3R9KA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, glu47asp mutant complexed with sulfate, a closed cap conformation
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
227
structure length
227
Chain Sequence
b'GSHMRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHDGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative beta-phosphoglucomutase
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 83
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3r9kA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3r9kA01
5AKLA 1AQ6A 2GO7A 3MMZA 2YY6A 1Z4KA 2BDUA 3EPRA 3U7FB 5AVYA 5AI8A 5AW2A 3WKEA 2WF5A 5ALJA 3L1UA 3DAOA 5ALLA 4FE3A 3ZX4A 2GHTA 3ZTYA 2CFRA 2Q4TA 3N07A 4ZEWA 1RQNA 3PGVA 1WVIA 3AR4A 2BDEA 2AH5A 3ESRA 2QLTA 1TJ3A 4BX3A 2JAOA 4IG4A 1Z5GA 4I9GA 1YMQA 5AHXA 3B9BA 3PGLA 3FVVA 3WKDA 2YJ5A 1RKUA 1RC8A 5ALWA 2P11A 4EX6A 2FEAA 3QU9A 5ALYA 4G9BA 5AW9A 2R8ZA 3RFUA 1N8NA 3OPXA 3I1YA 3N1UA 5ALVA 1QH9A 2O2XA 3FPBA 3U7HB 4KX5A 2HDOA 3J7TA 5AIBA 2FPUA 2Q4RA 3EWIA 3L7YA 4HGNA 5AW4A 5AM4A 3AR9A 4Y2PA 3F9RA 1RMQA 3AR2A 1J8DA 2G07A 2EAUA 4FFDA 4UAUA 3L0YA 2ZBFA 5ALOA 4XQ0A 4OCZA 3U7GA 1K1EA 1CQZA 3A1CA 2WHEA 2I33A 1S8OA 1SWVA 1Z4MA 3AR8A 1NNLA 3WK4A 4CF4A 4KNVA 4UAVA 5IT0A 1JUDA 3WGUA 4GXTA 2YBDA 3UMGA 3D6JA 5AW7A 5IS2A 3QXGA 1N9KA 4BKMA 3QGMA 5ALGA 5AVTA 2HOQA 2WF6A 5AM1A 2EARA 4Y2RA 1XPJA 3L5KA 3NAMA 3WKAA 5ALIA 1WZCA 2HEGA 5ALQA 3ZTWA 2FUCA 3QU4A 3ET4A 3L8HA 1ZD2P 1ZD5A 4HGQA 2JAWA 4CF3A 1O03A 3OCUA 4BBJA 1Z4LA 2FPXA 4Y2UA 3B9RA 2ZBGA 3ZX5A 3NASA 4NWIA 4F72A 5ALXA 1RMTA 2AGVA 5AVVA 4AS3A 1X42A 3MC1A 2YJ4A 2AUTA 3R09A 3OCZA 4Y2VA 4AS2A 1SWWA 4UW9A 2D2VA 2C9MA 1FEZA 2GHQA 4XE5A 5A3RA 1ZRNA 3WKBA 1RRCA 4KYTA 4XOUA 2P9JA 1L7NA 5AVWA 4KNWA 5AKGA 4PNHA 1XVIA 4YCNA 2R8XA 3AR7A 4EEKA 3QU7A 3IRUA 2YMMA 4C4RA 2R8EA 4CF5A 3B8EA 3N5KA 5ALFA 2B1RA 2G09A 1ZJJA 2HF7A 3OCVA 2YN4A 1XP5A 4IFTA 2NYVA 2HCFA 1Z4IA 3E84A 2I7DA 3NALA 3ZVNA 3ZUPA 4UASA 1L7PA 2FI1A 2OYCA 3DDHA 3BA6A 3SF0A 2B1QA 5AKJA 3R9KA 3WGVA 4Y2SA 3W5BA 3OCWA 1Z5UA 4J2TA 2PR7A 4J03A 3ONNA 3I76A 3R4CA 4JB3A 3KD3A 5AVXA 3OCXA 4KN8A 3SMVA 5AW6A 5AKHA 3QX7A 4HGPA 5AKZA 2DQSA 2YJ6A 3TLMA 2PKEA 5AM2A 1RQLA 4NFLA 3AR3A 1T5TA 4AP9A 2YFYA 3UMBA 2NO4A 1NRWA 4ZEXA 4HGOA 2OM6A 1TA0A 4YIKA 1L8LA 3W5DA 2ZBEA 4UM7A 1SU4A 4EELA 4BX2A 4EENA 2O9JA 5JJBA 3KC2A 4DCCA 2YMPA 3WKCA 4G63A 2WF7A 1L6RA 2MU1A 2X4DA 3QUBA 1ZD4A 2G0AA 5AESA 2C8LA 4Y2XA 3SKYA 3M1YA 4MUMA 3E81A 4BEVA 1LTQA 1Z88A 3QUQA 3WK5A 3SHQA 1L7MA 4OD0A 4UU1A 4XPZA 2YJ3A 4CE6A 2ODAA 3ED5A 2BY4A 3QU2A 3HYCA 1ZS9A 1EK2A 2FUEA 4MWOA 3KDPA 2RARA 3U26A 3A3YA 3SKXA 1U2SA 1Z4NA 3ZVMA 4O8CA 1RDFA 1L7OA 2C88A 4UU0A 3I28A 5IT4A 1RLOA 2VKQA 3W5AA 2HF2A 3NRJA 5AKKA 2B0CA 2I6XA 4NAVA 4I9FA 5AVQA 1YS9A 3A1DA 2B8EA 1U7OA 4BEWA 2CN1A 1U2TA 3EF1A 2I55A 3KOOA 5AW5A 2AMYA 4BNDB 4ZEVA 4BX0A 3FGOA 1Q92A 1Z4PX 1VFPA 1T5SA 2G08A 3L8EA 5AW1A 2B8JA 3ET5A 4EZEA 4HAIA 3L0CA 2I34A 3MPOA 3SLRA 2OBBA 2ZBDA 3OTQA 5AVUA 2JGAA 1QQ5A 2I54A 1WPGA 4UMFA 2RBKA 4HGRA 4QJBA 2Q5EA 2HHLA 3N28A 2WM8A 1KYTA 2HO4A 1RLTA 3NANA 3L0BA 5AI6A 3L8FA 4Y2JA 5AKXA 2YMLA 5AI4A 1MH9A 3PDWA 5A3QA 2C4NA 3GYGA 1U02A 1TE2A 2P27A 3FPSA 2ZOSA 3NUQA 3QLEA 4H1WA 3KZXA 4YCMA 4F71A 4UARA 3IB6A 3HLTA 3QU5A 5AVZA 4GIBA 2JARA 4DW8A 3U19A 5AW3A 1RMYA 4DFDA 1L8OA 3BWVA 3I6BA 5AM5A 3WK9A 2W4MA 3IJ5A 4FYPA 5ALKA 5AK5A 2RAVA 2WF8A 5ALZA 3ESQA 3CNHA 3WK8A 2MU2A 3QUCA 3FZQA 3P96A 4UMEA 3E58A 4CNQA 2ZG6A 3FM9A 2WFAA 3NIWA 2B30A 1Q91A 5AK6A 5ALHA 4B6JA 5ALUA 3ZVLA 4YH1A 3N8GA 2WF9A 3MN1A 3QNMA 3S6JA 3OCYA 5AKEA 5AI0A 1ZOLA 4YCLA 3AR5A 5AI5A 2IOFA 3QUTA 4NABA 4Y2YA 5AW8A 2IA5A 4YGYA 2ZXEA 5ALEA 4KX3A 2MSNA 3ZU6A 5AVRA 3CZ4A 5ALMA 4RETA 5AK3A 3WK7A 1J97A 5AM0A 3QYPA 1YDFA 3ZWKA 1F5SA 2W11A 2OA0A 5ALTA 1YV9A 4BNDA 4E88A 5ALNA 1CR6A 1RPZA 3KBBA 2GMWA 5ALPA 1ZRMA 1YNSA 5ALRA 4C4SA 1LVHA 2W43A 4L6AA 4C4TA 2NO5A 3ZW7A 1TJ4A 5AIAA 1T9ZA 2R8YA 4OHFA 1QQ6A 3ZI4A 1Z4QA 3WK6A 1QYIA 1RKQA 4NV0A 2CFTA 5FP0A 5AI9A 3L1VA 4YIHA 4UATA 5AICA 1Z4JA 3DV9A 1PW5A 3ZWDA 1Y8AA 2FDRA 2FPSA 3K1ZA 1QQ7A 2RB5A 1VJ5A 2B82A 2P69A 4JDPA 5AW0A 1ZD3A 4BYGA 3UMCA 4UMVA 3VAYA 2CFSA 2GFHA 3SD7A 5T41A 1WR8A 4UMDA 1TJ5A 3EF0A 3E8MA 3L8GA 3RF6A 5AM3A 4RESA 5AK4A 4OFZA 4DWOA 3UM9A 2IOFK 1NF2A 1RLMA 2FPRA 1YJ5A 2C8KA 2HX1A 2QYHA 4QQFA 3W5CA 2FPWA 3M9LA 3AR6A 2G1AA 3DNPA 2IOHA 1IWOA 5AKYA 5AVSA 1O08A 3PCTA 4L57A 5E0OA 1Z4OA 2EATA 3A1EA 1VJRA 5ALSA 4EX7A 2IYEA 2YMQA 2PQ0A 3U13A 4UM5A 1EK1A 2HSZA 3U7EB 5AKIA 5A3SA 2JAUA 2G06A 4HYTA 4Y3UA 5ALDA 4L6CA 4Y2TA 2G80A 1U7PA 1RKVA 4Y2QA 1S2OA 2HI0A
chains in the Genus database with same CATH superfamily
3UY4A 5K4LA 5I3CA 1NVBA 4JROA 2BUBA 5ED4A 4PLVA 2DE0X 3TZBA 1UEIA 3O8OB 1XXHE 2FX5A 1KQOA 1T9CA 4M0CA 4ZQIA 4LSMA 4TKMA 3AB3A 2TMGA 3EZ9A 5FBHA 3D3JA 1Y1LA 2J6TA 5JDCC 3LLVA 1N5KA 5JQGB 1F48A 1E66A 1L5OA 2PJUA 3RC3A 3RASA 3V72A 4LYHA 3G23A 5F77A 4QOHA 1SPBS 2MSEB 2H5JA 1E64A 3C45A 4RIGA 3KQYA 4BNUA 4ZT3A 3UCEA 4GM0A 2QSZA 2J5RA 3ELUA 4AJ2A 2NXCA 2X5NA 4TQAA 4Q4LA 3EVTA 3IP7A 4NOLA 2I4TA 5COQA 5D46A 4L5CA 4EKYA 1ONSA 3TZHA 4D3XA 3UV7A 2C5BA 3WBFA 2VDWA 2CVZA 4MQFA 4RW0A 1OWLA 4TKUB 5H3LA 3TBKA 2UAGA 4PRLA 2QTCA 3C4QA 4TYWA 3JPNA 4K9NA 2VK2A 3TSAA 1NIPA 3MLBA 3ZKWA 2II6A 1PG2A 4OREX 2IIBA 2OXRA 4NNOA 1C5KA 2OM2A 4QHTA 5CA7A 3PUVA 2I8LA 1BG6A 5JU5A 1H2XA 3OT4A 2CXPA 3T06B 4OHCA 3WMFA 5IJWA 2Q4DA 1GZHB 3AIMA 4HUQA 1NBHA 4W5QA 3C8HA 1MC1A 1XC9A 1D5CA 2YBEA 3F5DA 2W7TA 5K05A 5ER9A 1JDPA 5G0TA 2Q3BA 3PENA 2JEOA 3Q3IA 4BS9A 4RPJA 2GZ2A 4FDTA 3LW7A 5D49A 4HNAB 4IS7A 4IIUA 3KJQA 4H18A 5D84A 4O4IF 5EUCA 4YONB 2W9AA 1AB5A 2JKVA 1W36D 1Y5MA 4URVR 4HNVA 4I81A 1TKCA 4BC1A 2GB4A 2Z8ZA 2PGDA 1E63A 4R8MA 3DS8A 4RT3A 2I6XA 5KFGA 1M0WA 2WP8J 4BEWA 4A1OA 2EHJA 2OCEA 4QDOA 4I4IA 1G17A 4CPDA 2H2IA 4QYSA 1WOMA 3AL0B 3M8RA 1K5OA 4AZ3B 3TYXA 3S2FA 4D96A 4FOOA 5DLQC 2YRFA 2FWJA 1L5UA 4G26A 2RK4A 1SB3C 3PNYA 5KYUA 5G0VA 3WRWA 1E3WA 4BV3A 3MR6A 1UBTS 3H19A 4UPDA 2NZ2A 1W85B 3RGWS 3FYUC 3D2SA 4FGZA 1ISPA 2GYVA 1L5NA 4N54A 3CTMA 2B7CA 4F45A 3ESQA 3A10A 3BD7A 3TLCA 1GCGA 3E58A 3O0DA 4MKIA 3DLBA 1Q91A 3CVJA 1TAGA 3OCYA 3ITNA 4B7AA 1Q2XA 1SG0A 3RYCA 3NR2A 2JGIA 3OI7A 5KVVA 4RK4A 1NQUA 2V45A 3RS2A 1NTRA 1Z9BA 5HKAA 1O94C 2A58A 4FHEA 4C4TA 2J9ZB 4MEYA 3T7EA 1XP8A 2FOXA 1HOTA 3ZGYA 1BMFD 2BEVB 3TRDA 4UHCA 3MA0A 2X1LA 3EH2A 3UATA 3B20A 4BO1A 3UK2A 1GAXA 2XGPA 1VDZA 4AY4A 2R1UA 2Q1TA 2Q5FA 4OJMX 5LM3A 1JQKA 4ZYXA 3RC7A 1QK4A 4LYEA 3KETA 2FPMA 2WAOA 2ZQ5A 3RBAA 4M0AA 4JYCA 3P9KA 3T7DA 3ZE2B 3MJFA 3CEMA 2PGXA 3ONDA 5LZ5A 3FI0A 4BPRA 2D1SA 4ITVA 1VI6A 3OLYA 2HLDA 2BV3A 3EQ8A 4G37A 2CK3A 1YJCA 5ESXA 5L7YA 2VR1A 2DH6A 2P2SA 5T4HA 1QIHA 5A5FA 5CG1A 2H51A 5CA1F 5C31A 5FWXB 3W6UA 1S5PA 1H6DA 2CLDX 5JALA 4HMQA 1KSHA 3MWFA 2FE4A 4ZOHC 4F11A 4F5RA 5C2JB 4AY5A 1HLPA 5KAMA 3Q98A 1G59A 2I3ZA 4XDYA 4OCZA 3KJEA 1OKKD 1W4LA 3A4TA 2ZJ8A 1FP4B 3CO0S 2GAJA 2FQXA 8ICAA 1D9FA 1Y1PA 3HTXA 3L7LA 4FQ5A 1MOPA 4NENB 4PLTA 2BOVA 2C2KA 2HWUA 1N8KA 2Q6IA 2A84A 4LDAA 3ETRA 4KQWA 2NZXA 2CMGA 1TDJA 3BMQB 4D3SA 3C2KA 6REQA 4G86A 1E0JA 4AY3A 2QMEA 4EBCA 1OMOA 1L8XA 4TM8A 2QUIA 4H1HA 4RMNA 5J2TF 2G09A 4XWKA 2ASJA 4JAVC 4E03A 4UBNA 1ZESA 1LK0A 2HUPA 5KX5B 2OV1A 3H8MA 3IELA 3LJKA 1DELA 2AOUB 3LRTA 5DBGA 4D6PA 3T5AA 1KTVA 3QRWA 3OJFA 1M83A 7ICLA 1R64A 3VPGA 1GTJ1 3CMMA 3R4CA 3EZFA 1NV8A 1RHMA 4QOJA 3DOOA 3M1AA 4UTPA 5AKHA 1JHQA 1H3EA 2DQSA 3F2VA 3SZUA 3QHAA 1TF2A 1L4NA 4FYXA 3PD1A 4ARBA 1J2EA 5JO9A 1ZICA 1BWSA 2OV8A 3GP3A 2ZYIA 1Y34E 2WU1A 4IWYA 5K09A 1FQWA 5LQJA 2QMOA 1SXJD 2RLTA 3G2QA 3ZZNA 4OXRA 3U4GA 2C03A 2JXJA 4QRHA 2FN4A 3AZOA 1OXSC 1ZQTA 2G77B 4ALJA 2RC5A 4XA5A 3Q8RB 3L1JA 1BS1A 1A7AA 2DFDA 4NCKA 1TW3A 3WWOA 1RZRD 3SR0A 9GPBA 4FI3C 4RWZA 1EE9A 3O8RA 1UZMA 4ID3A 1DINA 4EDHA 3EGXB 2HUNA 1KVSA 3GX1A 2AJCA 3ZWPA 1NZBA 5FOSA 2WSIA 4H7EA 4GSKA 3SOPA 3O8QB 2WKRA 3P9SA 2JA2A 3NVKI 2OSBA 3KJHA 2ZSJA 1LBHA 2QWXA 2OO7A 1RLUA 2A0XA 2OO3A 2WF8A 3C6BA 3R5FA 1CJSA 3QVVA 4OHWA 4MUJA 1ELOA 1MXHA 3BB4A 4L2IB 4L8WB 1B8PA 5AOAA 2ZTHA 2GKGA 3GJ8A 4YUWA 1SHKA 3FYDA 5IF3A 2XI9A 2HRZA 4IIXA 3A6PC 2OA0A 1YV9A 3ILYA 4WFQA 1N9GB 3GEDA 4IS2A 4ZGBA 4RAOA 1N2JA 3Q5EA 4CLXA 1M5RA 4AQYB 8OHMA 3JAKA 4L9WA 3GXBA 2V6BA 5H7XA 3SYLA 3DBLB 1XCBA 1NUTA 1L4FA 4L75A 2VNKA 1A9ZA 4OQMA 2G4LA 4MHVA 3TIGA 2A0UA 2UYGA 2QRZA 3K0EA 4WGFA 1QTNA 3FUCA 2AX4A 4HTFA 1NY6A 4BUCA 4B1FA 3RVBA 4RDIA 2VCHA 4N65A 1OQAA 1FE8A 4OMFG 2LYHA 3QTTA 3AEZA 3RB8A 3K32A 3AB7A 1IEQA 5E0OA 4O4JF 4DLTA 4MJLA 2PX8A 1PSDA 2H17A 2XQIA 5GJBA 4C7MA 1FFDA 3OZCA 1JIKA 1QX3A 1BC5A 1O94D 1EEXB 3J81j 3GDHA 1N5MA 4AYXA 3QXHA 1VA5A 1QUEA 2IOYA 3I1IA 2BKLA 2IU6A 2Z9BA 4TXLA 4ECVA 4U2FA 4FWIB 3JATB 4Z4QA 2QVCA 3HU5A 2YINC 3KLNA 2HF8A 4BY9E 2WMDA 4O4HB 3DZDA 5MN4A 1RVDA 3LOUA 4EPVA 5B66U 1OFTA 5HIMA 2Q27A 4Z6KA 2ZTVA 3I52A 3RC1A 2PXHA 2C1XA 5AM4A 3EUFA 3H11A 5FA8A 3EVBA 3S8YA 1X92A 3CPHA 2V55B 3MT8A 2OCKA 3R3XA 4CKXA 1ZKDA 2BGRA 4AYBF 3Q8KA 1X80A 4RQ2A 3AERA 1V7QA 4H4CA 4FXPA 1N7HA 1B4DA 1PUZA 1A5TA 4JEIA 1VSUA 3EFOB 3IKTA 3THSA 2HAEA 4Q9JA 4ZREA 3VZDA 2JHDA 3JQFA 3WYAA 1OLSB 3KT0A 4FMDF 4KN7A 2W04A 2HOIA 4I4NA 1ZD2P 4HNHA 3ZHRA 2ZT8A 4Z2AA 3EY9A 1CXZA 3RYHB 1ZQKA 1MNQA 1K7XB 1QPZA 3TKLA 3DP9A 3MMNA 4I2GA 5THXA 3HU3A 3RRHA 8ICLA 2PT7A 3TSOA 1LB2B 1IIPA 1TAUA 2HDWA 3A7DA 3MCUA 3PL1A 3K1RB 3HU1A 4K3UA 4DMCA 2KVSA 1USUA 1VHLA 2G0TA 2JGEA 4DBLE 4FKBA 3K5HA 4ECSA 1TD9A 4TUSA 1DAGA 5FLYA 4J03A 4DIBA 1D2GA 1M5TA 4KO2S 1VB5A 1FUUA 5EERA 2IHKA 1FDWA 2JBWA 4HDOB 2ECOA 3X1YA 4KSBA 3LECA 1ZOOA 4DCGA 4YV0A 1SO8A 3JVUA 1SKWA 1Y4AE 2DPGA 5IU6A 3IIIA 2DKFA 2JDID 3M0EA 1N2OA 1O96A 5LZ4A 3Q41A 4HPJB 4E09A 1KPIA 4K9PA 3CW8X 3IPLA 2QT0A 1TD1A 1V5IA 4BNIA 2AXEA 1P19A 2DR2A 1N9ZA 1OI2A 3ZHYA 2ZWPA 2XD4A 1XXHB 2JH3A 1YTUA 2J6BA 4P58A 4WX2B 1H23A 1XTBA 4LF8B 2J59A 2FGKA 1HURA 2CNNA 3OU2A 4WNIA 1ZWLA 1CUZA 3ODPA 3JQPA 5KQGA 1HC7A 3OLXA 8ICFA 3T3FA 4QG3A 2X0NA 1CZHA 1XCGB 3GUYA 3R77A 1RIIA 4ER6A 2IDZA 4ZT6A 3R40A 3G5MA 3DKKA 3EZYA 1XSEA 2NGRA 3G0DA 4IIGA 4BEJA 2WMYA 4O4LA 1ILWA 4NCBA 2YOFA 5IZCA 2N9UA 4B3XA 3DOCA 4CCSA 4GOND 1MEEA 3SEZA 1ZOPA 2N75A 4EJSC 1PHRA 1F12A 2GTHA 5IAKA 5CD1A 5DB6A 4KO4S 1CUHA 2PUWA 2KKVA 4IUYA 1Y8RA 2G5HB 3KQLA 2OEHA 3P2IA 1X66A 3WLSA 4I08A 3GIJA 3I9MA 2R7KA 3SR6A 3D3QA 1Y6QA 4BO5A 4JLPA 4OHFA 3I5MA 1ZQVA 3VNRA 5HS6A 4EHIA 1WZIA 1HEYA 2NU6A 3PFFA 4L16A 5G40A 2B2XA 1HH4A 2NVUA 1BSVA 2QPLA 2ZB4A 9LDTA 1F2DA 1XLVA 3PC3A 4NU0A 3MEQA 3EG9B 2V9CA 3MQ2A 1OFUA 1EDOA 4QQFA 5D1HA 4HVLA 4L08A 2G1PA 5HPYB 2FWNA 4V3BA 2YVLA 4AO6A 3NEYA 1JQAA 4YP5A 4ZVVA 5A3SA 8ICKA 3MM4A 1GZ6A 4C4OA 1ORVA 2R47A 1SB9A 4PLZA 4GR5A 4WUVA 3HFJA 4FC7A 3L1UA 5IXSA 1ZH6A 1X7GA 5IAJA 1K68A 4OHBA 1MIOB 4BB6A 2J07A 1NLYA 5AK0A 3OA0A 5F5NA 1NNI1 2RHHA 3I73A 2V7QA 3LK6A 3RSZA 2A1TR 1WCNA 5I47A 8ICNA 4KQCA 3CMCO 3D54D 4ZVLA 3G7SA 5HRCA 4QFCA 4P54A 4U3JB 4LDJA 3QA9A 4HF7A 3GWZA 1J99A 1Q83A 3U7GA 1I3KA 2PKCA 1DC4A 4A2CA 5IAOA 5JJCA 1XAJA 4F97A 2GZMA 1OOEA 4E5UA 2PUDA 2YTUA 5KWJA 3E27A 3HXQA 6NULA 3E48A 3WJ1A 3PFIA 2ZATA 9ICTA 4RKRA 4GMXA 4FMPA 3F46A 1H2EA 2QSUA 1K9VF 2OCYC 1O03A 5AD1A 4L02A 4YXMA 3EAFA 3P9IA 2LCFA 3CUUA 2OYSA 4TM7A 2C4MA 3TXXA 1A8SA 4OVKA 3WKBA 4TWZA 4KYTA 1T0BA 4X91A 4YWJA 4ZH4A 1PBNA 2OBYA 1SQSA 2IQ5A 1P9RA 2X6RA 2YN4A 3IBYA 3E2IA 5KOYA 2QL6A 3AF1A 4HK4A 3QG1A 3NALA 2X76A 5ESWA 1DG1G 5FR1A 3ADOA 3JALA 2C58A 4Y6PA 4DJAA 4QWCA 1F2VA 4KPEC 4FSXA 4X6UA 2O8DA 1ZD8A 1R3UA 2FZCA 1XF9A 2ZUVA 3LY7A 2XGOA 4F5QA 3SIPA 4Y0VA 1M73E 3BXEA 1NVVQ 4PFKA 4Q6WA 4IDAA 3GLKA 4PTZA 4BRZA 4OLAA 4UDXX 5CLGA 1XE3A 1J5EB 2WZBA 5HCNA 4B48A 2YMPA 4H0CA 4K0RA 2QRHA 3TOVA 2E37A 3TO5A 1ML3A 1VSBA 5F5LA 1O1YA 1L7MA 3LC2O 2BFMA 4F2HA 4QDTA 3EGWA 3LTEA 1SIJA 5B2ZA 2EFEB 1NKVA 4ZEMA 2RGGA 5CXXA 4EI7A 4UU0A 4Q9NA 2CF6A 2DKZA 4GXRA 1CUVA 3A1NA 1QO7A 3LVVA 3N97B 2IYWA 2OFFA 3PMNA 2Q7XA 4BTLA 4Q4AA 5JSKA 1ZCFA 1UBSB 5DBOA 4OKSA 3MS4A 4I5EA 2J5QA 1UWCA 2B5OA 4MS3A 1QQBA 4FINA 2EQBA 4BNZA 1TA4A 1JEOA 3V6MA 4O2AA 4P32A 4RYDA 4BATA 2DX7A 3JPYA 1D8BA 3GELA 4BNKA 5DHPA 2KK0A 2KVCA 4MOWA 1KZ9A 1K98A 4BKQA 4IEIA 1HNNA 2NU7A 1JG7A 2VUUA 1MX9A 5KFWA 4MZXA 2WWTA 2RHLA 3T1OA 1X87A 2IHTA 3WDKA 1TM3E 2C3UA 2OTCA 1I3NA 4UVHA 2RHRA 3VDXA 3FPCA 2RGWA 4FZNA 4YC7A 2JZCA 4OXKA 4DF3A 3B5IA 5CVCA 2B4AA 4BXOB 1RBMA 1TZKA 5DM1A 1UOPA 3MTGA 1S89A 1SUAA 2YR0A 3WIOA 1KPHA 1PX0A 2H1WA 2QN6A 4GUAA 1HQCA 4XW2A 4ZO4A 1DBRA 3M6FA 3T15A 4DB4A 2PUVA 3NHSA 4AO8A 2O7RA 4BMCA 1KY3A 3DVSX 4QDXA 4E5YA 3I64A 1QIJA 3I12A 1XDGA 1YL6A 3C1AA 1UT8A 2QSYA 2EL9A 3K9LA 3W78A 2YIDA 2AR9A 4E2ZA 4Q9LA 4NX2A 4LOLA 3PFBA 3MWYW 1KRHA 3KXLA 1KMHA 4MWZA 4FJ1A 3NZEA 1Z6XA 4ZZ3A 2WWVD 3LLSA 3B60A 1V9CA 3E2MA 1M8PA 3DMYA 2F4VB 3BSWA 4OFXA 4FFRA 3IEUA 2HBQA 1U7XA 4DLAA 4IQUA 4G8JA 5DGBA 2R8ZA 4G07A 3C5EA 5DF1A 4NRDA 3V3KA 4QJFB 4PHCA 2F77X 1U9YA 3MGGA 5KQLA 4X94A 1N62A 4H35A 1OT3A 5F2NA 2GBLA 3R9XA 3W6NA 4RJTA 3EC7A 2B5WA 3OZFA 2NIPA 4KV9A 4MW2A 1VP9A 1ONOA 2FUG6 3F97A 3VM6A 3QE2A 1NXWA 3PRKE 4JXZA 4DSKA 2IYSA 4ZCIA 2GLTA 5ALXA 3H13A 2Y1EA 2Q5LA 1M76A 3EPPA 3EWAA 4AMZA 3GIIA 5T8KC 3F2BA 2UDPA 5BRAA 1CW2B 3EODA 1ZJ4A 2HA5A 2ZVQX 3K0KA 3L1HA 3W6OA 3R6WA 1ZJJA 3DCYA 5KYWA 1JWLA 2PX3A 3BPSA 3PR2B 4QTUB 4LRWA 3DOJA 3B48A 3JPWA 1Z8HA 3I2KA 3I6YA 3NT4A 1PVOA 1I1QB 4GL2A 4RHXA 1SBHA 5J8YA 4HDKA 4EHNA 2VTKA 5GOTA 1NRXA 2P40A 3TLMA 2NV0A 1NKTA 2VG8A 3UB2A 3P52A 3TIFA 3LVWA 2PKRA 1Z2DA 9LDBA 1QTMA 2XTAA 5DU2A 2ZRMA 4U00A 2V65A 1YQEA 1IIRA 4EW2A 1UCFA 1YE3A 2Q49A 4KN4A 2PS3A 4F2DA 4XPZA 4UCXA 3GLIE 3PIIA 3IAUA 4KUGA 2IFTA 3LO8A 4C8LA 2RG7A 2I6GA 3A3YA 2DUYA 3LVQE 3K4HA 1WCWA 3C7KA 4B9AA 5K0SA 4BLVA 3S1SA 1E9BA 2QT1A 4I50B 4JZKA 3W5HA 4ASUD 1QHIA 4DNFA 3F5EA 4MZDA 2G9NA 2DUJA 5HJ7A 3B6EA 4O29A 2WJIA 4R54A 5IUKC 4I1OA 4BNLA 1Z5NA 4DABA 1T0UA 2ZRBA 3AJRA 3ER6A 4HLUA 4NCXA 3NJ4A 3DEZA 5I7UA 2QUZA 1ZM3A 4U6PA 3DR5A 1C9MA 3R0QA 4UXHA 3H0CA 1J0CA 2O6KA 1YULA 2ARKA 1QAQA 4FGUA 2OXCA 3PX3A 3T6KA 1OUQA 2GZDA 4QPZA 3ILSA 5EWJA 3SI8A 3OSNA 1QK3A 3VPBA 5FBLB 2G83A 2XWQA 4G0NA 1NQAO 1IBSA 4DCNA 1DEKA 3L5OA 1P17A 2BVNA 3FRHA 3SF8A 5FWDA 2GOYA 3RRJA 2VNAA 4DXAA 1R10A 2CNDA 2VS1A 4L0CA 4FWBA 4EHHA 2YZMA 1FUYB 2AVDA 5ELLA 4LCBA 1PVRA 5JMTA 4EEYA 1EB8A 3I45A 4ZV9A 2ETXA 3OMXA 3H17A 1KA9H 2LD4A 2WD7B 2JKZA 4WAUA 3DE3X 2Z0MA 3R6GA 4Z7NB 2CXYA 2WQ6A 2RAUA 4ZOLF 3HRKA 4N48A 5AICA 4YYZA 5ER6A 1CUSA 4AWXA 3O1JC 3MHPA 1KH1A 2C84A 3UMCA 2XZPA 2P9CA 2WK1A 4CLDA 5B4TA 5G5GA 4L22A 2L2QA 4I4TF 4JH0A 1DBPA 3BILA 1RWVA 4AX8A 2FPRA 5GVSA 2HHUA 4W6ZA 4XIFA 4G6ZA 4GPEA 4CI0B 4MW6A 5MGBA 2WHRA 3JARB 1B4FA 3DBIA 3OIUA 2J46A 3T1YB 1KTQA 3FIUA 5CFRA 1PKEA 3E61A 1PO7A 1L7EA 4YR9A 4BOYA 5K0BA 5LIPA 4ZOQI 4ZO7A 3ZTYA 1TM4E 4WLFA 4IC9A 3UTCA 5C8YF 1SKRA 3F5FA 4KAFA 4DSOA 4CV1A 1NMEA 3S4YA 2CY0A 1I1HA 1Y6FA 1KDYA 4YMVA 4YJ2A 3CO5A 3DDCA 1Y7PA 3QY0A 2GRUA 3FZGA 1KOLA 2MMGA 3MMXA 4R83A 4RCZA 4RHCA 1MVLA 1TZJA 5FPPA 4YAWA 1Y37A 4E31A 5IAAA 3MHTA 2QD3A 1T3SA 3PNCA 1IY1A 1EFPB 3LIPA 1JRLA 4H7FA 2MTBA 1LDGA 3H2YA 5F3DA 8ICGA 3J81k 3S55A 3GVXA 1FRNA 4KQ2A 1KPGA 2ZI6A 3CU5A 1NFQA 3UK1A 3AI1A 2G67A 3EA5A 3SXUB 3RTCA 4HDNB 3PWZA 3KXDA 5IVPA 2A9KA 4MX8A 4V2IA 2WA1A 4BBJA 1WSBA 1A95A 1FRQA 3T1TA 3IVCA 2O06A 3OCZA 2EJWA 4KXNA 2VH2A 2MA1A 2DQZA 4GBED 4E2WA 1IH8A 1SXDA 2YIMA 2RBGA 1H85A 4FNGA 2Y9UA 2EP5A 3ZWOA 2VWHA 1KEKA 4E12A 5CGZA 1NW5A 3B1ZA 2BM1A 4RCVA 5KYTA 2J9XB 1RXUA 1EFRA 3C8ZA 4K03A 1L8AA 1GSOA 2FEPA 4FVTA 4Y1RA 2BP7B 2CCKA 3T5CA 5JNUA 4JGBA 1IQRA 1NUSA 4JB3A 2C5GA 3NVVA 1HQKA 5HF8A 5FBVB 2W8BB 2K8CB 3SS7X 2YFYA 1UA1A 3KQHA 3EXG1 3VX4A 1NT2A 4HEJA 5F3WB 1HEUA 2AMJA 4O5EA 3SZMA 5IKPA 4HS9A 3E6AA 2WYWA 5GOZA 3PR4A 2WD9A 1PT9A 4KH1A 1L8QA 2COEA 5EJ2A 5B57C 3FNGA 3P7MA 1L7AA 4DSFA 3GV7B 2GA9A 2I4NA 3HKEA 4ND4A 3W1VA 9ICAA 1QIMA 1JIJA 4P53A 4RZ2A 4B6PA 3L8ZA 2QUAA 3Q9SA 5E9WA 3DLHA 2VKQA 1YBAA 3X2EA 2CZGA 5CFOA 1OLXB 2I55A 4NHEA 2P77A 3OFND 1GD1O 3ZDRA 3S99A 3CSDA 2PCLA 4N4AA 4F0JA 2W37A 2CVFA 1XYGA 1JLMA 3D2CA 1AK2A 1W581 3S5JA 5TGZA 4DNQA 4QJBA 2HPZA 2V1XA 3BHJA 3RWBA 2H4ZA 4ZGWA 1XVTA 2Z7JA 1UWVA 5LC1A 2ORVA 3E1KA 4MVCA 4BVAA 1CCWA 3GYGA 4AJ4A 4QOIA 5DGTA 4DQUA 3ZDBA 1B76A 2FQQA 5JNTA 3HP7A 1LX6A 4LSGA 1NUUA 3PF8A 5EOZA 4DUZB 3LT5A 4BQPA 4DLGA 1HF3A 3CNHA 3CNBA 4LBZA 3A4YA 3D43A 3ZVLA 3KELA 2AV6A 1ZQLA 5AI5A 4UKDA 2NSHA 3U0VA 4GZ3A 4UB1A 3U7QB 2F64A 2GCOB 3BAZA 1OZAA 5KT3A 4KPYA 4KVZA 1GA6A 3AV0B 2R8IA 4A8JA 3VNVA 1ISRA 2EKZA 1SC3A 4HNQA 2G40A 1RXSA 3S68A 2ANBA 1E0DA 3QBDA 4FZJA 3LXRA 2WUFA 2PNFA 4OJQA 3RS8A 4ALLA 4AJ1A 1H9BA 2Y1IA 3B51X 3RS7A 1KW4A 1Y4DE 3UAZA 4OSOA 3DV0A 2QF7A 4BNXA 1OREA 1EVZA 1BGXT 2ZI5A 3FFXA 2XT6A 1CS0A 3RVKA 2ZYHA 2VDPB 4LJ4A 3VPXA 4DEYA 4HNUA 5B7PA 1OXJA 3BCHA 4L6CA 1M2GA 5HJEA 3DCIA 2CYAA 1Z4KA 4QLAA 3N74A 5AW2A 3UH1A 4D8VA 5A6SB 2XIJA 2C61A 2J0SA 3GV5B 821PA 3EXFA 5J4YA 3N07A 3KHGA 1Q11A 3HJBA 3IHLA 2FMIA 4X3PA 1XROA 5EIHA 4YV1A 1UIRA 3WGOA 4PICA 2IYFA 4LF5B 1QG0A 3PC8C 2EWVA 2AYXA 4NI5A 4MI6A 2HMTA 1UAYA 4F7WA 3P94A 3F9RA 5KFAA 4ND6A 3MINB 3FPEA 4LDQA 3UH0A 2UUOA 2YW2A 3KR9A 3GJ3A 1L3CA 4MROA 1ZNYA 1IJFA 1TK9A 4F5PA 4Y30A 2DQKA 3P5BA 3DOEA 1Q8KA 1JI7A 1D8YA 4WNCA 5HHIA 4K0KB 1E6KA 2SHKA 4I3FA 1R5NA 5E2AA 2J8ZA 1IHPA 4H7DA 1BRTA 4C7YA 4ZZ1A 4WEOA 2E4XA 7ABPA 2FSPA 1EHIA 1H0KA 4FLFA 5LBUA 3CVVA 4E51A 5B4VA 1JQDA 3HMQA 2CRXA 3ZZ1A 1Q5PA 1KFTA 5JSZB 2EQ5A 1R9GA 5EIOA 2DUMA 2D4AA 3VH4A 3R3ZA 5BP7A 3HZOA 2BKXA 1GG2A 2NUBA 3WGTA 3BGVA 4UB4A 3LSYA 3D3KA 3URKA 4Y2SA 2FFRA 2RCYA 2BR5A 4UE3S 4CLRA 2XUKA 3K0FB 3NDJA 5JS6A 2W6IA 3DZBA 4C7OA 1OU4A 3HNPA 4KLCA 3WG9A 1SB8A 2F6RA 2VDNB 4RSHA 3DW3X 1T43A 4MQBA 5CURA 2X3YA 4Z8XA 2Y2VA 3UJ3X 2IPNA 4QZBA 3TBFA 4C5AA 4PGXA 4A26A 2LDXA 3HRHA 3CRMA 2RBEA 1T94A 2BFFB 1J8FA 4DC9A 4CQJA 1U3FA 1JEYB 4M7RA 4WKBA 4BECA 4B6OA 4ONEA 2GF0A 3BCSA 1LLUA 3H75A 3P45A 1NE7A 1XEFA 2PZLA 4LW8A 3HB9A 1S0NA 2J3LA 2R6R1 5AT1A 3OE4A 1T5SA 1NLUA 5DNUA 3QFFA 4GT1A 4XKJA 1FPMA 2JLVA 2ZBDA 1A7JA 1S2IA 1QSYA 2EFHB 4M9CA 3QVJA 3KU1A 2W6NA 4D6YA 5HE9A 5J2IA 4B8WA 2KMLA 1BNCA 2AQIA 1NXXA 1PTJA 4EGCB 1SKUA 2X9LA 1NURA 2X4LA 3OZAA 3RH5A 5H70A 4DFDA 2QMYA 4MICA 3K71B 2Q3FA 1KYYA 1JB9A 3KLOA 2P9EA 5KEIA 2JFGA 1XZJA 1HOXA 1XIVA 4FEYA 3LFTA 4DARA 2JD0A 4QOGA 4YV7A 5DM4A 2AJBA 4BVGA 3TGWA 4XGIA 1KJYA 4HZUB 4LJSA 5HQ3A 2ANCA 3QM1A 4UUAA 4LXQA 3OO0A 2YYSA 5HKLA 3PU6A 3CVXA 2GBGA 2V7EA 2QARA 5BNWA 1S2DA 3S1AA 4GE0A 2FSFA 2IUUA 1QKKA 4P4SB 5CDFE 3Q0EA 2X8JA 4ZMSA 3S8MA 5I5EA 4IIDA 2HMAA 3WMGA 3GGSA 4QTZA 5F1KA 2AHOA 4P4GA 3E8MA 4L8LA 1W47A 2BRUC 3E70C 1JKMA 1U3WA 2FXIA 3EGOA 4KQFA 3DE6X 3AN1A 4YNBA 3MWEA 1UFVA 1S5LU 1J5PA 2RIPA 1G2IA 2AD1A 2P3LA 3FKSD 3BWBA 4M1SA 4RGYA 1UKBA 1GG5A 5SICE 5FDFA 4Y18A 3V1KA 3RC8A 2WDPA 8ICWA 5K20A 4C3ZA 1L1RA 5IEBA 2DY0A 1L5MA 2G5PA 1E7YA 1MX1A 1GNPA 4KLUA 1TRHA 4DXDA 2N47A 1KI2A 3K3PA 1OXXK 4O3PA 3T0FA 5BUZA 2CDCA 3WJ7A 4AKSA 3K0HA 1DT3A 2QP3A 1CR2A 2L19A 3GLIB 3V1NA 2QJRA 3LUHA 2H52A 2WTEA 1T1GA 1JI3A 2OZVA 2GVDC 1XMOB 4YGXB 1N0HA 2ZRDA 1XCMA 5J0PA 1VMKA 2P0AA 1Q46A 1NZDA 4LRXA 1HORA 2RGRA 4F5NA 1TYAE 3SHWA 1JYEA 4TVOA 4US8A 4B47A 2O8VA 3R3SA 4LDPA 1U4NA 1VJTA 1QYXA 2PLWA 2E4WA 5KOJB 4MR9A 2VUTA 3SVZA 1OFHA 1QH1B 1QTIA 5F64A 3VPDA 4MHTA 4IRUB 2OVFA 4XCVA 1P74A 3IS3A 4LJ6A 2JEFA 1G7SA 4X8LA 4OUDB 3M70A 4M36A 2R8RA 1DHRA 3FMGA 2RJ3A 4J94A 2W0SA 3MB8A 1A76A 3M6XA 2VHTA 2GJAA 4JLDA 1CFZA 2EW2A 4E7OA 3ZXIA 2I0FA 4WXRA 1UQTA 1JPVA 2C5EA 4PAQA 2DWPA 3NDRA 1UANA 2Q46A 4QPPA 1ITZA 4RK6A 5TF0A 2VXYA 3UXYA 5DMXA 4CF7A 5DBFA 3ESXA 3ZG6A 3MGCA 5BORA 1VSVA 2HRDA 1GR1A 1DC6A 2ZR0A 2IDKA 5EXPA 3QKRA 4UBJA 3VQTA 4HQ6A 5CHYA 2EEPA 3W5BA 1BN6A 1H2BA 3T5JA 2REBA 4OQDA 5JD4A 2D5CA 3F4LA 1NG1A 2PPVA 3E35A 4QWBA 3CUKA 5EHNA 4CKCB 4K2AA 2X9NA 3HDJA 1TIBA 1IOZA 2NXWA 5BNZA 2BJWA 2BZFA 3IDSA 4P0PA 1DL5A 1L7RA 3QTBA 4RPIA 3SBXA 1HK7A 1ZCAA 5G1OA 3P2KA 4DA8A 1C0KA 1USIA 4S24A 1OB2A 4TYQA 4J07A 5CA0F 2CLCX 4JC4A 1RYMA 5B6JA 5FOWA 3CR7A 4OD0A 2BGWA 2LYAA 4PH5A 3TRJA 1KERA 1EP3B 1VL6A 4PLPA 3KBOA 5CW2A 1IZ7A 2AZTA 1L7OA 4IH1A 2BTOA 5DSTA 1JHZA 4Q7QA 4N7JA 3MS7A 3F5MA 2B8EA 4UD6A 3HPRA 5KNDH 3LTNC 1G8GA 2NV6A 4KMOA 1ZGBA 3N7TA 3MMPA 1TEXA 5A2QA 1TTHA 4B9TA 2W9CA 6CHYA 4HAIA 4F4UA 1TVCA 1NKCA 4HX2A 3MB5A 1V95A 4UMFA 2OUIA 1XRRA 3PR1A 3CS3A 5LOVA 2GPJA 2QRJA 5KFZA 1S3IA 3PDCA 1YS7A 4EY6A 4Z1MD 3AEUB 2BGGA 4PGAA 4F71A 1I30A 3V97A 3F7TA 3ASVA 4QWAA 2DBZA 2RONA 4AL4A 3FZYA 3B12A 3STUA 3QKTA 1ZJNA 2EBFX 3JYHA 5CT8A 5FULA 3P96A 2EL7A 1ISGA 2BFBB 4R2LA 4ACBA 2IRWA 1C1XA 3S5UA 3AR5A 3TOXA 2BEWA 2AMVA 4IIJA 1OAOA 3J7AC 4M38A 1XEWY 4RMIA 3UK0A 3FIJA 1KDRA 1DIAA 3ETJA 5D6NA 2ZUSA 5JIBA 1VLZA 2WNHA 5TPWB 3PXUA 1K3UB 3Q8PB 2XYVA 3ZC3A 4AT1A 3CX7A 1O97C 2AZMA 5LKAA 3GEBA 5AW0A 3VVCA 4MUIA 1UFQA 5KIAA 1REQB 2FSUA 4ZVSA 3TINA 2FQYA 4C04A 3E23A 3UPUA 3QVKA 4D3ZA 3KSAC 1ZLXA 4OJ5A 2JJ1D 4OLJA 1T1JA 3DHVA 4GVXA 5JAUA 3ITEA 1XBTA 2PSHA 5ANRB 1XZNA 5E6UA 1AQ6A 3AIIA 4QEZA 2IP4A 4Q1AA 1BHO1 2EQYA 3L49A 1VJ0A 2YUTA 4IRMA 4WZBA 3WOHA 4DIFA 5ALLA 1F2UA 1GCIA 1T4DA 5BPHA 2IYLD 2H1OA 1KFDA 3VHXB 2A3NA 2VJPA 3WJAA 1SRQA 4J3FA 2GEDA 1JXLA 4KH0A 3V4RA 1CULC 5F35A 3WV5A 4HZIA 1MRNA 4OH7A 3K4GA 2IZ1A 5EAIA 4O5KA 2KTQA 3Q7RA 5DGAA 2JIOA 4Y0NA 2Q29A 2XWBF 3OQ6A 3NBQA 3IQXA 3G0OA 4L3WA 5JWOA 3ZGVA 3MSXA 4PYOA 1PUJA 1YIAA 1JAHA 1FIQA 2JANA 2ZXUA 4R6WA 2H8KA 4LY0A 4GEKA 3INYA 2RH8A 2FQ1A 5FWNA 3VVBA 1BA3A 5FJIA 3T5BA 4DT1A 1PJRA 2Q8QA 4RJLA 3VKFA 1BVSA 4HGQA 1O95C 3W1WA 4MK4A 3ZX5A 1JIIA 4B33A 3VNAA 4CMJA 4AS3A 1ZJ6A 2X13A 4MV1A 1KEJA 1XZPA 1JL3A 2ZAOA 1Z12A 1SZJG 4E2YA 1CTQA 1U4BA 1OGIA 4YAOA 2YWGA 3QW2A 4RQTA 5FV7A 1VE6A 1S77D 2VJDA 3B70A 4N82A 3G6KA 1ZHFA 3SKVA 3CF4G 4P7KA 5TQ2B 3I09A 4Q47A 3Q9LA 1MAVA 4RD3A 4C4XA 4B6EA 4P7JA 1WZUA 2QLMA 4TZKA 4HAOA 4G4JA 1PSWA 4RK7A 2ZT6A 1GQSA 5KFVA 1L8LA 4OHMA 2IY8A 3RJGA 2IEYA 4MINA 2J4DA 1SC1A 4QM6A 2MUTA 2B35A 3OZIA 4M9SA 1KBUA 1C7IA 4ER7A 1O2DA 3OQNA 1E1QA 4FMCB 2VTBA 4MW4A 4PX3A 4RTRA 4RMGA 3KEGA 2VP5A 3PQ7A 2ZUDA 1LKZA 1SU7A 3M3DA 2VAMA 3PMLA 1JXMA 1IRXA 1M34A 2LBPA 2OYRA 4D97A 1JN3A 3ICVA 5L4LA 5U4QA 2R65A 2QAGB 1U0RA 3OTGA 4FXOA 2PUGA 4NY1A 1CJCA 1OE0A 3NYRA 1VFPA 5M5BA 1CT9A 3BRSA 1YFKA 1AKTA 2XNDD 2WWXA 5TJ9A 4J16A 3ZEIA 1NR5A 2GM9A 1KH3A 5EQJB 3EUAA 5CXQA 4QTXA 2G04A 2PT5A 3GPCA 3KEOA 4JUAA 4ZK2A 1TLLA 4TTAA 1M2OB 4RA9A 2X5OA 3HLKA 3IMKA 2H7CA 1XKLA 4YXWD 1Z7WA 2ZE6A 4IHJF 5KHOC 1HG0A 3TM4A 2NRZA 2AGOA 3WLJA 3W90A 1XHLA 2ZIZA 3QUCA 4HEA1 4JWKA 4B6JA 4YCCA 3A26A 3QNMA 3H4IA 2AMFA 1WCV1 4GX2A 2VAPA 2HIGA 4DSJA 2J4CA 3ZWNA 4F96A 3C6YA 1KO4A 2XC9A 3HXMA 4BVBA 3ZWKA 2KJQA 5ALTA 1K7SN 3F53A 4BZQA 5IBCA 4W5NA 3QUAA 3HKDB 4ZI7B 2X2EA 2VKTA 2ATVA 2ZAYA 3OECA 2Z04A 3L1VA 4DWWA 1RYZA 2OLKA 1KAEA 2J0EA 4MYRA 5KBYA 1WHSA 4TT3D 1GADO 3W8DA 4Z4CA 1ICEA 4CEHA 3GEIA 3N2NA 3TAHA 2WB2A 4DLNA 2OAQ1 2O5RA 1QR6A 3D6TB 1N4AA 4RLQA 4RD1A 4IQ4A 2W2XA 2QD4A 2XTJA 1E9RA 4WD3A 3KHTA 2M1XA 2NUPB 4DY6A 5KQPA 4A6EA 5A5GA 3PA6A 5LQNA 4YJDA 2O14A 1L5KA 4M9LA 3QWHA 3WYNA 3F9IA 4WCFB 2FUKA 3UC5A 2WA2A 5CDGA 1FP2A 1LWNA 2VBIA 4DSZA 4MRPA 4DQ0A 4ON9A 1LJ8A 8ICCA 4BMSA 1E2NA 4FD2A 4MWCA 2E1EA 3MLAA 3N0XA 3KDAA 3UFXB 1PZMA 2ZWOA 4FHZA 4S1TA 5AHWA 4CU5A 1RYHA 2G6TA 5JH7F 3E9EA 2PSFA 3RVPA 1M6VB 2DKOA 3LXMA 2HDOA 4EY8A 1XCOA 1L0BA 3UAGA 2A9FA 2DRIA 3S2UA 2N1BA 5COBA 1O6GA 1G21E 1XD2A 3L4BA 2OE2A 4UBMA 4A6XA 2NU8B 3BGIA 3ZKAA 1S8OA 2BPOA 4HAXA 3IBFA 2XGMA 4JLUA 2ZIGA 2GF2A 1SV0C 1P5ZB 1PD0A 3FYTA 2HHXA 1MV8A 3D0OA 4IEFB 5MFZA 4CMCA 4XR4A 3SDBA 1D1TA 1W4CA 5L3SB 1ZGCA 2PEZA 4P3YA 4HEHA 2C7RA 3ZI0A 3WLKX 2PUFA 2I76A 1V5EA 1C30A 2ZT7A 4XOUA 4GYKA 1KIFA 1XVIA 4BRUA 1E61A 1CUXA 3JRNA 4KPFC 1O6ZA 1KXJA 4W5WA 4AKHA 2VHJA 1UDAA 4L4RA 3KO8A 5KNCH 1QDEA 2ZDQA 3R20A 2VHWA 4ZC1A 5DHFA 3B1KA 3F6CA 3IMEA 3OE1A 4IQ8A 3T3IA 5KQSA 2BPCA 4UTOA 3T95A 3JQBA 5GJCA 4UB8U 2PQ6A 3FSJX 3IBSA 3UJHA 2VPTA 1DWPA 2W2MA 4B3SB 1OX4B 3FTPA 1U8CB 1VCOA 2NTJA 4CQLB 3UMVA 1Z06A 1C1DB 4WXPA 3F71A 1Z8NA 4I4CA 1J2NA 3TUJC 3QJGA 5EWLB 2RH9B 3SQMA 3B3QA 4MDFA 4HB0A 3A58B 1VXOA 2W71A 3DVQX 4JJ4A 2G5CA 5J0WA 7ICMA 2CT8A 1DZ3A 4U5XA 4C6TA 1DDOA 3JYPA 2D74A 4BZZA 1O5TA 3KUXA 2X8BA 1S9DA 3D2NA 2FR8C 3P32A 3LKVA 3O94A 2GF9A 1IQ0A 3MPUA 3KJNA 2ENUA 5AMXA 4GD3Q 4QUEA 3LNTA 3IPAA 1I1NA 3AEKA 1EIZA 3LDUA 2G82A 5DGIA 4RQ8A 4B2LA 1FS6A 5B3LA 3B89A 5EY5B 1T13A 5C0OE 4XWAA 2VUHB 4KGVA 2X0DA 2XI4A 5AVJA 2EJCA 1QUFA 4W7HA 1BHQ1 1F8FA 4OA8A 4M0KA 1R4MB 2RKWA 1A6SA 4G9EA 3P4YA 4FFOA 2C99A 1UMKA 5GTHU 1YZQA 3IEPA 2R00C 3AI7A 4J1NA 2HJSA 3IJ5A 2FPGB 2D1FA 5BSUA 4Q3AA 3IAFA 1LW6E 1OFUX 3K9HA 4RLHA 1PZEA 3PTLA 1NK6A 3F2DA 4L5IA 3RBDA 2V5VA 3CBGA 1VYTA 3AKCA 4Y9RA 2AYZA 3L4PA 3OC0A 3OKAA 5EQDA 2GS9A 4ED1A 4JUDX 2W43A 1BXGB 1XLUA 5CEJA 3TQ1A 4R1PA 1M2VB 4DPMA 1C3LA 1G3RA 3N8HA 1JIQA 2YC4C 1WXEA 3FCEA 7MDHA 1F60A 1BS2A 4KG7A 3DLPX 3UBTA 1QC5B 3JQAD 1YR6A 1YDHA 2ZS7A 3UAWA 5LLTA 1FLAA 2QLNA 3E9CA 2PLFA 4O0MA 1GAWA 4GOXA 9ICRA 1QIEA 1V47A 4U9UA 1TKBA 4XYMA 4QZAA 3FCUB 5GQSA 2ZETA 4Y3UA 3VU8A 4MPTA 3DMRA 3EPRA 3BD8A 2QY9A 1Y6GA 2IIPA 1GUYA 3RS3A 3OEWA 4PRZA 2A3VA 3MRSA 5EEHA 3H87A 1H1LB 3FWHA 3KKKA 2VPYA 1J8MF 2YASA 4MV4A 3TQTA 4QZDA 4IDDA 3WB0A 1CD5A 1RWOA 1SJ9A 4RABA 5JS7A 3U4HA 5KTRA 4FC6A 1GGHA 3AU9A 3RTDA 1NK4A 3HHEA 2KN7A 2RGCA 3P2EA 2L18A 4DQPA 4NE2A 1IPEA 1S0VA 5KG0A 4JLBA 1K7EB 4XIJA 4PINA 3IUPA 2JK0A 4DOCA 2H08A 3IIEA 5B3JA 1AKMA 4UE6A 3R3WA 1AOXA 2QRLA 1YOBA 4B46A 4CF3A 2NRXA 4R4JA 3NCTA 1XEXB 4OYYA 1IQUA 1ZM2A 4BFVA 3ETGA 4HDMA 4LZNA 2UZ0A 3VOAA 4Q7MB 1AHNA 2OCIA 3PDJA 3K9NA 1TT5A 2HQBA 2QNBA 1GZ4A 3TLGB 1JFVA 2WIGA 1HYGA 1UFOA 2DBRA 4MKRA 2IBTA 1BX1A 5CM8B 3AHDA 2HRQA 1XPRA 2WU8A 4KN9S 3CM0A 4DQRA 3V8BA 1GTZA 4B3IA 3QE0A 4D99A 2IX9A 3K96A 3NM6B 4I1YA 3LW8A 1KXZA 1FNCA 4B3GA 2Z8XA 4UU7A 3H9UA 3E3LA 4B4VA 1EBUA 3C6XA 2VDKB 2YUIA 5C52B 1V8FA 3VKUA 1SOMA 2I78A 3FVTA 2PD4A 4C4PA 5JJBA 3P9XA 1ZNXA 3DDSA 4HN4B 3HT3A 3U1VA 2GOLA 2QPOA 4BGVA 4GL4A 1A9PA 2JEZA 5BVGB 4DZRA 2ZQYA 2Y9MB 5DWDA 2IV7A 3A6JA 2P7HA 5KNDA 2FW6A 2EW1A 3ZU2A 4DQDA 3DPIA 4TRNA 2BEUB 5UKDA 1SY7A 4EG4A 1UBRS 4A8HA 4JT9A 1ATIA 4QKQA 4B2IA 1H8ED 4JBWA 1ECJA 5IX8A 1R0BA 3TNYA 5ABPA 1COOA 2FKAA 3L0CA 3T7RA 4L28A 4N0DA 3RJJA 1CNEA 3C6KA 4Q9DA 3UPQA 4IHQA 4YMTA 4F6CA 4W8HA 1K6MA 3ENWA 2GZHA 4H6VA 3A0BU 4KLDA 4BNYA 3UMSA 3F9CA 3QWAA 4K9SA 4M9QA 2DZDA 4QVIA 1R0WA 4O2LA 1GRCA 8MHTA 3BZKA 4F1WA 1BQ3A 4B0OA 1JXEA 3C1OA 3QELA 1H69A 3TSZA 3C87A 4KX3A 1DKMA 4BB0A 3HVRA 4OJNA 5HE8A 5I9MA 5JFTA 4XIIA 3MTDA 5CW1A 5IYZA 4DXHA 2Q50A 1Y7LA 4H1VA 1VJCA 4K88A 4LXIA 3DDOA 4IMPA 4XB6B 4Q43A 2Z4SA 1GNLA 3VU9A 1QYDA 1CYDA 4LJXA 4KV7A 4L9SA 4PLCA 1E77A 5CJ7A 2WMNB 3FI9A 2IU4A 4KLSA 2DTDA 2AE2A 1BQ4A 5AOVA 3L06A 4NAUA 3O03A 5CPBA 2BH9A 1QGUA 3U3RA 2CD7A 4LC9A 5H1YA 5DIZA 5BQXA 3ML1A 5FI0B 1P8AA 2IPLA 1X7XA 1CB0A 3UYKA 4DLWA 3G2JA 3WYDA 5E0KB 1TCBA 4RPYA 1ZGJA 5K0EA 3U4MA 3UUFA 1ZIDA 2D59A 3WFIA 3BF7A 2PMFA 3VU0A 4IKOA 4XSVA 3QLVC 4CLOA 2WLSA 2F3UA 3IP6A 4HD8A 2PWYA 4D02A 2R0QC 1T7PA 3FTNA 3GO4A 1GGNA 4DZZA 5D3MB 2OCBA 2IW3A 3D8SA 2PCJA 1PYDA 2DWUA 1EX1A 1R6UA 5DW0A 3BRCA 1Z2NX 1KYQA 3VKGA 4WOPA 2QTNA 4IY1A 5KVQA 4DE5A 3B2QA 3PRHA 4FFBB 1G5RA 3GGGA 2I9PA 4M0FA 1J2RA 3RK1A 1K7YA 3IDOA 1KGSA 1EVLA 5FFMA 4OA5A 4AWBA 3NHMA 4JR2A 2XCAA 4JV2A 1Z47A 3VISA 1GXSA 2Q6LA 1Q0PA 1IPHA 4IQWA 4WMLA 5B1YA 1B8NA 1Q3UA 3EN0A 3UW3A 2OGTA 3GBPA 3BIXA 4O4IA 4N5LA 3CSUA 3UAOA 1HDOA 4ROTA 4AJKA 5H2FU 3OKFA 5JDIC 2E4ZA 3BK1A 2ZVJA 2ZYWX 4JJ6A 1DIHA 2GCNA 4YAKA 4EJ2A 2VI5A 4PYKA 2YJ4A 4WOBA 7ICOA 1KS2A 3KTQA 4WK4B 3C98A 2PFNA 5B1HA 3UMYA 3LY9A 3N8KA 3P0RA 3RF9A 4B74A 3STHA 3NCHA 4PPFA 3Q7QA 3RIEA 5IMBA 2PMZC 3GAZA 4CBVA 3N0WA 2WNSA 5L3QA 4II7A 2I3AA 4EJ0A 3QF4A 1ZVQA 1A4XA 1U3DA 3RCBA 2G9RA 3WNBA 2YYZA 5KNIA 1ZQAA 2KKPA 1WM1A 1ESNA 1AO0A 1HE3A 4KFRA 2GK4A 5TJHA 1U99A 3HJFA 1KY5A 2CSUA 2P8SA 2WKQA 7REQB 1BXRB 3GJ6A 3GY0A 4DCCA 2HC9A 2H7VA 2JGNA 2H7XA 2EWWA 1VIMA 5FB3A 3VBCA 4BVFA 3K09C 3DGEC 2C2YA 5TY0A 3S7TA 2Z3WA 4XA8A 2FZKA 1EFCA 1RM5A 1RWNA 5GM1A 2ISCA 1WSAA 4P82A 4ZAFA 5DDYA 4M60A 1DKRA 3SX0A 1YR9A 4UUNA 5FOUA 2FWPA 1QLHA 3ITKA 5AHRA 3F7MA 3SU8A 4PGYA 2I62A 5DN6D 3OQMA 1MC8A 1M3SA 5EE9A 1E9AA 2ZI3A 1HE8B 2WJGA 1VG0B 3V7FA 2ALZA 3CUTA 1G21B 2R68A 1N6LA 2O7SA 1UM9B 3S2EA 2FKNA 2POQX 1WF6A 3ORFA 3EZ5A 4BGDA 3F1KA 4FP9A 4MV9A 2B7BA 1G8FA 1DKPA 1YS4A 2A9OA 4LK3A 5BR1A 5DYIA 4ACOA 3DNMA 3HQ4O 1B8UA 4DMFA 4TTIA 3V6HA 4DJFC 3HM2A 3AW9A 2I6UA 4D6XA 5H02A 1QNLA 3DE4X 4E3WA 3PWKA 3WBJA 3DO5A 3GGPA 4FW8A 3UNXA 2H2FA 3SLGA 4J3NA 1XZFA 5LP1A 5DM70 3RHTA 1VHTA 3IT2A 3O8NA 3VJLA 1QB7A 2Z57A 3V7KA 4KTTE 4XM1A 4HYKA 1URJA 1QP0A 3ABZA 2X5KO 1RM6C 2B4RO 3SICE 4XASA 4R05A 4RESA 1XRQA 1MN6A 4XXHA 1V8PA 3UF0A 3MOIA 2DSNA 5DRTA 4C7KA 3DNPA 1EGMB 2V59A 4U7DA 1LS1A 2EATA 4JLVA 3DZJA 1Z22A 2ECPA 5C5DA 3NHWA 2IVZA 1F4LA 4W8OA 4HT3B 2GKOA 1HUZA 3W9SA 3X1XA 3KQVA 4UVDA 4A7PA 1BEEA 5DNEA 4Q03A 1KORA 4GICA 2G5IB 3DA8A 1J06A 1AO3A 1CRXA 2JGDB 1ZH2A 1DKNA 1XTJA 2IL1A 2SICE 4PTYA 1NOIA 2Q07A 3O3NB 1H0RA 4N8DA 3JTMA 4QZFA 1RI1A 3ADBA 4Q3LA 1U9JA 2H6EA 2HXGA 3A11A 3HN2A 4KLJA 4PYIA 2IF2A 2REQA 1ES9A 5FQOA 4NYIR 4AJ9A 4V3CA 4Q24A 1Z7YA 3QMVA 4YJ3B 2QTWB 4HAZA 1NQTA 3CV3A 3H7AA 2Q3LA 4HR7A 4K3VA 4W6QA 1J7KA 3A6LA 4PNZA 2JFQA 2W83A 1B15A 5DGXA 3HFGA 3WLEA 4J1TA 4ZHQA 1E1LA 5ALIA 3ET4A 2JFVA 2JPDA 1NQXA 3QNWA 2OCAA 3AETA 5DG9A 2WIAA 5KNCA 2GXQA 3GGCA 1WPXA 5TE9A 1YIOA 1FEZA 2P91A 4HNTA 2PFKA 4CM4A 3AKDA 1Q74A 4Q21A 4JJAA 4Z5XA 4F3OA 4UM9B 2B9EA 3DEKA 5E95A 3B5JA 4XUCA 1AH2A 1AA9A 2F44A 1YBHA 4ZCLA 1IVSA 4V0OA 3CXRA 2LNDA 1PEYA 2IP2A 3IHKA 2R751 2HNBA 4QZEA 5DM60 4BLUA 5IKOA 5I4IA 2IHZA 2XUZA 1PL0A 2OCGA 3OJ0A 3QVTA 5FOXA 3V3TA 4J0JA 3SIXA 4PZPA 3ZPXA 2FCRA 3SCZA 3AXSA 1V3QE 2NQ2C 4UM7A 1SRRA 5EJ7A 4JMPA 2QZ9A 2HLNA 3QBEA 1B6RA 1THZA 5AESA 3DT8A 4QYIA 3QVOA 1BVUA 1Y9JA 3IE2A 2FW8A 5T6MA 4IILA 3QU2A 4HQFA 1V37A 1T29A 2ATCA 1VECA 3RC2A 3B6IA 1ZQIA 3H97A 4AYTA 3O75A 1Y3AA 1P2TA 3THYA 5DNDA 4C2BA 3ZGNA 4QIWC 1NXOA 3DOHA 2PH1A 4LE2A 5HGJA 1NOMA 2HPAA 4EATA 4NLCA 1ODLA 4B7ZA 2AFHE 1IK6A 3BHMA 2SCUB 5AVUA 5BNFA 3PSFA 3R8CA 1U7UA 1YFLA 3AFMA 1B2RA 1VGVA 1EWQA 1NNSA 5IFLA 4BO8A 3M4JA 4ECWA 4CIBA 1NNEA 4YN3A 4K6GA 1ONPA 1FDUA 2ERXA 5SY4A 2BJHA 3G1WA 1RHUA 2XVTA 1PV2A 1MMFB 3JQGA 3WK8A 2K6GA 2JLYA 2WFAA 1NVAA 2JLWA 1CQIA 3GEPA 3DZHA 3RUCA 3MRXA 1WUJS 2GVZC 4NPAA 4U2GA 3KHUA 2R97A 4MXDA 1I2CA 2HJVA 2Y6VA 4F2GA 2IH4A 4OU5A 4BNNA 1CIVA 4IWXA 5ALPA 3D1JA 3H1AA 1PR4A 2BTQB 4Q3NA 4TRRA 1DJLA 3ZW7A 3TFQA 3NM4A 4TURA 1ABEA 5FP0A 2YVKA 2JLSA 2ZRGA 2ZBRA 1EDZA 1QIIA 2KIVA 5LJLA 3RYCB 3CUVA 2KZMA 4L4UA 3C16C 3PR3A 4ZVKA 2AN1A 4BVLA 2I99A 4AMVA 1ZITA 3VHLB 2A1AA 1N56A 4HLNA 5CIQA 4KQHA 3LWBA 2QYHA 1MCZA 4EYOA 4J7CA 2WSYB 4IOMA 3I9V6 3OIGA 3TTXA 3R23A 1XXLA 4N40A 3DEJA 4LGYA 1NZPA 1PDVA 3MMZA 4MVJP 4WOKA 5AI8A 1Y1SA 3HCWA 2ZK7A 4MS4A 7ICNA 3PRJA 3DG9A 3I2IA 3A3NA 1PNQA 1J7JA 4FT2A 5J2UB 4AX4A 3H5LA 3W4JA 3KYJB 1W4RA 2YWRA 1ORTA 3E9MA 5FA5A 1E4OA 5DGDA 2P2CA 1IZYA 3RAXA 1RKUA 4ZHSA 1BE6A 5B30A 3AJ8A 2C54A 3N1UA 1BNPA 2JAQA 1GL9B 4OUKX 2W6PA 2FEKA 4JL5A 4RD2A 5AHOA 1RCTE 1WQ4A 2PT9A 1U6JA 2CXXA 4PBRA 1KDTA 4XQ0A 2FRVA 5LQKA 3GU3A 4ED6A 1T5HX 2H4XA 4FEGA 1D0SA 1E98A 4EHBA 5TR9A 2O23A 2D2XA 4XCXA 2PH7A 3NWBA 3LH5A 1RYFA 4YBRA 3ZS9A 1BWRA 2G7ZA 4B9NA 1CJUC 1D3AA 2FSGA 4XH9B 3HWX1 3KQMA 4Q3CA 4YDRA 1XTZA 1BYUA 1UP4A 2Z4RA 3E7PA 5IAEA 2NT3A 2QS9A 1WCXA 5IC6A 4QNNA 3S40A 5TGTA 3DFZA 5KO2A 3U5TA 3PNQA 5K8UA 1ZOIA 3JZAA 3BRWD 5ILQA 1UBGA 3NW9A 1JNXX 4QELA 4YRLA 3OEED 3T7CA 4H59A 3BMOB 2H59A 3BIFA 3CKYA 1CY1A 4LHXA 4EVRA 3AR3A 3R3JA 3DQPA 1W7AA 3K8ZA 1YO6A 4FFSA 4NCHA 5ITVA 1SU4A 4KI7A 4ILEA 1CVRA 4RQ7A 3K6SA 3THWA 4C7ZA 3H5RA 1NQVA 3QJYA 4BO3A 1OILA 3DQQA 3EDRA 3IV7A 4MP6A 3FNQA 3LNCA 4Z6DA 1DKUA 1U5CA 1YRYE 4HWKA 5LQUA 3CIFA 1Z56C 1KAOA 3O8LA 4XVRA 1Z5WA 4PJ0U 5TRTA 1QJ4A 3RR8A 3ISJA 3BMNA 4TQSA 1Z29A 4LHZA 5T64A 1UA0A 4PZLA 3VH2A 3MUFA 4FOTA 1ZQFA 3CUWA 2CFOA 3BORA 4N6OA 3N2KB 2DGDA 2V54A 1ZU4A 4DZTA 2ZYUX 2JLQA 3WLTA 3HEBA 4DCOA 4CL3A 2HKIA 3ST7A 1YCHA 3GVHA 4TXJA 3NIFB 2O8EA 3E5HA 1ZI9A 1AUPA 1QX4A 1RPAA 3NANA 4RY0A 3OTOB 3ZNPA 1DUIA 2J5BA 3EAGA 2GERA 2ZYTX 1CJMA 4Z4IA 4O25A 2C78A 2FN9A 5DB4A 4ZGGA 2BHLA 5C1BA 2FPOA 2UKDA 1XD8A 4CQMB 5DBCA 1TCAA 1YH3A 5J23A 3H1BA 4CNQA 5AQ1A 2WE7A 3EWNA 2V7BA 4HYEA 3H8VA 2C22A 5K3DA 4MO2A 3IURA 2V9PA 2LCQA 2FFQA 1EG2A 4JCOA 4GLXA 4HH3C 3UXEA 2GPAA 1G3UA 2AQKA 5FPTA 2ZUTA 1Z1VA 1X74A 1NYTA 4XUGB 4IXTA 3QVUA 4TMFA 2PQMA 3EGCA 4R7GA 4YRMA 1A72A 4DJDC 4QTTB 2D0IA 1WMEA 4G89A 3VC8A 4BYMA 4B6FA 1X9MA 2OHIA 4EKDA 1FFYA 2ASVA 4J6EA 4KPGA 4FHCA 4H17A 3IVMA 1Z4JA 1NMZA 4LRTB 4IF6A 2K60A 2I2AA 4CM8B 2FPSA 3Q85A 2WSSD 3FKJA 1RKBA 1H6BA 1QDUA 1NW4A 3H5VA 1G2OA 2CXRA 3KXKA 2C4HA 1P7DA 1JDSA 5JVDF 1JTEA 3C3EA 4JMUA 3JAKB 4MMXB 1WD7A 3OQHA 4ALIA 3NWPA 2XV1A 1Z4OA 2P9FA 1KS9A 4F8JA 2ICAA 2CVOA 3MAGA 3KZ1E 3ABQB 1JG6A 4WNAB 4Y6RA 2KV2A 1LBTA 4CMGA 3OG9A 1XQWA 3QEOA 2QBYB 1NXPA 4FSDA 5JSYA 2VYCA 4JELA 1JRPA 2PGOA 1YMQA 4L95C 4JXXA 2H1RA 2BCGY 3IP3A 4DJTA 1K75A 3LYAA 4N1AA 4JI6B 1ZSVA 1RRVA 3IT0A 4L1KA 2GCPA 1IN4A 2QDKA 5T14A 4D74A 4CEIB 2PYZA 3WWEA 4C80A 3EDYA 3IUNA 4C22A 3RC9A 4KKVA 4YXJA 5HTOA 1CRLA 1KE2A 4OU4A 4DJ5X 2V6FA 1WWUA 2PRZA 4WA7A 4UEJA 1N63A 3LOQA 1JT2A 1TPZA 2LPMA 1UXGA 4AJOA 2ZIXA 1M1YE 3VH1A 3GGJA 1J90A 1W30A 4JMLA 2NSJA 4E15A 2I71A 4HVCA 4HDCA 1U2EA 4M37A 3MABA 3MWKA 4A16A 2XYQA 1X80B 3DLAA 1HX7A 1LDYA 3PQ4A 3HBAA 2QRMA 2IYVA 1X6IA 1XU7A 3OLCX 4ED9A 3EEIA 3QQ5A 3TFOA 3C41J 5J4LA 3FOWA 2FZ5A 1XYVA 3G9ZA 3QWIA 4MVJM 7ICGA 3T9AA 1Z4IA 4ARVA 2X9QA 5IIJA 5KTSA 2DFLA 4DFMA 4X54A 3WNCA 1AUVA 4GOLD 3RVDA 1J2TA 5IW8A 4FDLA 1PQYA 4F9EA 4YJHA 3MJCA 1QVVA 4PZ9A 4TWAA 1GPJA 1U4OA 4UUBA 5KYGA 4F38A 5KFEA 1MOSA 1KVUA 4HJXA 5EKDA 3VO1A 3EXIA 4RH0A 1YE5A 3EEYA 3WLFA 3SYRA 3BB1A 4MJ3A 3TZEA 2DJ5A 2Q3DA 3V4PB 1X9WA 1USVA 1QHGA 2DFVA 5EJFA 2Z6QA 4WESB 4CR6A 4EMSA 1V1MA 4R1UA 2E8NA 3LGAA 3L2OB 4CTNA 4GBJA 5IAGA 3M6KA 1UEXC 4J2OA 1JU9A 4LY3A 1FYEA 4EY7A 3P97A 1RJWA 1JJAA 5DJ5A 3HN7A 4DMUB 3GLHE 1SPXA 4FYKA 3GV8B 2CNLA 1R0KA 5JMWA 4Q66C 4C7XA 3UQ0A 2A35A 1XNHA 3FC4A 4KIJA 2PMBA 4P84A 1C20A 1TVKB 3PJDA 4NQZA 4CCYB 1O96B 5BYKA 2Q2NA 1Z4PX 5EZYB 1QU2A 3DKIA 3SXPA 3HP6A 1JLRA 3BQNB 1G19A 1SULA 1T1RA 4RFSA 3UICA 3JV7A 3O82A 3DE5X 3SIRA 1OI4A 1CBUA 2E2WA 3RSGA 3PUWA 5CNJA 5EHQA 4ZRMA 4FBUA 2WTFA 4X7BA 1C3XA 3PE6A 1MB2A 4WXEA 4GLBA 1U0EA 1L8OA 4PR0A 4CR7A 3G9XA 5DBAA 1Z37A 3SNHA 2EIHA 1CY0A 3FCAA 3FTQA 3C28A 3TPFA 1XDZA 2BE9A 2ZUUA 3VMFA 3PR5B 4O2BF 2DHCA 4JVNA 4XARA 4ENVA 4YO8A 3BN3A 5BN3B 4F86A 3W77A 4O4LB 2PRJA 4IJMA 5AM0A 1YDFA 1BU5A 1WVMA 4P80A 2GESA 4OX9B 4D8UA 3GCWA 2KWIA 3FROA 1P1JA 4FHFA 1PP4A 1KP9A 1IB0A 3C5HA 5K3CA 4HWOA 9ICIA 3V8QA 1EFUA 1Z4QA 3D6NB 3TARA 3UT5B 4JA2A 3O31A 1PW5A 2YFQA 3N7RC 2C0CA 1B3RA 5K8CA 1Y8RB 4Q12A 4PZUA 3OU6A 3C24A 3GRCA 4DL4A 1N2EA 5AM3A 3MAAC 4RJJA 3H65A 3GUZA 2R9VA 4IL5A 3NMUF 1DGSA 2W7PA 2W58A 2DQNB 4WGGA 3A6KA 2O8FA 1QONA 1SZPA 2AN5A 4YAIA 3ANTA 3V7LA 4KR7A 3HP1A 2YMQA 3FKQA 2UZ3A 1Z0JA 4FIDA 1SV4A 5CB4B 4BKRA 1TW2A 4JSRA 4Y2QA 5I9BA 1CX9B 2C2XA 3NWJA 2UYQA 4HFMA 3RABA 5EVCA 3WQRA 1NJ1A 2VRNA 1IXRA 5IILA 1SCKA 2FCAA 3EZLA 5TV2A 4DR6B 3LAWA 2GXUA 3AM3A 2H2DA 2EF1A 3WISA 5F7JA 4PBTA 2OBLA 1KZ1A 2D3WA 1GUBA 5KT4A 2WRZA 2AOXA 4WJKB 3AY7A 2C4UA 1EXMA 2W6JD 4Z6FA 3TGPA 1O58A 2BQ3A 2PDAA 2AFHB 4QAQA 3RR2A 4BHTA 2F17A 3EPKA 1N2GA 5DYGA 3S70A 1RPNA 4COOA 4CF4A 4AD8A 1Y8CA 1QKIA 3V1YA 3PFGA 1D6SA 1UOEA 1CSEE 1EYZA 4ZYTA 3GQBA 2RI1A 2L82A 3N2YA 2H5XA 2AGQA 1UMCB 4R1LA 4BQNA 4CL2A 3MYYA 1GZSA 2IT1A 1YA6A 1YB4A 5KDOA 3W5SA 4YMHA 1MJGA 3IR7A 3KQOA 2F9MA 4IIVA 1Q7EA 1ZRNA 3KT3A 1QKJA 2WYHA 4UOQA 3T5MA 3W2GA 1ZAKA 4YCJA 4ZJZA 1IB6A 3LWNA 1OWOA 1NUAA 3A6ZA 1GDTA 1S9HA 2R1TA 1UBNA 5KG5A 3QE9Y 1VLQA 1L1EA 2TYSB 5DG8A 5DTEA 1SVKA 1Z26A 5AVXA 2C9ZA 3DHWC 2BIFA 3PKZA 5J2HA 3TR6A 4NMWA 5KCZA 1A0OA 1AMOA 3MDAA 2FSSA 1T0IA 4LHSA 4WE3A 1CHNA 3GFFA 4WVLA 4EENA 4ZZIA 3L7CA 3EBOA 4XWWA 2ZSIA 4H6XA 2C2OA 3QUBA 1NUPA 1Y4SA 3C3AA 2NZ8A 4L4SA 2Y99A 4QEDA 1QCDA 3WYEA 1R0RE 4LOAA 1SOWA 4ETMA 4IDFA 3CLRC 1ZW1A 4H0NA 1O6FA 4IQFA 1WXXA 3D6AA 3HBLA 5E1DA 4LBYA 4QICA 4D42A 4QU9A 4GPZA 2F1RA 4NAVA 2F2TA 2NV2B 1KOFA 4X85A 1K5DA 2PMKA 2NQ8A 5JAMA 1CZOA 4JGGA 4BVJA 4DQSA 1T26A 5JCOA 5CAEA 5FTNA 5K51A 3M5PA 3KOYA 3UT6A 2YV5A 4R84A 3RO7A 2HYIC 3RBVA 3WWYA 1SBQA 3WS7A 1U90A 1QOZA 1UPCA 3K1TA 1AGNA 3H05A 2PNJA 5TLSA 1LLFA 1T2CA 5DE3A 4IOJA 1WEHA 4Q4AB 6PFKA 3IPRA 3M9WA 3LWLA 1O97D 3GFKB 4MS3B 5C7OO 2Y1KA 3HUEA 1JFSA 3KEQA 4P81A 1XYYA 3GN1A 1ZFNA 3VJMA 5AKEA 4X63A 5C8YA 3E3NA 3KZIU 1RZUA 3I9JA 3CRQA 4BJ3A 1SIWA 2XVAA 2JVJA 2BM8A 3GLTA 3D8RA 2NU7B 3TFSA 1T9ZA 1AURA 1E1RD 3BC1A 2HSEA 3F6SA 4M1QA 4GZMA 3R7NA 5E6RB 1VMEA 4JBIA 1TMOA 1T91A 2JGLA 1S0OA 3ROTA 3W7AA 4C0KA 1WR8A 3CUYA 3R3VA 2NOAA 3NP7A 4DV5B 3IEKA 4CVNA 4Z0HO 1CQJB 1HPLA 2OLJA 1G7CA 3F8TA 4IJWA 5AOCA 1XSNA 1GYPA 2F43A 3GDGA 3NDPA 4RQBA 1LDEA 1XZAA 1VJRA 3G17A 4I2BA 4X61A 4MUHA 2A9VA 2AR0A 4N8SA 3JQQA 4JK3A 1JDUA 2Y1CA 2KQUA 3WBKA 3NNNA 3INGA 3GC6A 3KNZA 2FWBA 2CJPA 1NJGA 2OG1A 5IJXA 1I2DA 4TLBA 3NV7A 2CL7X 1K06A 4FE3A 1XMIA 2E6KA 4R6XA 2EQAA 3K9CA 5AHXA 1ANKA 5I9LA 3RG2A 3DTNA 3EPHA 1U3UA 3GA7A 4PZCA 4EGFA 2Q5QA 3A3OA 1Y9AA 3H16A 1PUIA 2XGSA 2EBWA 2WOJA 1O95D 3AUYA 3Q88A 3F0TA 3LUGA 4KR0A 1EVJA 1XMXA 3PQCA 3CNQS 3FSGA 1MT0A 5KDLA 4UAUA 3LXUX 3PI7A 1MVNA 5CLFA 3WMEA 1Q19A 4PHFA 5JTTA 3G79A 2UVDA 4KU4A 4JV1A 4I9UA 3RJ5A 1DCTA 3OD1A 3AGPA 3BJYA 4V0QA 2IX3A 1TUBA 2I1VB 1XTSA 4BKMA 4D9BA 4JSTA 1ECCA 2QY6A 4LE1A 3G2NA 4EPRA 2QL9A 4CTKA 4LNHA 3WRYA 5TB5A 3ZH9B 2PS9A 3I61A 4YLEA 1V11B 4TMKA 1Z45A 4C07A 5HMLA 3W5VA 1WBBA 2ZJ2A 4KXVA 5JZSA 1RI3A 1C41A 3EFEA 2FWRA 3BH7A 4ND8A 1PK8A 3N7AA 4MLPA 1RQPA 4I46A 2ZDHA 2F1JA 3O95A 3B7GA 3ROMA 1ODCA 1ENZA 3AUUA 1IUKA 5DCWA 3ZDFA 1ISHA 3LGSA 1EAMA 1N2CA 1QVAA 4Q9AA 4YMUA 1URPA 3HMKA 2CDNA 2KI5A 3HYTA 3RUFA 1QS0B 2RFLA 3FCXA 3NO4A 1D09A 3HC7A 2WJWA 4DOMA 3EIUA 2ODWA 3KHKA 4R1OA 1E59A 3H2BA 4YG2A 3LUJA 4TUQA 1D9XA 4DLVA 4YASA 1U9LA 2ZJ5A 2GN2A 4RZXA 3B13B 3HDQA 4QDUA 3MIIA 2DERA 1QPGA 4J43A 4Q4CA 4HDKB 1FUEA 1QH8B 3ROQA 4O6VA 2F9FA 4NL4H 4JR1A 3TE7A 2Y1OA 3D7MA 5E4JA 2EU8A 1EDBA 1DFHA 1PDOA 3KJIA 5JHGB 5J43A 1N2ZA 3K0CA 3N3BC 2YNMA 5DI3A 3FUUA 4GYWA 3DC2A 3O8DA 4BWFB 4KFUA 1M1XB 2IMWP 8ABPA 1EUDA 3ETEA 3VSCA 2ZKLA 4F2PA 3EPLA 1U7WA 3R4VA 3PHGA 1X13A 5JAZA 1OHHD 2EW8A 3KPWA 3RM3A 4JV5B 2CUKA 3VGJA 5H82A 2Z5GA 1T8SA 4PPGA 5AI4A 1TC1A 2CHGA 3PDIB 2P27A 3RYTC 3KR1A 2QTAA 3CLRD 1U49A 1Q21A 1SKQA 4H3SA 4V1CA 3HI6A 1M1YB 1Y1TA 5KSYA 4R8LA 1ZQZA 1M2FA 4JBGA 4ZAYA 2YZNA 3FM9A 3L4JA 3BE6A 1W34A 4FI3F 1YRWA 3RJTA 3D4NA 1EDEA 1XEWX 2PX4A 1P3Y1 4P2GA 2PBRA 3TKAA 2I91A 1NJZA 3H84A 3UUEA 2IEBA 4KRGA 1YDEA 4Q4DA 1QO0A 4G2NA 4ZO6A 3NHJA 1KO7A 3INRA 1CUFA 1R0XA 1FLDA 4ETNA 3SF8B 1QQ6A 3L7IA 4AWAA 2Y9PB 2QVLA 4QOFA 4JT4A 9ICHA 3T0GA 2B78A 2EAOA 1Y8AA 5M7EA 3HKZC 2OXEA 1AD2A 1OBOA 2P4EA 4KR3A 3D2AA 2BL4A 3GJ4A 3UMRA 4HWPA 4C7VA 2QKYA 4BNTA 3FY4A 4U63A 3OPYB 3ZDAA 3S3TA 2G9VA 4L9RA 2WAYA 3M9LA 3PUHA 4MGEA 1DJMA 3QXJA 3MJTA 2CGEA 3OJEA 2A4KA 1E6EA 3IH5A 3FVQA 3K30A 4I55A 3P0FA 4W82A 5CX1B 4NZYA 4M9NA 1XA4A 4RFVA 4EBBA 5AHKA 4C7JA 721PA 4B73A 4ZTUB 1KDZA 1FFUA 3RK4A 3GLHB 3I92A 1Z5GA 2J9GA 4EA7A 2GD0A 1H8HA 2CC2A 5I5GA 1RJ9A 1ZH4A 1H93A 4X7PA 5JD6A 1IATA 1XHEA 3AVOA 3NP9A 2GZAA 4WKGA 4Z1OA 1OXKB 9ICKA 1OZ0A 2NNWB 3PF9A 3BXOA 3L04A 4ARUA 2E5SA 1LVGA 1IZ0A 4M0MA 1Z0FA 3OTHA 4BLQA 1KZ4A 3TRIA 2GUGA 1R7RA 4IRXA 1C9JA 2MCFA 4TRMA 2OSVA 1RRMA 4K81B 1NJXA 4QATA 3KR0A 1AY0A 3BSSA 4LRQA 4GQBA 1F2TB 3W06A 3WLHA 1WZCA 2DP4E 5LP6C 1QSSA 3O4HA 4RSMA 1T4CB 1A69A 3ZXYA 4M9RA 1QIFA 1NIJA 1WMAA 4RNOA 1JEJA 3G6YA 3QYFA 4CJXA 5A3RA 5LYJA 1UMBA 1EWVA 4BVHA 3DXXA 3LT0A 2C9OA 3RU7A 1ODJA 1T5DX 2BCVA 3AB8A 4TYYA 2BCEA 2LCIA 2Y92A 2FYTA 1E6MA 3MGVA 5G0UA 3WADA 4I99A 3ZBTA 3Q1LA 4Q18A 2ORIA 3GW8A 4ZYVA 3NOQA 4YRNA 4RS4A 4UUOA 1DBVO 3D5EA 1X7ZB 1N57A 4RNNA 3TOSA 2VJMA 5KAPA 3GROA 3OCXA 2C9DA 1QFSA 5AW6A 5FKJA 1MN8A 4I2EA 1W0JD 2YC2C 2NO4A 2MSWA 1Q1EA 3ZXXA 2EH9A 5FLKA 4Y7CA 1GGMA 1DO0A 1X1CA 5H80A 5E8JA 4RV9A 2XHZA 1IVNA 4DR2B 3EPIA 1TYZA 3D9QX 1XZ8A 4UM8B 4YRAA 4MUMA 4RQAA 1JB1A 4EQ6B 4BMPB 1JHMA 2A0WA 3N8NA 4AULA 4X5VA 3A06A 5CRXA 1AZWA 4RX1A 1JE1A 2ZM6B 4DWIA 3PD0A 4FFWA 1K8ZB 3ONVA 4W63A 3H5TA 1X3SA 4F4WA 2FY8A 2HHTA 1CUBA 1LNZA 4D9KA 7ICKA 3C8MA 3GRAA 4FGSA 4TLMB 1Y8ZA 5ECDA 5J0TA 7ICEA 1KQQA 3VSEA 4MRVA 1B42A 1Z6AA 3DM9B 2PI5A 4KYUA 2DC1A 2V7GA 4MYSA 3C3CA 1LZLA 4YRDA 2PS0A 1B8VA 5F73A 1XZGA 2WY2D 1A1SA 1SC9A 4D9IA 3I2FA 2NVOA 5GONF 2JFXA 7ICRA 2O52A 4EKNB 1JEEA 4Z7QB 4DOAA 1IN6A 3EOZA 3UTDA 1NK9A 1FW8A 5A71A 2KFZA 4CT0A 4G1FA 4ZWNA 2OOSA 5EHZA 1T0JB 2Y0BA 4WY8A 1MJNA 1Z62A 3MUNA 2Q1WA 2HSJA 2BF7A 3H3XA 4OXNA 1EFKA 5HIIA 1KH2A 4R3NA 4MUYA 3PDHA 1Z6PA 3F6EX 4HXYA 5B7NA 5F7OA 1J22A 3WK6A