulfate, a closed cap conformation
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
227
structure length
227
Chain Sequence
GSHMRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHDGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative beta-phosphoglucomutase
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 83
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3r9kA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3r9kA01
2I33A 1Z4KA 3K1ZA 3W5CA 3KZXA 1Y8AA 1ZD5A 2P27A 3OCXA 5AKJA 1RLTA 4UU0A 4DCCA 4AP9A 1L7NA 4Y2XA 1YDFA 3L1VA 1QQ7A 5AI6A 3N07A 3L8GA 1AQ6A 4EZEA 1VJRA 1RMQA 4DWOA 2CFRA 2C8LA 4Y2SA 5A3SA 5AW4A 2GFHA 3RFUA 2HI0A 5AVVA 2O2XA 4E88A 5ALKA 3M1YA 1T5SA 3U26A 3MMZA 4I9GA 1JUDA 3QU4A 4J2TA 5AVUA 3ZVNA 4Y3UA 3EWIA 2WF6A 1TA0A 4YGYA 4ZEVA 5ALNA 5AM5A 2YMLA 2HO4A 1L6RA 2CFTA 4UARA 1RC8A 5ALWA 2B82A 4YCNA 4BEWA 1YJ5A 2WM8A 1L7MA 1N9KA 4UMDA 1TE2A 2EARA 2Q5EA 2YMPA 2RAVA 3FPBA 4UAUA 3TLMA 1VJ5A 3IB6A 3ZW7A 5AM0A 1Z4OA 1QYIA 2JARA 3P96A 5ALVA 5AW6A 5A3RA 2WFAA 3ZX4A 4DW8A 2WF9A 4Y2RA 5AVQA 1Z88A 2ZBEA 3WKEA 4EEKA 3R9KA 1ZOLA 4KX3A 4RETA 3W5BA 1RQLA 5AK5A 4F71A 5AW2A 2I6XA 1Q92A 4FE3A 4UAVA 4C4RA 2JAWA 1FEZA 3CZ4A 4O8CA 1Z5UA 4NABA 1RDFA 5ALGA 4CF4A 2B8JA 1U7OA 5ALPA 4NFLA 3MN1A 5ALQA 4FYPA 5ALDA 3OCWA 5AI5A 2ZBGA 4HGOA 3B8EA 3UMBA 2OBBA 2YJ5A 2YN4A 1TJ4A 2NO4A 5AIBA 2I7DA 1J8DA 3PCTA 1ZD4A 3KOOA 4UM7A 3WK7A 2C88A 1XVIA 5AW3A 5AW7A 3UMCA 5AIAA 3FPSA 3PDWA 4ZEWA 5AK3A 1Z4NA 3UM9A 2HOQA 3QNMA 1Z5GA 4Y2TA 1T5TA 2G0AA 4OD0A 4QJBA 3U7HB 5AKZA 2BY4A 4Y2PA 3OCZA 5AW0A 3ZU6A 2NYVA 1CR6A 1KYTA 2NO5A 3U13A 5AW1A 4CNQA 1RMYA 2IOHA 4BX2A 1YNSA 2B0CA 2EATA 5JJBA 1Z4LA 5ALXA 4XQ0A 3AR8A 4FFDA 2C8KA 4CE6A 2PR7A 4UMVA 4MWOA 1XPJA 3M9LA 4OHFA 5AI4A 2HEGA 1SWWA 2Q4TA 2IOFA 1RKQA 3J7TA 4Y2UA 5AKHA 5AHXA 3GYGA 3L8FA 5ALIA 4IFTA 5FP0A 1NRWA 3ZI4A 4MUMA 3DV9A 4J03A 2IA5A 3EF1A 3OCVA 4YH1A 3L8EA 2QLTA 2HX1A 3N1UA 3ESRA 2WF5A 3I1YA 4C4SA 1QH9A 3AR7A 3B9RA 2FUEA 3QU9A 3E81A 3KDPA 2GHTA 2WF8A 2I55A 4ZEXA 2MSNA 4EENA 3SKYA 5AICA 1VFPA 5AESA 1TJ5A 4HGQA 1S2OA 4GXTA 3ZTYA 2EAUA 2JAUA 3ZWKA 3OTQA 2WHEA 2R8ZA 2P9JA 3L1UA 2CFSA 2B8EA 3FM9A 4AS3A 4BKMA 5ALSA 4IG4A 5ALFA 4C4TA 1RMTA 3R4CA 3AR6A 4KNVA 5AVXA 3L8HA 3SD7A 3A1DA 2W4MA 3IRUA 3ZWDA 3NUQA 1RLMA 3WK8A 3MPOA 4HGNA 2I34A 3KD3A 5AI8A 4OFZA 5ALJA 3QUQA 5AVWA 4F72A 4XOUA 1L8OA 2YY6A 1RKVA 5ALZA 3B9BA 2IOFK 1U7PA 3A1EA 1Z4MA 3D6JA 2O9JA 2HCFA 4HYTA 2C4NA 2IYEA 1WPGA 2ZG6A 3WKAA 4JB3A 1RLOA 4XE5A 4UM5A 2RB5A 4L6CA 4BYGA 3E84A 3AR4A 2HSZA 1Z4QA 2YMQA 1NNLA 2ZBDA 2R8EA 5AVZA 3W5AA 4L6AA 3QU7A 5ALOA 2G08A 3HLTA 4Y2VA 1ZS9A 2G06A 5AK6A 4JDPA 1Z4JA 5T41A 3ESQA 2RBKA 3L7YA 5AVRA 2VKQA 3SF0A 4GIBA 3FGOA 2FPUA 2G07A 3WGUA 4Y2QA 5AM3A 4Y2JA 4L57A 3ZUPA 2FDRA 3U7EB 4UASA 5A3QA 4HGRA 3NRJA 4NV0A 3SKXA 5IT0A 1ZRNA 2HF7A 3VAYA 5AVTA 3NASA 1YS9A 1L8LA 3QGMA 1L7PA 3QUBA 5IT4A 2JAOA 5ALTA 2X4DA 4H1WA 2PQ0A 2YFYA 1U2SA 3ZVLA 2G09A 2G80A 3WK9A 1O03A 4HAIA 5ALRA 5AW5A 2C9MA 3U7GA 4NAVA 5AKXA 2FPSA 2ZOSA 2OA0A 5AW8A 5AKGA 5AI0A 3BA6A 2CN1A 4YIKA 2GMWA 4HGPA 1O08A 1F5SA 2BDEA 4UMEA 5ALEA 3NANA 4NWIA 4G9BA 2QYHA 2YJ4A 1Z4IA 3FVVA 1QQ6A 2FPWA 3L5KA 2FI1A 3ZX5A 2YJ6A 3NIWA 3A3YA 4Y2YA 3R09A 2W43A 2JGAA 3ZTWA 3F9RA 3NALA 3SLRA 3ZVMA 1K1EA 2R8XA 4BNDB 1ZD2P 1WR8A 2W11A 2RARA 2HHLA 2FUCA 3SHQA 3E8MA 1ZJJA 4CF3A 4PNHA 3I28A 3U7FB 1YV9A 3SMVA 3U19A 5AM2A 2GHQA 2OM6A 3CNHA 3KC2A 5AKEA 2R8YA 3QU2A 3I6BA 4BEVA 2YJ3A 3ONNA 4EX6A 1CQZA 3WKBA 2G1AA 2MU1A 2ZXEA 1NF2A 2PKEA 3A1CA 3N28A 1XP5A 2DQSA 4G63A 2YMMA 5AI9A 1X42A 5ALMA 1J97A 4UW9A 3AR3A 1LTQA 2AUTA 3W5DA 1LVHA 2MU2A 4YCMA 3UMGA 2WF7A 5E0OA 3OCUA 3AR2A 3QX7A 5ALYA 2GO7A 1RQNA 3N5KA 2HDOA 4KN8A 4B6JA 5ALHA 3IJ5A 3DAOA 3I76A 3AR5A 2D2VA 1RRCA 2AMYA 2FPRA 4RESA 3RF6A 4BX3A 1MH9A 4QQFA 5AM1A 1ZRMA 2ODAA 3WKDA 4AS2A 5AKYA 4YCLA 1QQ5A 1U02A 2B1QA 3OCYA 5AVSA 4YIHA 2I54A 3S6JA 2AH5A 5AM4A 3ET4A 3DDHA 2YBDA 3QUCA 1WZCA 1EK2A 2FPXA 5AKIA 2ZBFA 4DFDA 5AKKA 1U2TA 4EELA 1YMQA 2OYCA 3E58A 3L0CA 1SU4A 3MC1A 2B1RA 1IWOA 3EPRA 4UU1A 3WK5A 3L0YA 5AK4A 5IS2A 1Z4PX 1T9ZA 3WK6A 2B30A 4UATA 3DNPA 3L0BA 3NAMA 3WKCA 1PW5A 3BWVA 4BX0A 3ET5A 3FZQA 5AW9A 2AGVA 1L7OA 3QLEA 2BDUA 2Q4RA 1S8OA 3ED5A 2HF2A 1EK1A 1Q91A 1WVIA 4BBJA 4XPZA 3WGVA 3WK4A 5AKLA 1RPZA 2P11A 3PGVA 3PGLA 4KYTA 4CF5A 2P69A 5ALLA 4KX5A 5ALUA 3QU5A 1SWVA 4I9FA 1N8NA 3HYCA 3QYPA 1ZD3A 3OPXA 4UMFA 1RKUA 3QXGA 4BNDA 3KBBA 4KNWA 5AVYA 3N8GA 3AR9A 1TJ3A 2FEAA 4OCZA 3QUTA 3EF0A 4EX7A
chains in the Genus database with same CATH superfamily
2JFUA 3MMXA 1JSRA 3DF9A 1EX1A 2XRYA 3DXZA 1H2AS 3HA7A 4FC6A 1SB9A 1U65A 2W00A 2XICA 3RK4A 4FILA 2B1GA 3KL2A 1BEUB 4MV8A 2RHGB 4UUMA 3OO0A 4ROSA 5TQ2B 2TS1A 4RQ0A 4LFBB 2CE2X 4HMQA 3LTNC 5G3YA 3ZXUB 5JCPA 7ICVA 4C9BA 3HZRA 1QZ3A 1NOIA 2I6UA 2XGSA 3P9NA 4M87A 3OZGA 2XKBA 4LSMA 2QVZX 2IHZA 3P0IA 4HY3A 2BKUA 4QXAA 5DI9A 5AOAA 1CNMA 2A33A 5ALQA 1QM5A 2L42A 4Q0MA 5KYWB 5AI5A 4HD8A 4HJRA 1JVNA 2ZRPA 5CT8A 5A62A 1QDUA 3WK7A 5TR9A 2SKCA 3Q0TA 2B8WA 5D86A 1ZAKA 2NT3A 2BFAA 3RBEA 3DVRX 4KXMA 1KC3A 1OXKB 3D6FA 4WKOA 1Z0ZA 1QFJA 4GNKA 4OSOA 1F06A 3MSCA 1COWA 3R7DA 1IHDA 4YQFA 2WPDD 1P77A 2GF2A 3D8UA 4MUIA 5IN4A 2GTHA 2V03A 2PUJA 2R00C 3QV1A 3BIOA 4UAJA 3I5UA 5EIBD 3H5VA 3IAAA 1ZWKA 2HRRA 3JQAB 3N4MB 2HFKA 3ZWKA 3NH9A 4PFKA 2F3SA 9ICWA 1O57A 1Z73A 3LA6A 1VJTA 1ZI8A 3SIXA 1IULA 1K5OA 3AHCA 1QX3A 2QNIA 3IRUA 1T13A 3WRYA 3LUKA 5TGZA 4GC6A 1R0RE 3DE6X 2OGWA 5LXTF 4BVLA 1JQDA 4KV9A 3KB6A 4AJ4A 5JU6A 4BBAA 3HFSA 4U6NA 1DQNA 2A7QA 3LLCA 4ABYA 3LUHA 4HVLA 4N12A 2UUBB 3QKSB 2Z0MA 4Y2GA 1PR1A 4TYYA 3NRJA 3SVLA 1F1JA 4RHTA 2RGBA 4J16A 5F5NA 2MTBA 2PGIA 1WD5A 3DULA 3BE8A 2ZOSA 1RYNA 5C1IA 1JDBB 5HJ7A 1YZNA 2L0XA 3Q4GA 4IMPA 4KOEC 1Z5OA 1DAGA 4M0DA 2C5AA 3O92A 4IDCA 2EQBA 3TLGB 4IH4A 3TAHA 3WV4A 3NIWA 3MJFA 1CIJA 5K8IA 2YB1A 1XMQB 3D7LA 3ZU5A 1PD0A 3E8MA 2IH5A 2QPTA 2WUDA 1Y5IA 4Z53A 2R6ZA 4E33A 3UUFA 3OZUA 4H6PA 2PPLA 3UWPA 4PG5A 3I6BA 4ZAZA 3N28A 3BYZA 1L4GA 4RHEA 3JTMA 3LT0A 2WWYA 2Z6QA 2Z5VA 1DQRA 1OGYA 1N2EA 1NVBA 5A5DA 4TXHA 1Q22A 4U0KA 4X3CA 3TIIA 1GPJA 1C7QA 1RYHA 3L06A 2CDCA 2EIHA 4CTOA 1HR0B 1VHWA 3SOPA 2HADA 3G2MA 4GSYA 4UAGA 1IG0A 4I8IA 3CY6A 1QO0A 2XCUA 1EK2A 1E7MA 1OX5A 1F8GA 4PCLA 1GAJA 4DQSA 3W3ZB 4QYTA 1QSYA 2ATVA 2XT9A 5JNTA 2GXQA 3VX4A 1WCIA 4C4YA 4ZYZA 1ONSA 2ZM6B 5KWJA 2GN4A 4DPKA 1WZUA 4V0SA 3T3IA 3DTVB 3NRCA 5A6SB 4UCXA 3DDOA 3UANA 1YCDA 2Y05A 2IBSA 1SXGA 3H5LA 4XQCA 1X1SA 2ODPA 3UJHA 4WFJA 1ZWLA 3S28A 2W71A 1G7TA 3K7EA 1Q5PA 5HR6A 5KFAA 2HHHB 4R71A 4NEHB 2EZ8A 1MVLA 3T15A 4UJ3A 1V9LA 5C5JA 4EZEA 2GEBA 3CV3A 4PHCA 2EWVA 1PIWA 5KAMA 2C3OA 3DNFA 4F38A 3ZWQA 2ROQA 4FHCA 1VIVA 4IWXA 2IVFA 5EHNA 1M7BA 2B1IA 3E53A 4HPJB 4COKA 4ZU1X 4ZOQI 5FPQA 2CFTA 5KDLA 1N5RA 2D0IA 1Z00A 2J6IA 4MJ7A 4RW0A 3H19A 3RW9A 2P0YA 5DYNA 1LW7A 1ECCA 2NSJA 1DO8A 4MUKA 2GSWA 2IKQA 3FJ1A 4Y7DA 1ZH2A 4CM4B 4Z7OB 1E4OA 1P0IA 2CEKA 4DLSA 4WLUA 1Z5UA 4RPXA 3T99A 2B8JA 1VDVA 3ANSA 5HKKA 1C3OB 2FX2A 1FP1D 4IDOA 3UK0A 3RM3A 3G5UA 2PL5A 2PMFA 2OFXA 3V6MA 3KWJA 1H23A 4P5PA 3LFHA 2I76A 3RU9A 5EPEA 3LRPA 1FRZA 1M1YB 3GJ7A 1KO5A 5J1TB 3WGNA 2PAAA 4U6PA 5LYJF 4IXWA 1NPYA 4C0QC 2BGKA 3D8HA 4PCAA 3WWYA 4Q6BA 4MUMA 3SC2A 2P90A 2QVBA 3O31A 2YCLA 2P62A 5EZYB 2QUAA 4DMRA 4GFJA 1TUBB 4BKRA 4C03A 3CEHA 3HTXA 5G4LA 4B2PA 3EBOA 4C2AA 3GQVA 1KI6A 4KFCA 3KD3A 3H83A 4PHHA 2LUOA 4WZBA 2IYFA 3HMQA 2NSDA 1E1MA 1U98A 4JLVA 2CFCA 4E0DA 4CG0A 7ICIA 2HSZA 2XA1A 4KMUA 4NK4A 4TL9A 5JJLA 3GEMA 4YJDA 2QI9F 4WKNA 3G88A 3H8SA 3UJ7A 2HBRA 4AFNA 3QH4A 4L9WA 1DBIA 2ZXUA 5F1YA 4GXJA 1ABFA 2AEMA 2MMCA 4J91A 1I3CA 5LXTA 1KFKB 3WC4A 3QX3A 1U0TA 1W87A 1ZCZA 4TMYA 3OHAA 3HM9A 3OQPA 4U2FA 2FPSA 3PHJA 4F1JA 4U00A 2EU8A 4Q37A 4HGPA 4YAEA 5IK2A 4DSNA 1EFHA 3DFMA 3H8VA 4KYIB 4AO8A 1N48A 5J0PA 4PH5A 5CVCA 3R41A 4EJ6A 3R09A 3NG1A 1VPEA 4INAA 3O1LA 4O6VA 3H1TA 4OI2A 4CRXA 1UDCA 5F7ZA 4EUSA 5TVKA 1Z29A 2KEYA 1WMEA 1ZR2A 2O8EB 3TFQA 4GF5A 4PYNA 2YMMA 2QX6A 3JQDA 1Z08A 3AYZB 3GIDA 4J9KA 3GDHA 4EY5A 4LDQA 3IQZA 1HURA 2AR9A 2WA2A 4W1PA 3CXRA 3CKLA 2GI4A 3GV5B 5AKYA 2R2GA 3GUZA 5EGSA 2JEIA 1WHTB 3HXOA 4LISA 2FXIA 5AJWA 5IG2A 1K9VF 2FPXA 3A31A 1PFUA 3NP7A 3PTLA 4ZT3A 3TGWA 2P0AA 1A69A 3MQFA 2VA8A 2IPOA 3N8NA 3ZZ0A 2P6OA 4ZVRA 3N58A 3OT1B 3U3OA 2DKOA 3RS8A 4Z4FA 2ZWVA 2P4HX 2QRKA 2K4PA 3HDGA 3CR8A 1DDIA 4HFRA 4Q05A 5LZ9A 1ZK4A 3MR5A 4AY4A 4GGOA 2CHFA 4RNOA 2XCTB 4UZFA 3IERA 4NPHA 2M9MA 3TLBA 4W5JA 1GPUA 2HCTA 1MDFA 1D2NA 5DRYA 3FHTA 2G72A 4TV8B 2P9TA 2HLNA 1QP0A 4G0PA 1B22A 2OD2A 5C3MA 3D54D 4DANA 4B43A 3LCRA 4C5CA 1QFXA 4PLWA 3T3DA 1QQ7A 4F4JA 1RWPA 1OX4A 5DHAA 1N2HA 5H8WA 3PHCA 1XP8A 4BMZA 4QULA 5LQJA 4IVPA 1M6HA 4HH4A 4MR9B 1QORA 5D3MB 1T5SA 1JX6A 2CJYA 2W93A 3LUDA 4UDYX 1FP4B 2CNBA 4ZCSA 4GS5A 4A5SA 5JDCC 4ZYXA 4HDKB 4Y1FA 1KAEA 4BBZA 4Q3AA 4OV6B 4DVJA 1GJRA 3KTFA 3HR7A 2ZB8A 1BHQ1 2C57A 3H3XA 4YMOA 4IBOA 2Q5EA 4MIKA 4BFWA 4CQLA 4ZVTA 3IB6A 4DYHA 3BKXA 4L5AA 2Q5QA 3RBDA 2GPNA 1DNPA 5BOSB 2E8NA 1YHZA 2X6RA 1T9BA 2VDRB 4WNAA 4ED6A 1XU7A 4F71A 3QELB 3F3KA 4NSNA 3GFQA 1BU5A 3TSWA 1YCFA 4RCVA 3PITA 4CEJB 2HBZA 2W2KB 3TOCA 5DGTA 1JE1A 4RTQA 2ISOA 4Z2YA 2OHGA 521PA 2E1PA 4XQ8A 4TROA 3KVNA 3DDNA 1S7CA 3RBAA 3P27A 1JHAA 4BVJA 1BS9A 1IG3A 1GL9B 3WIDA 4F92B 2B6HA 2C5BA 3ZJ5A 3OCZA 3OEED 3WLEA 3Q8RB 1SAYA 8ICJA 1XA3A 2HZBA 2PR7A 2ZUSA 2VBIA 3DC2A 4YXFA 1OWMA 3AXTA 4B47A 1M9NA 4JBGA 4FHZA 4R7TA 2G88A 2YUIA 1BMTA 1A9TA 4KLDA 1G6OA 3F2IA 1N2IA 3R6LA 2JBHA 3HM2A 1PGPA 1ECGA 3B0YA 1RS0A 4PNEA 1G0NA 2GXAA 5K2OA 1HEUA 4TQUS 3A4TA 3RS7A 2NV2B 5LYJA 1UKEA 1XVAA 4K7JA 4C6RA 2V3VA 3ZZ1A 5IVHA 4OFZA 4QDJA 1H9AA 1X1EA 4OH7A 2IYYA 1IHOA 1YS1X 5DNWA 2H1SA 4OKIA 4YMNA 3T1HB 3V8VA 4C4AA 5I6DA 4Q1EA 4LVSA 1NQUA 4X45A 5ECDA 5BVGA 1GNQA 2FPPA 3LWLA 3M81A 5JW6A 1XAHA 4GI3A 4AZ3A 4B4WA 3EPKA 1LI7A 1ZJNA 3BIXA 5L53A 3VUFA 1B0UA 1IZ9A 3JARB 3L92A 1PS9A 1DWPA 4MV0A 4BNHA 2GLUA 3HKBB 3V1NA 1PN3A 1G5FA 5GVSA 3MGIA 4YCXA 2HY7A 5IM4F 3EY9A 4JEIA 1PFQA 5KG1A 5DM0A 3TEJA 3GJ5A 3GRRA 4BLOA 2HMUA 4IRXA 1G9SA 5CBPA 1DCKA 4J7XA 1Z6GA 2RGNC 2ZR8A 4UUOA 4ETWA 4EYHB 4PSVA 3I0ZA 3PSHA 1MB3A 4FYJA 2ZSAA 3IOBA 2ZU6A 1RWKA 1V5GA 1AUVA 7ICMA 3RF7A 4RZHA 3MHPA 3IDAA 1O94C 4PEVA 4BE9A 2C3PA 1C0IA 3NHKA 4HDCA 4WADA 2VTVA 2ZIAA 4HVTA 1X80B 4Z8XA 1PR0A 4IMJB 1RCFA 3BC1A 1XMXA 3SR3A 4P4SB 1LW6E 4ED8A 1I0ZA 2AI3A 3HZOA 1SZDA 3TZCA 3GN1A 1NWCA 2PLFA 1TRKA 4NMHA 4HNGA 3GUHA 1AKUA 1IBCA 4LPKA 3VKFA 1YMQA 4JQSA 4JBXA 4KXXA 3C1AA 4GVLA 2CYBA 3ACCA 3TUZC 3FNQA 1T3QA 1A27A 1M6VB 2PCLA 3DBLA 3FDZA 4UVHA 2QRNA 2I62A 2WDPA 1V35A 4UDNA 1VQ1A 3E2PA 4DMFA 5EUCA 2C31A 1JF8A 3DD1A 2W04A 2GZDA 1DEXA 4X44A 1G7CA 3B38A 2H7YA 3SV4A 3A4LA 1AH2A 1EP3B 2QZ4A 2D0PB 3H0KA 3FHCB 5LB2A 2YYAA 3FFWA 5IIKA 4KDRA 3ZXIA 2LM4A 2ZIVB 3Q85A 2X76A 2YXEA 1KW4A 3CCFA 2FG6C 4Z0NA 4PPXA 1SGWA 1QV9A 5AW4A 5JO0A 2YWEA 1UFKA 4I2HA 4V0ME 3WLKX 5DGCA 1TI7A 1SY7A 2QW8A 3KLNA 3TD9A 2UYQA 1SUFA 2WG1A 4ZKDA 5TXGA 2GZHA 5C81A 3M5CA 4UBOA 1JU4A 1P5HA 5BYBA 4F2DA 1QHIA 1DQYA 5DTEA 4ZAXA 1DC7A 1O96A 5BUSA 1IPHA 1ZVQA 2I3BA 1U80A 2VWGA 5IFLA 4JLOA 1T6BY 1Z0AA 5EXEA 4C6TB 4EA9A 5EOZA 1KDHA 4JX9A 2WINI 4WK2B 2FHPA 4ZGBA 4Z4IA 4ESHA 4AYWA 2OGTA 2J5RA 1XSNA 1DX4A 3N0VA 3JVUA 4KLZA 4C2TA 3UWSA 2RK3A 4NS1A 4KLJA 5JFOA 1ZQFA 4JS0A 4ZZ2A 4YO8A 4CV2A 1TQHA 2PA3A 4KO4S 4L5IA 2AJ8A 1GCGA 3H9UA 3M2TA 4HN4B 4DR5B 1GZDA 2JFOA 3WBFA 3RB0A 2I1VB 1KI7A 4FMCF 1NVTA 3C23A 4RK6A 4PGFA 3RTGA 4PAMA 1QUEA 4FCCA 5I7EA 4I9HA 4CNQA 4WCFC 4F6RA 1TFUA 5IILA 3OLVA 1W29A 3PNOA 4MEXA 3VTFA 5CDFE 3CTPA 2HLDA 3JWHA 5FFFA 4CE6A 1BCSB 4MWBA 3BMCA 3KYDA 5DULA 1WXDA 1BNOA 4N8EA 1XZ8A 3S1LA 3W34A 4J0HA 4QOIA 3G79A 3KP1A 5LL6P 4YDSA 1QLHA 4CM8B 2PUHA 4HEA6 1SXEA 1XCLA 2Q4OA 1TCUA 4ZARA 5KFMA 4GRDA 5U1PA 2DFLA 4FE4A 1BG6A 4EA6A 4BNZA 3L1UA 2DKNA 3D3JA 2J33A 1WSBA 4IIGA 4V0OA 2ZR7A 2YY6A 3E03A 2Y1XA 1QO0D 2AHOA 4TSKA 4TV9F 1U2PA 3ZDCA 4A8HA 3I6MA 3OM8A 4CM6A 4IY1A 1U45A 4NOMA 1ZOSA 7ICTA 5CR0A 3DE1X 2H2FA 4YRJA 1LXCA 2M6KA 5E9QA 1O5OA 4V3BA 2GLEA 4TMZA 2ZYHA 4ZU6X 3AJRA 3WGLA 1H65A 4DR4B 1JJ7A 3FIUA 4PG4A 1WP9A 5EHIA 1UPBA 2XLCA 1ULTA 1EWTA 4B0OA 3S2SA 4TN5A 2F9LA 4D3FA 4AI6A 5LQMA 1J5XA 3KSRA 4BN4A 5ALEA 3VMFA 1KJZA 4EBFA 3ASVA 4D97A 1D8AA 3FVVA 1UKAA 1XMVA 3TARA 3K0KA 3F9RA 5DLQC 2FPIB 1SA0A 1LPSA 1GG8A 1T5IA 1DLJA 1UFQA 2MINB 2ZYTX 4LZZA 1ZK2A 1CIPA 1R4MB 2AZDA 1E3MA 4KL8S 3ZD6A 3T0GA 2AX4A 1AHPA 3IJEB 5IM4A 4YYEA 2EJTA 2FEMA 4LDJA 3M83A 4ARUA 5T3UA 2BFFB 3JATB 1SIOA 3AV3A 4P3PA 3I72A 2HDOA 1JAXA 4J1NA 5KFXA 1WIWA 1SZJG 3GRFA 2UUPA 4UOQA 1N75A 1T2DA 4FDAA 2VDLB 2FLKA 3VR6H 2WB2A 3ICOA 2C83A 2O8DB 1KY2A 2OQ2A 3HL4A 3RB8A 1DOAA 4QDXA 2KBFA 4D9MA 4F1WA 2ZE5A 1OXXK 4QBFA 3BZWA 1N34B 4B9MA 2JI6A 3K92A 4D26A 5JRDS 3DV2A 1XALA 1EUDA 4X1IA 1NNI1 4XCQA 3ZCQA 3JWJA 2EAOA 3QEOA 3RAEC 3PF8A 3PGVA 1XMIA 3IVCA 2PTHA 4OQXA 1KDOA 3F1LA 1I80A 4OP3A 3LGSA 2IU0A 4IXDA 4CM3A 3CN7A 3PRYA 4UU0A 2A0YA 1G64A 4LXUA 3G0HA 1U2DC 3EA5A 3HEMA 3I12A 3SXUB 5DASA 3I2JA 1K7YA 2BHTA 2ANBA 2CSUA 2K7FA 3A0BU 4QA9A 3FIJA 2P77A 4G5XA 4PZEA 3WGKA 4ZOAA 4IDNA 4XLTA 4ZCLA 3UFXA 1RLJA 3H11B 3GJRA 1CF9A 4J0IA 3TLMA 4Z9AA 1Z37A 2WSLA 4FDTA 1WXQA 2FMKA 2NTJA 1P6QA 4HUQB 2VRNA 3FOCA 1V47A 3RREA 1Z25A 1FB5A 1MO6A 4BQFA 4CR8A 3CUEF 1T8WA 3LUPA 3H16A 4CLOA 4JBYA 4C8LA 3D6AA 2XQGA 2R8RA 1O89A 4IL6U 4D9BA 2WMOB 2WVJA 3HP7A 4GMFA 3D5TA 3HPRA 1XZKA 3W2GA 2JI7A 2ZYIA 2LV8A 5DGDA 1BDMA 2BR3A 3W4IA 3IUEA 2FGKA 2F1RA 5B4VA 1T5TA 2WVGA 3R5SA 2VQ6A 5KDOA 5AW0A 1HDEA 5C5CA 2NO5A 1FSSA 5DM60 2ZIXA 2EP5A 1AOXA 5EQDA 4CMIA 3CU5A 2C8KA 1SCAA 3E8SA 3AOEC 3UB2A 1VIMA 2HEGA 3BJYA 3NTXA 5BW5A 3K2QA 3T5TA 2R751 3L8FA 3K1AA 1POXA 4D0LB 4KXNA 5GMOA 2E48A 2H0QA 1FNDA 1IY1A 2WF5A 3K8ZA 3MFIA 1N2ZA 2AWOA 4X3PA 4R98A 2ZJOA 4MF8A 1HDCA 3MBKA 3HXLA 4L5JA 1X7WB 3SQXA 4QGGA 4TTJA 1RWWA 2PPVA 1TT5B 1U9CA 3Q8XB 4FJ1A 1P17A 3SJZA 4HDMB 1U3FA 5DW3A 2RH9B 4O2BF 2V4QA 2W55A 2E5FA 4LRUA 2QXYA 4L5CA 3U6KA 6ABPA 2P8JA 1EFKA 4F9GA 4US1R 2XCSB 1NMYA 2OQIA 3C7TA 5AVZA 5IEJA 1P29A 5J2AA 1CZUA 3T1QA 2O3SA 1ADBA 4LGMA 4EDFA 2XPCA 1XE3A 4GIBA 1BZYA 4KGZA 4M1SA 2OENG 4TLLB 4FYVA 2OXFA 2WFLA 4P08A 3RWMB 3WYCA 1DPFA 2JCSA 2OHOA 2DY0A 2IPAB 3A1VA 2G09A 1D2EA 4TV9A 3P19A 4AN4A 2WIFA 3OVMA 3MT8A 1DGSA 3WL7A 4BLTA 2FW0A 3VR6A 1EE2A 5DTJA 2D1YA 3HB4X 3H4MA 2W7TA 4DTIA 5TISU 2KJ5A 4P54A 2ORED 1J8YF 2OBFA 3TQHA 4AVYA 1TVKA 1ZIXA 3D8TA 1TJPB 3M6XA 5GM2A 2YBEA 2P9HA 3R7WB 1N36B 5KYYA 4TRJA 4DSOA 4XIGS 2QUBA 1CUJA 5L7TA 4F9FA 1NV9A 2GS9A 4DCVA 3P94A 4UTPA 5JC8A 2VQEB 4KC0A 3TGPA 3GDXA 1YB5A 4KN8A 4ARZA 4C7ZA 3HN2A 4ZQGA 4PC2A 3N39C 1N9GA 4ZI7B 1YB1A 4QQFA 5J2UF 2X77A 2EEZA 3UNXA 1IWPB 3IOYA 4LGCA 3H9EO 3D5EA 5HIAA 4MQFB 1XPUA 1E99A 3DAGA 3SXJA 2ZJ2A 1GPDG 3CRMA 2G5TA 3L0YA 5E6SA 3ANYB 2PAFA 3T9CA 1P5ZB 1FNNA 2JCBA 1OIXA 3QNWA 4HX2A 1JEAA 1FMJA 2FDXA 5G02A 4Z5XA 5EHQA 2DM6A 4UBNA 1X8JA 3EXIA 3F71A 5LQKA 3K1TA 4CKWB 4AMGA 2GRJA 4DABA 3PX2A 1QH0A 4A03A 3CHYA 3HKZC 3CX4A 3L40A 2ORVA 4AP9A 3RT1A 5KU1A 3LDFA 2C95A 1T8RA 3NHSA 3LPNA 2H9YA 1EFUA 4H7DA 4QXOA 3JYHA 1QR2A 3II6X 1P4JA 3WI7A 2CL0X 3P1JA 1PR9A 2BUCA 2DUWA 3V80A 3E61A 2GF9A 4JQOA 1ZUNB 2QUIA 3W8RA 1KQQA 4W6QA 5K4GA 4GPBA 2PLNA 3CE9A 4MRMA 5IIMA 4Q3EA 4CCAA 5DG7A 1GARA 1GM5A 5J2JA 1ZHHA 2QPLA 1C3LA 3EPLA 4HRXA 4ND5A 4PG7A 1Y5MA 1BDBA 4LY6A 3FLAA 1QIMA 4NM2A 4XAQA 3KUUA 3FI9A 5J0UA 1WCWA 2IUSA 2WQ7A 2DOKA 2P4UA 1GFIA 4HDSB 4ICAA 5F7JA 2C88A 1K5GA 3H8JA 1L3SA 3HVUA 4J9NA 2QXUA 4V2UA 1MOZA 2BUAA 3GEDA 2F3RA 3NHUA 3KYIB 4FDUA 1RXVA 3EPPA 4F8RA 3MW8A 4I3FA 3DJFA 3F2CA 2QG6A 1Z5WA 4PW0A 4FGJA 4N0QA 2PXIA 1DJLA 4O5EA 2XOXA 1D1TA 4BS9A 4MZDA 1VRCA 1AGNA 4YUZA 4UHEA 5C8YF 3I64A 1VB3A 2V0CA 3UA4A 2Q3LA 3OF2A 5DX8A 2YWDA 5E4TA 1KARA 2QWXA 2JIDA 1H0SA 1K97A 3UWKA 1JQEA 5AJZA 2GOYA 1N3BA 2V7UA 3E5RA 2H5EA 3EZXA 1I3LA 3MPOA 4UCQA 7ICHA 3SYNA 4MVWA 1ZHFA 3RHZA 4H7HA 5L1LA 4KWTA 1CRPA 3O73A 3KQWA 3L8CA 2WJYA 3B12A 4HWOA 4G4JA 5KT2A 3NCTA 4V39A 3DF7A 5CVEA 1IN5A 4I9NA 3PF9A 1K7SN 4O4IB 4AICA 4DGQA 3C29A 4QJFB 5BV7A 4OM8A 4EGJA 4IJQA 4RD2A 4JP2A 4CLRA 1YOVB 2OO5A 5GJWC 3T3OA 4RE6A 4O2BA 1E9VA 5MN5A 5K8TA 3VO9A 3UC9A 4G5YA 1VBKA 1L5SA 2WC1A 2FFBA 1EPUA 1JDBC 2O8FA 4XFKA 4CF7A 2Y2UA 4C87A 1RI3A 3D2AA 1FFWA 5H16A 5G0SA 4A2QA 3NVWA 2RAPA 4TYPA 3GIMA 1Z4IA 2QZPA 4MKZA 2AIRA 5SYNA 2A2ZA 1PR2A 4G3XA 1RAIA 1O7JA 4L4RA 1L3BA 3K9QO 3NBKA 4ALMA 4EPTA 1WSDA 4B9VA 1Z75A 2WYUA 1T3TA 2ZRJA 4AMUA 4FN4A 4B8YA 3I6ZA 5FUWA 3GLIA 3I9FA 2ZYRA 2F17A 2NUTA 2ZXEA 3B1FA 1EVKA 2VYCA 4RUKA 1VFNA 2A84A 4BMYA 5AXDA 1XVTA 1MR3F 2K89A 5K2MA 3OCUA 5HGXA 1K75A 5KFWA 2JHPA 1PP4A 1KZ6A 3PUIA 2JGJA 5IJ0B 2PZGA 1C3XA 2XMRA 5FFMA 2GZ1A 2VHXA 2AH5A 5DYTA 1GTMA 1MOQA 2HA3A 4I8XA 4JBLA 5B37A 2KHVA 3CFYA 2BEVB 2VTBA 2OK7A 3MZ0A 4NU8X 1M0WA 3AV0B 2KW5A 2GJAA 4ENSA 4AJIA 3E0QA 4MLDA 4UFPA 1S8OA 2GK4A 5J2UA 3AUYA 1U4OA 3OKAA 1LRJA 4UDOA 2YY7A 4EJ2A 1J0BA 5HRUA 2K2WA 2I3AA 4I2GA 4BRUA 1MTOA 2P5YA 1V7ZA 4JOBA 4DCMA 3KBBA 3KXKA 1U1EA 2FLVA 4X6UA 1ZVMA 2WWHA 4EHHA 2IP4A 2N46A 5IUKC 2CYAA 2WAXA 2NRTA 5EJ9A 1ZJYA 2W22A 1H42A 2J6HA 2XZLA 2BHNA 1JUDA 4EF5A 1XZMA 4K6KA 1B8PA 2RP5A 5CNMA 1QHNA 4MS1B 4QOJA 4R3WA 2MYUA 2I9GA 2Q3FA 1T6NA 3UMMA 1MMFB 2A9VA 4QASA 3UW3A 4O29A 3P32A 3FSGA 4CCHA 4QZIA 3DTTA 3AFNA 1MORA 1Z88A 2A1IA 1C0KA 1G42A 4EYIB 1GTG1 2OZLA 1XJQA 4HWRA 1CRWG 3SU8A 2CFIA 5KSZA 5H82A 5KFQA 4MWCA 3TJMA 4I36A 4X94A 2XWSA 3OZTA 4TUQA 2OOKA 4RHYA 1HE4A 1ZH4A 1UXOA 6NULA 3W6ZA 1OKKA 2XTNA 4GUAA 2FVYA 4FOLA 3RS3A 1OW3B 4TZKA 4GZLA 4JUIA 2YL2A 4CIAA 1X3LA 1CS0A 3OJCA 4I29A 3X2EA 2QNRA 1AXEA 4CV3A 5GGYA 3O3NB 9ICOA 3TRFA 1KA9H 4KPUA 3VV3A 5FD8A 3HGMA 3UOGA 3K6SA 1DBVO 3C45A 2YV3A 3CKMA 4Q4HB 1XIVA 3R2JA 4J4HA 1PNQA 5CH5A 2IV2X 1GUAA 5FP0A 2CBXA 1TD1A 1MZVA 4DMCA 1PBNA 3TMAA 3HWTA 4YONB 1L5GB 4JLBA 4ONEA 4UHDA 5LDGA 2X23A 2FWIA 5J2IA 2FUEA 2IXDA 4ND8B 2H1IA 1HO3A 3HDHA 4GBED 3GP3A 3KUCA 4FO6A 4RQ1A 3HRKA 4PAOA 2X5XA 1NZJA 3AU2A 1CXZA 5CH3A 2FH5B 1I2BA 2YNMA 1NUAA 2GDJA 3D2LA 5C8YA 1CVLA 2I7VA 4QLBA 4UAWA 2C84A 1T5OA 4DR1B 4II3A 3CEJA 1OX6A 1KJWA 4GM1A 1PK1B 4X24A 1XJWA 4GOLD 4PCVA 1XZEA 5INTA 3HVRA 2VDMB 1TW2A 2KIWA 1O6FA 3RANA 4CKBB 2ZYGA 3B7GA 4Y2QA 3T5LA 4Y2JA 1N6KA 4EKDA 4RTLA 3D8NA 4D4MA 1EAMA 1JHMA 4MI3A 2W0MA 1FFDA 2F67A 4BNLA 5KG3A 2NO1A 1AUPA 2GK3A 4TWJA 1FDWA 1TRHA 1JWLA 4IJMA 4MCIA 1OXTA 5IAOA 5EWMA 1WY7A 3RTVA 5CFZA 4P7JA 3RABA 4GP6A 3DBHA 5SY6A 2XCRB 5ES3A 5SZIA 3W77A 1GPMA 4OJNA 2R84A 4H1UA 1JXQA 1XRNA 3F9CA 4P4PA 1JIXA 2XNSA 4G0QA 2H3ZA 3I28A 3P9KA 1MC8A 3OZBA 5G3ZA 4R16A 2XUHA 3LUAA 5A4DA 1A9OA 4CLDA 4JEMA 3DJYA 5F78A 1F2TA 2MIIA 5CGZA 3N0RA 4JI7B 3DFZA 2QORA 4LZWA 1SXPA 4ENVA 3PQCA 4YCDA 5KL8B 1V45E 3K9GA 5LIRA 4PTZA 4K05A 1UDAA 4PWZA 3KFLA 1N5JA 1QH8B 3SFTA 5WRFA 1TGVA 2OECA 2IZ7A 1DRKA 3X1JA 4LEIA 2B6GA 3BGIA 2FRDA 4UUQA 3N0XA 1RE1A 4XSHA 1WKCA 4UHJA 4CN9A 2NAFA 3UXPA 4XVRA 3ZWXA 1H0HA 4REOA 2JZBA 1U1CA 3N2GB 2ID8A 4DRYA 1Z56C 4JGGA 3HCCA 2DUMA 4D3XA 1ZQXA 3OOYA 3CKYA 3K5HA 5L7YA 3D3NA 1NOKA 1NBHA 1DOHA 1H3FA 2Y4NA 1JW9B 3C24A 1ZLYA 2MJLA 2ATXA 3SC6A 4F0JA 3I52A 3Q2KA 2WT8A 1SHKA 1CEXA 1ODFA 3HKDA 3DZFA 4IDPA 1TPYA 3CEAA 2PV7A 3WLAA 2VSQA 3OJUA 3N76A 2K4IA 4D81A 2CC2A 4PYIA 1Y1KE 2C7VA 3INTA 4PAQA 2GYUA 4B3JA 2D8CA 5JMOA 2PFQA 4CMEA 3CT4A 1UCFA 2GNAA 5LOVB 2CD7A 2N1BA 3GMDA 3L7NA 2DPJA 4AJNA 1NP3A 1KOFA 2RGEA 2H4FA 5AUOB 2V6JA 5LZ7A 4O3NA 3AM5A 4GDMA 4HN2A 4Z9XA 4O9MA 4ME6A 4LHWA 4NL9C 4LZAA 3EZNA 2ZTLA 3MTDA 5J63A 1BE0A 1S1MA 3G6KA 4I2AA 3PL1A 4LDAA 4E51A 2J3IA 1JR3D 4US9A 2AEFA 1SKSA 4XW2A 4DV6B 3GVCA 1JJFA 4IF6A 5JPDA 2O5CA 4ZC1A 1LPAB 9ICNA 3IJPA 3O9ZA 4KQGA 3DEAA 1NBMA 4EGAA 3AHHA 1Q3KA 4JI0B 4JYBA 3FDSA 1L7BA 4CL8A 5KYUA 3LZCA 1EXDA 5CW1A 2QQEA 1BFDA 1LV7A 4F5DA 4DQIA 3A1NA 3SS9X 2RQ5A 4MV7A 5E6UB 3LQQA 2O8CB 4KAJA 3WRWA 3T3FA 4HNTA 1RKQA 1UOEA 2I7CA 5ALIA 3G8CA 4MQUA 1ZQVA 5GONB 1U6IA 2SECE 4UM8B 2WYIA 5T7BA 3UXEA 1T2AA 3BPSA 1ZICA 5HF6A 4PYJA 2IHJA 2VDKB 4P98A 3TG8A 3LMKA 1RXWA 1RMTA 3P4YA 2O1XA 4TLAA 3DB1A 4E1AA 2PU7A 1OMOA 2ZAOA 1HDYA 4LMRA 1UBKS 2FMXA 4NXZA 2QYOA 4ZAWA 2ZUUA 1WDTA 3B9BA 1OXBB 3SSMA 3IT0A 4S1PA 5KNBH 4LJXA 3SBDA 3ZZUA 5CB4F 2FWNA 2ZGVA 1LKYB 2R8JA 1LK7A 2J87A 3J81j 2GM9A 2P2LA 5DW0A 4PHPA 3LVWA 3ULKA 2WD7B 2Z2YA 4F7DA 2JAOA 4JLUA 4HQRA 1MJFA 4OJTA 1OR8A 4UXIA 1GZ5A 1Q12A 2WMNB 3D9QX 1VMKA 3G13A 4K6MA 3CSDA 4XD2A 4YXJA 4MS3A 2ZANA 3RARA 3H9CA 2ZRLA 5EI5A 1A8QA 2BFBB 3IVGA 4ZQCB 1PT6A 4TXMA 4OVKA 5GADl 3UV6A 3T3HA 5JARA 2Q0HA 3GLRA 2ZYVX 2QTGA 1F0PA 2PD4A 1PFYA 2RGCA 2R18A 3NTLA 3UMSA 2H92A 4DZTA 3ITKA 5HYVA 1GUYA 3INRA 3JQCA 1GYPA 4KWEA 3TI9A 3M9XA 2B8TA 4IZIA 4BFCA 1QXSA 4LJRA 4YCMA 1ESZA 4LOLA 1WUKS 5KTRA 4RPJA 4S1VA 2VNKA 3SAFA 1P2VA 4MCAA 1VA5A 1NK9A 3KQPA 1WF6A 5EL0A 2M1ZA 4R8UA 3RGWS 4WZZA 2C07A 5C7LO 4FDMA 4G65A 4BPRA 3DMTA 3K6RA 3FOFC 2QZ9A 3CSUA 4TMVA 4LS3A 3KQQA 3OQOA 3QLJA 4KIWA 3X1MA 1BVUA 4DBLE 5LQRA 2UZ0A 3WVNA 3ZQ6A 2BEJA 1HT1E 1GL7A 5IP5A 2RHHA 3QVGB 3EVGA 5F5XA 3K2IA 4F3KA 3PGLA 3WQBA 1NW6A 1S3FA 3LW7A 4OX9B 1DKLA 4J75A 1II8A 1QHHB 4KCGA 4NDNE 3N2KA 1E9BA 1KBQA 3GJQA 1F9EA 3ZY5A 3MRVA 2R7MA 1DWQA 4CCYB 8ICSA 3UKOA 3DO8A 1DXOA 1IDOA 1X39A 2E3JA 1FNBA 1XWIA 2WQ6A 4EI8A 1OTXA 1B0AA 3PRKE 5JRZA 3FKJA 4TKVB 1WLSA 4WZAB 4FGKA 4GT1A 3L4BA 3KSUA 3QU4A 1MC4A 3F6BX 1XGKA 3KZCA 1G20B 2XGPA 3OLQA 2AGOA 2FFQA 1DX6A 2WM8A 3ONWA 2R1UA 3BHJA 4L78A 4B31A 4F4XA 2O6KA 1PDWA 1K06A 1HFEL 3ZYCA 1UZUA 5D6OA 4J76A 2WVHA 1WABA 3AGQA 1TO2E 3WNCA 3LX4A 2CMKA 2B99A 4KX3A 3KALA 4PZ9A 1M0SA 1D2MA 1TA4A 1T5LA 1OXJA 3G82C 5FTLA 4XVQA 4C0ZA 1GQ2A 1DIBA 5ALDA 5K99A 4XI9A 1R18A 4M8LA 3CGGA 3TRHA 4RSGA 5EJ6A 4DSKA 4ER5A 4XX0A 3H75A 2UYYA 3P9XA 3WJ7A 3LUCA 5KNBA 2H1VA 3KPVA 3VNQA 2JLAA 1LEHA 4BX2A 2OD9A 1XEXB 721PA 2FR8C 3A6GA 1QIGA 1XPJA 2KKVA 3M70A 4QU8A 3AJ9A 3F73A 3TFSA 4W99A 1HJPA 4ZREA 4IV0A 3O5AA 1RQPA 1C80A 4MGYR 1II0A 1D6MA 5EE1A 1KI8A 1QH9A 3BQ0A 2HA7A 3E9NA 4D3ZA 1C3JA 2CJWA 5HHTA 1Z38A 2UZ3A 5AHWA 1H0RA 4NJOA 3AW8A 5K0LA 1OAKA 2AD5A 4BATA 1A5TA 3B5IA 2JMGA 1A5ZA 5K8CA 2FA9A 2GEFA 2ESRA 3EBLA 1NVVQ 4QXMA 3OFKA 4GXIA 1POWA 3WP0A 1ZSYA 5HTOA 5EKXA 2YUTA 3HSKA 2RGWA 2WHRA 3S81A 1ZS9A 4J9PA 3TDMA 3H1BA 2P8SA 3WY9A 3I1FA 5KCZA 3SBEA 5DB6A 3U6BA 1T2NA 4ZRNA 1MW9X 1VPDA 2GFQA 3LPLA 1U1GA 3RVSA 5TQ0A 3VO8A 2PS0A 1YCGA 4X65B 4H1WA 2NIPA 4PAGA 1S8FA 3CCCA 3EPGA 3A9UA 5CB4A 4LV8B 2C9DA 1FY2A 3VPXA 3ADKA 3PXDA 4JENA 2APJA 2XMDA 5B1HA 3LT5A 3KQYA 2BLNA 5FXMA 2EAPA 2H4HA 2V7PA 3I9NA 3TOXA 4KACA 2LCQA 2QSUA 2UZ1B 2OYSA 4MNTA 2R1TB 3M6MD 4L85A 2L17A 1LD3A 2R8XA 3IAS1 2A9KA 1EUCB 1MFPA 4YBRA 3LF1A 5BWNA 3SHTA 4KLUA 1OTYA 1EFPB 5IX8A 4H1HA 5FUQA 1P4SA 1TEHA 1MXFA 3E9QA 3Q98A 2VATA 5FYQA 5DB8A 1GCUA 4R8KA 3HRHA 1G66A 5K3CA 2DFKB 1FE8A 4LMAA 5DBIA 5I9IA 1HMYA 5J40A 1L5HB 3RT9A 4F3OA 1DKOA 4J8PA 4J2HA 2IDMA 3FSGD 4CCWA 3PUZA 2H2HA 1UEIA 5ARBA 3PW4A 1JWBB 1ECJA 1CR1A 4QZDA 2O0LA 4D80A 3RSQA 1TVCA 4FM9A 6ADHA 3THXA 4PLGA 4R2KA 3AB8A 1G5QA 4NE9A 3BFXA 4DV7B 1XR3A 3O1IC 3JAKA 1EI9A 2YWXA 2LVBA 1K8RA 2O2CA 1ZVVA 1FDIA 1UP7A 4OHUA 3CPJB 4FZJA 1C9MA 2ZS8A 4W5OA 3EDMA 1JALA 5EGNA 3RYIB 4BBJA 2BM8A 2OMKA 4ZI5A 3F7OA 1QG4A 1R5JA 2JFHA 3F3SA 5LU9A 4FR5A 1DGQA 1YUNA 3GK3A 1IE3A 3DPIA 1JB9A 3EZ2A 4OTZA 4Y6LA 3GRCA 2WAAA 1BGVA 3GYBA 2R8GA 1CWUA 1USUA 4DAEA 4R9VA 4DCCA 2KNJA 5EJ4A 2FFAA 1JA0A 4Y9UA 1Z0KA 1F48A 3ZDBA 4HZUB 2O3RA 4AN0A 1LLQA 1DADA 3TS1A 3RWOA 2CHUA 4LY0A 4RXTA 5HJEA 4PL1A 4C0XA 4M9JA 2I0FA 2YYSA 1E4EB 3ZLVA 2VK1A 5CPFA 3S55A 1NUPA 1NC3A 1KDRA 2QNBA 3F90A 1TYZA 4HRVA 2VHJA 3K0EA 2YNMD 4ZN6A 1RI4A 2DJ5A 3FW1A 2GZRA 3FCOA 4IR9A 2GASA 5C32A 3ANNA 1G3MA 2ABWA 3ZX4A 1OJ7A 1GCOA 3NGDA 1SC9A 3NIDB 3EYZA 1KU0A 5JIBA 5AK5A 4X7RA 5IPFA 2AU0A 4IUCS 5C4GB 9ICLA 3GLFB 4EH1A 4MQEA 3T5GA 4U63A 4IOMA 2NZYA 2ZUDA 2ZRDA 1CW2B 4KN6A 3AVTA 1RLIA 4AUKA 2DBQA 1HUZA 4EB8A 1LBTA 3PX3A 1WO8A 1PAUA 3QPBA 3UVEA 5AW7A 2QBYA 4C8KA 1IXKA 1V1RB 3PQ8A 2ZVDA 2W42A 4KYUA 4RKEA 3BL6A 1QNFA 1CQJA 1PT7A 3JWPA 2HYDA 4YXWA 1XZQA 1B2LA 1SUWA 3UGJA 1H3EA 3LXXA 1XU9A 3IR5A 2COKA 3R0JA 3RVDA 3IEVA 1RJ9A 3ZGXA 3ENZA 3K8OE 2IU6A 4GMHA 1VLBA 4GOXA 3DMRA 2YQZA 5B3AA 4YDQA 2EAUA 4C2UA 3UTCA 2HU7A 2R5FA 3PMNA 1VOTA 4UAYA 3ZV3A 2VTDA 2VDPB 2HT1A 3ABIA 1KZ7B 3HFRA 3RYHA 2EIXA 1M2VA 1L5MA 2BF4A 1X7DA 3SOZA 4B6FA 3EWAA 2FSPA 4JJ7A 4DYVA 1Q3VA 2E4XA 3PVCA 4QHSA 4GKVA 4K9PA 5BN5A 4L6AA 2YV2A 4Y6PA 4EATA 1SKYB 3NX4A 3SF8B 5AJTA 2ONJA 5FTWA 3CF4A 2ZRKA 4RXUA 4RZ2A 2L5YA 3KK0A 4ZVVA 5JD3A 4UASA 3BN3A 1ULHA 3RAFC 1KVQA 3DOUA 2YICA 4HQFA 1ZONA 2BMVA 2NU6B 4N7JA 3CGWA 1GT91 4B71A 2QN6A 4PLFA 3MT9A 5I48A 3F2DA 3LLSA 3WWCA 4QYSA 1RZRA 4I4LA 1COWD 1YDEA 5B7PA 2FPWA 3N6XA 1PSWA 5TB5A 4EIWA 2XECA 1NVKA 1V4NA 1OA1A 5FLEX 1GPKA 5FWXA 3RB6A 4CT4B 1HI9A 1L8XA 1QKIA 5AJYA 1N1MA 5HSGA 4L51A 4X95A 3ENNA 3IE0A 1OV4A 3T94A 1IQUA 3IUPA 4MVJF 1Y9ZA 5BPFA 5EP2A 3TOZA 2HRBA 2JVIA 5K8LA 2A9OA 5MN4A 4LDNA 4REMA 5IULC 1OROA 4IEIA 5TF4A 1GV1A 3KOXA 1NLYA 4R64A 3HBMA 1Z68A 3ROMA 2BISA 4GI1A 5KFEA 2WNSA 2QD5A 3G0DA 3IIMA 2AOTA 3V48A 1Z17A 1FNCA 3ZH2A 4BQPA 2BRUC 3IEUA 5J2HA 3PW5A 5KG2A 1E0DA 3WK6A 3OUTA 4IQFA 3DNPA 1NDHA 5K3BA 2VUUA 3HWSA 1Q1BA 4XPZA 2Z09A 1N0IA 3M8KA 3LK9A 4PLPA 1I14A 1FFSA 2EVWX 2ORYA 4GPTA 3NVVA 3CG4A 3PXBA 5B2EA 1SKAA 4LVNA 4M0EA 2Q29A 3IDZA 3K1ZA 1GU7A 3WWZA 3ZZNA 4MHSA 3CNQS 3DEHA 4QTYA 3GA0A 2IH2A 3QEMB 1FU8A 3HPOA 5KFNA 1IXRA 3EAFA 7ADHA 1EJ2A 5KFBA 4LSWA 4MVJH 4RL4A 4PO1A 3T7JA 2Q21A 1JSCA 1EE1A 3NC0C 2IYLD 3TQOA 4BNFA 1WW3A 4BO7A 4XDYA 3UJ9A 4P31A 1ZIPA 1AO0A 1K88A 1QBGA 3ZLUA 4CIXA 5THXA 1D2GA 3A27A 2WUVA 3OU2A 2VP5A 2PLWA 2Z2JA 1PK9A 3JZMA 5CT9A 1A8HA 3C5WP 1RDFA 4DCGA 3VZPA 1U7OA 2RKOA 1VRVA 3JPWA 1B4FA 2RRDA 3KOOA 4NHEA 2Y1WA 4GUDA 3KEMA 1Y3BE 2A59A 3P2JA 2QM8A 2Z4TA 1PW7A 1PSZA 3Q2IA 1INLA 3HCNA 3FNBA 5CR9A 1R6DA 1L3IA 4DSZA 4KNYA 3F98A 5CNJA 1ONBA 4K1XA 4EFDA 2HHSA 2FK8A 3AT1A 3UCFA 2H57A 1KK1A 2WJHA 1WTAA 1QFMA 3C87A 1UZNA 1JJAA 2ECPA 4OYHA 5T4EA 4YJHA 1P72A 2DWOA 3OCVA 3HO1A 3VJMA 4LXGA 2XD4A 4ID3A 1T0IA 2A7XA 1B14A 3B9RA 4A4DA 2I55A 4QXRA 1MRNA 1R1DA 3SEFA 2HV9A 3WYEA 1IXSB 1H2XA 2R8ZA 4DV1B 3LHKA 3H3JA 2Q0QA 1Z6XA 1RR6A 1UOPA 1WQ1R 1TF2A 3HXPA 5JLAA 3AY3A 4OIMA 5BMOA 4NLLA 3OBIA 4LJKA 2O2ZA 5KQLA 4D4IA 1J8MF 1CDEA 3EVZA 2BPOA 2WZBA 1NVVR 2OBXA 3NAGA 4P3NA 5CRXA 2CFOA 3S1AB 4JAVC 5HKKD 2JLVA 4YLYA 1F8XA 1QYDA 2PQ0A 1UKBA 2HJ9A 4ZHQF 4ENUA 3PNPA 4HX9A 1VPLA 3LZ6A 5BQ3A 3T5HA 2JK1A 3BTVA 5EP1A 2VP0A 3DVAB 4MQMA 4WDQA 5T64A 2HHQA 3WYBA 3LQ2A 2YWGA 3WAJA 1SIWA 1ZD2P 4XX1A 1HH4A 2HHLA 3LS2A 3SHQA 2LGJA 1YV9A 2VQSA 3A9VA 1ESDA 1KOJA 1SCUB 4DNOA 3MS4A 4OUDB 3KTDA 1O1YA 1U9ZA 1BN7A 3DDSA 2VRCA 2RG7A 1ENOA 3ROFA 3EAQA 4UW9A 3VYTB 2XQKA 1XTBA 1XZCA 5E0OA 2ZI4A 2OSBA 4YR9A 1R66A 2H3VA 4KXYA 5A9SA 5JQGA 1CUCA 1Z1BA 3WNBA 1YZUA 2UYGA 4GP7A 4LG1A 5TDHA 2QTVA 2YFHA 3GZJA 2HYIC 1WHSA 4CQMA 4MP6A 1NRXA 4XFJA 3QY0A 1FYWA 4TX1A 2YZMA 2A0KA 4MVJA 4K9KA 1J9ZA 2J5BA 4MYCA 2H5LA 3TUIC 2B30A 2NXJA 5DTMA 4P86A 2IIVA 3QPCA 2XDQB 3OQ1A 4DL9A 4LHZA 4P32A 1WCNA 3DOCA 1AV7A 4UULA 4QBGB 1BE1A 3FRIA 4CFZA 1MLDA 4IRKA 1KVTA 5KT5A 5IK2D 2G9VA 3MBOA 2IJGX 4W5RA 4OCZA 4DMLA 1BAPA 3CPEA 5EJAA 1B6GA 4TRMA 2P27A 4XR4A 2BFOA 1BFKA 1SVWA 4QO7A 4WJKB 1J00A 2VZ8A 4WLNA 1ZVJA 2Q9UA 3SQIA 3FDJA 3PPIA 4BIMA 3AH8A 5AVVA 3KOYA 1YBFA 5JRJA 5D3KA 2ZPUA 5JAOA 3K30A 2RHFA 5JBQA 4M8IA 2XF2A 3H42B 3L4JA 2E0IA 3ZCVA 5F9MA 3IA7A 1UM9B 4WASA 3H9JA 9ICPA 1SB3C 3HP4A 1IZ7A 3B5JA 2OFWA 3FUWA 2P2ZA 4Q03A 2BFEA 3IQFA 4TVKA 3CT6A 3GZFA 2ENWA 3OZEA 1HDZA 3DCYA 5EJEA 2FQ1A 5KSWB 4MYDA 1HIWA 4QZBA 2GCIA 4JDUA 4JGBA 5BSWA 4M83A 3RKRA 1ID8A 4K6HA 2GLTA 1PJ2A 4QVKA 4H2DA 5J2EA 4RY9A 1UMDB 2XX3A 4JOQA 3FAKA 2VBFA 2ZAIA 5C7YA 5B58C 3E9DA 3UT6A 3UK1A 4KIJA 4BZZA 3K0CA 4RNCA 1DFGA 2VJAA 3F5MA 5CXQA 4OG2A 4M60A 3C41J 5SZJA 1XZFA 1FFAA 4IUDS 2JGEA 3I2HA 1ZN8A 1VGRA 1C1DA 3WE7A 4AXBA 3KUDA 2OTCA 2P9BA 3KQOA 4FZ3A 4QYMA 3I73A 1YR9A 3TIFA 3QW4B 1STOA 3BFVA 1ZK3A 3BSSA 3ND9A 2Z43A 4C4TA 4TKUA 4NMXB 2GX6A 4BAZA 1DC4A 3LD9A 4DEVA 3FTNA 2UXBB 2QMQA 4QJ3A 4RZRA 1SR8A 3QVLA 1QNLA 1GRVA 5FLXA 3UHPA 5HR5A 4E13A 2JAPA 2EF0A 2UYHA 5A3QA 3NBQA 1FIUA 1FMCA 4AY6A 1IOWA 3NASA 2AQ0A 1PQPA 3GFTA 4LI0A 5DM1A 5KHAA 2GZSA 5E6RA 3RTAA 1H2EA 3PHLA 5DT9A 2Q6TA 1T91A 2RAUA 1PCXA 3A4MA 2Z3VA 3MAJA 1KDZA 3O8OA 5ITWA 2W70A 1YDGA 4GR4A 1YK0A 4I4CA 1SCDA 1J0EA 3D6MA 1KGDA 3WGZA 4DSIA 4GSKA 2VZ9A 4G01B 3Q7TA 3MCAA 2YW2A 4EJSB 3D3QA 1MBZA 4ZHQA 4ZV9A 4OJKA 5IJ9A 1FFBA 3HKEA 1CQZA 3KHRA 2V8OA 5DBGA 2BC9A 2QD2A 1H94A 1W8DA 1ZD8A 5KL1B 2MCFA 5L3RA 3QTBA 2W8KA 3ZVRA 3HBFA 4MA0A 5MGBA 4W6ZA 4ALNA 1XXLA 1H05A 5DIFA 5TC4A 2ZYDA 3JZAA 2BP7A 4JLAA 4ZI2A 2A86A 1E20A 3RODA 5I9SA 4EGFA 7ICJA 3KKQA 3GLHA 3PICA 1JPJA 1L6NA 1SKQA 4CV1A 1DQSA 3KFVA 1WMBA 5C4IA 3C5VA 1E1KA 5DSZA 4AMBA 3TTWA 4DF3A 5J3JA 3AKZA 2PUDA 1F8FA 2VJDA 4DRXA 5TT0A 1NI4A 3OEWA 1C50A 2FUG1 1UANA 4RD0A 2QG4A 4BJ1A 4NS4A 1ECPA 3RTDA 2DUUA 1L0BA 4A2CA 2VP3A 5A0TA 3JD0A 5CHEA 5CHGA 4JB2A 4BEBA 5GPBA 4R69A 3QF4A 2C2OA 2O2XA 3RCBA 3NWPA 1NMXA 1RHQA 1S0UA 3WHKA 2XB8A 5E38A 1K4YA 2J3MA 3UAGA 3ZNQA 1S2NA 2JV3A 2I9KA 5J5VA 2GEUA 1O97C 4IILA 2XDYA 2H4JA 3UT5B 4ENQA 2DFVA 3LQRA 2VHVA 3A6HA 5FWAA 1LDEA 4RVHA 4NESA 1MF7A 2QP9X 4JC0A 2EKBA 4DV5B 2XMQA 3FNRA 2RGGA 2RI1A 4YMWA 3ZV4A 3C7CB 5LJLA 4S0ZA 3O38A 3FTCA 4A2PA 1LI4A 1OZGA 4I4TF 3WX0A 3N59A 1B93A 1TUGA 1S0VA 1SKWA 1CKEA 3GHYA 4J4TA 3GUYA 2GJKA 5BQXA 3GRUA 5DE3A 1RZRD 2HIAA 2EERA 2L19A 3K05A 1VYTA 5GAJA 4A82A 4M04A 4EY3A 2XE4A 3KXDA 5KFFA 3FCUB 5J0OA 4CN8A 2L2QA 3PV0A 1GADO 4YN4A 2QU8A 3RVMA 2NU8B 3CISA 3OIWA 4MW4A 3RK0A 4ZT4A 1R50A 5CJ7A 3D3KA 1VE6A 5K1ZA 3U40A 4KK4A 1CF2O 3JV7A 1SUDA 4ED2A 3T9EA 1BYUA 2WIDA 3BJIC 3RNLA 1W5AA 4YRDA 1B42A 3R0IA 1RQXA 2VHCA 2D59A 5A04A 2HPVA 3FAZA 4NATA 1BHSA 4WECA 2WTAA 2Y0DA 1XD8A 3L9XA 1KN5A 4ZTZB 2HCFA 3VU9B 4P82A 2ZG6A 2W9CA 3BUSA 4NCXA 1M66A 1VKJA 1Z4QA 1EE9A 2H1LA 4JJ8A 4BXOA 4S2UA 1QAOA 1VXOA 1XPRA 4UE2A 1EWRA 4R51A 3AJAA 1ZH6A 1ZRNA 3G0BA 1S02A 2YQ5A 3LWMA 4PGXA 2OILA 2EFCB 1OLXB 1JIVA 2FFRA 2PXXA 5IYZB 3JVDA 3A1UA 1ULZA 4MFFA 1NX9A 3MGAA 3IBCA 1VB5A 4ECRA 2DX7A 2HLDD 3BHNA 4JU8A 3FH0A 4M1YA 3IPXA 5JH7B 1HWYA 3CO0S 4ND2A 2CMFA 1QQ6A 5UKDA 1AUQA 5IXYA 1EQAA 4DMMA 4N7RA 1W85B 2Y66A 5E9AA 1G1MA 2GBLC 2QJFA 1EKXA 3VHQA 4UEKA 3VZCA 3OSPA 2OK8A 1XLVA 3NIGB 3G0CA 4EA8A 3GCXA 4KN4A 1OV6A 4XRGA 2ZUWA 4DIUA 4KQ6A 3TL2A 1XCGB 1AQUA 3AR2A 1R74A 3I01A 3OO1A 4EUEA 2GCGA 3Q2OA 3IUNA 3F4LA 1Y6FA 4OI0A 4F6CA 1G5HA 2OXIA 2XXBA 1ADYA 3AY0A 1BD4A 2J1LA 2C2XA 2RIPA 4M98A 2QVGA 4DFDA 1NUHA 3ETLA 4YFKA 2BMJA 4LF9B 1QHGA 5FBVB 2IYAA 5CXXA 3CZQA 3U5ZB 2C4UA 3JYPA 5H59A 3L8YA 3IUBA 3FKQA 1A9XB 1I4OA 1VL1A 3WMXA 1M2WA 2WHPB 1WVIA 2HBLA 1ISHA 3PW2A 2R7AA 5IBPA 4G8CA 2VHEA 1CR2A 1U6KA 1MO3A 1XRRA 3W5CA 3MD9A 1OB2A 1ZQUA 4RLFA 1K5PA 1ZBDA 3VPBA 4IGEA 4PXYA 2H18A 3WQRA 4AECA 4FEEA 5BSUA 4WZBE 5GP1A 2ZCVA 2J0UA 9ICGA 5C3UA 4W8OA 1I30A 1EP9A 4MIOA 1A9RA 1YJ5A 3JQ8A 3HNPA 3CSSA 3EXG1 1R0BA 1KAOA 1BEEA 4QSHA 1OI3A 4P4OA 5U9CA 5ILGA 3F5SA 4QKQA 1GSOA 2H59A 1R6XA 2XW6A 3HGQA 2PRYA 3H2KA 7REQA 3WLJA 1GQYA 2EJVA 2FVXA 1FDTA 2JD2A 2B83A 1O6CA 4F97A 5TGTA 1R4NB 1UWCA 3QW2A 3S44A 1KMHA 4L72A 2AMVA 3BWYA 2NZ2A 4A8PA 4V0LA 2ZXFA 2LKCA 1W2GA 3ZHRA 3UMCA 4ZEWA 3DOOA 1BXKA 2B7CA 4KR7A 1XS9D 2BY4A 4K5QA 3NDJA 821PA 3VPGA 1YNSA 4PX9A 5FOQA 1XXHA 3WRXC 2B0CA 1WXGA 3PO5A 1R8XA 2I2CA 2F90A 1TQ4A 4I4TA 2IOFA 2KLHA 1TYEB 4BMXA 3FXAA 2BFCA 4XIIA 2DHEA 5F9FA 2CLFB 1UPCA 1W5EA 2GQ0A 4HYKA 3RJGA 4GXTA 3JQGA 1BKYA 2RHJA 2K60A 5BYJA 1GPLA 4P3XA 4TVOA 1LI5A 4S3MA 2O1SA 4CQMD 5U4XA 4HX5A 5TNXA 3TZKA 9ICVA 4QTXA 2QAGA 3BGSA 1K5DA 4MVJD 1A8PA 3DKKA 1S9FA 8ICRA 1T1GA 5KSYA 4XD7A 4NZ9A 3B6IA 1KZ4A 3ZEAA 4YRMA 3P2IA 4O63O 4FGUA 1YWGO 3K70B 4Z6FA 4L8LA 3R6DA 4AJJA 1W2WB 2ZJ3A 1CP3A 4ZYWA 2CKMA 6REQB 2OR3A 4FX2A 5E0KB 1TKAA 1RP7A 5BQOA 4KXLA 5JSYA 1MFZA 4Z9BA 3I2YX 3V4OA 2GBIA 4E3WA 1OLUB 4K9MA 4DPMA 4QUKA 3AL2A 1EB9A 2OM2A 1UBOS 3HEBA 4YRIA 1FJXA 4DCPA 5LSAA 4G9EA 4Q4DA 1DP4A 5HUQA 3KKKA 3O3OB 1M1XB 4PGHA 4WLOA 4JL8A 3X43A 3C70A 1JIHA 2C7BA 1TM2A 1A0PA 1QIEA 1PJSA 1D0IA 5FB3A 5KSPA 5ED4A 1NSFA 3MB8A 3M3DA 2NU9B 3KE9A 4DZRA 3N7RC 2BUBA 1W46A 4E4TA 1U7DA 4IIDA 3VSCA 5CW2A 4JOCA 1DLIA 5EPOA 1A9ZA 3E5HA 1W1UA 1AZWA 3Q3EA 1U2TA 3L77A 2RH5A 4EELA 5FWDA 1R0LA 3PFKA 3KJZA 1TM1E 3I5MA 4WMLA 5FORA 4DC0A 1OFIA 1C3VA 1ZHOA 2PMBA 4A73A 4KHPB 3RBVA 3A9SA 5EWJA 5AW9A 4J3JA 2A6PA 3JPQA 3E35A 1LU9A 1FDUA 2XMSA 1PL8A 4YRKA 1K8ZB 1YKFA 4KIGA 2WAQF 3E9YA 2P69A 1CVRA 5HUJA 3VR6D 4X20B 1TX4B 3NYIA 5KOJB 4CEIA 4FBGA 3JCZA 2J31A 1TJ3A 3B1KA 1Q44A 2D0OB 1Y8AA 2FZ5A 1I1OA 3H9BA 4MI1A 2REBA 4D99A 2J59A 4JJKA 5BSMA 1CUEA 4NBVA 3AL0B 4AZ0B 4FD3A 4Q4JA 1NK0A 1CNFA 1NVAA 3PK0A 4MF2A 5KFKA 3BDVA 3ZVNA 4BUZA 2NQTA 5T6BA 2XUAA 2H3HA 3GP5A 1T15A 2R85A 4YJGB 5FL7A 4WXRA 4FTWA 2DF8A 3OAAA 4S05A 5DNAA 2JFFA 4RD3A 4CRWB 3FYUB 5BRNA 4G0ZA 3RH4A 4KMOB 3RRNA 1DAFA 3TLEA 2ZAMA 1DFIA 4TMFA 1E79A 2AYYA 3TR0A 2Q50A 1YC5A 1KKMA 2ZDGA 3CLKA 4O4HF 2RLTA 2QB0A 1D2CA 4OPMA 4OQDA 1YQGA 4QQKA 1GVNB 5B7QA 1LA2A 4O8CA 3ZZTA 3H65A 2FUNB 3ZJUA 1P1JA 1RWNA 1ZX1A 4QW8A 4JYAB 2QN1A 3LOQA 4IM7A 3MUNA 2H31A 1C30A 1IRIA 5CJPA 4K9SA 2VUHB 5KQRA 2FWBA 4EITA 4GBGA 5FL3A 1XK7A 5KWVA 1VMDA 3OTOB 3SDBA 2X0RA 4R63A 1V2HE 4FUTA 4BLSA 3HNRA 4JD5A 4EG0A 2LBOA 2YWBA 3GUVA 3W5SA 4K9LA 3M9LA 1FJ2A 1W73A 4GPD1 4B9EA 4R3NA 3STWA 4MI9A 3JPOA 4X8OA 1MGOA 2VT6A 4YUXA 1F3LA 3QHAA 1EDOA 2K5UA 3ZQ4A 1SXJA 3WGMA 4RT2A 1VJ1A 3OMWA 3OZWA 4OOFA 4KLAA 4P4LA 4L75A 1EBBA 4BNNA 1S2LA 1RWXA 1C9KA 1N5XA 4EPYA 2IITA 2WM2A 2HA6A 3DCJA 2AXPA 5IDXA 1FXSA 2IELA 3PD0A 3C8MA 4G67A 2X1VA 1SVOA 5EJ2A 3MINA 4YT4A 1S4QA 1SZPA 1ULAA 5CMLA 3KT8A 4Y6RA 1LVUA 2ILTA 4F4HA 3ESDA 2VANA 1OREA 1ZGZA 1U9IA 1Q17A 1Y42X 4MICA 4OXKA 5EXTA 3VU0A 3LY5A 2CVZA 3K4PA 2AQKA 2M98A 1IPEA 3UENA 5E1OA 4BASA 1XCBA 3ITDA 4Y1RA 4EF4A 1T0HB 3SCZA 2JFBA 1KMCA 1KEPA 4XYMA 3DGFC 1DKMA 2NX2A 4DUZB 1VLZA 3ZYZA 3TW8A 2CNKA 2WD9A 4K4HA 2WJVA 4O02B 2C9YA 3O0TA 5IHPA 3F7TA 2VUIB 3RVOA 3EOAI 1JPVA 3TCNA 2A57A 3G49A 3EOZA 4OHVA 2DF4B 3LT4A 4YG2A 1K92A 3RJIA 1FRFS 4NLKA 2XNJA 4N5IX 4HGZA 4Q3OA 4FBTA 2VF7A 5BR1A 3DDCA 2FSIA 3AKDA 1UMBA 4Y0VA 3IG5A 2O23A 1MJ5A 3T7EA 3PNKA 1PZXA 1B0PA 3ICWA 2Q0XA 1MJGA 1HKUA 3OPYI 3VOBA 2IPXA 5EE0A 4MRRA 4A0SA 4DR3B 5TPZA 4B46A 1U5CA 1UADA 3QUCA 5H81A 4MDFA 2QTHA 5BOLA 2XTMA 3AU6A 1SVIA 2R9VA 3LY8A 3VNUA 3HVIA 2D2XA 2GTPA 1GDTA 4NCAA 2FN7A 5DK6A 1N8KA 4WBNF 421PA 4Z6DA 2FWPA 3MPUA 1DKQA 3GIJA 3WK4A 2B92A 5AD1A 2C1ZA 2ZATA 4A9AA 3QU5A 3AEYA 3IULA 1QJCA 3RS2A 3LI2A 4L8YA 3SX2A 4A10A 2FEAA 5J0RA 1XRMA 2V5AA 1UK8A 2I5PO 5HKBA 4WK0B 2Q5LA 4LDZA 2VLIA 3GQBA 1GUBA 3COPA 1ULBA 4JKOA 5IH7A 2GHRA 3O1JC 1P31A 2IH4A 2MWMA 3AESA 3I4FA 5DV9A 1JR4A 1MO2A 1N5KA 3ID6C 1BMFA 4ED1A 4M47A 5EERA 4WGFA 1YS4A 1E3LA 1TC1A 2WIJA 4TLEA 3DKVA 1FYFA 1VZ2A 1YB6A 2IA6A 4QFBA 5F2EA 5B66U 3N05A 1QK5A 4PHGA 4NLGA 4JLWA 1UUFA 2HDHA 3BMOA 1PS0A 2CXHA 1A71A 3CH4B 2JAWA 4YV2A 2IRWA 4C8NA 4KVGA 1PVQA 4WUVA 4C0BA 4LCJA 4ZGGA 2OFPA 4I2IA 1PYGA 4Z3OA 4YR0A 1MABB 4JKIA 1W0CA 2D7CA 1Q8KA 2JLCA 1AZSC 1Y4AE 2I3GA 1IEQA 2IBKA 4MUFA 1Z5NA 3EGXA 5GZ6A 4O4HA 2D06A 4FR0A 2W9XA 4JT8A 3BT7A 1T10A 2M32A 3IQEA 5JXHA 1OA0A 2R6CA 2AKEA 3LGXA 1NQTA 1DXSA 5FEMA 1H2WA 2QN3A 3NHYA 1RRPA 3NQ41 4N18A 2EW8A 3IEKA 2ES4A 4C5BA 1NRWA 3ZI4A 3K2EA 2Q2WA 3OD5A 1IEWA 4I2EA 1HDRA 3RIHA 2Q5HA 2XCPA 3L02A 2H4XA 2VR1A 3PJRA 3EK2A 9ICEA 2Y6UA 4HVCA 2J41A 5KFPA 2BDPA 1E3DA 1LDMA 3THWA 4HWKA 1U1FA 3HYRA 4DJJA 2PQ6A 1P8JA 4KFRA 3CH5A 3L04A 4NYMQ 1DBQA 2ZRGA 4R6WA 4X62B 3MCVA 1E3IA 3G7UA 1P6XA 2X4LA 1SQ6A 2XI4A 4C2BA 3M7IA 2KD1A 2GNPA 3PR5B 3DBRA 1O95A 1Q3HA 4HGYA 2EKPA 3TLKA 1QYVA 5DM2A 1OKKD 4Z7NB 4R84A 3PWKA 3LVQE 2C99A 1AS2A 4HWTA 3QKIA 1W48A 3DG9A 1XTJA 1IUPA 4BX9C 4HAIA 1W36B 3OE1A 4HJXA 4BN0A 3VI4B 1ZG3A 2PYZA 1YQDA 3EGDA 1T4CA 1ZQAA 3GFVA 2R6FA 3L7OA 4FXOA 3PGJA 4PF1A 4AKSA 2H11A 4C08A 4HXFB 3RYFA 3RVJA 1OTHA 2HA4A 1JGTA 3JS5A 1FQKA 1APBA 4IUBS 4FFBB 4HB3A 1YU9A 2H1HA 3GN2A 1DS6A 2OKCA 4WERA 2I5HA 1N33B 1LS6A 3H99A 4NQRA 1AKWA 3HJGA 5E79U 1YZHA 4EJFA 3G5LA 2FEKA 4M0LA 4CM5A 1RXCA 2YWFA 3ZKWA 1UMCB 3H04A 2D1SA 5DGIA 3GWGA 3E15A 4D2IA 5JDIA 4AB1A 1ITZA 4ZP1A 3EXEB 1GR0A 4UHCA 1ZITA 1VL5A 1XN4A 3AFHA 4ZHSA 1HFJA 2FDCA 1G7SA 4M9XA 1CDOA 4GX5A 4OLFA 2PT9A 4UQGA 1Q91A 1EU1A 2O7VA 2C2YA 3V7YA 1EFTA 3BRQA 3TE7A 5E3IA 4NJEB 3L7AA 3SJ7A 2NUAB 3HLKA 1V5FA 3IHLA 1NBOA 3ECSA 4RKWA 2PGDA 2YIDA 3HPQA 4TTIA 2A1TR 1T0BA 2FW9A 1GNLA 3OUZA 4HXEB 3OLZA 2J3LA 4RNMA 1ZQNA 4XR9A 2ZSUA 4WBNA 1D07A 1YS6A 1A7UA 5JJCA 5DYYA 4FJ0A 5CA0B 2OCEA 4P4MA 3PXAA 3UQ2A 3HH8A 4BAGA 4N76A 2GFIA 4FONA 2XNHA 3CB2A 5DG9A 5AHRA 1M2NA 1BX0A 3Q41A 3WIBA 4RIGA 2DPGA 4HL6A 3FOBA 3CZMA 4J9MA 3C6ZA 1GG9A 1JR3E 4HUTA 4IS7A 3D2SA 1I1QB 1MQ8B 2Q6OA 1C41A 2B20A 1NPDA 1OYOA 2W6IA 3V4LA 3IP8A 1V4VA 4N3NA 5FWYB 1XQXA 1HY3A 4IS2A 3CXUA 1ZQIA 4U1RA 3R23A 1VE1A 4Z9YA 1ZEMA 1LF0A 3U5TA 1O8CA 4QZEA 5DHRA 5C1PA 1TM3E 5HILA 3X2SA 4RD4A 4W1RA 4QTZA 2IHKA 3QMWA 3OPYB 4E46A 3DO5A 2Q5OA 4R2LA 1EXNA 3UN1A 5HNKA 1KYTA 5LQDA 3NBXX 2OSVA 5KT3A 2AZTA 4IR1A 4TL7A 2QVYX 1ZIYA 2I9PA 3IP4B 1NVFA 2C8JA 4FMDF 1ZH0A 3VYVA 2N42A 1PZHA 2ADOA 2GXSA 3U37A 2GLXA 4H27A 3PG5A 4FLEA 5HUHA 1ESEA 2UYOA 3E22B 5JQGF 4KTTE 3LL4A 5EIWA 5FHRA 1U7UA 3ESRA 2XUFA 4U2KA 2EX4A 4DV3B 2ONYA 4MPJA 1E0SA 5AESA 4Q9LA 4HGQA 3GXBA 4JR1A 4M9SA 4Q7QA 3H5OA 2OAGA 4QG3A 2FZEA 3SIPA 4P2GA 4BKMA 2R7NA 2EBWA 1LUAA 4Y6OA 1GKLA 4KUEA 1CNEA 3HR4A 1F9AA 2IYTA 1Z13A 2NZ8A 2PM8A 1SXDA 3L0OA 4FSDA 4XA8A 2O9JA 4ED0A 1VCMA 4MUHA 4KQKA 5G0WA 3DOHA 1RM6C 4Q4CA 3V9AA 3FBGA 2B78A 4QOSA 2Q4DA 1BMDA 2XH8A 1HDOA 1P1RA 3LCMA 4EI9A 2PJZA 1L6IA 2ZDQA 1F44A 2R6AA 4PSAA 4F45A 2R1VB 3WGUA 3KPWA 2WAYA 2VAVA 4UB2A 1ZZGA 1NBMD 2VDQB 2RHTA 5DHUA 4MUGA 3HXQA 3MWYW 1U94A 3ZHQA 3IRVA 4X1KB 5A3VA 1BQ3A 2HWUA 3H2YA 3RS4A 1QVWA 1UEXC 3TZHA 1P4GA 2P9ZA 2R62A 4V0RA 4FIZA 5JJKA 2FK7A 3R3SA 1O08A 2NW6A 3HYSA 3P7MA 5EP3A 3V2HA 4TTPA 2GN1A 1QPGA 2HHUA 3CLTC 1M10A 4RMNA 2ES6A 4EVSA 4DBVO 4UD2A 4BUGA 3O4IA 4BNDB 4EFKA 4EJSC 5FADA 4NBWA 1PLKA 5BN3B 1L1RA 3FVQA 1MU0A 3DEYX 2L69A 4MPPA 4IHJB 3REQB 1IJFA 4RVOA 3QVKA 2FOIA 1W4ZA 5C7OO 4X93A 5KINB 2AUTA 3PUWA 2SICE 3EIQA 5TMEA 3DPUA 1E79D 4KQ2A 3R5HA 2IF0A 3R0QA 3SMQA 1E0JA 7YASA 3TX2A 8ICEA 1I1NA 3GDOA 2QZSA 1V38A 6GPBA 2ACKA 5EKUA 2AW5A 1UK9A 3IX7A 3KKOA 1OFHA 3E4DA 1KI3A 1J2NA 1HLPA 3HUFA 3C2LA 4JXKA 1UZLA 2OORA 1WV1A 1ZMTA 4IX1A 4L74A 1KQ3A 3PNSA 1L7OA 5IWAB 2XEXA 3Q8KA 5CXUA 1XI2A 4JJFA 2FLPA 2YXDA 4QODA 3AETB 3A6DA 5EMKA 1P9LA 1F60A 2H7CA 2VEDA 2KOBA 3NKFA 5I8WA 3DR3A 4DOMA 1UPHA 4RNNA 2CLKB 4I1SA 5HIJA 5EWLA 3MXTA 4LTMA 3U4DA 2Y1LA 1BRTA 2G6BA 3USCS 1SXJD 1GUDA 1VA4A 1ZNXA 1PFWA 5EJIA 4DXAA 1DTSA 1I8TA 2ZRFA 5EYPA 5KVQA 5EEGA 3Q9UA 4BQNA 5JS2A 3ROQA 2HMVA 1VIYA 3R77A 3O8NA 4HSEA 4ZV7A 4H18A 3ZE7A 1KMIY 3K9LA 3ROXA 3OX1A 1SPXA 3HA3A 1U3DA 4QBHA 5HA5A 3E9EA 4EL0A 4HNUA 2NUPA 3OJLA 4TTTS 1EFVB 5JQWA 1JQBA 4IV5A 4HYEA 1E3TA 2C1XA 3LQYA 4Q7JB 5TPWA 5AHKA 2H6EA 1B74A 3Q40A 3LXUX 5M5BA 5IAKA 4B33A 3STYA 1L5UA 1UC9A 4MB2A 4B3FX 2B4KA 4U0JA 1Q0UA 4JZYA 1JEJA 2GN2A 3WLIA 4BFUA 3CUSA 2F77X 3F8WA 3AERB 1OXSC 3U9SA 1YT3A 4LVCA 1KI1A 3T0IA 1RM4A 1NVEA 1HA3A 1KK3A 3GLIE 3RG8A 1R6BX 5IVIA 1YONA 2LPEA 1A04A 2XMGA 3R7LA 2GH1A 2XA9A 1XA4A 1R5OA 1GHTA 1EB8A 3EW9A 3QXXA 1NOJA 3D4NA 4NAUA 4NF2A 4XTRA 3V4PB 2PKXA 3NV7A 2EX0A 2C7PA 5JRTA 3BDAA 4UTOA 4IDDA 1CQWA 4C78A 1YJBA 1HZZA 3EXG2 4HXYA 1DO0A 1KZ9A 1NU6A 3QA9A 3NBYC 1KAGA 3NUQA 5DEOA 1YZVA 4MV4A 1NBAA 3AUKA 3EUWA 1N2JA 2OWDA 4NEQA 3ZWPA 3CRNA 3FSJX 4LF5B 3MWJA 4DV4B 4NYMR 3RC8A 2OVFA 5JD4A 1K1QA 3OIUA 5E1MA 4KPYA 1QGUB 3DXYA 2O8VA 2QX4A 4OJLA 1XROA 2BL4A 2Z08A 3F2BA 3WL5A 4G09A 4ID9A 1JHZA 1GPNA 5G1OA 2A67A 3PXUA 2NRVA 2HHTA 4NY8A 1NW5A 2ZIZA 3VAAA 3HY6A 2RGAA 2A5YB 4TQSA 4G6ZA 3BXFA 3LYLA 2ZI7A 5KNBD 2IP1A 3WLFA 3M4XA 3GGJA 2J9FB 3L4EA 4NNPA 1PDVA 2PMDA 3PI7A 2FETA 1NXTA 4MGKR 3RSFA 2G7MC 4RAQA 1TKCA 1YHYA 2B98A 5EJ5A 1IYZA 2D1QA 4BDPA 1CDZA 4KWCA 3EDYA 2JGAA 4PYRA 2XT0A 4BZWA 4C7OB 3A6KA 3WR5A 1IM4A 2ZE7A 1RJWA 1LPBB 3K32A 3HCBA 1RYFA 3NWEA 3QLVA 1SULA 1BMFD 4DWIA 4GU5A 1Y8QB 5JYDA 3GCDA 3L9WA 5NULA 1E6KA 2ISCA 2C78A 4I4IA 2WW8A 3T3NA 3PXCX 2ODAA 3QVUA 1QQ5A 3V6HA 4G5RA 4RTOA 1GFWA 2YB4A 4ZVMA 1I5EA 3KJFA 5JD6A 5DNYB 1GN9A 2E1FA 2ODQA 3BMQA 5EQTA 2F8LA 1A7AA 3OOSA 3P9IA 2VPQA 1QAQA 2H07A 4X61A 3ZLBA 1A4RA 3WA6A 5GTDA 2RG1A 3QE2A 2W2VA 2I8LA 3BG5A 1GSAA 3QVWA 1ZP6A 4KPGA 5K45A 4RM3A 3TIVA 5BURA 2H3FA 3RFFA 1RP1A 1R37A 4DEZA 3S2UA 3IQGX 1MW8X 4DE5A 3AW9A 4HS9A 3LT2A 4BLUA 1UK7A 1XCMA 2A4MA 2DCUA 3ETEA 1XNSA 1BPZA 3E23A 4LHEA 1EX7A 2XVZA 1Y8CA 1H85A 4P4GA 3M2PA 1Z2AA 3O3CA 4N8SA 5AI6A 4TSFA 3NVZA 4G1VA 1W5SA 5L6MB 5LNK1 2V3CC 1TK9A 4N3BA 2XWJI 2OP0A 3H6