3R9KA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, glu47asp mutant complexed with sulfate, a closed cap conformation
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
227
structure length
227
Chain Sequence
GSHMRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHDGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Putative beta-phosphoglucomutase
total genus 83
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3r9kA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3r9kA01
3M9LA 4ZEWA 3AR3A 4YIKA 5ALNA 3RFUA 2AGVA 1Z4PX 5AVUA 2R8XA 3I6BA 3WKBA 1Q92A 3PDWA 5AK4A 4IFTA 2PQ0A 3W5BA 5ALXA 2I6XA 5AICA 2FPUA 1XP5A 1TJ3A 4BX3A 3A1CA 4OHFA 3OTQA 5AKKA 1RKQA 1RC8A 4GXTA 4EX7A 3EPRA 4UARA 5ALDA 1RRCA 5AI6A 3NASA 3FVVA 1U7PA 2ZBDA 2IOFK 3OCVA 2WFAA 2RBKA 3U26A 3OCZA 5ALWA 3ONNA 1RKVA 3AR2A 3VAYA 1Z4KA 1U02A 2YN4A 4BKMA 2FPSA 2VKQA 1Q91A 4KX3A 3WK9A 2MU1A 4BX0A 3PGVA 1SU4A 2R8EA 2HCFA 1Z4LA 2I55A 3L8FA 4XOUA 4HYTA 2D2VA 4MUMA 4CNQA 3F9RA 4I9GA 4HGNA 2YY6A 3ZI4A 4BBJA 2FUEA 3SKYA 2GO7A 1PW5A 2X4DA 1ZJJA 3FGOA 2HEGA 2HSZA 3WK4A 3WK5A 2HDOA 2EARA 3OCYA 2IOHA 3U7EB 5AM1A 2JAUA 1QYIA 5AW9A 1CQZA 5AKIA 2GMWA 3M1YA 3AR4A 4KNVA 1FEZA 1QQ7A 4YGYA 3MC1A 5ALSA 3ED5A 5ALFA 3L8EA 3ET4A 1TJ5A 2C4NA 3K1ZA 5AI8A 2YFYA 3QUQA 2OYCA 4EZEA 4L6CA 5AW5A 1VFPA 2FUCA 2YJ6A 4HGOA 1ZRMA 5ALVA 1U2TA 3U7HB 4QQFA 1YMQA 2YJ3A 2WHEA 2IOFA 2R8ZA 3E58A 5AI0A 3QU9A 4AS2A 3CNHA 1RLTA 3S6JA 3B8EA 3A1DA 3SMVA 3DV9A 3NANA 4DWOA 3A3YA 3UMGA 2HI0A 5AM2A 3RF6A 5AKYA 3KDPA 5AVZA 2YJ5A 3P96A 1Z4QA 3E81A 2JARA 5AW0A 2GFHA 4KN8A 1Z4OA 5ALOA 4YCNA 4Y2RA 2G07A 2ZXEA 3KD3A 1L7OA 3DAOA 2JGAA 3ZUPA 4RETA 3SLRA 5ALGA 1JUDA 4KX5A 1RLMA 1ZS9A 3HLTA 5IT0A 4H1WA 4FE3A 5AESA 5AVTA 1QH9A 4C4RA 5AM0A 3ZTYA 4E88A 2P27A 4HGRA 3R9KA 3L0BA 1Z5GA 3L5KA 1L8OA 2Q4RA 3ZVLA 5AW8A 3ZU6A 3B9RA 4O8CA 3E84A 1J97A 3BA6A 4NFLA 4GIBA 3WK6A 1N9KA 1X42A 5AIAA 3KC2A 2YMLA 3W5DA 3WKCA 5AI4A 3B9BA 4XPZA 3WKDA 1IWOA 2HF2A 1YNSA 1XPJA 3L7YA 4BX2A 4YCMA 2NO5A 3CZ4A 1ZRNA 2EATA 3QU5A 2ZG6A 3FM9A 3L1VA 5AK5A 3ET5A 2CFSA 2WF8A 2PR7A 5AKHA 2DQSA 4Y2VA 5AVYA 5AK6A 3QUBA 2PKEA 1TE2A 5AKEA 5ALYA 4UMVA 3WGUA 4L57A 3DDHA 2I7DA 2ZBEA 2IYEA 1T9ZA 1Z4MA 1RPZA 1VJRA 3AR6A 2YMMA 4CF4A 3I28A 1S8OA 4UASA 3OCWA 3UMBA 2ODAA 4BEVA 3OPXA 5ALJA 4UMFA 1EK2A 2AMYA 1Z5UA 2HO4A 1U7OA 1L7MA 1RMTA 3KZXA 1TJ4A 1YS9A 3W5AA 5AI9A 2YMQA 2QLTA 3QU2A 2FI1A 4BNDA 2C8LA 4EX6A 4NV0A 4XE5A 2CFTA 3UMCA 5A3RA 1QQ5A 5T41A 2W11A 3WKAA 3IRUA 3QU4A 3AR8A 4UU0A 4J2TA 4YCLA 3SHQA 3N5KA 4UMEA 2W43A 4UM7A 4I9FA 5IT4A 5A3SA 4BEWA 3SF0A 3BWVA 2I33A 4UM5A 2WF7A 2FEAA 2B30A 4KNWA 2C9MA 2B1QA 1L7NA 5ALMA 2MSNA 3QGMA 1T5SA 2GHQA 5AW2A 1RDFA 3NIWA 5ALLA 3U7GA 1CR6A 2RAVA 3ZX5A 2W4MA 2FDRA 5AW7A 1F5SA 4JB3A 5ALEA 1L7PA 4CF5A 4EELA 2OBBA 2G1AA 2QYHA 1O03A 3U13A 4HAIA 3FZQA 3OCXA 4C4TA 4B6JA 3MN1A 2G06A 3ZTWA 1K1EA 3IJ5A 2BDEA 3DNPA 2NYVA 3EF0A 5AI5A 5AKLA 3U19A 5FP0A 2AH5A 3EWIA 4PNHA 4XQ0A 2RB5A 5AM3A 2C8KA 3FPSA 5AKJA 4AP9A 3ESRA 1AQ6A 3R09A 2B1RA 3N1UA 3ZX4A 4F72A 3L1UA 5AM5A 1WR8A 2NO4A 3L0CA 3PGLA 4KYTA 3ZWKA 2RARA 1L8LA 1ZD3A 2YJ4A 2ZBGA 5ALQA 3NRJA 3U7FB 1ZD4A 1ZOLA 3W5CA 5AVWA 1LVHA 3HYCA 2WF5A 4Y2QA 1EK1A 3IB6A 4UAUA 2HOQA 4Y2TA 3NAMA 4IG4A 5JJBA 4EEKA 3WKEA 1NNLA 3KOOA 3ZWDA 1MH9A 5AK3A 1WPGA 4BNDB 3A1EA 4MWOA 1RLOA 5AKGA 1L6RA 1WVIA 1RQNA 3I76A 5AM4A 2FPWA 2WF6A 4UATA 5ALPA 4HGQA 4J03A 1S2OA 4CF3A 2CN1A 3D6JA 3J7TA 3QXGA 3AR5A 3QUTA 5AHXA 3AR7A 1N8NA 3UM9A 1SWWA 5ALIA 2P9JA 3SD7A 2C88A 1Z4NA 3N8GA 4DCCA 3KBBA 5AW4A 4Y2JA 2O9JA 3OCUA 4C4SA 2I34A 2BDUA 3L8HA 5AW1A 3E8MA 2Q5EA 3MPOA 3QNMA 3SKXA 4YH1A 1SWVA 1LTQA 2IA5A 4UMDA 1NF2A 1ZD2P 1NRWA 4AS3A 3N28A 5AVSA 1RMYA 3EF1A 4NWIA 3R4CA 3ESQA 4Y2PA 4Y3UA 2MU2A 1WZCA 1QQ6A 1J8DA 4OCZA 2G09A 5A3QA 2B0CA 4FYPA 5ALTA 4JDPA 1ZD5A 5AIBA 2G08A 5AKZA 2BY4A 1Z4JA 2AUTA 5AKXA 4ZEXA 4BYGA 3GYGA 2YBDA 3N07A 1RKUA 3L8GA 3NALA 2JAOA 4FFDA 4UW9A 2Q4TA 1YJ5A 2YMPA 4QJBA 4UAVA 3WGVA 4CE6A 5ALKA 1RMQA 5AW6A 2ZOSA 4F71A 5AVXA 2G80A 2FPXA 4DFDA 2R8YA 3QUCA 3FPBA 4Y2XA 3PCTA 5E0OA 5AVQA 2WF9A 4G63A 1XVIA 5AVRA 5IS2A 5ALUA 1TA0A 4UU1A 2FPRA 1RQLA 4Y2YA 1O08A 5ALHA 4YIHA 2I54A 4DW8A 4EENA 3QYPA 4ZEVA 2HX1A 1YV9A 2B8JA 2HHLA 3QLEA 4RESA 2G0AA 4NABA 3QX7A 4G9BA 3WK7A 3MMZA 3ZVNA 1Z88A 1VJ5A 3AR9A 4Y2UA 2CFRA 2JAWA 1Y8AA 2O2XA 4OFZA 3ZW7A 2P11A 2HF7A 3ZVMA 3I1YA 5ALRA 2OM6A 3QU7A 5ALZA 5AVVA 2OA0A 4Y2SA 3TLMA 4L6AA 1T5TA 2B8EA 3WK8A 2P69A 4NAVA 1Z4IA 5AW3A 2GHTA 1YDFA 4OD0A 4HGPA 1U2SA 2EAUA 3L0YA 2WM8A 2B82A 2ZBFA 3NUQA 1KYTA
chains in the Genus database with same CATH superfamily
2YCBA 2AHOB 2LI6A 2EAOA 1VXOA 2JBHA 4J0DA 2R6R1 4YIKA 4YQEA 5K45A 5MDHA 1K5GA 1J9GA 4UB2A 3TKLA 5JS6A 3I2JA 4X45A 3K1TA 2CXNA 2PQ0A 3PEUA 1C3OB 4I50B 5BWMA 5ICEA 5KT7A 1UIRA 5FYQA 1B42A 3HR7A 1ZY2A 2HT6A 1XHLA 3QKIA 1S0UA 5DNVA 4ARIA 4W63A 3HKCA 3A1CA 5TQ2B 4XDHA 4CV3A 4DJTA 2F3UA 4YAGA 2TMYA 3K0EA 2QRQA 2WJYA 5FLKA 5KTPA 2NTVA 4F92B 2QTLA 5L9AA 1U0EA 1CE8A 1MRSA 4GXTA 3F3MA 3W5VA 1SC4A 2R25B 4B44A 3LL7A 2GPSA 3QVWA 5IKOA 3AW9A 1B8PA 3HVUA 1MIOA 5B5SA 4CIWA 2FUKA 5JQGF 3E7DA 2LWIA 5DN9A 4RNMA 4NQRA 4H3KB 5H02A 1FOEB 3CBQA 1MHTA 4DQIA 1RD4A 1YS4A 2GZ3A 4GKKB 1O7JA 1P62B 4AJEA 4UB1A 2HVHA 3U26A 2V5AA 3GPCA 4AJKA 5FUWA 4X6YA 1W2HA 1XTVA 4KMRA 1U02A 3H9EO 1C0IA 1OSNA 1T1IA 4F4ZA 3OOWA 2FPSA 4NDZA 1JXAA 1HF3A 4QYMA 3VNSA 2HFKA 3FCCA 3V48A 4BQFA 4WN3A 4BP1A 4EA9A 1JF8A 3DJYA 1TYZA 3L1KA 3QLTA 1WEHA 4P3OA 5JEEA 3GRZA 4HNSA 2W93A 4WNAB 5CLHA 3KPYA 2F43B 1LDBA 3RTDA 1ZMBA 2HRDA 3NKLA 3BSFA 1Z6AA 1PWHA 3T3NA 2KHZA 3C1YA 1P2VA 5KSWB 1ZQPA 2VWHA 3ZCXA 1FUIA 1E3WA 5CGZA 2B61A 1VRCA 4CNQA 1X1AA 2X6TA 2ZAYA 3E35A 4UQGA 3F9RA 3L84A 4IDEA 3VZPA 3ZYZA 1DQZA 3BGVA 5EKXA 3BH7A 3VYTB 4OKSA 2ZAIA 3VPHA 4O2AA 2GN1A 5BRJA 1ZG3A 2D5LA 3ODGA 4MB6A 4TL9A 4PH5A 4GXKA 3FGOA 1ZJJA 5DFAA 4BO5A 2DLNA 2GAFA 1WKBA 1U47A 2B69A 2I2FA 3A27A 5D5PA 1EYZA 5IANA 2QTFA 2B36A 2RH9B 4BAZA 3WK4A 1JJIA 1ZBQA 2C77A 4BKUA 2DH5A 4JLAA 4LN1A 4URXR 3EAGA 5HUQA 4EHLA 4NYMQ 2H5LA 1A7JA 1T3QA 4UPDA 4F97A 4LF5B 2PVPA 3DQPA 2BCSA 4F5NA 2QD5A 2WSIA 2GDJA 3S2FA 1QV9A 4UVIA 3I0NA 3TRKA 2WZCA 3W1WA 2C2MA 4CHGA 1GDHA 4V03A 1L7QA 2C7PA 5IDWA 2JD0A 4MW4A 4Z9BA 3GEIA 3C74A 2WWWA 3HB7A 3T3GA 1KE2A 1TVAA 3C2MA 1BSVA 2JCXA 2NPIA 3ENNA 2QR3A 3GAFA 2SCUA 4H31A 4QYXA 4RJLA 4NF2A 1HDRA 5EERA 3T5PA 1PUJA 4S05A 4BB5A 5C34B 8ATCA 2W00A 1NI4A 3A6GA 3FJOA 3GGCA 1SHLA 1UADA 3E48A 3NEYA 4EWLA 5C8ZA 1DUVG 1OW3B 4JI2B 5GP1A 1T94A 4TUYA 1XRMA 2KBEA 2YXDA 4YRLA 3GG2A 1YZNA 4X8HA 4DC1A 2PEYA 2G4VA 3LVRE 1UQVA 5J2UB 5J2TB 4DV5B 4DR2B 1CJTC 2O6KA 2Z8XA 4FGUA 2H4XA 5GJVC 4RA6B 1T5IA 2RGYA 2UVDA 5DRTA 5B53A 4ANFA 3S6JA 3NWJA 3WZLA 1WB6A 2ZTSA 3SMVA 3OU7A 3S4YA 4DAOA 3O95A 4L9SA 3VC1A 2OL4A 4KLUA 2QHXA 2X5KO 2HXSA 4FGWA 4NZOA 3ZDRA 1U9IC 4M22A 2IITA 7ICEA 2OXCA 2XPCA 2VKTA 3A7EA 3O8QB 2IBKA 1HTWA 1BVUA 2ZYDA 3AKCA 4NNPA 2R7AA 4EQ6A 2OAEA 3F6YA 2GTPA 1TM4E 1YD7A 1KLNA 1C2YA 4JS0A 3BOSA 3DZFA 2RGBA 2JH3A 2AD1A 4PIPA 1FSGA 1JTFA 4B0OA 3OOHA 1ADYA 1VCHA 1GILA 4I4TA 1H0SA 1L5VA 1GZ3A 1S2LA 2OCKA 3I5YA 1A6SA 2JXJA 1E92A 1C30A 2WM2A 3IV7A 4DG9A 1UP7A 3U60B 1G6KA 2Q8PA 2WABA 1KNQA 4L4RA 1X3LA 1IDN1 1MXFA 1SQ6A 4B9AA 2I6TA 1QH9A 1FFAA 3UT5B 4YJ3F 5C8VA 2V7UA 3H9QA 4HGRA 3R7FA 1BPEA 3SC4A 4UD2A 2X58A 4LWQA 2C2BA 4X63A 1D7OA 1FVOA 1P2UA 2HJGA 4LJ6A 3WLFA 2OCBA 4EG7A 1GZ5A 3H2BA 4H6VA 3A4NA 4O4HA 4HZUB 1X8XA 4O2LA 3JRXA 5AIAA 3RRMA 2NRWA 4QPDA 4EI9A 4IRCA 1ISGA 1QU2A 2X41A 1F4VA 2GEUA 1BD3A 3S7TA 1Q0TA 1MO5A 4JL5A 3PFKA 3G49A 1ACJA 1E5VA 4KLRA 3OG9A 2IXGA 1YFLA 1R6VA 3BMNA 3Q7PA 2PUAA 1YIOA 2Q0ZX 3SE0A 3VSCA 3WRXC 1SGWA 1AKWA 4EHJA 3KVVA 2BMWA 2EGGA 4F9GA 4Z0TA 3E7FA 2JFBA 2JFFA 3ETGA 3L1VA 1WD5A 2NT3A 3TLGB 4HBZA 5DMXA 2BM9A 5EWMB 4LVSA 1YKFA 4JXZA 2WF8A 1KJNA 8AT1A 4NR0A 3WGHA 1QFXA 3CMMA 3C41J 3ZV7A 2L82A 1HORA 1T4CB 5L4NA 1U2DA 4W8OA 5KWJA 3RLFA 1GAWA 3DDHA 1FX0B 2HNKA 3COSA 2E55A 4NLLA 3ROQA 4DSOA 4MWCA 5HGXA 2YICA 4LZZA 3HU2A 3HFRA 3E9CA 2BISA 3R7WA 3WS7A 1MB9A 1RR6A 4BQQA 1X66A 4L8GA 1IN1A 3TQIA 1BQEA 2H1WA 4G3IA 3EMKA 3OZCA 1RLIA 2IUEA 2V7EA 3I53A 2WJVA 2ON6A 1Q1NA 1XTBA 3AGQA 3CRQA 1WUTA 4IDPA 2DYKA 1GPNA 5BSGA 2WUEA 4J9VA 2V1UA 1TCVA 4AYBF 1E4OA 3KQLA 1JPNA 1YRBA 3X2EA 2W42A 3HMKA 4RAQA 4CLXA 4PIVA 1UIMA 3GAMA 3LKVA 1Z0IA 4JYCA 4JB0A 4KVFA 4OA5A 4NLCA 3GIMA 1W48A 4CM5A 4GZ6A 1SH7A 2GJKA 3KKMA 1ZGZA 5DIZA 3QK7A 3OJUA 2J6BA 1M72A 3FSEA 4G84A 4H7JA 3VU9A 4CCYB 1EE2A 1OIXA 2P1RA 3MBOA 4FXPA 2ZI6A 3MYRA 4NAUA 2VOEA 1U3WA 3DD5A 2CDNA 1JHYA 1TF5A 3JPYA 2LYAA 4NEGA 3T9BA 1KU0A 1MP0A 3AUSA 1MW8X 3IV6A 2CNDA 1HMYA 3N59A 4LRSB 4MXDA 2H1OA 4TZ0A 2XI9A 4LSZA 5HKKA 2FR8A 2BKUA 4REQB 3W2FA 2AMLA 5BYJA 1E2LA 4DEZA 1OF1A 3OPNA 2FG6C 1XEXA 1KO7A 4BQOA 1NJWA 2CPRA 4QPCA 2BMFA 2DY1A 3QGMA 2PX2A 2XICA 4UEKA 3EH1A 4EA8A 1U49A 2R4UA 5CLLA 1TK5A 9ICGA 3K8YA 3LIIA 3KHGA 3ZCRA 4BFXA 1IUPA 2WAXA 3ZE6A 4FVTA 4E5YA 1EK5A 2Q8QA 5IFLA 3PDHA 3BVPA 9ICAA 4E2YA 3C6BA 1ZMRA 3I9V1 3O75A 4KQ1A 3TLCA 2GI4A 5IG2A 1L7PA 5JUMA 1PRYA 3MRSA 3TPFA 2C20A 2FWAA 2OBBA 5HUHA 1W87A 2IZZA 1S01A 1HYQA 3IP6A 3MNFA 3VPCA 5HPYB 3K1RB 2NO6A 3T34A 1PO7A 4F4YA 3TZLA 4HAIA 1L3VA 5E9QA 4C4TA 3AEVA 1EAMA 1Z9BA 5J2TA 4CKCA 2IGTA 1AF4A 3BE6A 1K9VF 1KRWA 3ND9A 4M9HA 4YRTA 3P9RA 4ZOLA 2A67A 5IZCC 2J7PA 1E3EA 3LXUX 3SSNA 1GT91 2JAPA 2R5WA 2H5JA 3PHGA 4LYEA 1R8QA 3RSZA 3EB9A 3WYFA 2RGWA 4L2IA 2BBSA 3QG1A 5J40A 5KTSA 3LLSA 4UD6A 1VBMA 2FEPA 3MCAA 2X1MA 3FWPA 2RB5A 1OWOA 2X8JB 5GQSA 1MG0A 4PL2A 5DGIA 2W8ZA 2C4TA 1YT3A 1WB5A 4P58A 3I61A 4NCKA 4ZVVA 4B7ZA 2Q45A 1LWOA 3IDZA 3LPAA 2PSHA 2PIDA 2DKXA 1QP0A 3AUTA 3ZHZA 3G02A 2HNAA 2Q6TA 4G2TA 4GPIB 1W52X 4NFYA 1JZTA 1TXGA 3JATB 1SVOA 2O2DA 3HV0A 2VQ6A 5T67A 2JBAB 3G5MA 3EUB2 3PGLA 4LK2A 4ARSA 2FWRA 3MIIA 4XD7A 4LF7B 3M70A 3VBEA 3WYGA 5B58T 2PSDA 1X70A 3NRJA 4JC0A 3RFFA 1SBIA 2XRZA 3L8ZA 2EW2A 4YAIA 1QO0A 1WW3A 3TH5A 1SXJD 1B8NA 5B6JA 4IG4A 2VN8A 2OO5A 5TE9A 5A7FA 3VR2A 2WJ6A 1HT2E 1AQJA 4M3NA 1ZQNA 1T6BY 1IIRA 3I05A 2HOFA 2IK8A 2KMLA 4ESOA 1PT9A 4D4KA 1MH9A 4ETWA 5JSYA 4KXXA 3P52A 3A1EA 4GXNA 4NCXA 1V9PA 1OA0A 1PP4A 1HY3A 3HN6A 4C0SA 5DB8A 4B46A 2AXPA 4L5IA 4B17A 4DGSA 4R3NA 4WBNF 2FN8A 3JQ9A 4DQRA 4LJ5A 4L4ZA 2HH9A 1JQKA 1NMEA 3BL5A 3QE4A 2CXUA 2W58A 3NHSA 4W1RA 2AI2A 5JS7A 5LOVA 4LNUB 3PDIB 4UHFA 1ECFA 3K96A 4KAAA 1EHCA 3HU5A 1U6IA 3TLXA 3W9SA 5ELXA 4S24A 3TW8A 2QL9A 4BNWA 3U6KA 4CXMA 3GJRA 4MWSA 1RQRA 1P81A 1WPQA 3AERA 4YT5A 1YZUA 2VA8A 5ARCA 1DB3A 4AUNA 1N5WA 1XL1A 2EF0A 2WI8A 4EI8A 4CIVA 4BN0A 4US1R 3WAGA 4JLUA 1PSZA 5T8KA 1JEDA 4G4SO 2V6FA 4HH3C 3DTYA 3REOA 4CM6A 1DOQA 4P1ZA 1DIHA 3OHMA 2QARA 4UEJA 2H3ZA 2WAQF 1AF7A 3H5VA 3RARA 2IJGX 3T5JA 4C43A 5KFKA 3GIDA 4G24A 4J9UE 4ENPA 4UBJA 5ICFA 4UVGA 1FTQA 2W98A 1X2BA 1JJAA 3R5FA 5AP9A 1WVGA 2GT1A 3W8FA 4EUHA 4UBKA 1CUCA 1NLUA 3QPWA 4K6CA 5EN4A 3ZZ0A 4AMVA 5JNWA 3WB0A 3A6ZA 2IXEA 3WY9A 3PUIA 5AVSA 2QG4A 3GNTA 1TLLA 4I1UA 2C3MA 2RBEA 5LN1A 1ST2A 2HJ9A 5ENZA 5BQXA 3PA8A 2GXAA 1IPFA 1T15A 5E8RA 3GWGA 4WV3A 1RXIA 4QWCA 2B0CA 1G20A 1U0JA 3QXJA 1GDDA 3RVOA 1BTOA 2MSKA 1O96B 4UBBA 3GJTA 2OZKA 4OVKA 1W19A 3S7ZA 4ZJUA 3QWHA 3ETRA 1GPLA 2O0KA 2QRLA 1I1QB 1P1HA 1P2DA 3TQOA 2ZAMA 4XUSA 3JQAB 4G5SA 1EXDA 2R1TB 3V7FA 5G2OA 1ENYA 2VJ4A 2CJWA 2Q1TA 2EG5A 1JAIA 5EJGA 4W9NA 4DLXA 1E59A 3KOUA 3STHA 2AD5A 3HMQA 2HJHA 3DF9A 4DQQA 4J1TC 4G0MA 4TL7A 2XT6A 3B6JA 3LT4A 4Y6PA 2B21A 3KHHA 4P3XA 1JQBA 1WSAA 4N8SA 1NE2A 4XQ9A 3FMVA 4JDUA 3ILXA 2KSOB 4ZOHC 2N47A 2WZQA 3QVGA 4NJMA 3C14C 2DFDA 4A27A 1DRGA 2PYDA 1ZA2A 4CM4A 4ZI2A 1N3YA 4TN5A 3MCZA 1EINA 2B5WA 3PCTA 2AQ8A 2RG7A 4BNJA 3TOCA 2VLIA 1J9ZA 5E4TA 1Y8ZA 5GV8A 1X7YB 4L0CA 4W5JA 3OOJA 2LUOA 3NTLA 4JKYA 3DO6A 2P30A 1RRGA 1JMSA 1A88A 1PX0A 1T1GA 1YXMA 1WQ1R 2OHFA 3DS8A 3HCDA 4GEGA 1G4AE 4CDGA 3DXZA 1C7ZA 5EPOA 2WPNA 1UPXA 2VSQA 4EB6B 1IHDA 1L1QA 1M5UA 3NIGB 3EZXA 1H94A 2P6UA 1TF7A 5J0RA 1JZSA 2EYUA 1JKXA 1WXGA 3FOBA 2H7CA 3M83A 4ID3A 3F9CA 3DVRX 4ZI7B 1T0UA 1E5DA 2QAGA 2B8JA 1D8LA 2K6GA 3C8HA 3GY0A 1N6LA 1X7XA 4RMGA 2CNKA 3KSRA 5B1EA 4V0QA 5HDBB 2VHEA 3WQSB 1BXGB 2WUVA 2I9KA 4K9OA 2VTEA 2H29A 3P45A 4IX9A 3WWYA 2ODTX 3G9UA 2C2GA 3OIWA 4L4SA 4QTYA 2C4MA 3CH6A 1QGED 3I3SR 3KU4A 1Q1AA 4FSHA 4M8IA 1FU7A 3EEOA 3RJZA 3UY4A 4DJEC 3VU8A 1J1UA 3HDGA 1BAPA 4IIHA 3ORFA 5D51S 4GZMA 4BB6A 7REQA 3H8MA 4CCYA 5C8YB 1YKSA 1MAHA 1U6KA 2JHFA 1NWHA 1OBOA 2VRCA 3HXPA 3E5HA 1FPMA 1WY5A 2DBRA 3PA6A 4ZO7A 4IYJA 2G9NA 3AKZA 3NM6B 1UK6A 2J31A 1E0SA 2J7KA 4RPJA 1I5OA 3LRTA 4ICIA 3G5LA 1GPJA 1UBEA 4LF9B 2Y1XA 2BEKA 5DH9A 3QOWA 3MA0A 4YMGA 4Z99A 5L3QB 1YS7A 3B6EA 3C1TA 2L42A 3WI7A 5CVUA 5D84A 5B7GA 5EZYF 2VVTA 3KAKA 3ZHTA 2WSYB 1Y80A 3D6NB 4K6KA 4TLMB 4MI9A 3HJFA 2A3VA 3RFCA 3TXYA 5AUPB 4DG8A 4RDXA 2F55A 1HIWA 1V97A 3A9UA 1WDWB 4FK8A 3A1WA 4N7BA 1U2EA 1ZJZA 4R8UA 1AG9A 2WICA 3BWDD 4G1FA 5E3IA 3UFXA 4DANA 4ZDWA 1E18A 2YY5A 4DDUA 1S2MA 3A2MA 4LQ4A 1RYBA 3JAMA 3NHBA 4R5MA 1A9XB 1U1IA 4QT4A 4ZT4A 1CVIA 3ABSB 3EGCA 2WKWA 5I47A 1QAMA 2BR4A 2AC7A 2YZMA 3MJDA 1G3UA 3PSPA 1KVRA 3OTWA 4GC6A 1EA5A 1PEAA 1EXWA 3T1NA 4CV2A 1RSZA 3CIOA 1X1RA 3PNMA 4GKVA 3RE1A 4D0RA 1ENZA 2B34A 3Q12A 3H40A 3CR7A 3HCFA 1BVYF 2O1XA 2X5OA 2NIPA 3A9CA 4EO4A 1DCMA 4JX9A 2ZBDA 4BEJA 2BR0A 1G1MA 1TMYA 1AK1A 1CUBA 3O8OB 2JIDA 1X94A 3U4GA 4XTCS 3WL7A 3JPWA 4EDHA 4CTNA 5JZMA 4QFCA 4Z9XA 3VHXA 2FW9A 1NJ1A 2BEUB 4UHHA 3GMSA 4ZANA 4J90A 1QVVA 4GEKA 3FCSB 4I99A 1M73E 3NP9A 2IEDA 1Q74A 3GRKA 1R6BX 4IRXA 3HK2A 5DBOA 2CK3D 3MR6A 5EE5B 1SKUA 3U7RA 1C1DB 4CM1A 4DIMA 4I2AA 1MMFB 2CKMA 1NASA 2OUIA 3T9AA 5DNUA 3D1VA 4IILA 4HQKA 1K6XA 4H35A 4DUGD 1IOWA 1RKXA 3THXA 1M9NA 2I7TA 5LDHA 4C04A 4JVOA 2AEEA 2J87A 1NBEA 3ZI4A 5DVZA 1HOTA 2FUEA 2QTMA 2VNIA 1F3OA 1QWSA 4XIJA 1YB6A 2PGXA 5DRYA 4KLDA 2DF8A 3VI3B 4UB8U 2PFGA 4GH5A 3ZNQA 5F35A 2F48A 3KKAA 2YX8A 1ZI8A 1HURA 4U9UA 4MFAA 2ZUSA 4K8RB 4PZAA 4JP5A 4L51A 4RDHA 1JT9A 1L5FA 1U8AA 1XZFA 3BCRA 3F1LA 1NK5A 4MS3A 4L95C 2OG1A 2ST1A 2BJWA 5CDFE 1FIQA 2VYCA 5DWQA 1JTEA 1LD3A 3WWCA 4YGYA 4OQXA 4ZKDA 5AUNB 4KO1S 3ZQ6A 3QZ7A 1HDCA 2AR7A 5GONF 2ZRBA 5JNTA 4Q9HA 5ALFA 3PHLA 5LZ8A 1JT2A 1Y3FE 1KH2A 13PKA 5DI3A 4TUYF 4PNEA 3VR4D 4P2HA 1H2BA 1G7RA 2AZ4A 2AEFA 2QNRA 4OXNA 1R8YA 3IMGA 3R5SA 1QSYA 1QMGA 1WXXA 3NZEA 1Y8QB 4NECA 1N36B 1U2TA 3IUQA 2Q0QA 2PSEA 3SSOA 2BN4A 3D8NA 3ZY2A 8ICSA 4C8NA 3GFSA 4GM1A 5K0GA 2WBLC 4IVPA 3JQFA 4UB6U 1EB8A 1GFSA 1R0BA 1U1GA 1XZHA 2ZS7A 3RIYA 3F9IA 5AVKA 5BRAA 4F2RA 3BD6A 3NANA 3A6EA 4MVWA 2ZSUA 3NOVA 3IT3A 3TM5A 4BV3A 5K8JB 1YDHA 3RF6A 4QJFB 3CLRC 4IUYA 3LBFA 3KHTA 3N2IA 4XOIA 3FCYA 2FF7A 1E3DA 5AJZA 4LJAA 5TDHA 1HLDA 1R4ZA 4OQMA 4DNPA 2BGGA 1SEPA 1JDTA 4WASA 1KYQA 1P33A 2GFHA 2DE0X 2OAQ1 3LFHA 3N05A 4QBFA 5DYNA 3VTZA 5C0OE 5JD6A 4C4ZA 4ABTA 1PGJA 1TC2A 2AK2A 1EJ2A 1VP9A 2BZSA 4KLCA 2VYVD 4KVAA 1SHZA 4URHA 3EEBA 3T4XA 1Y5MA 5J4HA 3WB1A 4H7KA 3E2IA 4UE3S 2AG5A 3G0IA 5MN5A 1ZS9A 1KSHA 8ICNA 3QWIA 4C1NA 5CR0A 4HY3A 1EZ4A 2DR0A 2DFLA 3E8SA 3IR6A 4PLFA 4C2TA 4D8XA 3FDFA 3MERA 1AN9A 1ATZA 4EB3A 4YAUA 3JR7A 1FW8A 4MEJA 3WLLA 4XA8A 5P21A 2H3FA 4R7TA 3G0HA 1Z1VA 2V4UA 3E84A 5KYWA 2OEPA 4MV3A 3MFIA 1GO3F 5BSMA 4J6FA 5EXSA 1P6UA 3B5JA 1QLHA 3SBDA 4AMGA 3TGWA 1KRHA 1OBHA 2DG2A 2R8HA 1R9MA 1S4QA 3B2EA 3IELA 4LTNA 3N0RA 5I01A 3X1XA 5KI6A 3VC3A 1IONA 2VJCA 4QPNA 1UOOA 1G2OA 4XEUA 3EZ2A 4F7DA 1UWVA 1XPJA 1AXGA 2YIJA 1VTKA 3GBPA 4I3HA 4KITB 2IU6A 3IEMA 3UENA 5LA6A 3DUWA 3E9QA 5IF9A 4NCIA 1WHTA 3MTQA 4DCSA 5BY2A 3I58A 1UBJS 1U04A 3FM9A 1PZGA 2B37A 5AK5A 2HK9A 2X7XA 3ET5A 4D9MA 2QMOA 2WPDD 4U2CA 3AM3A 1Q1GA 4UCXA 3BHNA 9ICMA 3RT9A 3W4KA 3FTFA 4YXFA 4QFMA 1U2RA 2O7NA 4LCJA 4BX8A 4XASA 3SX4A 2DWPA 2O07A 1EDOA 3ZWMA 4O63O 3RRHA 1YBMA 3O8BA 3B3AA 1DAHA 2D59A 4KODA 2HV8A 5IXJA 2RGCA 3P19A 1SZHA 4YR9A 2EKPA 1E2FA 3QEMB 4MNTA 2M6LA 5LLTA 3JPTA 1UBMS 1P19A 2Z2JA 3BC1A 5LPNA 1NUQA 2MCFA 1VCNA 4QZGA 2COUA 2VT2A 3SNKA 4LY3A 3KYJB 4QZCA 1H0RA 1KO5A 4F04A 2FWNA 2UYYA 2WFLB 3C1OA 1U4OA 5CFPA 3OPXA 4UMFA 4CMCA 5KTNA 1FY2A 2V4MA 3ANTA 5HIMA 3VOBA 4GXRA 1Y6RA 2IPNA 5CA0B 3RADC 2FZVA 3LP5A 5BPCA 3KXLA 3CF4A 4G5XA 5DGXA 4F5DA 5AI9A 4ZTBA 3C97A 3VR6D 5BT8A 1RAFA 1SCKA 2D4AA 2PWAA 4NARA 1Q84A 2YNMD 1PS9A 1V1JA 4IJMA 5CURA 2YVAA 3ZDXB 2TMDA 3OLZA 1HDXA 1UZLA 3GCXA 3KWMA 3MM4A 4RPGA 1W36D 3GJ5A 4NYMR 1L5OA 1AHHA 4L9RA 2X9VA 4NS1A 1XG5A 1CUFA 3GA0A 2R66A 1WEKA 1GN9A 1QHSA 2QX4A 3IP1A 4A4DA 4C4OA 2BPCA 4I4IA 1HNNA 3HW8A 3CWCA 2F3SA 3ZHCA 3RG8A 4JMUA 4KAFA 3HBFA 3RRGA 3RV3A 3SHQA 2A14A 1JWBB 1QTQA 3K1JA 4OB7A 4C6SA 4GPEA 3DLIA 3LSTA 3JWHA 4IG9A 3TX6A 2I33A 3FDJA 1DK3A 2PFQA 1H2XA 2B83A 3H86A 3L18A 3AY7A 4MJ7A 3SJCA 1SV4A 1D5WA 2NUBA 4C8LA 2H4ZA 3QXSA 2NXJA 5IBCA 4FZVA 2V6BA 4AUKA 2W2LD 4XB2A 1N2IA 5CDSA 4TLAA 1LPNA 3NHWA 5KKAA 3ZX5A 3CYMA 1N5XA 4HAZA 1VL1A 3HCWA 4WD3A 3WRYC 2HHCA 3K9GA 4JMLA 1AHPA 4DDHA 1IAQA 1UPHA 1PX2A 2H5EA 2PKQP 4FINA 3O47A 4H7EA 4Y98A 4M99A 2HMWA 3IESA 1H38A 3UBMA 4AJ1A 5IVKA 2HDNB 2ISSD 2PH1A 2DUUA 3BIOA 5DM70 3IKJA 1Q0HA 1QH1B 4TN1A 4I5FA 4Q9DA 3G89A 1NI5A 2GWHA 4M0EA 3TBHA 3V4OA 4QUDA 4H18A 4B6JA 3O90A 4BLOA 4E14A 3R7BA 1MFPA 3UFBA 1ZK4A 5EJIA 1ECWA 3AM4A 4B6GA 1Q1EA 5HKKD 3EQ9A 3ZTWA 3IE1A 2JG3A 3V6LA 2FAXA 3BXGA 1J6UA 3QYFA 4PZCA 1LQ2A 4WZBE 4CHTA 5KVCA 1DBSA 5MGBA 4M0FA 4NBUA 4RQ0A 4MO9A 5AI5A 3GLQA 5LDGA 1ZM4A 1XNJA 1MAAA 2HWKA 3L79A 4KFUA 5CCDA 1TM1E 2HSGA 1J5XA 2A78A 4FR2A 4RD0A 2P66A 2YWCA 3LY7A 1T3HA 3O7WA 4KN9S 2DQNB 4W4TA 4R9VA 2IBTA 4AY2A 4L73A 1VIMA 4RLFA 2IWHA 5KFUA 4CLEA 2HPVA 5AKJA 1DLIA 2BDTA 1IY1A 1GXSA 3BRWA 2XCTB 2YTUA 3EXG2 5CDYA 4DEYA 2VBCA 3EASA 3DHWC 5IVIA 2H18A 2NU8A 3GHYA 3W4IA 3JQGB 1W94A 2VC2B 1AUQA 2ZRAA 3WRWA 3BEDA 3W3ZB 4EG5A 1H6BA 5FX2A 3AEKB 2HJVA 3BFPA 3COYA 3KYCA 3L0CA 3UF0A 2XIQA 2E5LB 4KK3A 2PXHA 4KLGA 1KP3A 4E7PA 4RELA 1ZD3A 4LJSA 3PRKE 1FZQA 5ALQA 4B82A 5DQIA 1N1EA 4IGEA 5DHRA 1NKEA 2K8CB 3IBFA 4D7AA 4GX2A 2CFOA 4Q18A 3ZBTA 5BMVB 1GG2A 1XMXA 5JADA 4RQ5A 3K4GA 3P9KA 3CQ9A 3RNOA 1B43A 4DSTA 3R5KA 1FXWA 1POXA 3E9NA 2Y1LA 3LVQE 4BATA 1J2JA 4ZQIA 2JJYA 6YASA 2PUDA 3VJRA 3B9PA 5I8WA 1LWNA 3GCGA 5L3ZA 2FOIA 3AY3A 3EE6A 3I76A 3DWEX 3NAQA 4U5XA 5LB4A 3FMPB 3FUUA 1F38A 1WL8A 3PNQA 4KR3A 3IB3A 3II6X 3L1HA 4TYNA 2WM3A 1GG5A 2GBLA 1WCV1 2PNFA 4FE7A 4RFLA 4TZTA 4MYDA 3IDSA 7ICJA 1URJA 1VSQA 1T2UA 1N8NA 1PFUA 4FDMA 1E79D 2V6GA 1R4MB 4MIEA 1HTTA 1KFBB 2R7NA 3SD7A 4FYVA 4IRUB 4CMBA 3N8GA 4F3YA 3EVDA 3EX7C 3O9MA 4ED1A 1QUEA 4MF2A 1GKYA 2RHGB 3AUYA 1QK5A 2JGNA 3H1AA 2VF2A 3KEOA 3FYUC 1YHNA 4INAA 4OKIA 4W8GA 1T9CA 1E9RA 3U9SA 3F4LA 3Q8PB 1D4ZA 1LKYA 1U9YA 2IYXA 3FNEA 3JYOA 3UVEA 1XU4A 3OZDA 4PTLA 1C1HA 2Z8YA 3DXFA 1TGVA 3R77A 4KSCA 4Y6GB 5IVHA 1TUEA 1RXCA 2R8JA 3N86A 4S1WA 4WCFC 3RIEA 1ZK2A 221PA 3BQNB 3FKSA 1HUZA 1G2IA 4KFTA 3CG4A 1PG5A 1QGAA 2ALJA 4IUCS 2X5NA 2YNMA 3AXTA 3DE1X 4B9SA 1MO3A 4R68A 1QG4A 3NBUA 2PUFA 2CFIA 3AMZA 1RMYA 3EF1A 3FETA 4XLLA 2WHXA 4PAOA 3NEJA 3QMVA 4A6PA 1AROP 2HHQA 2UZ1A 3KZMA 2G09A 1CTQA 4P4UA 4OBBA 2VPWA 1LNZA 3WHPA 2GYWA 4NE2A 1Z6QA 2J3HA 5F1PA 2IHJA 4ASUD 3RAGA 4L74A 3TNLA 3ZR4B 3I42A 4F9EA 1X8LA 5IBPA 2ZRHA 3OF2A 3QELA 4ETIA 1O8BA 1NSTA 3PKZA 1PWZA 4YN4A 4W99A 4BQNA 2NSJA 1Y5NA 4HTFA 3HTXA 3PUJA 4Q82A 3BQ2A 1ZQQA 1VFNA 3KLOA 1C7JA 1BPZA 1AKQA 1T8EA 1OC4A 3V46A 3GGSA 3WLMA 3ZCQA 4EG4A 3S8YA 5J0UA 4LGYA 2WYUA 3VISA 1QG2A 3VOTA 4GF5A 3EXIA 2AZMA 4H1HA 4OMDA 1PJ3A 1PR2A 1SBNE 5FJIA 3OD5A 1YZQA 1HL7A 3QBDA 3HU1A 4DJ5X 3UQZA 4QJBA 3DTVA 1Z5NA 4PINA 2FNAA 2BUAA 2NO0A 1Z0DA 3TQHA 1RWXA 3X44A 2ZIVA 2VTKA 3GU3A 1X39A 2N3ZA 1VLZA 4B8YA 3V55A 1PD1A 1SL1A 1G5RA 2QTGA 4ZK6A 3O91A 4FDLA 1ID8A 2LW7A 1NDUA 3AVYA 4RIHA 2BWJA 3CSUA 3RS8A 5DB6A 3ZCUA 3QWFA 4Q3OA 5E0OA 3O2SB 3PXAA 4NXNB 4B76A 1X40A 5B2EA 3RRXA 3UV6A 2EKLA 1PVVA 2G6TA 3LX4A 4L85A 4P4SB 5IASA 2PS1A 3L9WA 2XWQA 1G7SA 2Y6VA 4GP6A 3OZVA 1RQLA 4IIVA 3S1LA 1TM5E 3FUCA 1EZZA 1KOFA 1J99A 2QKQA 3MMPA 1L9XA 1THGA 5B1DA 4OMCA 4B81A 2A1IA 121PA 2C83A 1JFFA 1D9FA 3E5RA 3AXSA 1V2HE 4FONA 4PHHA 2GEJA 3SR3A 3ZY5A 4EAQA 3RC7A 2HX1A 2HYIC 4RESA 4AZ0A 4BGDA 1EM6A 1WABA 1TEZA 1REQB 3F2VA 4TWAA 2OD9A 2HPHA 1NTRA 2AIRA 2XNSA 1YJCA 5EWLB 4HAVA 4BZWA 4BZPA 1GAXA 4CT5A 2REQA 1J0XO 3AYXB 1O97D 3FLMA 4FIZA 3T7IA 3QMPA 2IV3A 2FMIA 1PQ4A 4BAGA 3INTA 2JHDA 1E8DA 1MX3A 2YTZA 2J07A 2J6SA 2FP4B 3C16C 1XJ5A 1IY9A 2QM0A 4HLNA 4EVIA 3EYWA 2JZOA 4UCWA 3OZRA 4BNTA 3CYFA 2G76A 3HP4A 1Z62A 2OO5C 2ORED 2W22A 4KTQA 3LLMA 3GD5A 3OLCX 4WINA 5AJUA 1H05A 3AU6A 5T4EA 1KWGA 3MWDA 3KOZA 3UXOA 4I27A 1KI7A 2QRUA 1MDBA 1BDMA 3LY8A 3SYRA 4D4LA 1K4KA 2D1QA 1Z6TA 4HF7A 2A0FA 3HWSA 2PPVA 3RKSA 1HE3A 3QEJA 1AV6A 4CLOB 1W0KA 1M6VB 3H9CA 1OXVA 2CSUA 3DDNA 3KFVA 4RGQA 1Z4PX 4UBNA 3UCEA 5LP6F 2R8XA 3R8CA 3WFZA 1VLLA 4XX0B 5ED0A 4NS4A 5D3MB 1Q92A 3HYTA 1EQAA 1YRLA 1UR5A 4N3GA 1YS2X 2X0IA 2H85A 2W7TA 3GZFA 1ZQDA 3D1JA 1QO9A 1HT1E 3D7LA 1J20A 2BFAA 3U37A 5TMPA 4N5MA 3G13A 2PV0A 1WB9A 2MYTA 4WI1A 1SVKA 3WIDA 4JQSA 3FDXA 2Q3EA 4UARA 5FFMA 4OIFA 5DB7A 1QHGA 1I36A 3DBLB 3PDCA 5AI6A 1RE0A 3EHEA 2W37A 5FTKA 4ER7A 2NZ2A 3GUCA 3MTGA 4LVOA 4KOEC 3A4IA 3X1YA 2P9QA 4BO2A 3SVZA 2H8KA 3LW8A 3Q0EA 1D2CA 4V1CB 4HAYA 1SA0A 1SZCA 3OCVA 3EC7A 4M86A 1BFUA 3QPBA 1Q21A 4F1WA 4FILA 4R9SA 1J07A 3TRIA 1P0MA 3LQ2A 3ZG6A 1AS2A 4QBHA 3WHIA 5HYVA 3EGXA 4R3UC 4WXHA 2VKQA 2OGSA 1C4OA 4MRPA 3U1VA 3RSFA 1DQPA 1GLNA 3TADC 1YJ8A 1ECCA 3PPIA 4DV7B 5KFYA 2WHRA 4Q34A 1S76D 1EP9A 1UPAA 4LXQA 2Z4RA 1FNBA 5B1IA 1E7YA 3ROGA 4CCSA 4DDMA 3RC8A 1B22A 1KPGA 1XGKA 2RHRA 3DAFA 1NI3A 4GXQA 2YFHA 2FPOA 4H1TA 4X64B 3NPMA 3WQHA 4TKVA 1Z6YA 3UTCA 2ZRKA 4YXMA 3AF0A 3CPHA 2ZRCA 3DLTA 3UJPA 4MUMA 1WUIS 4D6XA 4OOEA 3KDAA 3WLEA 3BT7A 5F9NA 1FMJA 2Y27A 1V11B 4OQLA 3JARA 4UUPA 2PJUA 4N41A 4LTMA 1AT1A 1LJUA 1Y0BA 2VH5R 3JTMA 4FB5A 2LCFA 2YV2A 3Q7SA 4G56A 4ZEVA 2X4DA 1WMSA 3SIPA 2ZBPA 4E30A 1AE1A 3E7XA 4G5FA 1FFUA 3E1SA 1LBTA 3UC5A 4X7RA 1HKUA 5LP6B 4G0WA 1WULS 3HUEA 5CVTA 1XXLA 1PJ2A 3O3NB 1Y4SA 4NNOA 4J0FA 3HADA 1D6SA 1B41A 1WX1A 1PS8A 4AU1A 1GUFA 1NM5A 5CRXA 1RI3A 3G2JA 4AURA 2CMKA 8ICMA 2PZBA 3TL3A 3OO0A 2BCUA 5G4KA 1Z0ZA 1FXWF 5BN1A 4UHKA 2WJZB 1HMPA 2BP7B 3WGGA 2VNAA 2ZIFA 4BHTA 5KOJA 2HY7A 3FZEA 1XIVA 3TSOA 4RACA 1UXOA 1E2UA 4LE0A 2AA3A 2IU3A 4QOGA 4CU5A 1M8FA 1TJ5A 4Z3DA 5HIAA 2DL0A 3P9PA 4LQDA 5FBKA 1K4YA 1G18A 2I3ZA 1UMCB 2FB9A 3FPAA 9ICUA 3RUFA 3WLJA 1J7JA 4MKRA 5KYGA 4R1MA 5AW5A 1YR1A 1SZJG 4M9JA 3RVQA 2CNBA 3OPYB 4ARZB 3A37A 5A2GA 4RKFA 3ZIDA 1ZMOA 1JV2B 1XLWA 3W2GA 1X7ZB 4XVRA 3RUIA 1MG5A 2Q99A 5LXTA 1T0HB 3TIIA 4JEIA 5FWAA 1H85A 1MEOA 3K1YA 4OG2A 4RUAA 2HOIA 5GY7A 1PT5A 4MDFA 1YVUA 1D03A 2D8AA 1Y1QA 5T57A 1NQXA 3KQWA 1NW9B 5AM2A 4LDQA 5K0EA 4NK4A 1V16B 4QZIA 2V96A 4BLQA 1CUKA 2VJAA 4RHUA 4RQ7A 1I51A 1VPEA 2QLNA 1FX1A 2WJPA 1VHTA 3S27A 1MUUA 3SYTA 1ODKA 3FTCA 4ZVNA 3M6IA 2XEDA 2C42A 3JAKA 1Z5OA 1SXQA 1R6DA 4O0IA 1B73A 3CGGA 3L7DA 2GPWA 3E1GA 1JIIA 1MAVA 4WLFA 3ZU5A 5ALOA 3D2AA 4FD2A 4G0ZA 3NTQA 3RH5A 1VHDA 3GLIA 3RJGA 3U4QA 4TURA 1OI4A 3QPUA 1I0LA 4J16A 3RYFB 3NP7A 2YHIA 4RETA 3JVEA 1XSLA 1QS0B 4NH0A 1XQXA 3IO3A 4Q3DA 4UUMA 4INPA 4N3BA 1LSOA 1JLMA 2XXBA 1DAFA 5HIJA 3RU9A 3VO9A 4BO6A 4Y18A 4Q9JA 2I8AA 3HJEA 4O2BA 4YV2A 1V8BA 3S2GA 1E2DA 2ORIA 1ABFA 2PMKA 3DXYA 1E1RA 4YHBA 3SQIA 4B4VA 4EVRA 2ZJ5A 2Y99A 2YZKA 2OORC 4FP9A 1NW4A 4NDNE 2C95A 3RYHA 3U3DA 1J06A 4PQEA 5KFRA 2BTQB 5LQKA 1J97A 2UUCB 2O0MA 2PI5A 1K6MA 1S6YA 4WN9A 3T0IA 4BJHB 3LUFA 4LRXA 4NLNA 2N75A 2AG8A 3A11A 2C61A 3KC2A 3LCJA 5JZBA 5KNDD 4MHTA 2ZRIA 2X3YA 4FHZA 2ZRPA 1ABBA 2ZJBA 10MHA 2QN7A 3PI7A 2Z6VA 4U6QA 5CYFA 5LQCA 3A1TA 1KQQA 1ZPDA 2H2FA 1ULAA 4OQDA 5KNLA 2IE8A 3OVMA 2XUGA 3VGPA 2IELA 4XWGA 1S96A 4Q48A 3RJMA 1XMPA 2L0XA 2HLPA 3GLKA 3EJ6A 3DOOA 4ZAYA 4E4RA 2E8OA 1DT5A 2CVQA 5B2ZA 2YC4C 1LVGA 3HACA 4GC5A 1VPVA 5DBCA 3W1VA 3V8PA 2XTAA 5E6UA 2KFZA 2A1TR 4R0MA 2VAWA 4RZ2A 2Y6UA 4MVYA 3TFWA 3L7MA 4GPBA 4M87A 4L16A 4YFVA 4BLTA 2AOUB 3D8TA 4PYQA 4TZKA 5E2BA 1C50A 7YASA 1G41A 1W47A 1PT8A 2C00A 3EC1A 2B7CA 4A10A 5EMLA 1AZSC 1T4GA 4JI5B 4DFKA 2O05A 3GDOA 2GLXA 1KY2A 2VT3A 3QE2A 2DUMA 4KTTE 3K2BA 3CE9A 4DNFA 1MIHA 5CEHA 8ADHA 3U40A 1LLQA 4L4UA 4JH0A 1H2HA 3SCZA 5BWLA 3VYRB 4I5GA 2FEXA 1W1WA 4YI3A 1SBTA 3WNDA 2XGQA 4C5CA 2W6JD 3JWPA 3PCXA 2E1EA 5JNLA 3OOEA 3ZVKA 4FC7A 1XNHA 4UKDA 4FS1A 4NLZA 2DAPA 1FP1D 1UKCA 4AI6A 5AHWA 4ZRDA 1R6AA 2EHDA 4A92A 3Q7QA 1FFXA 4YK7A 1YQ9A 3UT6A 1OT3A 1UKZA 1T3TA 3W5AA 3PJFA 3QU2A 3D6VA 4OXYA 4Z49A 1T3LA 3B53X 3JV7A 4I2HA 3O8NA 2QX9A 4KXFB 3L0SA 4HDKA 4GMFA 4DCJA 1MX1A 4EJ6A 1N6OA 1RACA 3L7CA 2Q9UA 5JSZA 3A05A 3W0LB 1CUHA 1T5LA 4HNAA 3TRHA 5BPFA 2I1QA 2C9DA 3WL8A 1E20A 1O5TA 3A6FA 3DKPA 3EVTA 4AZ3B 5L95A 1KYZA 1S0OA 2Z9BA 3MBIA 1JMKC 1KC1A 5JDCC 3E22A 2HSJA 2ZT6A 5C51B 3RYTC 1GVNB 3FCAA 3MGVA 3RHZA 2WQZA 5LMZA 4O3NA 4UU0A 4CV1A 4BGUA 4UMEA 3LZCA 1ZIOA 5G1NA 1YQUA 2RBGA 3DCJA 4JODA 3WRVA 4OYYA 3HHPA 1CWUA 3ONFA 2NQTA 2RIRA 2RKBA 3HLYA 3GUUA 5M3BA 4WXMA 1WY7A 3QIAA 3EHDA 2JJQA 1GR1A 1NDQA 2MR6A 2PGDA 3FNHA 2FWJA 1CJKC 2XCOA 3Q3CA 5EHZA 4TRNA 2IHVA 3NIWA 3VU0A 3GGDA 3CHYA 3HB5X 3WSWA 1NW3A 2ZR7A 4MW0A 4PAGA 1B0AA 2FDRA 1NQWA 1IRIA 2C4UA 2NU7B 3BXZA 3D59A 3KAPA 5AQ1A 1KTIA 2RD2A 2BFFB 4UNIA 1IBRA 1FFYA 4QE3A 1LNQA 3V6KA 1NBME 1NE7A 1O5IA 1OGYA 4LWZA 5I7FA 4IDFA 1M2OB 2D7CA 3HFJA 4FLFA 5J0PA 4TX1A 4B48A 1K5PA 2ATXA 5BV2P 1M1ZA 4HB2A 5JZSA 3TOZA 4JYBA 3MFYA 3WYAA 1QTRA 4UXJA 2HU7A 4OHVA 1KQFA 3VX3A 4ZQHA 1ZISA 3RYCB 2H16A 2DF4B 1GAQA 2R6CA 3DOJA 3SJAA 2O06A 1IU9A 1PBNA 3RTCA 1GPDG 5FQOA 1ODCA 1ZESA 4HLCA 1F8FA 4LSMA 1W4ZA 2WSLA 4GQIA 1DG1G 8ICUA 4OHXA 4Z4FA 2JEFA 2YZNA 1AB6A 1BWSA 2FN9A 4GMXA 5FF9A 1VGVA 1RAHA 4YRQA 3LUKA 1R0KA 2W8KA 4MUBA 1LPPA 1Z7YA 2WT4A 3EIXA 4JLMA 1EXMA 4DTCA 4HDRA 3ZE0B 1FYVA 4DLKA 1H8EA 3ZWOA 4H77A 4JNKA 5B2FA 2KJ8A 4C89A 2BCRA 5TARA 4P5PA 3D7NA 3DCYA 2K2WA 2M2IA 4RK1A 5K8UA 2JI7A 2LM4A 1RJFA 4LHSA 5CXXA 1H3FA 4GBED 1PBTA 4V0MA 2GH1A 2YFKA 4GI5A 3UKJA 3V7UA 2DFNA 1XNSA 1U0OC 2JLQA 2POQX 3QFCA 4NY8A 3K30A 5HBRA 4AG3A 1GTZA 3D3WA 3UG7A 2HDHA 4EARA 3ER9A 1F2UA 2IPMA 4JEMA 5FNVA 4Q4LA 3PUZA 4KYTA 1P4JA 1ZYUA 3M9NB 2O2CA 4YJ2A 1GQRA 3OUUA 2MHCA 1FFEA 1ZOLA 4XRHA 1O97C 3LQKA 1E3SA 4M53A 4B80A 4D43A 4TVSA 4UQLA 5C35A 4AS1A 2ZB7A 4Y2QA 1NK8A 3AHIA 1NVKA 3ORQA 1AGYA 4RS3A 4UOEA 4UAUA 2Z8ZA 1T8UA 1VMKA 4M7OA 5JJBA 3GLRA 1RXSA 4O02B 5EJ6A 1DS6A 2D5IA 4P0QB 1UKEA 1WF6A 2JEZA 3OIDA 4HN4B 4RULA 8MHTA 2FDCA 2C5LA 3WNVA 1TVKB 3KSDO 1ZGJA 2I4OA 2YBEA 2LMRA 1N60A 1MT0A 3SEIA 3EVBA 3S28A 5IVPA 5GONA 1RQNA 3WZMA 1NN1A 2VHCA 2JFGA 3BMXA 3INRA 5GJCA 3A70A 4P83A 5ILGA 3RAPR 1C4KA 5ER6A 3X1JA 2LDBA 3PP8A 3VNBA 3ZDFA 6REQA 3ER8A 3TFOA 3H8SA 4NPHA 4IXMA 1IL0A 1IMJA 1KARA 3JZIA 4GI1A 5BXQC 3EYZA 1ZDMA 5GTHU 3T3EA 3PQFA 3MJCA 2A9PA 2D62A 2XE6A 5CPBA 3U7JA 5JCOC 3F90A 2YV4A 2CRXA 1NF9A 3JQAD 4GR9A 1U2GA 2IVFA 1KVQA 1SHJA 4NZYA 4DCCA 5KJFA 3OM0A 2AEMA 1PFYA 4B87A 4H7FA 1DL5A 3E2MA 1NN3A 4OOFA 4UM9D 1Q22A 2NP7A 1H8HD 1I0ZA 1K9SA 1BNPA 4ZQBA 2RDMA 2REBA 4IR7A 3ICPA 4C0QC 4F5ZA 3PR3A 5DYIA 1NXQA 3PRJA 4WNCA 3HY4A 4MLDA 1VZ2A 3THYB 5HF5A 1M2HA 2HM7A 1Q14A 2QUBA 4D99A 2FWBA 4KWHA 1GRQA 4MOWA 4KQKA 1SWVA 1ESNA 2A58A 1ZD2P 3O0FA 2C2ZA 4ZP1A 1VJ0A 3FXAA 4YMMA 2R48A 2JGLA 3UQYS 4MHVA 2VLBA 5JRTA 2WG2A 1QZXA 2QXYA 1ZXIA 2F1RA 3L0ZA 3WGTA 4F2HA 3PV8A 3AFMA 1PZEA 3OE1A 4RK0A 1MVOA 1VPWA 4G37A 2J0UA 3H65A 1QQ6A 4ED0A 4OCZA 4RC9A 2VBGA 3HM9A 2ZE5A 1FJGB 4BJ6A 4PSKA 4WLVA 1ULUA 1IY0A 3HY6A 4M38A 2YKGA 3OMXA 2J6IA 4U7FA 5KX5F 4QYIA 4D6PA 5FTJA 1DIRA 1BVHA 2QW1A 5D3ZA 4U9HS 3PE6A 4BGIA 3GBVA 4TKZA 2AGOA 1NYQA 4X1KB 3GYGA 2Q2NA 5KCZA 5FKJA 3TUZC 3BRQA 3TXAA 2Q3DA 3L8GA 3GT4A 1JG6A 1LA2A 3BN3A 4KXWA 1LQTA 4X91A 1RI2A 2VSFA 1G59A 4KR2A 4FFDA 2HFJA 1EWVA 3CC8A 4JJKA 3WMRA 4BMVA 2QQGA 1PJBA 1YE3A 2O8NA 1ZUNA 5K3BA 4DPKA 1L1FA 2AC2A 3TAQA 1L9KA 2VWPA 2MMCA 3P2IA 4BTVA 1YBFA 3DV2A 4FW9A 3ALRA 3EEQA 1L4LA 2OFWA 1C9NA 2DCUA 1QK3A 1NJYA 3W90A 3EXFB 1WSWA 5AVXA 5B55A 2HD4A 2XNDA 4DFDA 4MQMA 1E1CA 1HE4A 1N8TA 3D0QA 3H6GA 5CFRA 3FAHA 3IHQB 3LUBA 2ODWA 4U8GA 4HQRA 1J90A 4XVHA 2JIMA 1C81A 3RNLA 3VSEA 4INJA 2JH8A 2O2EA 4IIXA 2OCLA 2GTIA 2LD4A 2OLKA 3C3XA 1SXEA 1ZXXA 5DT9A 1HTBA 5ALUA 3HDHA 4E13A 2PZ8A 4IH4A 1TA0A 2QAJA 4LKRA 2Q7OE 7MDHA 4OBEA 4CKYA 1VBNA 3OFJA 5DTJA 3AEZA 4F5EA 3KL4A 1W7AA 1K6IA 3OH8A 3PXXA 3IAUA 3ZDDA 4IMJB 2WYHA 5I51A 2LYBA 1KRPA 1WPXA 1HQCA 3CRMA 3GLHB 3V1MA 1A8SA 2JFHA 2NU6B 1DEKA 1UMKA 3QF4B 1AD2A 2K7FA 1KZHA 5JWOA 1I3CA 5C1IA 3RUAA 4ZI3A 4ROTA 1XUOA 3DBHA 3AVXA 4R71A 4MW7A 3EGVA 2CXXA 4J2HA 1SVWA 2OHHA 2F1IA 3QX7A 4RY8A 3KQUA 4JQOA 3N2KB 3IIEA 1UZNA 2WOJA 4Y2GA 3ST7A 4BNZA 4JP2A 5FA5A 2JIRA 4B8WA 1UZAA 4CDMA 4LF6B 1FF9A 1H1LA 1KY5A 3CCCA 3G2IA 3TDMA 4AY4A 1O5OA 2QVCA 2PX3A 5F98A 2PBRA 3UBTA 3SZRA 8ICYA 2PMFA 4F56A 2OM6A 3L3FX 4KLHA 4Z53A 3QU7A 4I2FA 1RZVA 3JQ7A 3PW7A 3I0ZA 2NRTA 3UGKA 3H2YA 5JNUA 1HEYA 1F6WA 2WWHA 3LYAA 3SMQA 1AO0A 4JUIA 3IX7A 4OU5A 4P81A 5IFKA 3JYLA 1R5JA 4NAVA 1CRWG 1CY2A 1LC3A 1QG0A 2IZ7A 4R8RA 4LWPA 5BSTA 1N2CE 2VJMA 3AKEA 4OK6A 1K2WA 4F6CA 3R9XB 3ASUA 2O1EA 1NZBA 5HF6A 5TQJA 4TSFA 4TVBA 1O8CA 2PDAA 4YRGA 1NKVA 1PG0A 5JJIA 2EWVA 2UXCB 5ALNA 1PV1A 5DSTA 1C4WA 1WO8A 2R6JA 3OX3A 3E23A 2H1IA 4KLQA 4J7AA 4OGGA 4PYOA 4QWMA 1XEWX 4XFKA 4PQRA 2VSYA 2J45A 2ZJ3A 3PDWA 3SX0A 1Y6FA 2JAHA 4MIOA 3DC7A 2NZWA 4MS4A 3G1WA 1BG6A 4KR9A 1NOIA 2I5HA 2FPUA 3HBMA 4HN9A 4L5YA 4NLBA 1KNXA 2B1GA 2O6HA 4KR7A 5IAGA 4BX3A 3DC2A 4H59A 4D81A 1HA3A 3W6OA 4EKDA 4H7PA 5C7YA 5JISA 3DAPA 1BJTA 3B52X 2KVCA 3QFSA 5ETJA 4NFHA 4BKPA 2HT1A 2YQEA 1WKCA 3COVA 2H48A 4FOTA 4P82A 4DKJA 3O8CA 1PJ4A 5IJ9A 3THVA 3NVDA 4RFSB 3C5VA 4YRBA 3FVVA 2OK8A 2XDQB 1U7PA 2DHDA 4FDTA 4MCAA 4B83A 7ADHA 3Q8QB 2RK6A 3AOGA 1QQAA 4GGPA 1EIWA 1CP2A 4CFSA 1NJGA 2ZYHA 4B4DA 3TF5A 1F20A 3LBAA 3ZC3A 4LTDA 1CEQA 2DPJA 2RAPA 2IHKA 4K6OA 2H3IA 2W2TA 5JTIA 4C0XA 4OHWA 4ZYZA 2WHPB 4KYUA 4ND3A 2IE0A 3C1ZA 2UUAB 4DIUA 5HNKA 4U39A 8ICTA 2UVVA 1TEHA 4P0TA 3H0KA 4BX0A 5KFTA 3DM9B 4K6GA 4KLAA 2Q62A 3ZTTA 4CG0A 3DOFA 2JEGA 1GCUA 4KLEA 3EG9A 4ID9A 4J4BA 5JPIA 5LYYA 3NCTA 1BW9A 1PZNA 2G7ZA 2PUJA 2X0JA 1OLUA 1VCIA 2Y05A 2FZWA 3ABRB 3T7EA 3L6DA 2G5HB 2Z5VA 1PKEA 2EAPA 3LGAA 1ORWA 4H6WA 4K4HA 4ZAGA 3JPQA 4M0KA 4BP8A 3GEPA 3IE2A 3NIBA 2Y1OA 4N0EA 2ZRGA 2FDXA 3CO0S 3JTEA 1H5QA 1MNAA 4M8LA 1C7FA 2VWQA 5C9ZA 3FNBA 2FLLA 2IW3A 4YR2A 2NSLA 1SU6A 3R9IA 4D41A 2P3QA 5JYDA 2JMGA 1Y9DA 2G77B 2GKOA 3VR1A 3PY8A 1CZRA 2C2HA 5HJ2A 2AQKA 5AM1A 2ONZA 3NM5A 4U7HA 3NDBB 2C4WA 5AKIA 2B4RO 4F84A 4A0SA 2H0QA 1GEEA 3HN7A 4PONA 3NMUF 5JANA 3D2NA 1LQUA 1MEJA 3HXTA 2GXQA 3Q98A 1QQ7A 1T2FA 3AETB 3NGMA 4HNGA 5J5AA 4COKA 3GRPA 4WY2A 4MMZB 3V3KA 4M1SA 4N47A 4B5LA 1RM6C 3RUDA 1BMFA 3L8EA 2F2AB 2H7XA 2I1LA 4M60A 1XRLA 1YI0A 3D7KA 4AY5A 2I3AA 1QCDA 1PJQA 3GMTA 3L93A 4WZAA 2OYCA 1NPDA 4BAUA 3QKSA 5JCJD 1VE5A 3FGNA 5KJ1A 3GQCA 2BPFA 4E5VA 4RPXA 1AXEA 2VZ9A 4MR9B 4K9KA 5GOTA 2BKAA 2XOXA 1F44A 3DOEA 4TS4A 4ZYXA 3QMMA 2WHEA 4N82A 1CEEA 3BAZA 2P9CA 3JYNA 2BUCA 3NRCA 3QU9A 5TPZA 3N7TA 1IBCA 2G8LA 3MQ4A 4CT0A 1VE9A 1Z74A 3BILA 3A3YA 1XMQB 3UMYA 1VG0B 4TGLA 1Q83A 2FSFA 4KWEA 4AJ4A 1YR3A 1RZ3A 2ACVA 1OXTA 4P4OA 1MOSA 3SLKA 3WGKA 2ZUDA 5BURA 4AKIA 3H5AA 4OUDB 2HXGA 3K8QA 1W581 1KVSA 4NESA 1RBYA 5ECDA 1TADA 3LGSA 3RJ9A 5JU6A 4ZAVA 5CX1A 2XRMA 1LSJA 2IXAA 2KHVA 3G7SA 3IHWA 3K2EA 4RIFA 4HAUA 4TUSA 4YCNA 5F9HA 2CC2A 1QB7A 4DB2A 1RG6A 1E58A 4EAAA 4D46A 5HXAA 4DSIA 2LXNA 1Z7GA 4BNXA 4WKPA 8ICRA 1YZ7A 2J6UA 2M9NA 1V1MB 1WHSB 4IAOA 2PKCA 3I5UA 4TTJA 4C7OA 1U4BA 4O4LF 4V39A 4BZQA 4NFSA 3OZBA 5EHXA 2DH6A 3NT4A 2G5PA 3CNBA 1RKBA 2SICE 1WM1A 1HNXB 1JWLA 4U7WA 4BFSA 4HYKA 1E89A 3STXA 4H1WA 1NWCA 2R8GA 1GCGA 2DPHA 1E1DA 4MVJF 2H3VA 3RBXA 4LZDA 2JIOA 4RHFA 4F3TA 2ESEA 3D5QA 1B93A 2FMTA 3LQ4A 4O8CA 5CH8A 2R85A 3UKOA 1GQ2A 4QUHA 1U1EA 1BPXA 4HCJA 4OFWA 2P9ZA 2WA2A 4OY3A 1N92A 3N3AC 3IBCA 3HWX1 3CLRD 5F3DA 4DIBA 4EGAA 1UBUS 4W1PA 5CB8A 3ROPA 721PA 3CLTC 3QV2A 5I3ZA 4FYIA 2H51A 1FE8A 3KT8A 2WIAA 3HILA 4FFBA 4IJWA 1C1XA 1FUUA 2B8TA 2ZT7A 4IDQA 3BD8A 4HAXA 3ULKA 1MRNA 1ZRNA 4BX2A 3AVWA 2HLNA 3L4BC 1TEVA 1P9WA 2KIWA 1E3QA 3QEAZ 3AP3A 3B60A 1RTKA 3RJHA 2ZG6A 3O3OB 1TUBA 1SU8A 1F4LA 4RMHA 1Y1RA 1JR4A 5J5CA 3COZA 2EF1A 4TMTA 4NEHB 1H2RS 3S68A 4JLVA 3T7TA 1ZQXA 1QGUB 3KDSE 3UUWA 1DKNA 4DLNA 2GJ9A 5A6SA 2XKAA 1KJZA 2GK4A 2WEKA 3IUEA 5BUCA 4O3MA 3BIFA 3P97A 4JV2A 1I4TD 4QREA 1BC5A 1VMAA 2C7VA 4HI0E 1R0ZA 3AINA 5AK0A 1JLLB 5EOVA 4AY6A 1PL7A 2A35A 2RGEA 3CX3A 1I6LA 1T9ZA 4M8NE 2Y0SF 3PFIA 2H65A 3GVIA 4NOMA 5HFJA 3ZK7A 3NXSA 2D1YA 2FKNA 1BE1A 1P45A 1EVQA 1D4FA 1B16A 5J0OA 4LOHA 5DWDA 3W9YA 4Z54A 1MOQA 3U48A 4CF4A 2JKYA 2VF7A 2R2GA 3F5FA 1CRPA 2VP4A 3IR7A 1K63A 4FPXA 4M0CA 2K2QB 2ODAA 1OFUA 1NA5A 4F50A 4ZTZB 2VPQA 3EAFA 4ZZ3A 1M1YA 1ZVMA 4R31A 1T25A 2ZI4A 4A8TA 5CT4A 1TJ4A 4AUMA 1CT9A 1JZQA 3CF2A 4M0UA 3HXOA 5DBGA 5KYXA 2VRNA 2G0NA 2GFQA 3AOEC 2ECPA 3GEMA 3MT7A 4U3JA 5J59A 4NV0A 1AS0A 1NZJA 4B6OA 2ZS8A 2VDLB 3UQ0A 2COEA 4P7KA 3UOAB 4CN9A 4CEJB 1N32B 1BS2A 4ZRNA 3OJWA 3NTUA 4I2CA 2V7TA 3ESBA 1QQ5A 3T4UA 3TQRA 2EZTA 3CONA 3B2NA 2DGZA 3MYYA 4JIMA 4C0BA 3IKMB 3IRUA 1QFZA 3FVRA 5LQMA 3JAWA 4Y1GA 1WQ3A 2GHRA 1GADO 1O6BA 1T0JB 4C7KA 1P7WA 4YJGB 3TARA 4HLUC 2ZQYA 4QYSA 4CEIB 1I01A 3P7MA 3OUZA 4LY0A 4YCLA 1XVLA 2W4IA 2F4NA 5EPUA 4C2AA 4JR2A 5JXIA 1EQ2A 4FQ5A 1QYRA 1CY7A 3HKEB 4Q9LA 1J33A 4OHMA 1I4LD 2WF7A 2FEAA 4O29A 4YLYA 5LDDC 1QOZA 2GERA 1IQUA 1CUDA 5IXSA 5CU7A 1T5SA 3T5DA 1BOOA 2IHTA 3GV8B 1P6QA 2RMKA 2VP2A 3FWKA 2DHEA 4QJ3A 5ADHA 3ZDZB 1CR6A 2WIKA 2O2HA 1CY4A 5JQGB 2YHUA 5JY1A 1H66A 1Q5PA 4X20B 3L46A 3VC2A 1FDSA 5A0TA 5B3KA 1E96A 2NUAA 3T95A 2MSCB 1SV0C 4A1OA 1Z6GA 3PNKA 1T10A 2HQRA 2P6MA 4RKQA 2H3HA 1T26A 4JOSA 1D7AA 3L4KA 4R7GA 4V38A 1M7HA 1IBLB 4DV1B 2PL3A 2NPOA 2OQRA 2X1VA 2FPIB 1IH8A 2R4TA 1V3QE 1T2NA 3C85A 3KIPA 1XZEA 3IYLW 4L50A 4TS3A 2QZSA 1JHZA 1DV1A 1QCCA 2RP5A 1T5DX 3HXMA 2XB4A 1V3VA 3ZH2A 4R5HA 2P9HA 3CRXA 2H9AA 3T5MA 1RVV1 1VSBA 5EE3A 1XMVA 4KV7A 4UBCA 1MJNA 3PR1A 4DRXB 1KIMA 1SELA 3IAM6 1OWPA 3IDAA 1KU6A 4N0PA 4EFLA 2ZUEA 3OCCA 3H2IA 4G1UC 4HP8A 2BFBA 4K9LA 3JQ8A 2PUTA 5K05A 5HEKA 4ZVRA 4YECA 1XJWA 2QPLA 2V9CA 4G25A 5IJ0B 1FFGA 2WTUA 2XQVA 1S0MA 3KRTA 3IMFA 3PG5A 1KO8A 3GZNB 5F12A 4B5KA 3ESRA 5E38A 4QSHA 2O8EA 1NK7A 4NLKA 1VHQA 4H3HB 3OZSA 5DBFA 4FC6A 1U90A 4KMMA 2XADA 3FVQA 4RIEA 1YA6A 1XRPA 4EUEA 4DSEA 3BXEA 2SBTA 5A3JA 2EQAA 1G63A 5CA1B 3C43A 2VTBB 1KY4A 1L8LA 4OJNA 1MA3A 3RHSA 4YR7A 2QB0A 5LNK1 2Q5QA 1N2ZA 2F00A 3M1AA 3MPUA 5A7GA 4CKBA 1M2FA 4BFTA 3RSCA 3IT0A 4RJKA 821PA 4QPJC 5FRDA 4Z6CA 4DRYA 1YACA 2X22A 2ZT5A 4EEKA 2Z2XA 4PX3A 2ZXIA 5FV7A 4B3HA 5J2FA 2XDAA 1SXGA 1YIAA 3PF9A 4BV8A 2OM2A 3KOOA 2FTKE 3V4VB 1D09A 4KHZA 4L27A 3S55A 4E31A 3KQVA 2I4IA 2XCPA 1IFXA 1R16A 2G70A 2C4HA 3K20A 4IIBA 5FL7A 3PC8A 1F2TA 2O50A 4JOBA 1NRXA 2EDCA 2WF6A 4MWDA 4P7GA 1DX6A 2XZDA 4LDZA 3GNSA 1U94A 4HNRA 5K4AA 1CG6A 2PUGA 4ED8A 3V8NA 3D6JA 3J7TA 4MJLA 3N7PD 5AHXA 2V9PA 1N5IA 2RCYA 3BD9A 4Q3CA 1VYHA 3GCWA 4DV0B 1NNEA 2P9JA 1DNPA 1VKZA 4E22A 4M0MA 4BUJA 1OX6A 5L51A 4II2A 8GPBA 1S0NA 2XA1A 1ODSA 3KBBA 1YHZA 3KQHA 1NC3A 3I9NA 4GGMX 4X41A 2Z83A 4PICA 2P2SA 1C9DB 1P4GA 2AOVA 1NQTA 2I34A 1SCUB 2V6IA 3EWNA 3FR7A 4G1CA 4F3NA 4EFNA 5ICMA 4CF7A 3F2IA 1NNUA 2NG1A 4TV9A 4HATA 1G6OA 4NXZA 1AS3A 4URWR 1O2DA 3WIUA 1E6UA 2I67A 4DB4A 2QTZA 2HC9A 4C3UA 5K8LA 2PRYA 3GDXA 2IA5A 3FNGA 4MQ6A 4OGWA 4X66B 1UEXC 1QSGA 2QD4A 3IQHX 2KOBA 1D6JA 1GPKA 2GBLC 2QPTA 1ZVJA 1EI9A 1FYFA 4GW3A 4HAWA 3J81k 2JFOA 3AV0B 3JY6A 2GESA 2IHYA 3DULA 5DN6D 1HK7A 3ITDA 1F06A 3K0BA 3RTEA 1OUMA 1W5BA 1XR3A 4IIJA 4AJLA 1VRWA 2HQBA 5DG7A 1FUEA 3DUFB 1ZN7A 3MXOA 4JJGA 2HBQA 4MVJD 1M67A 3U31A 3UA3A 5KG0A 2O8BB 4Q4AA 2PS3A 3TPCA 3UXNA 3OQNA 1OZ0A 3HPRA 3PUXA 1TDJA 2LIVA 3RF7A 4XPIA 3UTDA 4HQLA 4DA9A 2P62A 2FYTA 1T8WA 1IPHA 5JZVA 1QORA 4IPTA 1LBSA 2WKRA 1NMZA 1LTKA 2PSJA 3GFRA 4UAVA 4LXHA 4NRDA 4IZIA 1ZONA 2BFEA 5BV8A 2ICAA 4JBXA 4PHFA 5HDQA 1FYWA 3JD2A 5JCZA 2FXIA 2KS6A 1TPYA 3C8UA 2BFDB 3MD9A 3PJDA 3AUUA 1GITA 3GT7A 1E2BA 3WBBA 2G9ZA 1QHXA 3QUCA 4HTAA 3WNBA 3EOAI 2IYWA 4CUJA 2PN1A 3B1XA 2C2RA 5JYCA 2GR9A 2OD7A 2QIPA 2YZ7A 4MH0R 2TYSB 4EVSA 4KIFA 1VE7A 4TSKA 4YS6A 1WP4A 3REGA 4EG1A 1Q2UA 4Q12A 5HJEA 1IM5A 3KOMA 2FMFA 2GCOB 3EIEA 1BEZA 2FSVC 4WKNA 4YJHB 2K4MA 1Y82A 4QELA 5EGNA 3TJMA 1QFMA 3UO8B 3H5WA 2I78A 2EXXA 4O33A 5DX0A 3THSA 5IIMA 5BV7A 3C5WP 3CNOA 5DLFA 3JQ9C 4QW9A 3HKDA 1NUAA 2O5CA 1E3TA 1G60A 3KV3O 4TL6A 3EVGA 2HJSA 3EYAA 2X15A 1BVRA 4DF4A 4Q4JB 5FL3A 1KS2A 4CKXA 1P0CA 1RAEA 1U99A 2FRDA 2XX3A 4BMOB 1CQJB 4E94A 2PGLA 4FTWA 3UWSA 4G1EB 4GZ3A 2ISOA 5DO9A 4AZSA 2GEBA 1M0TA 2O2XA 3RH6A 1I2DA 1SKQA 2P2YA 3M6VA 1TYCA 3SV4A 4K9MA 1TUIA 3L0IB 5BN5B 1L4UA 4YT8A 5IKMA 1ORIA 3ZKWA 4IKOA 1QP8A 4LYYA 1P3Y1 5KNCD 1CERA 1SHKA 4NJOA 2BV3A 2HA0A 3BIXA 1IEQA 1S2DA 4LYAA 4PSCA 3BMOB 2OC4A 2MDTA 1W8DA 2EX1A 4J16C 5IH7A 4Q37A 4DKXA 2I7VA 4R83A 3TUJC 1O4WA 3C15C 1T6YA 1DC4A 1XZQA 1Y3CE 2XECA 2Z2IA 2RAFA 2VJLA 3EOBI 5L6MB 3OQIA 5KNDH 4DOMA 1AKRA 2E49A 2WIBA 1HM5A 3CU5A 4PG4A 1KZ6A 4NOKA 2O8DA 1YVRA 1LBEA 1KQOA 3HLKA 1FXSA 3E9EA 4FJ0A 3R6TA 3RAXA 3GJ6A 1Z56C 2QQEA 4HQNA 5GADl 4B3RB 1HETA 2JANA 1VHJA 1W88B 2BKLA 3BJRA 1G64A 3F0TA 1J2NA 4EK9A 4N3CA 3I6BA 2Z58A 4IGFA 2P79A 1DU4A 4I1RA 1Y8RB 5EXEA 1M75A 4I1VA 4TT8A 3CT4A 5FUVA 3IXQA 4KXQA 2X8AA 1K75A 1Z7EA 4O4IB 3KT6A 3IAM1 1ADGA 521PA 5KNBD 4Z4QA 4GYYA 1UFOA 2AF4C 3FH0A 4P0PA 1JR3E 2GN2A 1DAEA 3QBTA 2OWEA 4V02A 3A25A 1JG7A 3BWEA 1JDBC 1YOVB 4XQ8A 4LEIA 1KQNA 2NMVA 3RVBA 1T8RA 4RMNA 3IQEA 1DWQA 3H8JA 2OFOA 5CNJA 4AJIA 4FT4A 5HQ3A 3FKJA 4HB0A 4J0KA 1EFVA 2V3VA 2XWSA 1NKCA 2NXCA 4I6GA 3ISDA 3ONEA 4JYAB 3RFVA 4MR8A 1M83A 4GSKA 4HVAA 3SOPA 3ICQB 2BSQA 3EW9A 1EAYA 3F8TA 3ZD8A 3I9OA 4H17A 3GA5A 2F3PA 4M2LA 1KF0A 4HADA 5DF1A 3D6FA 3O2JA 2BZ0A 2CL6X 4M9RA 2BEWB 2ODPA 4PZUA 3VPSA 5CEJA 4UM8B 4I55F 2YN0A 1VLVA 1EX1A 3ZDCA 1PFVA 1UT8A 3WC4A 1QZ3A 5K0JA 2I7CA 4PGXA 1R3DA 4GO1A 4M1WA 4F6LA 1DK2A 4CL0A 5HK9A 2AF3C 2LPMA 1AGRA 2I55A 3O4VA 3W1EA 4EM6A 5EE1A 1OBFO 4Y1FA 4D96A 2BLNA 3CLSD 5LYJF 2B7BA 1ADCA 2PUWA 2KEYA 2PJDA 2TMKA 4HDOB 1SCBA 3C8MA 4IRMA 4ZVKA 1ZW1A 3V2HA 5FOXA 3VYVA 1E4EA 1T5OA 1CUSA 4WZBB 5CP8A 2XC9A 3KQYA 5IN4A 4X3CA 4XVCA 2Q5FA 5GJBA 2OSVA 4QJ5A 1ISMA 2NU9B 3QW4B 4CL2A 1NNI1 1SCQA 1AM4D 1R0XA 4U6PA 2ISPA 2J9ZB 3HP6A 2OWDA 3DEIA 4U2DA 3VC8A 4FWTA 2UVRA 4FZNA 1SBQA 5L1MA 1M8GA 2CLDX 2G5TA 3P4XA 4JHLA 1E6EA 4QXRA 3CUWA 4X8OA 2X3FA 2O5VA 5KINB 2KVSA 3H4MA 4B6EA 3IERA 4F8EA 3R24A 4LDJA 4RH1A 5G4LA 1A9TA 1DUSA 3G2NA 3F97A 2ONJA 3NHYA 4ACBA 4KMUA 3AVVA 1W5AA 3WQBA 4BMPB 3LYSA 3I6QA 4NLGA 1UDBA 2GRJA 4MFFA 3PLNA 3T1VA 3C2LA 1L4KA 2NRXA 1V9CA 4MV6A 2W2PA 2XMZA 4LFCB 1JIKA 4NIMA 4CLRA 4YRIA 4HH0A 3UG6A 9ICXA 3OKFA 3HSKA 1T4MA 2IUUA 9ICBA 4Z4GA 3H7AA 1HQDA 1DTEA 1EMDA 1KXZA 1ULHA 4Q3EA 2WWRA 4ISCA 2NTNA 5I6DA 4YUAA 1X2EA 3PNPA 4HL6A 4TKUB 2WD7A 5BT9A 2EC5A 2NXNA 1M2KA 2UZ3A 1GUAA 1LS1A 2FWIA 2P4EA 3HE3A 1UDWA 1I24A 1KY3A 1N2XA 2ZIXB 4IHQA 3SDBA 3W2IA 2RE8A 4GLXA 4D3FA 5BWNA 3F98A 4JL8A 3ADOA 1R7RA 4O5AA 1TT5B 2PL1A 4RMIA 2Z3WA 2W6JA 1YHYA 2F17A 3IEKA 5CD9A 1X1EA 1JHUA 4FLMA 1ZZGA 2PZEA 4DT1B 5AVZA 3WGQA 3VDRA 4XJXA 1UXKA 4GNRA 4GM0A 2XZPA 2LBOA 4MLZA 2ZDGA 3FUWA 3H2KA 4B9UA 4G3XA 3NHRA 2ID7A 4YI5A 2JZCA 3BZWA 1K7EB 4OAOA 4RPIA 2PBFA 3H1PA 1FLNA 4FGZA 1PVOA 5B7QA 5JAZA 2ZU0C 4D9CA 1V71A 2PU5A 3AFGA 3NBFA 1WUYA 4ZOAA 4N6NA 2ZSIA 3CZ5A 2XSZA 4IM7A 3A0BU 2AJBA 2CSXA 5KFEA 2XMQA 2WV7A 1OREA 3WOHA 5A5DA 3T6KA 3EDCA 1FLDA 2HBJA 1PF7E 5WRFA 3TL2A 2FN4A 1AMUA 2E18A 1Y5RA 2C07A 3DLAA 3AL0B 4OXIA 1GKIA 3SEZA 5DP2A 4E88A 1Y7LA 2Y0SC 4GU5A 4XYEA 4UJ3A 4QM6A 4UNSA 5H68A 5C81A 4G0OA 5DM1A 3MCUA 3OQHA 5A2QA 1NVTA 2MINA 2VCHA 4MX8A 1RAAA 3T9CA 2GCIA 2VI5A 3R7LA 3TW4A 2W2OA 4MVCA 5KNCH 1CJUC 1BWRA 2QY9A 3U61B 3R20A 1C3OA 4ROSA 1ZQFA 1SXHA 2C9OA 1T1JA 3TG2A 1F60A 1D8BA 1KFKB 4U7JA 1U3UA 3CO5A 4MP8A 4R8KA 2VP6A 2EATA 3O73A 2CMGA 3GI1A 4KO4S 4RXUA 1SV0A 1TKDA 1F6BA 2IBMA 4GFDA 1IBKB 4DFMA 4MV5A 4DLYA 4NVRA 1A27A 1DBRA 2WNIA 4R9NA 2N1RA 4HMPA 4IIDA 3D6UA 5J2DA 1OFVA 3PWZA 4G2NA 3QUBA 2PKEA 1EKXA 4ERNA 1LRJA 2FE4A 4RTJA 5L3SB 5AH0A 4E11A 2ZBEA 4DDKA 4EBBA 4LF8B 5GGXA 2XGOA 2IYEA 1T35A 1T8YA 2WWXA 4EKYA 1GAEO 3QOXA 5CEEA 3S81A 2ZTMA 2LCIA 3EXHC 2I3BA 4H9GA 2NV2B 2ASVA 5BO5A 1RPZA 1N6IA 3IILA 2A0YA 4ON9A 2DHRA 1ZNXA 2G3YA 3P4YA 1UOPA 3QVVA 1MJ5A 5EWFA 2OORA 2QVGA 1RRKA 2WU1A 3NGXA 3OCWA 2XA2A 2AE1A 4CQMB 4RYLA 2NO1A 4WNAA 4DSFA 3PTAA 4AKHA 5AO9A 2JGEA 3EAQA 3EQ2A 4H0NA 1I8TA 2QRVA 2AMYA 1YC5A 4PRZA 2H54A 2BCEA 2D8MA 5HJ7A 2PLFA 4ZJPA 2JRCA 5K8TA 2Q1YA 1TK2A 1EXVA 1LPAB 3AH8A 5CRIA 3IJRA 4XUDA 3R74A 4BNDA 5EIEA 4BQIA 3KQPA 4ZC1A 2PXIA 4YPOA 3R8FA 2AWNA 2FSGA 2J0EA 3KS9A 4G5QA 3DO8A 5F64A 4MP6A 4DLSA 3I1FA 1H2ZA 1UEJA 5GGYA 5HIKA 1XCPA 1YR9A 3PSTA 1V4VA 4UBIA 2QUJA 2BZGA 4EEYA 3H11A 3WKAA 3N0TA 2PGOA 4K86A 4HPXB 1J1ZA <