3R9KA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, glu47asp mutant complexed with sulfate, a closed cap conformation
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
227
structure length
227
Chain Sequence
GSHMRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHDGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Putative beta-phosphoglucomutase
total genus 83
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3r9kA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3r9kA01
1RMTA 3ESQA 3SKXA 3ZX4A 5AW2A 3ED5A 4EZEA 2QYHA 2D2VA 5AVSA 3ZI4A 3NASA 5AK4A 5ALMA 2HF2A 5IT4A 5AI4A 5T41A 3QX7A 2C8LA 5ALTA 4IFTA 3P96A 1NNLA 1VJ5A 1L7PA 2ODAA 1YS9A 4CF4A 1VFPA 3OCYA 3F9RA 1YMQA 2B0CA 2GHTA 2JAWA 5AW0A 5ALQA 3KZXA 5AI6A 5AK5A 3I76A 5AKEA 4UU0A 1ZOLA 4HAIA 3WKBA 3FPSA 1KYTA 4ZEXA 1RLTA 1Z4PX 3R09A 1Z4KA 3DNPA 3L8FA 4FYPA 3L5KA 3ET5A 2MSNA 1Z4QA 1RKUA 3U19A 2AMYA 2FPSA 2EAUA 3AR6A 2HCFA 2HHLA 3EWIA 3AR7A 1Z4OA 3VAYA 4CE6A 3L7YA 1CQZA 5AM3A 3R4CA 2C9MA 4I9GA 2AUTA 4NV0A 5AM2A 1ZRMA 4BBJA 3ZWKA 3WKDA 4BX0A 1LVHA 1EK1A 2CFRA 4GXTA 1ZD5A 4NFLA 1L6RA 5ALJA 4YIHA 4DCCA 1WZCA 3WKEA 2EARA 4G9BA 3QNMA 2FEAA 2G08A 3AR3A 5ALGA 3U26A 1L7NA 4UMDA 1U7PA 1QQ6A 5AW6A 1XPJA 3W5CA 5IS2A 5AM0A 1PW5A 3L0CA 5IT0A 4HGPA 5AVZA 3D6JA 1K1EA 2G09A 3IB6A 3QUQA 2C4NA 1T9ZA 2NO5A 4BEWA 4ZEVA 2O2XA 5AI9A 4C4RA 3WK8A 2ZG6A 4FE3A 3A1DA 5ALOA 3J7TA 3EF0A 4BNDB 1Z4IA 2CFTA 2WF9A 4RETA 5AK6A 3W5AA 5ALXA 3E84A 3E8MA 3GYGA 1NRWA 2MU2A 2B82A 4MWOA 5AW9A 2WF8A 2HOQA 4BX3A 1YJ5A 4NWIA 3M9LA 2MU1A 1U02A 3L0YA 4L6CA 2RB5A 3I6BA 3NIWA 3ZTYA 4L6AA 1ZD2P 4UAVA 2ZXEA 5AM1A 4XQ0A 2ZOSA 3E58A 5AHXA 2HO4A 1EK2A 3OCUA 1NF2A 4EX6A 2FI1A 3AR8A 3HYCA 2HF7A 3A1CA 4EELA 5AM4A 5AICA 4C4TA 3R9KA 1X42A 2HX1A 5AW5A 2BDUA 3IJ5A 1Z4NA 2YN4A 3TLMA 5AKLA 3SMVA 4Y2UA 1JUDA 1RQLA 3OTQA 2DQSA 3EF1A 5AW3A 2VKQA 3NRJA 1RPZA 3K1ZA 2IA5A 3U13A 5ALPA 1QYIA 4BKMA 3QUCA 3U7FB 2R8YA 4EEKA 4YCLA 4B6JA 3ZVMA 1CR6A 5AKGA 2IYEA 3L0BA 2WF6A 2AGVA 2GHQA 1U2SA 3UM9A 1N9KA 3L8GA 4KX3A 3NUQA 1RQNA 4C4SA 1SWVA 4XE5A 4AS3A 2YFYA 1YNSA 3DDHA 1FEZA 4ZEWA 2Q4TA 5AVQA 2ZBFA 2I6XA 4KNVA 1VJRA 4YIKA 1Z4MA 4BX2A 1S2OA 4UMEA 4F72A 3WK6A 1RLMA 4G63A 1L8OA 2G06A 4OCZA 2B1QA 4IG4A 4QJBA 3AR9A 3EPRA 3ET4A 1TE2A 3KOOA 3WK7A 1QQ7A 2JAOA 3ESRA 1Q91A 4Y2SA 3RFUA 3MC1A 2WHEA 1ZD3A 1O08A 5AVTA 2O9JA 3UMGA 3OPXA 2WFAA 4HGOA 3N28A 2FPWA 2HDOA 5AI0A 4Y2VA 1Y8AA 4Y2YA 5JJBA 1L8LA 3AR2A 5ALSA 3B8EA 4OFZA 5AM5A 1J97A 3UMCA 2B8JA 2Q4RA 2W11A 4EENA 4DWOA 1RDFA 4E88A 3CZ4A 1RC8A 5ALUA 5A3RA 4BYGA 1RLOA 2AH5A 1T5TA 3NAMA 3OCWA 5AW7A 4FFDA 3FZQA 3QU9A 4Y2QA 5AVXA 5AVUA 3QUBA 2P69A 2IOHA 2GO7A 3WK9A 2WF7A 5ALEA 5ALRA 4MUMA 4Y3UA 2PKEA 3KBBA 2OM6A 5ALFA 3PGLA 2YJ6A 4NAVA 3ZW7A 3W5BA 2FPRA 2X4DA 3ZVLA 4Y2TA 3WK4A 1RKQA 2OYCA 2NO4A 3SHQA 3MMZA 5AW1A 5ALDA 4KNWA 2YMLA 2P27A 2ZBEA 3U7HB 1ZD4A 2HEGA 4OHFA 2W4MA 2QLTA 5AIBA 3PCTA 5ALWA 3S6JA 2C88A 3QU7A 3U7GA 3SKYA 5ALVA 3I28A 2P11A 3L8EA 2C8KA 5AKYA 3SD7A 1WPGA 2B8EA 5AW8A 3I1YA 2P9JA 1U7OA 1Z5UA 1O03A 1N8NA 2R8EA 3MPOA 5ALYA 4CF3A 3ZUPA 5AVYA 1ZS9A 3WKAA 5E0OA 2YMPA 1IWOA 1J8DA 1ZJJA 4F71A 5AVVA 3IRUA 4I9FA 2JGAA 3N07A 4DFDA 1Z4JA 1RMQA 3KC2A 3ZWDA 4YCMA 5AI5A 4UATA 1XVIA 2YMMA 3QU2A 5AESA 5ALNA 1TA0A 4UARA 5ALZA 2JAUA 5AVWA 4XPZA 2R8XA 2JARA 3BWVA 3L1VA 1QH9A 1QQ5A 2G07A 2W43A 2YMQA 1LTQA 2G80A 3NANA 2YJ4A 2HSZA 2FPXA 1TJ4A 1YDFA 5ALHA 2CFSA 3QGMA 4YGYA 2YY6A 1L7OA 2G1AA 5FP0A 1RRCA 3CNHA 3FM9A 3AR5A 5AW4A 3WGUA 3WGVA 4CF5A 2YJ3A 2YJ5A 2HI0A 1T5SA 3MN1A 2WF5A 4HGNA 4HGRA 4GIBA 3B9RA 2Q5EA 4YCNA 2RARA 2I54A 4J03A 1Q92A 5AKJA 1U2TA 5AKXA 4Y2XA 4UAUA 3QUTA 3WKCA 3KDPA 4UM5A 5AKKA 4KYTA 1Z88A 3RF6A 2RAVA 1S8OA 4L57A 4UMFA 3QYPA 2IOFK 3AR4A 1YV9A 1ZRNA 2I55A 4J2TA 3N8GA 1F5SA 3KD3A 3U7EB 5AKIA 4JDPA 4JB3A 1TJ3A 1RKVA 2RBKA 4UM7A 2EATA 5AKZA 3ZX5A 2FUCA 4KN8A 3ZTWA 2YBDA 4CNQA 3N5KA 4OD0A 5AKHA 4UMVA 1MH9A 2PQ0A 4BNDA 1WVIA 2ZBGA 4AP9A 1SWWA 3SF0A 3A1EA 3QLEA 2B1RA 4RESA 4QQFA 2BY4A 3W5DA 4Y2JA 3SLRA 1WR8A 4PNHA 2B30A 3ZVNA 3ONNA 5ALLA 1RMYA 4Y2RA 3DAOA 3OCXA 1Z5GA 2WM8A 1TJ5A 3A3YA 4Y2PA 1Z4LA 4H1WA 4O8CA 2CN1A 2BDEA 3UMBA 3DV9A 2GMWA 1SU4A 2FPUA 4HGQA 2FDRA 3B9BA 2ZBDA 4AS2A 1XP5A 3BA6A 2I33A 2FUEA 2GFHA 3PGVA 3QXGA 3L1UA 2OA0A 2I34A 5ALKA 4UU1A 4XOUA 3QU5A 4BEVA 2NYVA 4DW8A 2I7DA 3NALA 5AI8A 5ALIA 3ZU6A 3OCZA 3N1UA 3OCVA 3FGOA 2R8ZA 4HYTA 4UW9A 3L8HA 4KX5A 4EX7A 3FPBA 3E81A 3PDWA 5AVRA 5A3SA 5AK3A 3WK5A 3QU4A 3FVVA 4NABA 2PR7A 1AQ6A 2IOFA 5A3QA 1L7MA 2OBBA 2G0AA 4YH1A 3M1YA 5AIAA 4UASA 3HLTA
chains in the Genus database with same CATH superfamily
1A5AB 4ZYYA 3CWQA 3UJHA 1N7IA 2KQUA 3DOCA 3GVIA 1O77A 4MULA 3SKXA 4I1IA 3VNAA 1PWHA 13PKA 3ESAA 4L5IA 4NBNA 5I7RA 4WN9B 1YUMA 1F17A 2JPDA 5HGXA 4ODIA 1CFJA 4MGYR 2QR2A 1H0RA 1Q1AA 1V48A 4AB1A 4OU5A 5LQCA 3E0QA 4DBZA 4MKZA 3MWEB 3UXEA 1IN8A 3KKQA 4CG0A 2WMDA 4J4TA 9ABPA 1Q7EA 1A9TA 3KL2A 4KHZA 1ZQ9A 1DGQA 2GESA 4MKRA 3TQHA 2HBJA 4LXQA 2JAWA 4PLPA 4LMRA 4JLWA 4X6YA 1DB3A 4TQUS 4ZVRA 3NVYA 3ADOA 4IQ0A 1A2OA 1KYTA 4EKDA 5E1OA 5BNWA 1W85A 2B4TO 3GUCA 1E3WA 3NFYA 5JE8A 1BKDR 4QEZA 4RQUA 5CTJA 2KLBA 1VB5A 3MTEA 3HO6A 4PC7A 4F4IA 2P6RA 1YMVA 3KVYA 5F9LA 4QELA 1EE9A 4TUPA 3FSJX 3G7SA 3GI1A 2VP5A 2YX1A 4WVLA 1TPZA 2XMPA 4DC9A 3KOWA 1PV1A 3SGLA 3WQHA 3RJHA 5JZSA 5DSZA 1IFXA 3THWB 3KG2A 4FYVA 4JELA 4B2IA 1E7SA 2HHLA 1Z16A 2AXNA 4PNEA 2ESRA 1Y9ZA 1EHYA 2ID8A 2OP0A 3CXUA 3DMTC 3EB9A 4MAAA 1KSGA 5FPPA 2IIVA 5TB5A 1GU1A 1YRWA 1KH3A 2AUTA 4NNOA 4RV5A 4RV9A 2ORVA 5DN6D 1N36B 1XD2B 3TO5A 1PGOA 4B34A 1FDVA 3T3OA 1DO2A 1FZTA 1Y6QA 1L6RA 5F35A 2WJVA 5KNBA 3PJEA 4NBSA 3CBGA 5H2FU 3WDSA 4NU8X 3WSVA 4O3MA 4NJOA 1G21A 4RPZA 3R6DA 1C7FA 3GCGA 4NG5A 2BPCA 4MHTA 4F5QA 2PFGA 1K88A 1TU3A 3ZBUA 3B6MA 1EDZA 1PJ4A 2AK2A 5D86A 1NBMD 2D06A 4O3RA 5FYQA 4FONA 4B80A 5KFKA 1HT0A 2J9XB 1WHSB 3M6FA 4W1QA 4B2YA 4CRWB 1C20A 2DUYA 3G1UA 3EEIA 1MKYA 1UBRS 1UODA 1Y7HA 3C1UA 3PT9A 3QOWA 4I19A 4MVJD 5FLEX 2NYRA 4LJ5A 4X92A 4KLOA 3TAUA 4IQ4A 4B6SA 2ACWA 3NEYA 1AKYA 2MSLA 2CVHA 2Q1WA 5AI9A 3ASZA 2Z9CA 3DD1A 4UTPA 5FTJA 3I5YA 3KCNA 5C5DA 4LNHA 1GGEA 4QECA 3MUEA 1YKSA 4OB7A 5I9BA 1VLHA 3CZAA 5J47A 3S1SA 5H68A 5F12A 3HQ4O 1WW2A 4IHQA 2HHCA 4EYEA 3EULA 3Q15C 1I51A 5H0IA 2FZ5A 5DTEA 3Q8XB 2QD3A 4YS6A 2A33A 2A7XA 1BHSA 1PVVA 2QY9A 2WMYA 3HCPA 3M8SA 1CJSA 4KLJA 1NMYA 4YK7A 1NK6A 3FB4A 3X0DA 1FW6A 2NV2B 2QI9C 1OYOA 1CJBA 3Q11A 4HNHA 1PK1A 5TNXA 4AG6A 2I5HA 2WI8A 2JFXA 4DWWA 3P94A 4LQLA 4GWGA 2UUCB 1QP4A 1OTHA 4KTQA 3DEJA 3BBPA 1EYZA 3F6BX 3RS4A 4HTFB 2RGNA 4EB3A 4KKVA 4DR6B 5COQA 3PC6A 3NETA 2E49A 2AN3A 1JPVA 3PYMA 1QBGA 1IWBB 2Y1IA 1KGSA 4J7UA 2XMSA 1D04A 4FZJA 5CW1A 4DJJA 3LWNA 5CDGA 2FDXA 4BIIA 3ZDDA 2HO4A 4JSYA 5JNSA 3ROTA 1XP8A 2W0SA 4EX6A 5CURA 3JYPA 3ZWNA 2J85A 3W4JA 4DIDA 5KYTA 1ORIA 3FPJA 2AC4A 2IHYA 4HQOA 1SOVA 2IV2X 3TZQA 2PFQA 4M88A 1U0RA 1UC5B 4CIDA 4JI7B 2Q0ZX 3LW7A 3TCKA 1N25A 5CH5A 3FR8A 2M9MA 2ZJFA 5B6IA 2JI6A 5ITSA 1MQ3A 2QAGC 1C3LA 1Y9JA 2O3QA 4MH0R 3DHYA 2I03A 4MA0A 2V9PA 1UFKA 3C1TA 3E22A 1Z33A 2AFHA 2CLHB 2GN0A 3A28A 1GSOA 2F00A 3WLFA 2FMPA 4RQ3A 3HZOA 1OBHA 4PVDA 5ICFA 5EIXA 2YZKA 4XB6B 2PD6A 2XO7A 1UBNA 2E5WA 4IIEA 3VH1A 3UY4A 1LF0A 2V7GA 4AULA 3LA6A 3I04A 1O4WA 4BJHB 5EJEA 3H4TA 2D6FA 1PGNA 1PBNA 1SVMA 2C31A 3HSKA 2HFJA 1JR2A 2I3DA 3H5WA 1GGHA 2QTHA 2BZSA 4NG4A 2GZAA 2WF6A 1KU6A 1OPXA 2AGVA 3KB1A 5DNDA 2ZT5A 2X1VA 4IFBA 5FNVF 3UJ9A 2ZT8A 5AJTA 4AMVA 1A76A 1UT6A 2QSUA 2B7BA 4CM9D 3U16A 3PF8A 3EEOA 2REXB 3W5HA 3VU0A 1RQNA 4HEA6 3VUFA 2Q1UA 1FP4A 3JQ6A 4FFNA 2MOKA 4NJMA 3ZLTA 1DDGA 2D2EA 4ZVPA 2GUGA 2CK3D 2ZUBA 1RQGA 3DDHA 4K03A 4MPDA 4ALIA 2B6GA 3O94A 3DLAA 4XGQA 5EUCA 3Q12A 4FZRA 2IX9A 4GI2A 4GYKA 4LCEA 2XODA 4BX2A 4CFYA 4EJMA 3UJ3X 1A6SA 1DIGA 4CETA 1G1MA 1VKJA 3HN7A 3LXMA 4N5DA 2ZUFA 3M4XA 1U81A 4UB2A 3RM3A 2JAHA 3EIQA 1X13A 7ICLA 3P5BA 1JKIA 2DFTA 2CLKB 3HADA 1XNJA 2ZYTX 4X3CA 1JEYA 1IBCA 4QBTA 1NKEA 4BVJA 2H9YA 4QWBA 2HZ7A 4LJ4A 3EQ8A 3T0GA 7ICPA 1KAEA 4MYSA 4JK1A 4BAUA 2WYOA 1M6HA 3OE5A 1N48A 4J0QA 4LPKA 2QMOA 4QUEA 1YO6A 2CVPA 3GZFA 2YWFA 3EYWA 2WFAA 4PX2A 1GPMA 3O8DA 2X4GA 4Y1RB 3MJCA 1JRLA 1MSWD 1IY1A 2FPWA 2R6JA 3PC8A 3ZQ6A 4D02A 4PLFA 3CMCO 4II3A 3RFFA 1DOHA 1JDTA 1JJVA 4ZVOA 2DPIA 4M0CA 5ITWA 3LVQE 3DMHA 2IRWA 3ELUA 2W2KA 3JSXA 1U3WA 1ND6A 5B3JC 4QZGA 1X7YB 3SN6A 3H0RB 5JJLA 4U2GA 4NEGA 1XMPA 2PKXA 5CTAA 1URJA 3UTDA 1T5TA 3SHWA 3R7WA 4IXDA 4FFDA 2K89A 3W8NA 4JWNA 3GAMA 3QBVA 5LQSA 4AMUA 2BV3A 3SYRA 3HHEA 1E6MA 3UMVA 2CD9A 3V4PB 1PRYA 3KQOA 3PZRA 4CKWB 4EYOA 5K0EA 3OM9A 4PWYA 4QLBA 4E2YA 1V9CA 4KLMA 3NHBA 3EH2A 4CMHA 2RJ3A 5IJ9B 2Y1OA 4OSPA 1DDOA 1Z8FA 4I2JA 2WSSA 3PDHA 4PGHA 3WK9A 4QX6A 3SAJA 2BCVA 2OLKA 1BS9A 1CNEA 4B3GA 4NDZA 3CLRC 1W2HA 2I7VA 1MX3A 4Y18A 1BCSB 1TIKA 3AFNA 3CF4A 4Y3UA 4ZHQF 1I2CA 1OXSC 5BQ3A 2POQX 3T3PB 1DXHA 3K0HA 3OZFA 2NO4A 3BFXA 3CO0S 3EFOB 3KL4A 3S7TA 2XTNA 1O0CA 3AHEA 3Q2IA 3QX9A 3ENQA 3U4GA 1MAVA 3VC1A 5JH7F 3O4VA 1BPXA 3T7TA 2DCMA 2WKRA 2CMFA 3SS7X 2WWXA 1T2NA 4ZCPA 1W44A 4O4HF 5DYGA 1NXTA 6CHYA 2FPPA 4HXGA 5ESWA 2NAFA 4LE1A 5A0FA 3GLGE 3RFAA 2B2NA 3KCQA 5IDYA 3WJ2A 1J56A 3A9CA 4P4GA 2DYKA 1XIVA 5IBQA 3TW6A 5A5FA 3S0JA 2GASA 3ETJA 4WCVA 3ZDZB 1ONBA 4FU0A 2O50A 3U17A 3NRZA 1PQ4A 2QAIA 3E9DA 4L1KA 1MCZA 1R6AA 3ROZA 3K30A 2BWJA 2IZOA 2OG1A 1C7ZA 1P2UA 4O1MA 4B9LA 1UK8A 4Y9UA 5LYJB 5GV8A 2OGWA 1TRKA 2C8KA 2VWQA 1XSPA 2VYCA 3FWYA 3MJ4A 1PFYA 1LSUA 1U2DA 1HIWA 2WTBA 4M0KA 2P4HX 3VVLA 4N7RA 1UZAA 4XM2A 1HE8B 1KYYA 1OKKD 1U9ZA 2XRFA 4YO7A 4M9QA 3F46A 3IELA 2OC9A 2DKXA 1OZHA 3C3EA 2XBLA 3PI7A 4KK3A 3V2IA 2QX7A 1ULBA 1OB5A 1Z00A 1U9IA 3V1LA 4O4LF 5AVVA 1JFVA 2Q28A 4ZCQA 4F21A 5DTRA 1T6ZA 2I4NA 2BFOA 4DAEA 3FPHA 4KAAA 1GP2A 5CB0A 1LX6A 4MV6A 5IX8A 1W8DA 5IJWA 1KDHA 3C6YA 3C7DB 2O7VA 1HDIA 4ZT5A 4WQMA 1GRVA 5DTIA 5K3DA 1KSPA 4C76A 1TA0A 4DDWA 3U4CA 3QLVC 4NYJR 3HFSA 2JARA 4N49A 1WPQA 4KHPB 5DTQA 1VSUA 1QQ5A 1NOMA 2B4YA 4R1SA 4TL6A 4BUGA 3KKZA 2YMQA 5F9MA 1P1BA 4EMBA 2UUPA 3TJMA 3FCCA 3ZGVA 2RGDA 1A7JA 4Y98A 3OQIB 4HQFA 3WWEA 4D82A 2P2YA 3EUWA 3MA0A 4TLMB 5JXHA 3RVMA 1V8DA 2G1AA 4KPFC 1YOVA 2HHSA 1F9AA 3KZMA 4EA9A 1JSRA 1T0HB 4FX5A 2W00A 3WYCA 2QQ5A 2CXOA 2GAAA 1YZYA 1QGAA 1VLZA 2XDQB 3P9KA 2ZUSA 1SG6A 1SXIA 1QGDA 1N0VC 1T8YA 3ICOA 5EZSA 4Z0PA 5LD2B 1R50A 3OF2A 3LY8A 4KBYA 1XZCA 4XD2A 4KR9A 2KJ9A 4ID9A 1Z6AA 1J7JA 4CCYA 3GRVA 5FWXB 3LWMA 4M9NA 4CMEC 1P6QA 5FJIA 3OJXA 3ZWYA 4Q1DA 8ICUA 4ZALA 1VKZA 2AN9A 3QKIA 4UZFA 3D6NB 4ND8A 3UMFA 1VMEA 2A57A 2BJWA 5ARDA 3IC5A 4P6VF 2W3RA 4JLMA 3PIIA 1P6UA 3UCFA 3P2JA 4L57A 1UFRA 2GJ4A 1RJFA 4FILA 3CKMA 1N0IA 3T9AA 3AOGA 4D5GA 2HOIA 2B37A 2GNAA 3AHGA 5E3HA 4X71A 2VG8A 4EYSA 1IPEA 1RABA 1T29A 2E4AA 2QB0B 1RJ9A 4R2MA 3J81A 4IL5A 1GG2A 4P86A 5DGTA 1T7PA 1OCEA 1W4LA 4KQWA 2ZSFA 5DF1A 3V8RA 1VC2A 2I2BA 1WBDA 2GDJA 3LLVA 3TTXA 5DK4A 2UVPB 5JXGA 4MYHA 2C28A 1DV1A 2ZYVX 5JFGA 1S8FA 5B30A 4O9MA 4P3XA 3CCFA 1RJ9B 1LFDB 5KFQA 3L49A 2QZPA 4UEOA 2JI7A 3LUBA 2H54A 3T5HA 1XRRA 5C34B 4BOYA 4I2NA 5HG0A 4UUOA 4ZO9A 1Q84A 1V16B 2HEIA 4KQHA 4EBEA 1FE8A 4O02B 1WXGA 3SQLA 3BGIA 4M55A 3NH6A 1T2DA 3KQQA 1D9DA 1J0BA 1KI7A 3DTVA 3H1TA 1ZXIA 5AXBA 2WTUA 1ECWA 4Q7QA 3MSCA 2CFCA 5TARA 1LV8A 2FNAA 1V9PA 3INRA 2G9QA 4OK6A 5K0BA 1G8JA 1VE9A 2RGNC 5JBNA 2QD5A 4RZSA 2II6A 3O3CA 4HAYA 4WDRA 4EI9A 5BXYA 1MPXA 5FPKA 2OQRA 2QUJA 1Q12A 2J46A 3O8QB 3Q85A 3DSRA 5CT8A 3UA3A 2JGMA 1S8AA 2V45A 4XRGA 1NSTA 1TGYA 2D1QA 3VOTA 3LF1A 1F2UB 1UJ4A 1W2GA 2D5LA 3ZVNA 1RYNA 4JDUA 2VDKB 5G0TA 2COKA 1TQ8A 3PNLA 4FFOA 5D8DA 5BQPA 5CJ2A 1Z5GA 3GELA 3PXAA 5A05A 4DUZB 3FRHA 4LNAA 2PMCA 3IIEA 3K16A 3L4PA 2LNDA 1ZIPA 1Q50A 1XX6A 5GMOA 1ORTA 1MA0A 3UGTA 3HVJA 4IAOA 4B4VA 1VYTA 5CCEA 2ZTVA 2C96A 1O94D 5I7VA 2FDRA 1GCUA 2VPQA 3BCRA 1MIOB 4NK4A 1U7TA 2BKXA 1QIHA 5JMOA 4BO1A 2LCFA 2H2HA 1FVFA 1UZMA 1XT6A 5TLSA 1D4AA 3RJMA 1RP7A 3U9TA 3KR9A 3WU2U 3OHBA 2GFHA 2Q9UA 4YHBA 3WWDA 3L7JA 5F23A 5I51A 4K6GA 1ULSA 3LK6A 4GGPA 2DFPA 3QU5A 4PZPA 4YMMA 1PFWA 5KX5B 4PTLA 5AQEA 3OE1A 1JA9A 4ZVMA 5T5QA 3TIVA 4NL9C 4CRXA 1UQVA 1TV9A 1JEYB 1KVSA 1M2FA 2XDYA 2XNDD 3DNMA 2J3KA 2XWPA 4ZPXA 3EW7A 4ELUA 3PQ6A 3IYLW 5DMXA 5TGTA 3PNOA 5A5VA 1AB6A 1PWYE 3PUJA 4DMUB 5HOEA 5FV7A 3RGWS 2E1FA 2V0GA 4M0FA 4J43A 1T3SA 3L43A 4X9XA 3OZTA 4H77A 4R4JA 1WWKA 5BURA 3RB3A 3PX0A 1JIIA 1CCWA 3BSWA 3IUEA 2E3JA 3TZEA 3HUTA 3L4SO 9ICSA 4J9QA 2FFAA 3TN7A 1QIJA 4BLVA 4EKGA 1Y6JA 2MCFA 4DTIA 2PGAA 1L7MA 4FHGA 3Q0TA 4OB6A 3MGBA 4YDHB 3ONDA 1T2FA 9ICIA 2F3UA 3SXUB 2QM7A 3I9V1 2O8VA 4Q1EA 2HK7A 1YZKA 2O48X 5A0LA 4RMGA 1NTRA 3R5XA 5FI3A 2VQFB 2R6R1 3IBFA 2H1OA 1RWXA 4IQVA 1EDDA 2R0QC 3TCNA 3I39X 5KQLA 4B1FA 2KKPA 3E70C 2M0NA 1M7GA 1HORA 2F1OA 3V6MA 4EKNB 2DPJA 1NQTA 1DC7A 2VDJA 2XIJA 4MCHA 1WDWB 4I3FA 4WACA 4JB0A 4YA6A 5HZMA 4JX8A 1QTQA 3LQ1A 1KI8A 2B4AA 4JWTA 3BS4A 3DDCA 4D92A 4GOLD 2J0VA 1VJ5A 3LFUA 4CF4A 3VSEA 3E3MA 4R1QA 4D81A 2ARKA 2P1ZA 1YL7A 4GQBA 5TVGA 2YQEA 3GMIA 3TVDA 3Q8RB 1G4AE 4K0RA 5AK5A 9ICLA 5KT7A 4BLUA 5JSZA 3VZSA 1DPGA 1UQTA 3M33A 3H5VA 4MVJP 4BZQA 1XU7A 3E8SA 3KYJB 3KKAA 3JQ9C 1QKJA 4OAQA 4YI3A 3VR1A 5K0GA 4I2FA 4I5IA 4WRRA 3W4IA 4KXMA 4UM9B 1Y33E 3WLNA 3ET5A 2MSNA 3JPRA 1G98A 1GARA 2O5RA 4TKVB 4YWJA 3BK7A 4E46A 3TQQA 3PFCA 3CW2A 2Y0PA 3UV6A 2H2WA 2JA2A 5DGHA 1KS2A 2FSGA 1PG5A 1Q0QA 3JYQA 4GRIA 4IMJB 4K9RA 5AJVB 5H16A 3Q9SA 1R12A 3ZCTA 4OLAA 3KHLA 2W9CB 4JWMA 2DAPA 1RQPA 1FXSA 2C58A 3GUVA 5EJ5A 3QWHA 3FN4A 5IU6A 4AG3A 4MX8A 1CUGA 3LUCA 4L8LA 3PV8A 1ENOA 1F2VA 1U2GA 2W2KB 3FNBA 3QE2A 1EH5A 1MIOA 3FYSA 4FINA 3WKDA 1U2GC 4KSBA 2IUEA 3GNTA 4B6PA 4EG5A 3BWCA 1TMOA 2XJ4A 4FTWA 2JLYA 1CNFA 3Q1LA 3C6XA 4J4HA 1ESCA 1KSHA 2AX4A 4DCCA 2WRZA 4BQRA 1YBMA 2Q7XA 3BVPA 3E9MA 1XMJA 2W93A 1R5BA 3NNSA 4BWGA 3MCWA 5EMKA 2O8EB 4C4XA 4EW3A 1UR5A 3PYLA 1S89A 3KZ1E 2GCGA 5C5CA 4KWHA 4PZNA 2VP4A 2BSAA 4IICA 1N5JA 2QE6A 3A58B 4RHFA 4UNQA 2AKEA 1DCFA 5EZQA 4CJXA 3NCTA 3RJTA 3SHFA 3NNNA 4JEIA 2MUTA 1SBZA 3GJ4A 3F5EA 1NK8A 4KXYA 2HLDA 3JYOA 4W7HA 4M4SA 5IT0A 1D2CA 1JHXA 3GXOA 3LVRE 4G0ZA 5JOQA 3BRQA 5JWOA 3DMDA 3DDSA 3HO8A 1VPTA 3IH5A 4C3VA 5HQTA 5B1SA 3UG6A 1T9ZA 1CJMA 1RXSA 1F0KA 2PZ8A 3EZ6A 3N0TA 3PNKA 1F06A 4M1YA 2OMEA 2PKCA 1NVDA 3R3XA 4FJ2A 2UV8A 5AJWA 3A9SA 1E2DA 1QHIA 3E48A 3GP5A 3IAM1 1XJ5A 2OILA 4CMBA 2G4LA 1GNSA 2HADA 2GOYA 5BMOA 2WILA 3D0RA 1BMFA 3B1FA 3WDLA 3CTPA 3NYQA 4JQCA 2OBFA 5CDSA 5JZMA 4O2BF 4P83A 4X24A 3O8RA 1M1YB 3MTQA 3ZXUB 4D3FA 4M36A 5L6LB 2ZWPA 4C6SA 1QG2A 1RQXA 1SY7A 2AK3A 4ECVA 3C24A 3IT1A 4DL4A 3QNWA 4MCIA 2P6PA 1H5QA 1NULA 1YVEI 4C22A 2CMDA 3OLXA 2C4VA 1UWLA 5HYVA 1XSLA 4EZ6A 2MU2A 4P0PA 1E98A 3GJ8A 4A2WA 1U2PA 4BLSA 1GQYA 5B57C 3KHHA 4RSHA 4TTTS 5JAPA 1F7VA 3M9LA 4WKNA 4RMNA 1SEVA 1XTQA 2MU1A 2FLPA 5AUNB 4H7FA 1AZLA 4MW9A 3WGZA 2QUKA 1YL6A 4PZDA 1UEJA 2GBIA 4EPVA 4BO8A 3ZIAA 3THWA 4OG2A 3L2OB 1T3QA 1ZD2P 2QRPA 1VXOA 4KQJA 2ZRHA 1I3MA 3UHFA 1SHTX 1OLOA 3V8MA 4KPEC 4EW1A 5EMJA 4B74A 9LDTA 8ICEA 1RYRA 2PO5A 1BMTA 2ZRNA 1CFZA 3ACCA 3DCIA 4BU0A 4ECXA 4C4TA 4YUVA 3PW4A 4EJ0A 5EPEA 2FP4B 2CNBA 1W94A 4AN1A 3JAKA 4RK4A 3WWCA 5KL8B 1ZH0A 1OLUB 1WNFA 3DE0X 1RHQA 4FGSA 2YN4A 4MUYA 4XH9B 3UAXA 3CH6A 3GFBA 4QG3A 4QWCA 5JNLA 2C0QA 9ICNA 3PC3A 2IUTA 4IX9A 1AMNA 5AXAA 2H63A 2J6UA 3AFHA 1NXQA 1UBMS 3RH6A 1TEXA 1X7YA 3PXBA 2WLSA 4QWAA 4HNQA 1RHMA 5DBAA 3HS3A 3GJ6A 2MWMA 3U7FB 5IYZB 1F12A 2AHOB 2C4KA 1EHCA 2QORA 1Z9BA 2XF2A 5DNEA 4AKHA 2D3WA 4JXZA 2EWWA 1XDSA 3PC7A 1ZJ5A 4H9GA 4IDOA 1ZCFA 2B6HA 3EDRA 2FY8A 3NHJA 3N0XA 1XAHA 3L40A 2Q41A 1UMCB 3SF8A 5ABPA 4G1EB 2AJ8A 3IJRA 3QF4B 4MVCA 4P5EA 1I0IA 4X7PA 4E30A 5BSGA 1G66A 4OLFA 3D0OA 5FPHA 1J23A 3WHKA 3GV5B 4IVPA 4HFRA 1P9RA 3GRYA 3IMCA 4OUDB 1K68A 4G01B 2C82A 3C74A 1FEZA 3DCYA 4DRXB 5A02A 1DKOA 1PYGA 1OIVA 1XUOA 3BERA 3K09A 2ZJZA 3O7WA 3Q87B 4IDCA 1QDLB 2A5LA 5M3BA 4B6EA 3GLFA 3UAZA 5FWAA 2CXYA 1SUSA 1E3EA 2P4EA 4YIKA 3BIOA 2YNMC 2JNWA 4COOA 3BE5A 4JA0A 3SZGA 3DC7A 3L6DA 4RK5A 5E1MA 2Y9MB 1VP3A 1XQVA 1SCUB 1ZA2A 4CIAA 1FFXB 3ET4A 3RJGA 1J5PA 4RH3A 5B66U 2F43A 4HO1X 4Q4JA 3G9XA 1Y81A 2OZKA 4R9SA 3ZK7A 5L6MB 1RPLA 2CHGA 1DEAA 2ZGVA 4BO3A 1A4XA 1DG3A 3KQHA 3NW9A 2MRLA 3FR7A 5BOMA 3RYHA 4YC7A 3F9CA 4MWGA 3O3MB 3P5SA 5BPHA 4PFQA 2IHUA 4GI5A 4YPFA 1BDIA 4BRZA 1RLIA 2IXGA 1GPAA 1KKMA 2HMUA 2X58A 3DTVB 3W7VA 3UC9A 2VJBA 4JV0A 1Y8AA 4Y2YA 2BI8A 2YWXA 2IELA 3CW2C 1FUIA 2YFHA 3LZDA 3OX4A 4OQ4A 4JIMA 3CGWA 3R3SA 3ND8A 4MRVA 1HQKA 5D2CA 5KX5F 3EARA 2ADMA 3F2DA 3DKIA 3T06B 2HBMA 4B7UA 2CB9A 3O2JA 1O5IA 1YKFA 4P3OA 1RC8A 1WJGA 2WM9B 5A3RA 3ROQA 3SE0A 8ATCA 3TFOA 3WQSB 4H0FA 1PTJC 3JSAA 3CNOA 4PYOA 1SV4A 2O0LA 2ZIGA 4H0CA 1NMQA 1PLKA 1FNSA 1LJLA 1V2HE 2IYTA 3DDNA 4Y2QA 1M1UA 3AUFA 3PWKA 1ZC3A 2BGJA 2AKYA 4F4ZA 3ANLA 3DLIA 4R8LA 1U3FA 2VDUE 1C80A 3N3AC 2NV0A 4CMCA 1J00A 4LJ6A 5F7XA 2Q6KA 3KKKA 3BC1A 1UZNA 4MQ4A 3GIDA 2F3RA 1QCYA 2N9UA 3CMMA 1B8VA 3M5PA 4M37A 5ALEA 3HU1A 2QTZA 2PZGA 2K2WA 2WV9A 1H6DA 3I9OA 5K0FA 3GF4A 3QLJA 2PLFA 5CP2A 3D31A 3EZXA 1CRLA 1CUDA 2G9RA 4KIWA 1QGED 3U3KA 2YHIB 3MWEA 1AXEA 2P5UA 3JPWA 5EQFA 3ROEA 4HTFA 4GHWA 2OZLB 4ARVA 3D3WA 3JTMA 1WUDA 3D2CA 2F2AB 5DFAA 1FF9A 2MTBA 3SZOA 4JYMA 3EMVA 1I94B 4LY6A 1X9WA 4Q24A 3DMPA 4Q9AA 4BVGA 3RS5A 9ATCA 3JTEA 1W87A 5AVJA 1XBTA 1NXVA 4XSHA 1KSJA 2DH5A 3I8OA 6LDHA 3BHIA 4YR2A 2TRSB 4QXOA 2L42A 3H5OA 3KEFA 4GT1A 4PPGA 1P7CA 3SYTA 3QU7A 1XEAA 3U7GA 1T0UA 1BPEA 2BZGA 4ZVKA 3EQ9A 4A03A 1J99A 4QWEA 1DRWA 2JVJA 4Q5IA 2VAXA 3DYIA 4KLZA 4ZQIA 2I6SA 2PX0A 3W9YA 2GJ8A 3BKWA 4WT7A 3JQAD 1JHYA 3HXKA 2X8LA 1ZQRA 3BN3A 1E18A 1UMBB 2PKQP 3DHEA 3WFJA 1JEDA 1AZTA 2VHXA 5J2TA 3UOGA 1JSXA 1F0MA 3VKGA 1E4OA 1C8BA 3D0QA 1MABA 3Q7RA 4HYYA 3DOJA 1OZGA 4DREA 2AJBA 2OBNA 4YLGA 4TXMA 3ZK9A 4CM6A 4HV4A 2XRZA 3VPCA 1A9RA 4B8WA 1ZS9A 2ABWA 1XEFA 4MPRA 2VJAA 2EX1A 3UWSA 3BWYA 1EFAA 2VFAA 4F71A 4C8MA 1MABB 4ND1A 4B6OA 1Z6XA 5BSHA 2J5RA 4M7RA 2C7PA 2PEZA 1L3BA 2FSVA 2VJYA 1GQRA 5DHFA 5L9XA 3K0SA 1Z4JA 1EVKA 2Z1MA 1BIFA 1B0PA 1XLVA 3BG5A 4MDHA 1QFSA 1SHUX 4MR8B 4MHSA 4WA8A 5EMHA 3UWPA 1C9DB 1T5DX 3K92A 5FNVB 2YMMA 4YMVA 3T4UA 1PJRA 3BL5A 3ZBPA 4NU5A 3SR6A 3EIFA 2FEKA 3PZBA 5DISB 3D54D 4JT9A 4LDZA 1IBLB 4H3HB 4GZ3A 1OT3A 4A26A 2FVYA 3PKZA 3D4PA 3VHXB 1L5MA 2O7RA 1JXLA 1CZKA 2W6CX 2E5SA 3C21A 1AZWA 1MG0A 3FRIA 3OZEA 5K7SA 1EXVA 3VISA 3ZI0A 3BQ0A 4G5QA 1VJ1A 1MFZA 1FFCA 4TKVA 5EHGA 5BR4A 3FBWA 1NY5A 2VPPA 3WNBA 2C2MA 2FPIB 3UXOA 2FZ4A 2B1JA 3OCJA 1GILA 4QPCA 4IVRA 3TIIA 4KWTA 3WWOA 4ZYVA 4DV1B 1M76A 3CISA 4JOQA 3MW8A 2BEKA 2RK6A 1T34A 4MIYA 1BE8A 5B58C 1SUAA 1XYGA 4MJLA 3GVPA 2WYUA 3P71T 3U5ZB 1U8CB 2Q62A 3RVDA 1MV5A 4DLYA 3EWSA 5H4GA 4OBXA 3EPJA 4J03A 1RRPA 3AMVA 1I32A 3OO0A 2VT7A 5LQKA 3MRTA 1KI6B 3CX7A 4J9KA 1VZ2A 5T8KA 3UN1A 2BZ1A 1ZIYA 4C6TA 2GXQA 4F91B 3N53A 4OXQA 3S28A 2PGJA 1D1TA 1UDAA 4UM5A 2ZTCA 1K6JA 4RPJA 3GQCA 1Z88A 4WCDA 3IV7A 3W77A 2WYWA 1G1AA 5FV4A 3BIWA 2G67A 3AKDA 1CS0B 5BN1A 2ZRCA 1TVKA 3EXEB 3OP1A 2DQNB 1E1MA 3VKFA 2Z5VA 2GI4A 1WQ3A 5HR6A 3WWZA 4YRRA 3N8GA 5LDHA 3PF9A 3R8FA 4NBLA 3AUJB 5KG3A 3ND9A 4FVTA 4AP6A 2Y9PB 2XT0A 1S2IA 4WWHA 1N1GA 2CXPA 3T1OA 1RG6A 2H2DA 3VNQA 4DF4A 4ZAWA 3E2PA 3KSBC 3L5OA 1QLHA 2BAGA 3L04A 4A8PA 3EQ6A 4D42A 4UUBA 1JR3A 1SVLA 5CDYA 2FHPA 2EAOA 2KV2A 1BMFD 4Q9IA 1W5EA 1W93A 1XLUA 4WOKA 3HJNA 4YJGA 3ILXA 2NU9B 4ZEMA 5IANA 2G5IB 4L74A 3MXTA 4OA5A 4BDSA 3GA7A 4UVGA 1UAGA 5F1KA 4DUGD 1U3GA 3WGGA 2BLNA 1F0PA 1IEQA 3FCEA 4WEOA 4ZHQB 3CRVA 1LBTA 1ZQUA 4G0UA 2ZDHA 4KITB 2C8JA 2FQYA 2OPBA 3PR4A 4A8EA 3S5UA 4KFCA 2OHGA 3NDRA 1TVAA 4HAZA 3B3JA 1IONA 2ZT6A 3HXTA 1P5JA 4GNKA 2M9NA 2AOUB 4BNLA 3F73A 3UT0A 4CMAA 3MDCA 2EIXA 2W6MA 4Z6CA 1W4CA 3HJBA 2IYFA 4A8TA 2HWKA 3QXXA 4Y2JA 3C29A 4Z9YA 4BNKA 1RM6C 4RQ6A 2IPOA 1JAXA 1B41A 4NI5A 3QIAA 2JFYA 2AQIA 1EGMB 3FPAA 3QRWA 3CY6A 4II7A 4OM8A 3UAGA 3GEIA 1CULC 4PS0A 1P45A 2SNIE 4DV4B 4URYR 3H16A 3OZIA 4QW8A 4P92A 5GJWC 4PIMA 5A04A 1V8ZA 4F1KA 2CN1A 2GA8A 1KJIA 4MKHA 3SFVA 4NL9A 1ZQIA 1KDZA 3KVOA 4GX1A 3F4KA 3C5HA 1FNDA 3EG9A 2R6GA 4BJ6A 4QTYA 1J2JA 3PENA 3OZDA 1KFJB 2Z98A 1L4HA 3VTAA 4HZUA 2EF0A 3A4LA 4D97A 5IWAB 3SS9X 3KWJA 4B4DA 1Y8ZA 2R6CA 3GARA 5E8JA 4QVIA 3U3ZA 1JPUA 3NVZA 5KFAA 1NRXA 1TAHA 3BFVA 2C5FA 5H80A 3RUAA 2OXFA 2VPTA 1F6WA 5G4LA 4KN6A 3TW0A 1MAWA 5I47A 4MRPA 2D0PB 2WWRA 4CDGA 1OUQA 1JQDA 1AGPA 3A3NA 1H3NA 2BFBB 3AVQA 2FQQA 4DO9A 2BZFA 2W98A 1TADA 3CS3A 3RUFA 1SRRA 1Q3HA 1TM3E 2I66A 1PQWA 5DVZA 3HMQA 3M49A 3RKUA 4BE7B 1QRRA 2GJ9A 4V1CA 2ORWA 4QUGA 3PHLA 2AQ4A 2WKPA 1NJFA 4NCXA 5KYXB 1T0PA 3QPCA 2QZ9A 1COOA 8ICVA 1NK4A 3UENA 3OU2A 1RWQA 5FXMA 1GM5A 4O3SA 4L5JA 3W3AD 2PGIA 1OXXK 4NZPA 3G2HA 3NIDB 4GSLA 2BMDA 3TLEA 1GPYA 3HNPA 3FPBA 3K96A 3L7BA 5TEVA 1SCNE 4OAOA 3GV8B 1S9FA 5AVRA 1L4KA 2OH2A 3WK5A 4FZ3A 4UU8A 4UOZA 5JS1A 1X38A 2B61A 4LC0A 4URUR 5DHQA 3WISA 1JLSA 3COYA 1BDHA 4P7KA 3WS7A 3WTBA 1TK2A 2HHAA 2BH9A 2R2GA 5IXJA 3C3DA 3ELBA 4C5CA 2PCLA 1OFVA 1YBVA 1RU3A 4OP3A 5KYNA 3OBBA 3C1AA 2J6BA 4HDCA 4G5XA 3PJRA 1ZKMA 4G9GA 3BDAA 3OPYB 5IASA 4BMCA 1KDPA 3PSIA 2F9FA 3JPPA 3VH3A 4E6PA 2IYXA 2QYHA 1TZKA 4DLVA 2B7LA 1E6KA 3BQ9A 2KJ8A 2EQAA 4GXNA 3H1BA 2HF2A 1T0IA 3P9XA 4L8VA 4MUBA 3BHNA 3IQDB 4O2AB 3JAWA 3P9IA 3QX7A 1I6KA 3EY4A 2WWFA 4Z4FA 1FU7A 2DULA 3DJYA 3GVXA 3NT4A 5KNCD 4ZQCB 2AG8A 4EGAA 2IYPA 3WNQA 3EJ6A 4NARA 3MT8A 4Y0VA 3BSSA 2ZR7A 3OCYA 5HRUA 4LQ4A 3EOBI 4ZOHC 1G59A 1FTGA 1JIVA 9ICRA 2IF2A 3G23A 4NYIQ 3Q8PB 5AKEA 2BBTA 2DT5A 2V1XA 3NT2A 4U3JA 5IF3A 3L0SA 3IT0A 2P65A 5DG8A 3MCUA 6PFKA 2QR3A 3H13A 3JD0A 3TUJC 4Q39A 4OXNA 3OT4A 5JAQA 3OFNA 3U1VA 1I30A 4NBWA 1P19A 1XZEA 1DRVA 3BXXA 3HGQA 2POCA 3F6SA 3FVRA 4HEJA 3SPXA 1FRVA 1Y1LA 3SAHA 3SBEA 3NTRA 3PFGA 4FOSA 1VIAA 1CE8B 3FRJA 1ILEA 1JHQA 2Q21A 5CCXA 1RXIA 3A3PA 3C4VA 4LOHA 4OJNA 3OQVA 1HEKA 1MN8A 4PXYA 3Q3JB 2J3IA 1WMDA 1ZEMA 3JQAB 4GQAA 4NKRA 1HFKA 3DBIA 4B7ZA 4TMXA 3R4CA 3NOOA 5IZCA 4PBSA 2Q27A 1KAHA 1NBMA 3FBTA 4CR6A 1ENZA 5DM2A 3T4XA 4INPA 1V0JA 2GS9A 3S2SA 1GZ6A 2GYVA 1I5EA 2IW3A 3C70A 3EG5A 3ZHBA 1AH2A 3DWFA 2VJQA 3M0EA 2DPLA 1ZK3A 2IYVA 2Q3HA 3BTVA 1SC3A 2JG3A 1LUAA 4AMZA 4G26A 4YRFA 4LTDA 2KOBA 1YUBA 1JBQA 3PHGA 4J0GA 4RFVA 3VU9B 1IZ7A 1UOOA 1CUWA 2P4UA 1G3MA 3BMOA 5E3JA 4AJLA 1NDUA 2H3FA 2VN8A 5U1PA 2QYSA 4HGPA 3BD6A 1P3Y1 4NE9A 1NC1A 2F1RA 2O0HA 2FUKA 3TTYA 3ZWAA 4GMGA 2ZCJA 2XMRA 3KKPA 3O1LA 3OG9A 4LHXA 3ROXA 2RGWA 4NJ8A 4G07A 3T3GA 2FN9A 4BB9A 1HNXB 2R2AA 5LYJA 1PSDA 4TT3D 5TSDA 1P0FA 2XR1A 3QVVA 3H75A 3A2MA 3AEZA 4GP6A 4XR4A 3VVCA 4HNVA 4ENTA 3HRIA 4RUAA 5E7QA 1UP4A 1ZW6A 3KJFA 3KFVA 4DSEA 5D3QA 4ZKEA 1X6IA 4BHTA 2W7OA 1ZRHA 2HA5A 3E1KA 4GPIB 4J75A 1NRWA 2FW0A 3RC3A 2ONJA 4ALKA 3TANA 4LZWA 4EFMA 3GIIA 4ZAFA 1BDBA 1VJGA 4DSTA 2QSJA 3QH4A 4K87A 4NBKA 4G1CA 3TZCA 4AJNA 3ID6C 3JRWA 1QIFA 3BQTA 2WZCA 3KZCA 3MPUA 1R9NA 4J16C 4XIGS 3RTAA 3SC2A 4MVWA 4XJSA 5KOJB 4XX1A 1PT5A 5LPNA 2RB5A 3R7FA 1U2QA 2QMHA 2GPTA 4MW1A 4ZQGA 3VZDA 5FPYA 4A7PA 1Z63A 4ESHA 1PW7A 4OX9B 2BEVA 2WMNB 3QBDA 2EDCA 4IJ5A 1VPWA 2LD4A 2ASLA 2ENUA 4G0QA 1KYXA 1R0CA 1MORA 2ZS7A 1N92A 4OKIA 3GZNB 3KKMA 2YW2A 3Q7QA 4PNPA 4RCZA 1EK2A 4M8SA 3RVJA 1FK8A 4FR0A 4DR4B 2Y1KA 5LQAA 1YB1A 3HI6A 1LD3A 4OHCA 4AMYA 3HKDA 2E4VA 3ZU5A 4MGEA 3ZXYA 1WP9A 4LNUA 5DT9A 5GTDA 1G9XA 4LYDA 4PF1A 3AMZA 4YMGA 4OMUA 4E13A 2W4IA 1T3NA 3HY6A 3QVTA 5CR9A 1XZHA 1Z5OA 2XCPA 2GD2A 2MR6A 4J0DA 3VR5D 4BNUA 3FXAA 3Q8LA 1XNHA 4KV7A 5J9FA 3WIBA 2YRXA 1P1CA 5KNDD 5L45A 4KQ9A 1A8SA 1O6CA 4EJFA 3GIJA 3LU1A 2AFIB 3ADKA 1MF7A 1JUDA 4R71A 4G89A 2DQSA 4K7JA 2MMCA 2PBZA 4LVOA 1IOZA 2PWAA 5C5JA 3FG9A 1PR0A 1XFDA 4KQ2A 2FN4A 3KPUA 1KFKB 4NYIR 1X7XB 1M10A 3F2VA 2YVUA 3QUSA 4GZLA 4EEKA 4DUGA 4LJAA 4XPIA 4EHFA 3T7IA 4YMNA 4M8IA 1SKQA 3MIIA 1U0GA 1U0JA 3O8OA 5EI5A 3DEEA 5KG5A 1CR6A 3P4UA 5KNBH 1OI4A 5G2OA 1VG1A 4UAGA 4JC5A 1Y8QA 3TZHA 3HKZF 3KPVA 1RBMA 4US8A 3EMDA 4U7CA 5CCBA 1N9KA 4KX3A 2R7MA 1O2DA 2CXRA 3TNDA 1UBHS 1E0DA 2YFYA 2AG6A 4EECA 2CL7X 4IXTA 1SKRA 1E6CA 4WOPA 4ZEWA 5BSFA 4YT4A 1IEWA 2ZBFA 2RK4A 4YAJA 2AZTA 5L1LA 2CBXA 4QTZA 4DR3B 5EJ7A 4BLPA 2PKQO 4C4ZA 2ONKA 4JLPA 1AKNA 4RTMA 5BNZA 4L9SA 1GZ7A 1PE0A 1UKZA 2FPKA 1N2IA 3V7KA 2VP6A 4GGOA 3VZRA 1UXKA 1CQJB 1JLLA 4TKUB 2QYTA 3NIFB 1QTMA 1AHNA 1NBME 2AJTA 1N2BA 1SBHA 3QV2A 3G6VA 1AQUA 2QJTA 1Z5PA 3VDMA 5IDWA 3F3YA 4FMBB 4TYQA 1GR0A 2D0IA 2XBMA 2DL0A 3MC1A 2JJMA 4LZAA 4Z6FA 3USCS 4ZJYA 3JZFA 2PLAA 4WVFA 5FWYB 3IT2A 5C2JB 2O8NA 2QTBA 5L53A 2BMJA 2ZQZA 3DVQX 1WUKS 1IOLA 3UFXA 4Y6OA 1UHUA 3WNZA 3AZQA 1TGVA 2BHNA 2WVJA 3MT7A 5HJ2A 1VPEA 1SOAA 5DCWA 1OPRA 1S3GA 4QGHA 3RO7A 1WYGA 5JH7B 1C3VA 1W88B 5I4BA 2CJYA 1XA0A 2H52A 2J33A 2R7LA 3I9NA 4U63A 4ANFA 4G5OA 1US8A 3M6LA 3C23A 1ZGGA 4CQLB 4HNUA 3U4IA 5JASA 5ALUA 2Z2KA 1D5CA 2FWRA 2W2VA 4B85A 4FNMA 3U49A 2WWTA 3KHGA 4FDUA 1E6WA 4GM4A 3RT1A 1PK7A 1GAQA 2WIJA 3N2IA 5GOTA 3ZNOA 1GPH1 2OAEA 3ENKA 3RVKA 4U8HA 4ZH4A 2XOXA 2EH9A 5LYYA 2B7CA 1P5ZB 2A9RA 2X0IA 1UBCA 1F8FA 3FMVA 4YXWD 4QOJA 5E79U 3W7BA 1BRTA 4AW9A 2CVQA 2C78A 3EVTA 2MJLA 3CLSC 3RFVA 3VX4A 2DPXA 2FUNB 4RKQA 2CV2A 1JEQA 2WE7A 2ZSKA 7ICVA 1BXRB 3EYZA 1UL1X 1QK5A 2Y0SC 3BSFA 4PLYA 1K27A 2ZT7A 3KOZA 1HX7A 5JFTA 5K4LA 2ESEA 4DQ0A 1PQUA 1S3FA 3C15C 3WDKA 1KOLA 1II0A 4C2UA 3TADA 2O07A 3DAYA 3G6KA 3LBAA 4G8JA 4GWKA 4OATA 1H0KA 3UAOA 1YCGA 5DK6A 2BCRA 4M9UA 3ZZ1A 2D1FA 2GWHA 3S99A 3ON5A 3QBEA 4DZTA 4I50B 3R5FA 4GC9A 4K6FA 4YBRA 1EDOA 4UCWA 5IRCD 5T6MA 2Z2XA 3V7YA 1CD5A 3EA0A 5LZ4A 3GRFA 3IAAA 4YRBA 3JQGB 1JBKA 1NXXA 3EA4A 2A1IA 3KLMX 1A4UA 4MHVA 3NGMA 1XRMA 4GFJA 3KYCA 3Q72A 1MDBA 4CCWA 3AI2A 1JXMA 3PBKA 4J9NA 1NU8A 4W8GA 1NLMA 4Q8EA 3F5DA 2IHJA 2LKCA 2SCUA 4XIFA 5LQRA 2JLQA 1SXDA 4MV1A 4NP6A 3NYRA 4KLEA 1JDNA 2XB4A 4BX8A 4G4IA 4YR7A 1MQAA 4QYTA 3T6KA 3EPHA 1Z6ZA 5DWVA 1XI2A 3BGVA 3VDNB 4DL3A 2FR8C 2KB0A 2VTEA 3HEAA 4PBTA 1ZUIA 3IXQA 1BAPA 3QPAA 3Q10A 1ISRA 1QFYA 5MHTA 4NLBA 1AHHA 2AVDA 4NJEB 4QICA 4RORA 4ETNA 1I1QB 1G20E 2XKKA 1EDBA 3O4FA 2HWUA 1VMIA 3UANA 3N0WA 4DM4A 3K32A 1Z0KA 2JIMA 1GKKA 1X74A 5E2BA 2IOQA 4UM8B 1DWOA 3O5AA 5DOZA 5CLJA 5D85A 4ERXA 1TECE 5CFQA 2OO7A 3UFXB 3EX7C 4QJ3A 3IULA 2LCIA 4DV3B 2WPNA 1SHLA 3ZKWA 3LVVA 1RI5A 3K2BA 4ND2A 2VJ5A 1U4BA 5BNFA 4I4IA 4TX1A 5LXTB 1L5UA 1HKHA 1W0JA 5DZSA 4LYFA 1MJFA 5BVHB 5HKAA 3RABA 4LZZA 1WB6A 3H11B 3UYLA 5CBPA 2G04A 4D56A 3AUSA 1G6Q1 1UJCA 1Y8RA 1B0AA 3FVTA 4I81A 3B85A 4CKCB 3GWZA 1C1YA 2W7PA 2IU3A 4D0RA 2IE0A 3BQMB 4RBNA 1SKMA 2KKVA 2VSNA 3C3YA 1B2RA 3QHAA 4L22A 4CTNA 5FBHA 5JMPA 3L7IA 5J0SA 2P5YA 5H82A 1T8UA 3TOXA 5E6RA 1NK9A 2BFMA 2BMFA 2WZBA 3BZWA 4A0GA 5J2JA 2HI0A 4I27A 2VP9A 4GXJA 1ZO8A 1HZZC 2QG6A 3F8TA 4EABA 1Z0JA 2WF5A 2WSMA 4DANA 4ER5A 3D1JA 2HU7A 1ZM9A 2XHEA 2V9ZA 3JD1A 3G8YA 1C14A 3P26A 5KG7A 1POWA 3A0HU 1NUTA 3D6MA 4FZ5A 3KXDA 5ERXA 3N2LA 3Q41A 3KQPA 2G1UA 2C8VA 2ZYUX 3S27A 3PQFA 4L8FA 4DUYB 1K98A 2ZLBA 4D57A 1EJ6A 1NU6A 5CLQA 3ES9A 1T9AA 3UH0A 1TZ2A 5LBUA 4F1WA 1PJ8A 1V26A 2HNBA 1XRSB 3GBPA 2XGPA 3GZJA 2JB9A 1YS2X 4KLTA 3HDGA 5K9ZA 4WNCA 3I0ZA 4ESVA 2YJZA 2UZ0A 1JQBA 5K0LA 3MJFA 4OEHA 3NO4A 4HGYA 5TMDA 3VHQA 1JV2B 5I7WA 2DTXA 2NADA 3FW1A 1E3QA 2H3QA 2VK1A 4O2AF 3LO8A 4WZBA 4R83A 5G1PA 2P9EA 4P7JA 2AR7A 3BH7A 2QTLA 3IDFA 3KK0A 3NC0C 4F7DA 2IS2A 2CXXA 2IODA 2H48A 3JPQA 1SXHA 3RVPA 2J6SA 1CSEE 5DM0A 2JGRA 1ZGHA 2P40A 3CKKA 4NONA 4RX1A 1QONA 3HJAA 3ZHQA 3KB8A 3QFTA 3CKYA 3AF5A 3JY6A 2YJNA 5KJ1A 2J0UA 1T2EA 4HH4A 5LLSA 1INLA 1Y0BA 2OCPA 2P78A 2PS0A 3H18A 4JROA 2X14A 4UMVA 4O4LA 4XIIA 4YEDA 2H5JA 5HILA 5C5EA 1X66A 4CEJB 1M9NA 1BFKA 3T4PA 4OQFA 4PYRA 1EWYA 1LA2A 4F4WA 2WSBA 2JK0A 2ZU6A 3RAEC 2PZEA 3ODPA 4XTCS 4F6RA 1VE1A 1U0BB 5FTNA 2RGRA 3RJKA 1QDUA 1QVZA 3RC9A 3FF1A 3DG9A 3O21A 4X6XA 2FPIA 2WA2A 4HUJA 4Y67A 4AYTA 4C14A 4C8KA 1H2HA 5KDOA 1ESMA 4G0YA 4DCJA 1C2TA 2X5NA 3H3FA 4YFKA 1DQPA 3RBZA 3ZOKA 4C0BA 1VA5A 2PGNA 4REQA 5UKDA 3W6UA 3F8WA 1U49A 2QU8A 4M6WB 1XWWA 3PXCX 3UB2A 5LIPA 1CDZA 4QFBA 5AHWA 3CRNA 2O2IA 5LXTA 3W5VA 3MINB 4YV7A 4G4JA 2BP7B 3HT3A 5F1OA 3IDSA 1NKBA 1U11A 1NBEA 4HAVA 4CZ2A 3RS8A 5C51B 3HJUA 4UQGA 2ATEA 2H85A 1JKMA 2OCDA 4W1SA 2JL1A 3SLGA 1AV6A 5BYBA 2QTGA 2GF0A 2UVQA 2ZB2A 4UU1A 2DR2A 5JAOA 1D8AA 1JHPA 2Y2VA 4V24A 4DJTA 1ECFA 5KNDH 3KNZA 3HWTA 4F4FA 1NLYA 1MO5A 2A8YA 2X2OA 3S68A 4DS4A 3A6ZA 4IF4A 2CHQA 4K9DA 2F3QA 1NWCA 3AIKA 3J81k 4D4GA 3RE1A 2R11A 3QEJA 3W78A 4LVNA 2R8ZA 2Y4OA 3LWZA 3FCUB 1SAYA 4HBGA 1SCIA 3RU9A 4CTOA 1C4WA 3LQKA 5CAEB 4RC9A 4I5EA 4UD2A 2HBYA 1VGVA 3Q9LA 2BI4A 5ARBA 3JQRA 1ONSA 2G5GX 3BIJA 3A6JA 1B0XA 1Z06A 2PR7A 2G1JA 3HRHA 3OY7A 1QRTA 3KVRA 1FPMA 1QFJA 3CCBA 2QX6A 3L6CA 2RQ5A 1WB5A 2Z83A 4U2BA 4AJHA 4CM5A 5J29A 4OJTA 3VC7A 5K4HA 5GTHU 4DFPA 2RONA 1E1LA 4O0IA 2IV7A 3EGDB 4YH1A 2K8CB 2ZZNA 1X8LA 4JVMA 5ER9A 4BBZA 1N8TA 3DGEC 1Z7BA 3M1AA 1PG2A 4AU1A 4B4OA 4B5LA 3PV0A 1TKDA 1Z25A 3IURA 1LI7A 4BQIA 4BVHA 1P1KA 3CRRA 4XM0A 2PUWA 4G4SP 2CJWA 1V37A 1USUA 1ESDA 1BWPA 2OECA 1KBZA 4J07A 4Y6RA 1YA4A 5IYZF 5DNCA 5IULC 2F1JA 3H4DA 1E5QA 2I6FA 4RZIA 4Y1FA 2E8MA 1ZOPA 3P96A 3R6TA 4IXWA 2PBLA 2RI6A 1L7PA 3HILA 3DA8A 3ROFA 1QX4A 2HBLA 4K6HA 3MS2A 3DULA 5TPWA 1KI6A 3DTNA 2CHUA 3SEZA 4M0EA 3S8MA 4QJFB 1YMQA 1TLLA 2V0CA 4HN9A 2GZHA 4N01A 5BYJA 4EBFA 4E4RA 4B9EA 1P29A 2QL6A 4Q15A 1NG1A 3C2KA 4RNDB 1ZYQA 3FPSA 3TXYA 1SUBA 1Y3BE 4JJ7A 1GCIA 1IHXA 4BCDA 1QQBA 3KIPA 3C3BA 3AUAA 1JXAA 1VIYA 3DNPA 3ZHTA 1PK9A 1FTSA 3UHOA 3MRVA 2AN5A 3BJZA 4IWNA 4R1PA 2NO7A 2WSLA 4C7OA 2H9IA 1XMXA 2Q2OA 1QG6A 1U7HA 4XLLA 2EF1A 2AZDA 3EZLA 5F2KA 1AVTA 4D8TA 3PEYA 3TW4A 2VZ0A 1WU7A 4DCTA 3I62A 2AQ0A 4PL2A 1ZESA 2FGKA 3PQ7A 5DI9A 3RH0A 1H3EA 2QG4A 3HM9A 3KD2A 5AM3A 3KEMA 3TGWA 4PE5B 4PQYA 2YZGA 4PO1A 5AM2A 5H7XA 3ST7A 3NBXX 4LY9A 3LPDA 4YV1A 3FNFA 1K5HA 4YASA 5G1OA 2R1ZA 2OTCA 4WJKB 3WGNA 3ZS8A 2G0NA 1WDLA 2GBLA 4DV7B 2HU8A 4KMRA 2UZIR 5B3AA 3VPDA 1ISSA 2EP8A 1ZNQO 3PNPA 1IUKA 4G9BA 2B36A 3QNMA 1EGAA 1MC5A 1ZGBA 2CL0X 2PYDA 3GUHA 4O5CA 5KB3A 1CB0A 1P2TA 2P9BA 1GNLA 5F2EA 1X7ZB 3K71B 4L3VA 3WHPA 1AF7A 2YB1A 2XGOA 4NBRA 4AJ4A 2PGLA 2DF4B 3ZDCA 3ETRA 1JN3A 3REQA 3TQ1A 5BUQA 1QQTA 3AM4A 4Z9BA 5BUCA 4EVSA 2ZWAA 1LKYA 1C9JA 1PNRA 2A0KA 4YV2A 3CRXA 1IJBA 3DLBA 2GYWA 1V5FA 3GJTA 4PO8A 4XVCA 1F3OA 5KVCA 4PQRA 2ZE7A 3WB2A 2VR1A 4NAUA 1ORVA 4BEWA 1DHRA 1G9TA 1ZL2A 2UXBB 1J42A 1BU5A 2NXNA 3L1JA 4RANA 5L1IA 3N74A 4FS2A 3B6EA 4B9UA 3UUGA 4R2IA 4DQQA 1XZLA 4ZCSA 1DQYA 2V9CA 2WJHA 1HEYA 1B74A 3IBSA 2WWWA 4HZUB 3UQZA 3VNRA 3GT0A 4KRXA 5K4AA 3B48A 1IG3A 2RC6A 4UNRA 4ND3A 3THVA 7AT1A 2XA1A 3CGGA 5AK6A 2PK3A 3IEPA 3PEEA 4W9MC 1JL3A 1TQ4A 2J0QA 3V8QA 3QSGA 2BPGA 1OY1A 1J0AA 4O3OA 1X8JA 1FSGA 2BUCA 2JGIA 1NXPA 2NSLA 4J90A 1OHHA 4XYEA 3C3CA 3ZY3A 2XSZD 4BGEA 5LP1A 1RE1A 1YJQA 5AW9A 3QEMB 1HLFA 1TJNA 1U5AA 2H29A 5DMHA 1UINA 1YU6A 5HKLA 4MW0A 5A0VA 2ID4A 1FMTA 3D9QX 2BKEA 4MICA 4DG8A 3OFND 1DJLA 1PEAA 4L6CA 5KBYA 3PKJA 5BR1A 4ZJUA 1G3IA 2J6TA 1OX4B 3LECA 1N2HA 1HH4A 1G3QA 1UMDA 1JHAA 2X9GA 4NC9A 4A82A 1NOJA 4GOXA 2B9VA 2ZXEA 2G71A 5BPFA 4K8OA 4ES6A 5L3VA 4XVQA 1N2CA 3UH1A 3NT5A 4C6TB 3GLTA 1Z47A 2NXWA 2P6UA 1G8GA 1CDDA 3R7LA 2KVSA 4AX8A 1KJQA 1R4AA 3D6HA 3DOFA 3ZD6A 4JSTA 2FEOA 2J32A 3TFQA 1DWQA 3STXA 1W49A 3MT9A 1JJAA 1ZCJA 2XNKA 1C0LA 3KT0A 1ZISA 4CL3A 5KCMA 1MC4A 4BMDA 4EPRA 4ZOQI 2NU7B 3MABA 2Y1DA 3DM5A 4CFSA 3GLHE 5BSWA 1XC9A 3I37X 3EZ2A 4DVGA 4JHLA 4RD6A 1O95D 3LRXA 5E38A 1L1FA 3T5DA 5JXWA 4IBOA 1W1UA 4NK5A 3P2YA 4X7MA 3G2MA 1UBJS 4M49A 5AOVA 2IA5A 1KE2A 1PNOA 4YYZA 2NU8A 5HF9A 4OXIA 1VXRA 2VS1A 3SS8A 2GEJA 1C7QA 1OXVA 2G25A 1HV8A 1RJWA 1YHYA 2UVWA 2AE2A 2JBWA 2APJA 4IGKA 1UOQA 1KXJA 1EX9A 2BGWA 3R7DA 1LSSA 4ARAA 5DHRA 4YAKA 2OXTA 1X39A 3LUFA 3ORHA 1YONA 1QP0A 1WD7A 4C0XA 1HDCA 1TVMA 3DT8A 1DEOA 4JI6B 4RVHA 1NC3A 1CVRA 4WXHA 3HK2A 4FFWA 4GKAA 1PT6A 3SAFA 4C4SA 3CV3A 4C0HA 2YZ2A 4Z3KA 5K4GA 3MF4A 4V2UA 3RSSA 1UKYA 1BNPA 1U4SA 3TQFA 1QO0D 3PRKE 4GPD1 2IPXA 5FL7A 1Q7CA 3F1KA 4XVRA 1RR6A 2C22A 2CYBA 1ONNA 2I6XA 3Q2KA 2OBXA 1ZH6A 2XDAA 2WWGA 1H4VB 1ZY2A 1DEHA 2VBFA 4IIBA 4RZQA 3DP9A 2G76A 4TV8B 4CLRB 2I91A 1YBAA 2JFFA 4BJ1A 3EAGA 3NOXA 1I2DA 5A7HA 2OFOA 3PXEA 7ICQA 1A5TA 4G63A 4E3ZA 3G79A 2J3HA 1NP6A 3LC2O 2KW5A 2B1QA 1CC1S 4JUZA 2AR9A 1P2VA 2QN8A 4UVDA 2DC1A 1IUNA 1E8MA 1T8WA 2WFMA 3EGCA 3M8KA 4YRTA 4K9OA 4AP5A 1KR2A 3FPLA 5D5QA 4BCCA 4E94A 3IOBA 4PG7A 1G5TA 2OXEA 3ESRA 4KO2S 5EIFA 1VKRA 3ZY6A 2ZSDA 1C30B 1NVAA 3FDXA 3JASB 1NK7A 4Q4AB 4YJFA 5T3UA 1JQKA 3FLAA 4B73A 2FW9A 4MP3A 5E9WA 3OPXA 1XAGA 3VR5A 3A6HA 4YP1A 1ZN9A 1QFMA 1P7WA 1T4CB 3DPSA 4KAJA 5C7OO 2RJOA 3DDWA 4GQIA 2RHBA 5AOCA 5HJEA 4UVIA 1GG5A 4KIUA 3HI4A 1DRGA 2QRKA 5K03A 3SWWA 4XCVA 4J2OA 1P2GA 5D3KA 3PLRA 3AESA 2FMSA 1MO4A 2CWDA 2E4XA 2PWBA 1EM6A 3NDJA 5GM2A 2JLSA 5AYVA 3P1JA 1NNEA 4OBEA 4C21A 1REQA 3IVRA 1DVRA 1X2EA 2NRZA 1ZBDA 4MUNA 4JT2A 3WL7A 1SVKA 3B7PA 4FGJA 2PM8A 4KMUA 4H18A 5TR9A 4KL8S 1WZNA 2W8BA 2BCUA 1XHEA 2C0CA 4RHUA 3MELA 1GTSA 4OI0A 3CUSA 1L7RA 3CZQA 5FEUA 4FQ8A 3RIGA 1N6RA 2W8LA 3A6DA 4NESA 1SUCA 4Q4DA 1PWXA 2A5YB 4NX2A 5ERYA 2Z3WA 5AMXA 1QFXA 3HGTA 3OTOB 1M8FA 2W54A 1V38A 4LEIA 3MLEA 4NF2A 3WZLA 3E5HA 5KQMA 3SSOA 1FC0A 2C7VA 4OLJA 2QPLA 3RTDA 5JSZB 2QKQA 3C7TA 5EA2A 4MGZR 4HX2A 4B82A 1CEEA 1L3VA 4JLJA 2VDWB 3S8EA 5KKAA 3IAS6 1THZA 1RBZA 1V25A 2VJKA 2AMJA 3KTAB 4G0NA 4IOMA 5D3ZA 1XCBA 2QT9A 4GKKB 4N0DA 4NAVA 3U6BA 1QIGA 4YJ2A 2FPRA 1V8OA 2FPPB 4P5DA 4L5AA 3GJYA 3LW8A 3T7EA 3QVUA 2ZRBA 2R66A 1I13A 2YOGA 2XOEA 5JNTA 3V2GA 1H2YA 2V4UA 2YVKA 2FZWA 2G8NA 3CUTA 4GP9A 4M98A 4ZMBA 1IOWA 2CLSA 1FUEA 5FTMA 3ZHRA 4D3ZA 4XX0A 1I0ZA 3ZE1B 4XLTA 3ZH9B 2XUIA 3IDOA 5K6AA 4DL7A 1A77A 1YQTA 4FBMA 4MV4A 3GILA 2H1WA 1TK8A 5KTTA 3PQDA 4A16A 4YPOA 4Z9AA 5KYWB 3DP7A 4EJ6A 4NFHA 3ZEIA 5KU7A 2EX4A 3ZW7A 3NAQA 2FUG1 3DBHA 5B53A 4DA8A 1PJ3A 4JUCA 3IIKA 3R7SA 1Z75A 2AG1A 2C4HA 1V3QE 3V1UA 4B87A 1H85A 4EHAA 3WRVA 2AQ8A 3CX3A 2X7JA 2ZKIA 4G8BA 2G8LA 3WHIA 3OTHA 1R5NA 5HE9A 3TE6A 3ETCA 4JBNA 3DVSX 1AKMA 4Q3EA 5JTUA 1SUFA 3DAFA 4BC0A 5H83A 3M6AA 2I99A 1CJUC 1CRPA 3MLBA 3OOHA 2P90A 5AKYA 3NKFA 2CF6A 2QIPA 2FOLA 3O0FA 4R81A 1ZM4A 1ULUA 3CLSD 4TUYA 3W4KA 2G82A 4ZOLF 3RAPR 1HG0A 2W03A 1H6BA 2QF7A 4M0MA 4ZOLA 1BXKA 4JV5B 2VDQB 3K1TA 4EYKA 1NQVA 5D6OA 3QX8A 1SA0B 1ZJJA 4MW5A 1ODFA 5CNJA 2ZIFA 5IAOA 1ADYA 3LWLA 1HFWA 3MMPA 3N07A 4MAMA 4II2A 4BGUA 5BNTA 2IY7A 4P38A 3GBSA 1UXIA 2EGHA 3TOVA 4DQSA 1SZCA 1T4CA 2CFIA 3T0FA 4G5GA 3N6RA 3VMFA 4M2LA 1IY9A 1MOQA 3QU2A 1II9A 2R96A 2RHOA 4HDRA 2RCNA 4QBHA 5IFLA 2RFLA 1A9XA 1KJ9A 4YUYA 2HJGA 3QPUA 4QGGA 3AWIA 1ZMRA 1JIJA 3B1WA 1M6YA 4PPQA 2RHLA 2W43A 4QFDA 5LQUA 3HE3A 4EPXA 2JCVA 3QUAA 2DR3A 5IHPA 3SXJA 4MW4A 3D6FA 2Q07A 2P9GA 5EP4A 1TW3A 1L7OA 1Q6YA 3JALA 5FHQA 3A6FA 3F3MA 2VNHA 1VFNA 3G3EA 3IERA 1YVDA 4GLFA 2BMEA 4XFKA 1UM9A 5FI1B 5DLYA 2ZS9A 4CF5A 1QUEA 1G7TA 4MKGA 3KUDA 5CEJA 1GZDA 1JTEA 2HYDA 2XGGA 3FROA 3NEAA 1IQUA 4IHJB 2PUBA 2BR0A 5EMMA 2K4IA 3U44A 3ITNA 4RW0A 4GIBA 2JFUA 2IYWA 2OV1A 2RKOA 3CEHA 3LRTA 4DQPA 4FBUA 4RAQA 1DELA 5LR6A 2ZRMA 3MS4A 4QULA 1R0YA 3F5FA 4HRYA 4FKMA 3PIDA 4KMSA 2LWIA 4PRZA 2GLXA 4JP8A 1KZHA 2C5LA 1RE0A 4ALJA 3HL4A 2Q3EA 2IEIA 4RDIA 3RI3A 3O1JC 1MOZA 3ZWXA 2ACVA 4JQZA 1N5OX 1HUZA 2AV6A 3BJEA 2VNIA 1M34E 2C95A 3AU6A 2R25B 3E7PA 3KDPA 3MWJA 4WW0A 3FPEA 1CKEA 1G64A 1SXJE 1XV5A 2J3JA 3R8XA 3U0BA 2YXPX 2CL5A 2BDPA 2CY0A 1C1DA 1QVAA 5ADVA 1IZ0A 1FOEB 4XX0B 1JHMA 2G28A 4E7OA 3ZHZA 1P73A 3ISJA 6REQA 3PMLA 1IXKA 2EVWX 2PX2A 3OSUA 2XECA 4FEAA 3QY0A 3DDOA 3R6GA 4F2SA 1XRNA 5DV9A 5THKA 1R74A 3V7UA 1L7BA 4B3IA 3B6ZA 5JAZA 3P9YA 4RHCA 1ENPA 2HVHA 1A1VA 1B26A 1RXWA 3FMIA 3C4JA 3WX0A 4CVNA 5FOSA 3KT6A 1X80A 4L73A 1XTVA 2HK8A 3OTIA 2PXCA 5KFHA 4KN8A 2C2YA 3OMWA 4ZCLA 3HV2A 2PGOA 1PDOA 2I2DA 2K8BB 2F17A 3BHJA 3N5KA 4GKVA 2P30A 3CJTA 5U4XA 3DDZX 2BM8A 3B38A 4ZT6A 1KO8A 2ATLA 1TQ6A 1VP9A 1WNTA 2CDCA 4PU0A 5DU2A 3DFZA 2OBYA 3FZGA 4HKTA 3R5JA 4BE9A 4CCYB 3LCCA 3O8NA 3R77A 5B4VA 3KQNA 2FMFA 3AFGA 1KP9A 2PQ0A 1L5KA 2KLHA 5JR3A 3RYCB 5F51A 2OOSA 2VPIA 4BWYA 2VRCA 2EG5A 5AUPB 3NTVA 3KZOA 3NWBA 2FOXA 4D26A 1Z2OX 4EHHA 5HBGA 4GO1A 3T7KA 5CHYA 1R0LA 4GBED 4V1CB 1PZNA 3BICA 4BNZA 3DFKA 1GAXA 4R5MA 4KK4A 4EG1A 1WDTA 3HYSA 4P4SB 2BFBA 1RMYA 4K9PA 4C4YA 3HXMA 3I3OA 2EU8A 2CFOA 1SG9A 3OCXA 1E1KA 3QFRA 2X0RA 4KMOA 4R5HA 1BJRE 4JMUA 2QRHA 1KEJA 1D8YA 1U3UA 5A4IS 4F6LA 1A5ZA 1CU1A 2VPYA 2YIDA 1D5WA 5KJEA 1SCAA 2XMZA 3RVLA 1PK8A 4RTLA 5JD3A 3B12A 3P9QA 2XADA 3K15A 2CKMA 3R5TA 3TQRA 3WLAA 4IS7A 1AQIA 2AOTB 1W25A 3QPWA 4MI1A 3T3IA 2XKJE 1Z74A 3KQSA 4Q02A 3HXQA 4LMAA 1NVUQ 1O97D 5EKUA 4MDYA 5EIEA 5KTQA 1RACA 5IVKA 1J1UA 5ALKA 5F4ZA 2YY7A 3Q98A 4N3AA 3CRMA 5HFNA 1TTPB 2GBPA 4JT4A 1X7GA 1H69A 4F38A 5CNMA 1SL2A 2Q4OA 1W48A 1ZNZA 3TZKA 1E89A 5BSUA 1QC5A 4M7OA 4XYMA 3RSHA 3ZU6A 3R3WA 5IJXA 4QD3A 5G40A 1F2TA 5K0ZA 3O4RA 3KYDB 3AEUA 1E1YA 3WGKA 1NYLA 4KX5A 1AUPA 1SBCA 5E2AA 2QTFA 3GRUA 4OGFA 2GHIA 3OFJA 4L28A 4NCIA 4C1BA 3RYIB 3HYLA 2PRKA 2QM3A 3LXUX 2HA6A 1EMDA 5D5PA 3QU4A 1JFTA 1R6DA 2I2FA 4J9SA 1IM8A 2ZVQX 2H1FA 1E8DA 2GM3A 3ASUA 2ZJ3A 3NGLA 3PFBA 5JU5A 3GGGA 3DAGA 3H2GA 4FLMA 2J4FA 4TOIA 5F5XA 3T1QA 2OBBA 4LVUA 5A9SA 2IEDA 3AHFA 5E2IA 4DJEC 5HS4A 4ENUA 5KOIA 1K5OA 2J7KA 3DBLA 3LC0A 4YJDA 4AJJA 1GQSA 2QVLA 4E0BA 7ICNA 3DHVA 2PTHA 1LJUA 4TKZA 4E5SA 4RVNA 1GO2A 1P4AA 3FHOA 1YRBA 1WL8A 2ODNA 3H5RA 3IO5A 4HD8A 4M22A 1VL5A 4PX5A 5KVAA 1ZMXA 2WAAA 3DFFA 4ED9A 4YBZA 3GOHA 3NASA 1GT6A 1Q57A 4Y9RA 3BB3A 4EK9A 2DG2A 5AI4A 1L5HB 4MP8A 1HDEA 2EX0A 3A3OA 2KFZA 4WTOA 3WO1A 4ZK6A 4YJ2B 2D0DA 1VFPA 1CW2B 1E1CB 4ZVVA 4AECA 4G5FA 3OWOA 3QEBZ 1RW4A 2VTVA 4IY1A 2EANA 3A4YA 3RUIA 3ZCUA 4CF6A 3CM0A 4KODA 4F3NA 3EZGA 4QOSA 3QMWA 1HDGO 4ZU6X 4MS4A 2Q1TA 4EO4A 1U2ZA 2C77A 2UZ1A 4BFUA 1DCTA 3FHCB 5HKBA 4CR7A 3VJRA 5DQIA 1NN3A 1NF8A 1BX1A 1JYEA 2ZTHA 3A2NA 3CZ9A 4OLHA 3ZD8A 4XZ3A 5KINB 5IW8A 2UXCB 3K9NA 1A82A 4J7CA 4Q3DA 4L9WA 3TSAA 4QL3A 2P5SA 3FVWA 1E2GA 3IFSA 2W6OA 1SVWA 2WTNA 1KDVA 1L9KA 3WG9A 1SQ0A 4USAA 2BCEA 2VVTA 4Q9KA 2VYVA 1FLNA 4LRSB 4GW3A 4M9XA 3NUGA 2JIZD 3I2HA 4JJZA 4XKJA 1JH9A 3EXIA 1CY1A 4N0QA 2YYSA 3KHSA 4RK6A 4D43A 5KYGA 1YE3A 4BJ5A 1MHTA 5DKFA 2CL6X 1N57A 3KDSE 1N6OA 4N40A 3QWIA 1FFVA 4FDTA 1IXZA 2ZU0C 1DG9A 1Q1QA 5DYTA 3UUEA 1L3CA 4JV2A 5J4KA 3FOAA 2PUFA 1OLSA 4DBLC 1J5EB 4IOJA 5CFNA 5CVTA 1C0EA 4GECA 3RIXA 3GJ0A 1GCOA 4YECA 5J0PA 2AF4C 4CF7A 2JFGA 2FRDA 2AWOA 1SU8A 4V2IA 1Q0UA 1S3IA 3RB6A 1U65A 2RJNA 4DA0A 4DC0A 1BA2A 2E2WA 3HYRA 3ZE8A 2QP9X 2GAFA 4DSFA 1YASA 1ZK1A 4BTVA 4XWGA 3A6PC 1NXWA 2C1EA 3BDIA 4LSWA 2HA4A 4J8PA 3UMSA 4D5EA 5IS2A 2G4VA 2DBZA 2H2AA 2G9UA 2QL5A 4L5YA 2QGNA 3X2SA 3ENZA 2ZRDA 1K1EA 1U8FO 3PC8C 2ODTX 4B76A 4QQKA 3DR5A 1R00A 3NTXA 4NDNE 3GP3A 1HM5A 1X9IA 2A14A 4ACOA 4LBWA 4QDZA 4UHKA 3RTBA 4BTLA 2PUGA 3L4BA 2L5YA 4R6XA 1JI0A 1G21B 1CETA 1C50A 1F8XA 3PPWA 4L8GA 4O1IA 4PSVA 4TN1A 3IG5A 1DFIA 1MRZA 2NAPA 2W6ZA 3G0CA 1D6NA 4TSKA 4YRCA 2Q4EA 2VOEA 2FQXA 3J7TA 1P4RA 1M6VB 2ZUVA 2CFTA 1XD2A 2GZDA 2RSLA 3AINA 3HC7A 5B37A 1N33B 3TOCA 4RGYA 1PYDA 1QHNA 1T9CA 2CK3A 2X8BA 1BVRA 1U8AA 4PCLA 2J1LA 4QPZA 1USGA 3RAJA 2J67A 3S3TA 2C4UA 2R4TA 4CDNA 2HBKA 4L8WB 5CHGA 5IJZA 4I3GA 1MENA 2GJSA 5EIBD 1G8MA 1EZZA 3BULA 3OOEA 4HLUA 4D2IA 3RSZA 1S2DA 2QQFA 3UC5A 2UVPA 3SU8A 5BW4A 5CYPA 3M6MD 2M32A 1G0NA 4INZA 3HJRA 3ZNNA 1UBGA 1JU4A 3QWFA 1O7JA 1I7PA 1QO0A 4GP7A 4IJUA 1RYFA 3UT5A 1PTKA 3COWA 3BK2A 1NWHA 9ICXA 3I6BA 1GAWA 3NIWA 4JU8A 4L6AA 3VO8A 3WGMA 2Y0SF 1XK7A 3NV7A 2G3YA 9ICQA 4CODB 3JVEA 3E22B 2HHJA 5AHXA 3P27A 2CGEA 4G56A 1UF9A 2BGNA 3LNTA 4ARIA 8AT1A 1NVKA 2R8BA 1E79A 3KTDA 4JB8A 3WMGA 4IIHA 2PUTA 3RTVA 4MKIA 3SOZA 4ZDIA 2Y6VA 1ZUNB 3KV3O 3T35A 1WEKA 3KJGA 2WOJA 4FE7A 5AM4A 1YR7A 2CDRA 4GMXA 5AICA 4KQXA 4EBCA 3SMQA 5DTMA 3N8NA 3MQFA 3LQFA 2HL6A 2VH1A 1CY8A 4Q9DA 5A06A 3OSPA 4KUEA 3IJ5A 1P80A 2RE8A 2EZZA 2XXAB 2H8KA 2K6GA 2R8OA 5GM1A 5LJIA 3N86A 1F6DA 2AOXA 3E6AA 4Q3LA 2C4TA 4HSGA 2EZUA 2ZAMA 3R3ZA 4TMKA 2HBQA 1N6LA 3F2BA 4RV4A 2NP6A 4LHSA 4MAFA 1BDMA 3X2FA 1GPJA 1HRKA 3EF1A 3K5IA 3T1VA 4B5KA 3K1ZA 2FLVA 4PYJA 1WF3A 4F5ZA 2XWSA 2DFDA 4O08A 3ZTTA 1R2QA 3AESB 2I6QA 4I1OA 1N1MA 3CLUD 2OV8A 4MO2A 4OJKA 1QOQB 3EXAA 4MVXA 3V7WA 1ZP6A 3MZ0A 4X6LA 2F6RA 4YCLA 3F74A 2ZE6A 3IEKA 1GGFA 5AXCA 3QJ5A 4UJ3A 1WOYA 1FP7A 2IYEA 4TXLA 5EYPA 2Y1CA 3WLIA 4WXEA 5IIIA 2OM2A 3P9SA 4FDMA 3VU8A 2H5XA 5CA0F 3EC2A 4X41A 1XKXA 5FUYA 3BCSA 3I2FA 5JD4A 2VPWA 3K1YA 1JVBA 1QVVA 2VHVA 5LXTF 4EGFA 1CUUA 4P4TA 1CR0A 4ZMSA 3O47A 1Q95A 2XQVA 4KQFA 4PZCA 3B9QA 2WM3A 2C2RA 2YUTA 5LZ7A 4HGZA 4YAIA 2P75A 5D3MA 1NI3A 3E7FA 4IDNA 4R63A 1IQ0A 3ZZ0A 1U98A 1NASA 1OFUX 4TRMA 3MQ4A 4ECUA 4PYQA 2I2AA 1SFRA 4OQQA 2ATCA 5J2KA 4YD1A 3PC2A 1DG1G 1KFCB 3PW2A 1UXOA 2HN9A 4I0WB 3ZYZA 8ICSA 3C3MA 8ICMA 4GMFA 2AUMA 1O4VA 1LC3A 4K9KA 3CG4A 2EC5A 4PZLA 3CB4A 5IXSA 3VR2D 4GICA 4ZVTA 4KLAA 4CMKA 1V1RB 5KVVA 3E8XA 3WOHA 4DIKA 3IAUA 1P0QA 5DBHX 1G6OA 3H9GA 4KI7A 4U7HA 1ZKDA 3S70A 2V8OA 1G2PA 2ANCA 1GU0A 2ETXA 2IKQA 4P4NA 4AKSA 5KDDA 4IIJA 4RS4A 2R44A 2YWGA 3QF4A 1AUOA 3CZRA 2OESA 4TZ6A 3TZ6A 4LX8A <