3R9LA

Crystal structure of nucleoside diphosphate kinase from giardia lamblia featuring a disordered dinucleotide binding site
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
139
structure length
112
Chain Sequence
b'MARERTFLMVKPDGVQRGLVGEIISRFERRGFKLVAMKFFSSGPVCAMVWEGANVVSISRTMMGVTKPAESAPGTIRGDFGIDVGRNIIHGSANLDDAAREIALWFKPEEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Crystal structure of nucleoside diphosphate kinase from Giardia lamblia featuring a disordered dinucleotide binding site
rcsb
source organism Giardia lamblia
molecule tags Transferase
total genus 31
structure length 112
sequence length 139
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3r9lA00
3NGSA 3WX8A 2HURA 1NHKL 1LEOA 3EMTA 1NDKA 2HVEA 2DXEA 2DXDA 2DXFA 5CAAA 3EVMA 3NGRA 2NCKL 3EVOA 3PRVA 3ZTPA 1WKLA 3G2XA 3EM1A 1K44A 2BX6A 5CABA 1NPKA 3DKDA 3Q8VA 1NCLA 3VVUA 3VVTA 1WKKA 1NDCA 2B8QA 4EK2A 2DY9A 4FKYA 1HIYA 4ENOA 1MN7A 3BBCA 3B6BA 1PAEX 3MPDA 3FBFA 3FBBA 1LWXA 4O0NA 3R9LA 1S57A 3ELHA 1KDNA 2VU5A 1F6TA 3EJMA 5IOLA 2B8PA 1XQIA 4HR2A 3BBBA 3ZTRA 1NSQA 3FKBA 1B99A 3FC9A 1U8WA 3EE3A 3FBCA 3GPAA 3VGUA 1BHNA 4UOFA 4UOHA 2AZ1A 4ANDA 1VYAA 3PJ9A 1HHQA 3BH7B 3L7UA 3BH6B 3FCVA 3BBFA 3DDIA 3Q86A 2AZ3A 1W7WA 3FCWA 4DI6A 3EICA 2BEFA 1ZS6A 5C7PA 4W98A 4DZ6A 4FKXA 1S5ZA 1NLKL 3NGUA 3NGTA 3B54A 1JXVA 4DUTA 1NSKL 4C6AA 3Q8YA 1WKJA 3ETMA 1MN9A 1XIQA 4CP5A 1EHWA 1NDPA 2ZUAA 4WBFA 4ANEA 2HVDA 4F36A 3VGVA 4S0MA 5BXIA 3Q89A 1NSPA 3ENAA 1B4SA 1F3FA 2CWKA 3FBEA 3ZTSA 1NDLA 1NB2A 3VGTA 1BE4A 1UCNA 3JS9A 3Q8UA 4ANCA 1NUEA 3EVWA 3ZTQA 4F4AA 1HLWA 1BUXA 4KPCA 1PKUA 3VGSA 3ZTOA 3GP9A 1S59A 3Q83A 2DYAA 4UOGA
chains in the Genus database with same CATH superfamily
3OL7A 2ZH7A 1SB6A 1GTHA 1SL2A 3SSQA 4X4RA 2F5GA 1FDDA 4RNMA 3NEKA 2YWFA 1JX4A 2KXNB 1N6QB 3NRBA 5HVGA 2BYCA 2XCPA 2DEIA 1M1HA 3GV8B 3C6UB 2C2MB 5E41A 4IH7A 3POTA 1U1RA 4DR6F 1WG1A 2GA7A 3VZHA 1D09B 4DLEA 2AT1B 4ZPCA 3PACA 1E6YA 1IJFB 3W64A 2GHVC 3QT6A 2EBEA 4J9UE 2VFRA 2YX1A 4QIEA 3BN4A 4NA2A 2XM3A 3OTOF 1VCTA 2AJ0A 2UXBJ 2DGQA 2L3MA 3T5KA 1F60B 1T0TV 1S7IA 4WF9Q 4Y6IA 1MROA 3RBZA 1FDNA 2UVRA 3M6XA 2LQJA 2PMHA 2RHSB 3THTA 4P7VA 5KFLA 2MKIA 4USTA 4ANCA 3OXFA 3FDSA 4OYBA 4UOGA 2QLBB 1NDKA 1RTIA 3QT7A 1U6BA 2HQCA 4PYAA 2KHDA 4OZ1A 4RW8A 3NS6A 3R1LA 1NRKA 1TZ0A 5BYRA 3I0RA 4UUXA 2COLA 3P45B 2YKQA 1H73A 3PX4A 1VR6A 2BE9B 1C4CA 1WACA 3OVSA 3MMBA 1N0UA 2ZH5A 5KT5A 4KTQA 2M0GB 3DRPB 4PWWA 5B0FA 1RA7A 2X1GA 1O5JA 4OZ3A 1RE1B 1UEKA 5KT4A 2AYMA 4OYWA 5KFZA 1HI1A 4Z7YA 1FRHA 2Y1LB 3NGUA 3WIUA 3J80U 1F0XA 4O4GB 1MN9A 5D4OA 4DWIA 4DR2F 4USWA 1VHFA 3D6TB 5BXIA 4ZJOA 2VG5B 4B3OB 3QT5A 2HNDA 2DIVA 1YITS 1HD1A 1TUVA 2FJEB 2JZ5A 2D1CA 5AT1B 1N36J 3LP1B 3AH6A 3PEHA 3LWMA 2YNFA 4KHMA 2ZEJA 2RRNA 1VS3A 1XERA 3FNNA 3M2RA 1HI0P 2B5JA 3D1QA 2V8HA 2CWXA 2HLTA 2YXLA 3S7RA 1WKLA 2CFXA 4RNFA 4NLDA 2IC3B 5E7OB 2WVDA 4PQAA 2ZD1A 1UVNA 2BABA 2ACYA 2FLLA 1DTTA 4ED4A 3EJMA 3TEGA 3A4TA 2HK3A 3BDEA 4QW8A 3SQOP 3MCSA 3OL6A 3N6NA 2ADCA 1IKWA 3TYTA 5GAHI 3BH6B 3ENVA 3ILOA 3CJ2A 3AXKA 4KKOA 3DLEA 3GYXB 4DL4A 1RTDB 2BKOA 1BLUA 1WOPA 1PBAA 3GSDA 3H59A 4ELTA 5IM0B 5HBMB 3LP0A 1YBTA 4ID8A 3T5JA 5L1JA 2CPJA 4OYZA 1RU1A 2UV8A 2DHXA 3B78A 1FEHA 1S77D 4QWBA 2POKA 3CDUA 5KG4A 1VC5A 2D41A 2DXFA 4L75A 3PRVA 5HP1A 3JSBA 2EC0A 5JXSA 1FT8A 4ZIWA 2AF6A 1JXEA 3C15A 4GVBB 1TU0B 1VI7A 3OSPA 1IJEB 4HACB 2CPFA 1VQMS 3IFEA 3M2VA 2ZM6F 2HWHA 4PXDA 4ZVQB 3M9OB 3BO4A 2Z2MA 4IRDA 4HR2A 1FK9B 5KT3A 4MIWA 1UEUA 2OELA 5J2QB 1N88A 1UPPA 2BBEA 2QYGA 3BKFA 3MOZA 2KFYA 4RBVA 1NSKL 3HP6A 3CD6S 2HIYA 1CULA 1GMVA 4N47A 3QSYB 1TK5A 5F8HA 5KFXA 4PUOB 4CO5A 5L9NA 3ZFVA 1S99A 3N6MA 2HVEA 3HK2A 1AFIA 2PC6A 4KV8A 2GVDB 1ZTTA 4ZK7M 1BC6A 4WE1A 2K3KA 5HLFB 4KHPJ 2WRMA 2X1AA 4I56A 4R0JA 3EZ5A 1Y10A 3OHAA 4ECXA 1SC3B 1CJVA 1KD1T 3AJ1A 1HNZF 1JLCA 2OSRA 3J81U 3FBCA 3PCOB 2BKNA 2RUGA 3IR6B 4LFAJ 5A8WA 4YN3B 1VQLS 2W9BA 4DZDA 2I9SA 1S79A 2BOPA 2XZTB 1ZBTA 2CNKB 2HBYB 3OUYA 3CJQA 3GIKA 5MLCV 3D0HE 4CM0A 3HHLB 1B70B 1TL7A 3KLFB 4USHA 2OPRB 3ILJA 4PG6A 1N52B 1JLAB 2W25A 1U09A 4JV5F 2CPZA 4NXMJ 3ZZTA 4DJBA 3ZTOA 4DMZA 2W7OA 1I3OB 4AQYJ 2JL9A 3G82A 4OHWA 5CZXA 2HAFA 1H7XA 2VG7B 3R97A 2VBYA 2CA9A 1QAYA 3DOKA 3TO8A 1RU2A 3EWGA 2BJDA 1Q7YT 2PD1A 1NKBA 2GMHA 4F50A 4Q45A 4MK8A 5CCMA 2V2VA 3KHLA 4RR5A 2V6AA 2VPXB 2PT0A 3HVTB 3A1YG 3NCPA 1VYAA 5BR8F 2AZ3A 1T03B 3M1VA 2OEMA 3BKUA 3W60A 5BJRA 2XNQA 4FNIA 1FFGB 2Q79A 1S1WA 2P6SA 4NASA 2MJUA 2NXNA 1T9UA 4ED1A 1EKSA 3KHGA 3P4UB 2EVZA 1JXLA 1RT3A 3CJKB 1CPZA 3Q8UA 3MOJB 4M5DB 4ZPBA 1B7FA 3CJTA 2AYBA 2KFNA 2XS7A 1LWCA 3CUNA 2LQ8A 1YJ9S 1SC4B 2LDYA 1UL3A 1TKXB 3IWXA 2AGOA 4MFBB 1S1TB 2RSQA 4JI6J 3M8SA 1RWXB 1GQEA 3ELHA 4K0KF 4LF9J 4IG0B 3CCRS 1UFKA 4PXEA 1PC5A 1MMNA 4DV4J 3BF4A 2EG2A 2JLEA 4RW4A 2VJVA 1HW9A 1F2GA 4KY3A 2C2RA 4GC6A 2VOPA 1GMWD 1U1MA 2KTQA 3UQSA 2OKQA 4YR0A 1C0UA 3GFYA 3G8TA 2ZBPA 4PG7A 1W25A 3P3DA 3G8QA 1G2EA 4S0MA 2DHSA 5MAOA 3W61A 2MYFA 4H4KC 1SJ4P 3P8BB 2BXJA 3IAS9 2DCLA 1YWXA 1WI8A 3IA0A 4Q43A 3QRQA 3GV7B 3W9JA 1XN9A 3J7Z5 3RR8A 1M5HA 4WWSA 4QQBA 2IM1A 1NPKA 3BPDA 4MMOA 5FLXU 1CG2A 2YVSA 1S1VA 4GO5X 5F8LA 2CQ2A 4JI7J 5K14B 3PZPA 4NXNF 3L3CA 3QO9A 3G71S 4YP3A 3DDKA 5CD4H 3FKBA 2HZAA 3F0NA 5FD1A 5I3UA 2GIFA 4ETZA 4TU8A 2IRUA 1YRXA 2GC8A 1Y3JA 4DI6A 2BEFA 2UXDF 4XPCA 2MKCA 1FJCA 4O44A 1OYEA 4ZPTR 1X9MA 2MQOA 2QZ8A 5D8HB 4OX7A 1VBKA 3FZBA 4DV0F 3C6UA 4X65J 1UVIA 4ILLA 2HLUA 3D9BA 4PRFA 5C25A 4K5RA 1TMJA 3C3LA 1QE1B 1LWFB 4H4KA 2UVWA 2W2MP 1KR4A 3GONA 2KYZA 4Y3CA 3PEJA 1IUJA 2LU2A 1A0OB 3I5BA 4F3MA 1RT4B 1X4BA 3SCLE 3K7RA 3S8SA 2DGOA 3D66A 1X4FA 2W9AA 5L1KA 5K9FA 3CCTA 1S49A 2DK2A 1W2IA 1JLGB 2N3LA 3SIPB 1WOSA 3UCUP 1Q95G 3TUJC 2HHWA 2CQDA 3PKMA 1ZOTA 3J7ZT 1T3NA 5A6PA 1F5CA 4JOUA 1FD2A 3THPA 3OVBA 1KFDA 1IKVA 1QD1A 5KFRA 2CIMA 3LANA 1Y7PA 4WFXA 2FHMA 4A48A 3Q24A 2OTJS 2FYXA 2AKWB 1SI9A 3C16A 2I6WA 3I32A 3M9MB 5KFFA 1SL1A 1QUPA 2CDQA 1IKXB 7AT1B 1U25A 3D3BJ 4UT4A 3IM8A 2ZH3A 1VJQA 2W9CB 4AL5A 4YS2A 3M6VA 1MN7A 2PMZD 3V81A 1W26A 4KGKA 5E3CA 3ITHB 4KFBB 3T9ZA 2JEGA 3F56A 1JKHB 1AYEA 4N7TA 3TX0A 3AJDA 3WX4A 3PKYA 5KOXA 3TZZA 2H54B 3MEEB 2VG5A 4B3OA 3QWPA 1GTEA 4CZCA 1CLFA 2VIHA 2AP6A 2HGMA 4LVOP 3MAAB 5KFNA 1Q8LA 1OY6A 2Y0SD 3M6WA 2D3O1 3ILIA 2FJAB 3OSNA 4MK7A 2IC3A 4CM2A 2W2NP 1H74A 3LGHA 3MTKA 1YHQS 4WFNQ 5DQIA 2IFXA 1YJTA 2ZITA 4F0KA 4NL5A 1FXDA 1HPZB 1R8BA 2X1BA 1GEHA 4PPZA 4N8OA 4X62F 1VBYA 5EUHA 2V8GA 4HHUA 1XR6A 2FHKA 1NK4A 3MPVA 4MYTA 2UP1A 1YJRA 4LFBF 2BE7D 1UVMA 1RTDA 3CCSS 4RX6A 5DM6Q 4OZ0A 1KS2A 4C3KA 2KRBA 2RKIB 5IM0A 3R3TA 3DU6A 4BWMA 5HBMA 3IWNC 3UVJA 4JI4J 4RZRA 1S4FA 2B43A 1UA0A 1V5IB 3FMBA 1S48A 1XMOF 1QVGR 3IBCB 4YHHF 3MUMP 3U1MA 5C42B 5CHCB 2Y1RI 2ZH4A 3OLAA 5DG7A 4DZ6A 3RJMB 3PW7A 1IWAA 1TVRB 4KRWA 3QJJA 2H1YA 2QLWA 4IH6A 4P2SA 5M2PA 1WC6A 1S4EA 3K5OA 2ADBA 4HACA 5T7LB 2ZDOA 4X4TA 3JB9k 2YWKA 3CMQA 4NEYA 4QWCA 5DQGA 2H5EA 2MMYA 2PEBA 2BJEA 3O3LA 1VC6A 2YWGA 3PVXA 2N7CA 3UR3C 2X7IA 4CI0B 3MFIA 4ZJLA 2DXEA 4F0HA 4R8UB 4LRFA 5J2QA 3HHLC 4F4YA 1Q4RA 2GJIA 4ZVPB 2IYGA 5GAEI 2M88A 1RHUB 3KUHA 4DV2J 2ZWOA 3VAJA 2O1PA 3IAM9 2FQQB 3Q0AA 5EDWA 1WUUA 1FKOB 1FESA 2MLYA 2OFHX 1J5OB 3WZ0A 1LXNA 2MEWA 4ILMA 3DM2B 4ANDA 3ZO7A 4PUOA 1NU4A 2ASJA 1S9EB 1J27A 2UXCF 2C2EA 3NAHA 1RTZA 2C3YA 3EGWB 2VA3A 3IRXA 5CH7B 1FRLA 2Q3PA 4YMEA 2YNIB 1S9GA 2RF2A 4DUTA 4X4SA 1TQLA 4DR4F 4F36A 2GZOA 2DR6A 2KG1A 4USUA 4HKQA 4KQZA 4ZVGA 1SJRA 3HF5A 5LMUF 4M5NA 3BN7A 1FNMA 3UO0A 4LMZA 4LR7A 1HWIA 3HX9A 3MM8A 4DV6F 3TJAA 3EVMA 1EAYC 3ZZ0A 4HH1A 3RB6A 3MM5B 1AROP 3J81j 5KFTA 3HLUA 2AJQA 5FDLB 2JC1A 3AXMA 3MPUB 5LT5A 2G0JA 3ZZRA 2EEYA 1FI4A 3SBMA 1S12A 1AW0A 5IC6B 1H72C 3M2UA 3HHLA 1SQGA 1F6TA 1OSDA 4RUHA 1U1OA 3PW2A 4EWTA 1JLAA 1YJNS 4F2RA 1YX2A 4NLTA 1HNIB 4IG3A 2X3DA 3TUZC 1U2CA 2VASA 2IHR1 2WSEC 1TP7A 3C2PA 1SJ1A 2DNZA 2VG7A 1DJ0A 3ISND 2VQEJ 2AYGA 3SXLA 3SFGA 4OLOA 2CQ4A 3HKZD 2YKMB 2MQQA 1UTAA 1HLWA 3GR0A 1HHSA 3EGNA 4KC5A 4PQUB 4F4XA 1HWUA 3HVTA 4FZVA 4QJVA 1IBKF 3CD7A 2FHJD 4WYLA 2W8LA 3IGVA 2QEXS 2Q1LA 1T03A 4M5HA 4OFZA 2CJBA 1RHKB 2JEFA 4FYVB 1C0TA 5K8NA 4NYZA 1M5PC 3A3OB 3U1LA 1TK0A 5KG2A 3C8YA 3H8YA 3KG4A 4MYUA 1B99A 1ITPA 3CJKA 3TAPA 1KQFB 4M5DA 2DNGA 1X4HA 1H2TZ 1QUVA 1KVJA 2XQCA 2OP5A 1X5OA 3DLBA 2ASDA 2FGOA 2J0QD 1EP4A 4ZJQA 1U0SA 2HQGA 2B9XA 3JSRA 4PWUA 4D3GA 2GJ2A 2GQQA 4MFBA 4ZOSA 4WJBA 5DM7Q 1S1TA 2BW2A 2EFGA 3PY8A 3UPFA 3R5BA 2GIRA 1NB2A 2QE5A 3K5MA 3JS9A 2HRTA 3VAKA 2H5IB 1YGYA 1TUGB 3AT1B 3L9ZA 2OJ3A 1M5SA 1VISA 1RT1A 2UU9F 2MSTA 4U6PA 3Q23A 4ED5A 1FWKA 2BX6A 1WKKA 4DQPA 1S6OA 3BB5A 1ZAVA 5KT2A 3BGRB 2FZGB 4ZHRB 2RAQA 4OYAA 1YG0A 4I7FB 4YR2A 1J2VA 1TFWA 3GJTB 4O3RA 1RA6A 5F0WA 3HPOA 4C8NA 3GMGA 3PO4A 3BBBA 2CPEA 3UD3P 2ZBIA 2PA3A 1G3OA 2OH2A 2QL7B 2HG4A 1P6TA 1RSCA 4RNNA 2BQ3A 4DOZA 4DX7A 3BSOA 1UZDA 3QWUA 3MMJA 2UUBJ 2YWWA 3V6KA 2LDIA 3X3UA 2ZDPA 1EJ7L 4DUYF 4F7VA 4Q8EA 3UFCX 1SV5B 4KO0B 1GX6A 2LQ5A 2EXUA 4BWJA 1BQXA 2I5JA 4XIUA 4NLWA 5K14A 2BDPA 1B3TA 4LSNB 3UCZP 2R7QA 2DNKA 2FLNA 1RWVB 4NCBA 1ROFA 1S1XA 5J2MA 2MDAA 5HMZA 4OJGA 1TKZA 2OFGX 1F5AA 2F4VF 4ES2A 2VOOA 1R0CB 4OYMA 4A8FA 2N4CA 4NLXA 2YBVA 2LEPA 3MF5A 1FTCA 1KVKA 3OXGA 1CBKA 4JI1J 2Z58B 2R7XA 1LOUA 2KRRA 4B9UA 1YKWA 1BQMB 1HR0J 4DFKA 3G4SS 1RTJA 3QZ7A 3KMQA 4FYWB 2FVPA 3N6LA 4O4RA 1N5YA 2Y9HA 3I5AA 4FKXA 4F0MA 5CA5A 5KFJA 1QE1A 3RBDA 2KT5A 5C24B 2PGCA 4FF1A 3OHBA 3K57A 1PJ5A 2VJUA 3BSNA 2H51B 2M8HA 3CCJS 3RW7A 3J80Y 1Z4UA 1L3VA 1I1GA 2R8JA 2VODA 2IA0A 4HHJA 3DOLB 3SDEA 5GAHU 3ZZYA 1MWZA 4DLGA 5M2RA 2QN6B 4DR7F 5DRKA 3QIDA 4ZCMA 4OLPA 3UN2A 4P75A 5SUHA 1YQHA 2O67A 3Q8RB 4NOHA 3W63A 4CH0S 1GK8A 2A1BA 1MU2B 3M8QB 1DBDA 1PG5B 2WVCA 4XO0A 2O66A 4EEYA 3RW6A 3QFWA 2ILYA 1NK0A 1JWWA 3V5RA 1KNZA 2N82B 2C2DA 4U67Q 3MD1A 4JBCA 1APSA 1NH7A 5F9NA 4Q0BA 4DR6J 4RO0A 1FA0A 2NXUA 4FBTA 1XNQF 2NXJA 4KE5A 1EB0A 1L3KA 1AA1B 4N56A 2W9CA 2AW0A 2QJ3A 2OEKA 1NNDA 1HI8A 2D3ZA 2KH9A 3OTOJ 1Q86T 3T1HF 4TQSA 3QPIA 2NQPA 5LSLA 4ZN3A 3FEXB 2QTWA 3GG1A 1DARA 3MAAA 4LUBA 2RDIA 1TUWA 4BC9A 3ZZZA 2OI2A 5U47A 1K8AT 2PN6A 3GWCA 1RCXB 2QA4S 2HRUA 3F44A 1QTMA 2G9OA 3KLHB 5DZ6A 2DY1A 1IM6A 1HPZA 2E7VA 3H20A 4ICLB 4B17A 8AT1B 1HBNB 2XZWA 3BKTA 1K0VA 4GMKA 2NXCA 4G6VB 4EBDA 4UF4A 1R0AA 1C4AA 1Y5NB 1UPMB 2E1AA 3PYDA 4GKJF 2I1RA 5IXUA 3NMRA 4M5GA 1B7YB 4LRAA 3PX6A 2BE2B 4KIAA 1HMVB 4FNHA 4ZP7A 4F4AA 4UY85 4DR2J 4KHRA 2YKNB 1FJGF 1HNVB 2DNPA 3LPYA 4XDCA 2KJWA 2RILA 5C42A 3W1YC 1RISA 3KFWX 1S6QB 4DR5F 2HQIA 1MLAA 1U6FA 1N54B 1TVRA 1VRQC 2XULA 4DPXA 2WOMB 3GIMA 3FBFA 4C97A 4ZIVA 1RT6B 4OYIA 2PFDA 2UUWA 1N56A 3NGDA 3G6ES 2DNOA 3HHKA 5KFQA 3IG1B 1VDHA 5T7LA 2YTCA 4ZCKA 1S7HA 1X4DA 3OT9A 4JI8F 1D1UA 2L41A 4J7CA 1UVLA 3U02A 3J81Y 1RXOB 3ISZA 5IT0A 2V4JB 2ZKUA 4R8UA 3QGPA 3T9NA 4G65A 5K8MA 3W7BA 1RADB 3PRBA 4L76A 3K2YA 4ZITA 4X4PA 1HNWF 4BBYA 5ETLA 4ZPAA 3A13A 3QMQA 1YI2S 4QR2A 2V4RA 3BGFA 3VGTA 4JI3F 3HM9A 1FE4A 4O3QA 1PBUA 3DM2A 2QIFA 4J90A 4P52A 2Z30B 3MECA 1S9EA 2HNZB 1LW2B 1VBZA 4ENOA 2CVEA 2H4YB 2YNIA 2LXIA 3H5UA 2AYEA 4ES1A 4BHQA 3R7BB 3NXZA 4QU7A 2D9PA 4WK1A 3N01A 4QBUA 2JSXA 6FDRA 2W4DA 2B3TB 3MM6B 2A2DA 1XMQF 1PJ6A 4Y2KA 3W9HA 2XI2A 3H42A 4Y2CA 2HMIB 4W4MA 2V8VA 2ZM6J 4F3QA 2DRBA 2QMUB 5A0YA 4UY8T 1HW8A 3JXOA 1R0BG 2IDEA 3EXYA 2ZE2A 1UZHA 5FDLA 4N5SA 3M6UA 3EGZA 4RUBA 2CZ9A 2Y0BB 4L6V3 3DGPB 2MQNA 3CD0A 1Y5IB 2MY8A 3OL9A 2CDRB 1Q81T 4LVNP 4GRSA 4I64A 4DBQA 4DL6A 5DG9A 2BRKA 3G87A 3W2VA 3ZTPA 3CCMS 4IR1A 5KFPA 1EZZB 4IFYA 4WTOB 4E0DA 2B8QA 2XY7A 1FXRA 3I55S 2AQ4A 4FS1A 3PW4A 4HYKA 3JYTA 1DAXA 1JLFB 4QZVB 5CZVA 4C2MA 2XTJP 4USKA 5LJ3Y 4LRCA 5LM7E 4C8KA 2DO4A 2HBRB 2WONB 3Q2TC 3DRSA 5EHHA 2GO9A 4PQUA 4YUDA 2ROGA 1AT1B 2IBOA 3GR1A 1G4CA 2PDAA 4Q2LA 1HBUB 2V2QA 3GIRA 2KVIA 4N8NA 3FSIA 1CS4B 4ZA1A 1TL3B 2J9DA 2D3UA 1OSCA 2DNYA 1UVKA 2DT9A 2MQLA 1K1SA 1ZPWX 2MY7A 4JI2F 3W8PA 4YB1P 4DV1F 2ATCB 2EPIA 1N32F 4YOEA 2UUAF 1RAJA 4FBUA 1YZ6A 2DR8A 4B9MA 6FD1A 3EDQB 3RR7A 1SUQB 3MEGB 3KNAA 3C46A 2VFVA 4DSIA 4J9LA 3L09A 2HNYA 4JV5J 2DHAA 3DRRB 3MEDB 4J9NA 4Q2MA 2F7VA 3TUPA 4TNOA 2HHHF 1ELOA 3LAKA 3FJ2A 3IC1A 3WHIA 1T05B 1NMEB 1U48A 3IGNA 1H0HB 2VPYB 2DHGA 3T6JA 2IVFB 3GFHA 2AHOB 4EU0A 1ZETA 1CC8A 1I6JA 4FF2A 2MJNA 3M8YA 1U1NA 1X0FA 5BR8J 1CJKB 4ZHRA 4PG4A 5J2PA 4I7FA 2WSFC 5RUBA 2J7UA 1VQ9S 3QJLA 2DNRA 2W4CA 3T1AA 4CYUB 4I2PA 1T3OA 4WP9A 4I2QA 4H4OB 5CYMB 2R7WA 3VGSA 1NK8A 3A12A 3TNVA 2J7WA 3TA0A 3OD2A 3W62A 4CH7A 1OJ4A 2RH3A 3DLHA 4U9RA 3RBXA 2W1BA 2FUG9 2HQFA 4O3PA 1V6HA 1GH8A 5IWAF 3Q8VA 5A6WA 2HFZA 1QSSA 2CNLB 1RWPB 3M8ZA 3AAWB 2ZWPA 2AGQA 1LNQA 4UQTA 1SV5A 2ZC4A 1SQFA 4KO0A 4DPTA 5KFKA 4B08A 2UVUA 3N79A 4WIIA 4C8LA 2W4PA 2IAJB 3SV3A 5F9LA 1J5EF 4WKYA 3DLKA 2B0GA 1VRUA 1R3NA 1HWKA 4KGMA 3UWTA 2ZKTA 4QWEA 2L9DA 2WW8A 1NKEA 2ALYB 4NZ0A 3H4BA 3HVAA 2V94A 3MD3A 3H5XA 4DPUA 2F1FA 5KAKA 2B4PA 3TAQA 1N5VA 4F3OA 4M95A 1IQTA 1SJ3P 4QPXA 1BQMA 3KUEA 2FC8A 4O3SA 2RHQB 4B9LA 3CCUS 3H0PA 3H2UB 1AUSL 1RTHA 2F65A 3BM7A 1DTQB 1F2HA 3GU0A 1M1KT 3HO1A 4ECRA 5HL7Q 5EGYA 4DU8A 2ATLA 1RT7B 1VRTB 1M0SA 4CIOA 1S9FA 2VU5A 2R7VA 2HHPA 4TLRA 3R5DA 1KVIA 4LR8A 4NXNJ 1RYSA 1NHUA 3FCVA 1SKRA 1RYRA 1FTRA 1W7WA 2JVOA 1YRTA 2ZUGA 4OZNA 2J6SA 3VF0B 1Y11A 4YY3J 4OV6A 4LF1A 2XHCA 1MU2A 1QJHA 3V4MA 4C0OC 2UXDJ 3PW0A 3LH2S 4CO3A 2VZ9A 1T9WA 2VG6B 2Z2YB 1WHVA 2B9EA 2HAIA 4KGVB 2BRLA 3HD1A 1LEOA 1FRKA 2XMMA 1OQ3A 4USVA 4QIVA 4DV0J 3CIZA 4X4VA 4ED7A 2QLJB 2DD8S 4E98A 3Q8QB 3M30A 1Q7LB 2VH7A 4FYDA 2ZH9A 4C8YA 5KT7A 4DS5A 3FBBA 3RYLA 3KK3A 2XSJB 3MM9B 2AMCB 4CT9A 4WYWA 2MGZB 2C22A 4R5PB 2E1CA 4Q8FA 5GAEU 1DZ5A 3VAFA 4CDIA 3RAMA 1JLQA 1SCJB 3AA8A 3DN9A 2RU3A 1P27B 1BMQB 1CSJA 4QU6A 2YH0A 2IDLA 3I5CA 3CT9A 1IBMF 2F8EX 2YWHA 3CB4A 1QLNA 5ETKA 1JJHA 5HQMA 2IM3A 3ENAA 1HYSA 3FCHA 3FBEA 4ED8A 4OJHA 4LBIA 1MWYA 1WF2A 2P9GA 3NG8A 3SFUA 5K8PA 4O0IA 3GJRB 5HROA 1GMWA 3KLHA 3LQVA 5G4DA 3Q83A 2OLWA 4MT1A 2OMOA 2P9CA 1NZAA 2Y3YA 4OI4A 4DS4A 2E1PA 2JHEA 1QAXA 1RCOB 3Q22A 4ICLA 5AXLA 3GFZA 1K0TA 4Y00A 2KT2A 2YWEA 1N5TA 4M5KA 4QOTA 1S10A 1FRMA 1N8RT 2CQ0A 2I38A 2K7JA 3V6DB 3ENWA 2J8AA 4UOCA 2ZBCA 1K47A 3MMCB 2BE2A 1LW0B 2Z2ZA 3DLLQ 2C2KB 3TZXA 1HMVA 4PZVA 1WG5A 2OPQB 2CG8A 3BO3A 2KM8C 3VZIA 4QIWD 2YKNA 2E5GA 1HNVA 3I87A 5DDQC 2R3VA 3CCES 2IA6A 4C6AA 2X1FA 1S6QA 4ZP8A 4Z37A 4DL5A 2WOMA 5AXNA 2BOAA 4F67A 1O6XA 1RT6A 2VKRA 2LXFA 4DX6A 4A8QA 2NSCA 3L7OA 3WQPA 2EFPA 3TRGA 1IBCB 5D0GA 2DNNA 1UWBB 2GCFA 1GT8A 2RQCA 3OR1B 2GGPA 1RBAA 4X62J 3DKDA 4AQYF 3MEKA 5K20B 2V4JA 4L74A 5C5JA 4OX6A 2R2RA 1VFJA 1RAFB 2GAHC 3AD9C 4A8XA 4O0NA 4IUFA 4TU9A 3I96A 4LFBJ 4ZVTB 1IBLJ 3W2WA 5ETMA 5L46A 3MMAA 3TVZA 1C1BB 1T7PA 2BM1A 1IKYB 4M1KA 4IYQA 4F4KA 4PXCA 4CTAB 1UJ6A 2XYGB 1XMOJ 5H9FK 3M32B 5AXMA 4V19J 2DITA 2MZRA 4J9MA 4YHHJ 2K2PA 2R8IA 3NL0A 4KPYA 4L73A 3NMAA 4ZKAA 3N4WA 1FXLA 4MKBA 3OTDA 3AD8C 2FVCA 3O1LA 3QLHB 4OJ1A 1RABB 1MNEA 4EBEA 1UJ5A 1ZAWA 3UE2A 1T9VA 5H9EJ 2XMKA 5GADI 4C8ZA 1LFWA 3HSJA 1A7GE 1HD0A 2DEJA 2XY5A 3M05A 3TANA 4LSLA 4M5JA 1ZM9A 3T19A 2B6AA 5I3QA 1S0NA 2FDNA 2QV6A 2FGCA 4JI6F 3KOAA 3OFGA 3QGHA 3R27A 2D69A 5KFIA 2AV5A 4GVLA 4LF6F 1YDLA 5IS2A 4UQGA 3D2WA 1U4BA 3ADAC 1Q78A 5HQLA 2HWTA 4E2FB 2CPDA 4JV1A 4LQ3A 2FTRA 3D5MA 4DCOB 2F63A 2UXCJ 1WWHA 3G6XA 1UJ4A 4C3MA 4ECZA 3VTIA 3IBWA 4UTGA 3I31A 3HI9A 1JLFA 1WC4A 3KKFA 2E5JA 2HBZB 2W7PA 1R89A 5E0OA 2V8DA 1FKPA 4DR4J 3KNGA 4QYZJ 2WONA 2DXDA 5B7WA 4FF4A 2UUCF 1SH3A 2RQ4A 5LMUJ 2CZ4A 4RW7B 5F8GA 2J0WA 1O0PA 5E33A 3E01A 4NZ7A 1RWKB 1NXIA 2OD4A 1HBUA 4NLPA 1VQ4S 1VLOA 2MLXA 1OQ6A 1I94F 4DV6J 1WSRA 2KDOA 2AEJA 5KFGA 4J91A 2W2PP 3H2VE 4TXSA 1TL3A 1FCAA 1LWXA 4JI7F 4EUVA 4FP9A 4BC7A 3QATA 3JTPA 1KN6A 4UOFA 5J1EB 1ZM4A 2VQFF 5I42B 4LF8F 1QSLA 1P8GA 2PFFB 1FRJA 2W8KA 3LO3A 3MGJA 2Z4PA 2QA1A 4IFVA 3GZ7A 3NP5A 4ELVA 3MCOA 1YZ7A 1R8CA 5B0EA 2C3OA 2LCWA 4CO4A 2MKKA 1HQEB 5D6GA 4QW9A 4F4ZA 1FFWB 2FJXA 4ZMMA 1RHJB 4PYDA 4OHVA 2VB6A 3D6FB 5LL6d 2K06A 2Y8WA 4D3HA 1H38A 4LIWA 3PW5A 1U1KA 5I3PA 3L7PA 1U6ZA 3HD2A 1SKWA 3DMJA 2UUTA 4NRTA 4UZBA 1SVDA 3H90A 2XO7A 1CJUB 1R31A 2M8DB 4MH8A 4A8OA 1IBKJ 5LJ5Y 4ZVRB 4CO0A 2E1RA 2P2CB 4C11B 1CJKA 2B8PA 4DX5A 3SCJE 5H9FJ 5L8RC 3TX8A 3VAMA 1NAQA 3M8PB 4YQWA 2AJ4A 3GPAA 2LVWA 4IRCA 2LP4A 4DF4A 1KC8T 4ATNA 1WTBA 1HARA 1S0MA 4MK9A 3TAMB 1JLBB 2X51A 2Z2LA 2NLWA 3PX0A 1HQUA 1N0VC 1NPPA 3H40A 3R5JB 3ETMA 5D4PA 4Y65A 3DLJA 4OV1A 2IMOA 1U1LA 3WDOA 2XZDB 3ISNC 1QAJA 2HHUA 1UVJA 2R7SA 3WC2A 2IAJA 3W9IA 5ETRA 4TLQA 2PE8A 4USJC 2EBGA 2BJ8A 4FPIA 4ZPVR 2VV5A 3SEOA 2G2OA 2UU9J 1S57A 5IOLA 1T8EA 5J1NA 3K8WA 4LF5F 2KI2A 2YNHA 3LPEA 1MROB 4J9QA 4URQU 3SYZA 3T1YF 1JNRB 3BGUA 1TKDA 3FCWA 3AOBA 4KGXB 4KGZB 2BQRA 2MLZA 4OZJA 4WIQA 4QCLA 1DFDA 1WKJA 1DTQA 1HWLA 1SBRA 4K7QA 3M9NB 1XNRF 3GYGA 4LR9A 2PSZA 2RDDA 3Q8SB 3M7VA 3GQCA 3DHXA 5F0UA 2ZZNA 3CTRA 5THWA 4PG8A 5BYQA 1E6VA 3MMBB 2W7AA 3E3XA 3P49B 2B56A 2LXUA 3D67A 4ID5A 1QDUB 1NJYA 2N4DA 5DETA 2V69A 4GO7X 3FFIA 2GFFA 4LQ9A 3OTCA 3QGGA 2WB1D 4C0BA 5GAGU 1HBMA 3B8HA 3GCXP 4X4NA 5FJ4A 2F4VJ 2J8SA 2V68A 1M5OC 1NJIT 2UZAA 2FHJA 4ZLJA 4M63A 2DPIA 2VG6A 8ATCB 3CJSA 4DUZF 4FDFA 2BA9A 4DSLA 2QG9B 2MZQA 1NK6A 2FC9A 2ALZA 3I6PA 3KK1B 5LXYA 1PC4A 4JI5F 1WEXA 4ECVA 1MWQA 1PGZA 3R6LB 3DLGA 2HS4A 2CUYA 5C2CA 3MUTP 4G1QA 1HWJA 2O3DA 3M2RB 1KWMA 3DU5A 1C1CB 1KTQA 2B5JB 2RRBA 4CLUA 1TTHB 2XY6A 3R1HA 3OPKA 2XNRA 3Q89A 2LA6A 1FX2A 3W66A 5L39A 2XSJA 1OS5A 2ZOFA 2EI5A 4NI2A 1NDLA 1U1PA 5HI7A 4HVZA 3DRXA 2MGZA 3VAHA 1FNXH 3M8WA 3QNWB 4WZQA 4R5PA 1DTTB 1WC3A 4JYAF 1Q5YA 2PI4A 2NCKL 4DR7J 2P9EA 2DNLA 3KLVA 2KN4A 4P74A 1IKWB 4F8RA 3B6BA 3GV5B 6AT1B 4KKOB 2XGQA 2UV8G 3SSSA 2XC9A 4DV2F 5A8KB 2OSQA 3R9LA 2ILZA 2V9KA 4EMDA 2CQIA 4JP8A 5ETPA 2QLXA 3W65A 4PKDB 3RRKA 1HNXF 4DXLA 3UDCA 3QJPA 1WF0A 2J9CA 4UUWA 5GMEA 4IOBA 4OYOA 3TQ1A 2DR5A 3RB4A 1NDPA 1XNQJ 3AJ2A 5HP1B 2E5IA 3NNAA 1X0PA 2C2NA 4DL3A 4I6AA 3C15B 4OHXA 5ETQA 5ETOA 3V6DA 1NUEA 4C0HA 4K4WA 1P1TA 4B9NA 3MMCA 2HHTA 4ZVSB 4DG1B 2IVMA 5KG1A 1LW0A 3KJQB 2J6TA 1EKRA 3VQTA 2ROEA 1REGX 4TQRA 3T1HJ 2OPQA 3S01A 5KTQA 1H7WA 3LAMA 1IXKA 5KFMA 4CNZA 1NJWA 3OW2R 2JRSA 4LF2A 3RUBL 2QO3A 2DCUB 4HTJA 2IM0A 3GG0A 3GFXA 1HA1A 1CULB 3HZEA 3GJQB 2CPXA 3VCDA 1NJXA 2QL9B 2AX1A 4ZP6A 3PG9A 1RAAB 1ZAXA 1LQ9A 2GHPA 4PWDB 2GHWA 1AB8A 2O01C 4TY8A 2CPHA 1N48A 2CKWA 4KV8B 4AXJA 2HS0A 3IMQJ 4AYBD 4WE1B 2EK6A 3CPWR 2RU9A 4G1IA 2GO8A 4K8RA 5D77A 1TMMA 2N3OA 1OPZA 1SJQA 1BWEA 2G2YA 3BSCA 2XMAA 2ZC3A 2YQ0A 4GKJJ 3QSIA 5G0RA 3EPIA 3V6JA 4NA3A 1NHKL 1CJVB 1VQOS 1IKYA 5F3ZA 3FSYA 1UFLA 2HHSA 1ZA1B 4C8MA 3HSDA 5B0AA 5J2NB 3AQOA 2YNGB 1FJGJ 3M32A 2E66A 3A8EA 1RKJA 1WEYA 1OMSA 1V3ZA 3UR0A 1ZTWA 3MPYA 4EBCA 3HHDA 1OO0B 1NEEA 4DR5J 4DL0C 2U1AA 3OUYB 2G0CA 3QLHA 2EKNA 3DFEA 2I0XA 2OPPB 5F3TA 3CDBA 1Z2ZA 3RAXA 1N6QA 5A76A 2HVIA 2R7RA 4ZVUB 2D7SA 2HHQA 4JI8J 1IR0A 2AX0A 2CQ1A 4DEZA 2D74B 3V6HA 4PCQA 1AZSB 1NH8A 2ZOGA 2LU1A 4TU7A 3THVA 2J5AA 2FJWA 4F4WA 3TZWA 1HNWJ 1Q1KA 2ZH2A 1RHQB 4BCAA 3WX8A 3R2DJ 4U8YA 5T14A 1UWAA 3I0SB 4EGLA 2VPZB 2KZMA 3UW1A 3W5XA 4HH0A 4JI3J 2F8HA 3SQGB 4QR0A 1S6UA 3NNHA 4U7UK 4M8LA 3FZ2A 1RDRA 3N5BA 4J9PA 4O3OA 2IRXA 3KG1A 5HN0A 2P6TA 3DGVA 5HVFA 1YJWS 4B3MF 1RP5A 1X60A 5DO2A 2ZBRA 5CXTA 4RWXA 3OXLA 3A8KA 1U02A 4PPDA 4F02A 5H1SV 3RG6A 5KFWA 2V4QA 4F04B 3AFGA 4OZLA 3CC4S 1XMQJ 2GW8A 4KH0B 3NS7B 1NSAA 1RT3B 2WK4A 3QGIA 1WORA 4WFZA 4Q7AA 3NGTA 1S76D 2Q66A 3RB0A 4ZLNA 4P73A 1HL6A 5B08A 5IT9Y 4WTYA 3DRPA 1NSPA 1IN0A 2M5YA 2VONA 3MWBA 4IO1A 2IM2A 1U24A 3CDEA 1U2FA 2DYAA 3KJFB 1GNKA 4O4GA 2VDIA 5J1EA 2DR7A 4U7CA 4DPYA 5HQ8A 1BQNB 2Z57B 4CLFA 4WK3A 1EQ0A 3MAHA 1T9TA 5ADZA 1FF2A 2OEJA 4DQRA 2BM0A 3NAIA 3LP1A 9ATCB 2E7XA 2HFVA 4KSEB 3V4IB 2E44A 1CQNA 5A2QU 5LMNF 3MI7X 1C0UB 2OIHA 3CMAS 1Q82T 4K4ZA 1XBWA 1Q8KA 1L5UA 3FRZA 3Q86A 3O5TB 2AEMA 1L3SA 1VOMA 2W24A 5DJBA 1YVFA 2V5HG 4MKYA 2HWIA 2IVYA 3UNYA 1QAIA 4CLSA 1V9OA 4X66F 1NB7A 3BR9A 4HT7A 4LRBA 1CJUA 1DLOB 4WPAA 2C3PA 2H48B 2BANB 2WBRA 3LWLA 4C11A 1OY9A 3KHRA 2DKOB 5KOWA 1XC9A 1TL5A 3KLIB 3QO9B 3CCWA 4JI2J 4DV1J 4HHHA 1SIZA 4A4JA 5CYJA 1N32J 2UUAJ 2EW9A 1JQGA 4FKYA 5I3UB 3CDAA 5DLFA 2PI5A 1WDTA 3B4MA 4XTTA 4B3TF 4NYOA 2IPOB 4DCPB 4HDGA 2LMIA 2OTLS 4NRUA 4O44B 1BD6A 2XS5A 4IDKB 4WU2A 2PA8D 3BSAA 3U27A 2HHHJ 4ITSA 2VFUA 2EKYA 4DQSA 3BGOP 1VHIA 3PJ9A 3GSIA 4GVBA 3C66A 1SKUB 2IIHA 3UDVA 3TVYA 3LTOA 2Z0GA 1LK5A 3KMSA 1FK9A 2H65B 2LA4A 5C25B 1N5QA 5IZHA 1SIWB 4LBHA 4PAAA 2DJWA 4DSEA 5EWGA 2YKAA 3TW0A 2ACMA 3ZNJ1 2J6UA 1LWEB 2XLJA 3AB4B 4FVCA 5JVGQ 2ZNYA 3TA2A 3H4DA 2R2UA 2P8IA 1KTVA 4RW9B 1FRXA 3EZUA 2KG0A 1FD8A 5IWAJ 3JTOA 3HHNB 5HO4A 1B64A 5KFCA 3FEZA 4NE9C 2GVDA 1ZZFA 3H25A 2NXEA 2GVZB 1GXUA 3O2IA 3ZXWA 2XMUA 1BHNA 5HLFA 3AA9A 1IKVB 1EETB 2HPUA 1FHTA 1RBLA 1QY7A 2X3GA 4JI0J 2LYVA 2JOQA 3R5CA 1EARA 2CJQA 3C16B 2M3DA 5E2QA 4X64F 4OHZA 3A3PB 1XR5A 4FF3A 4W90B 3HJVA 2VHGA 2FVRA 1J5EJ 2R8KA 3HSZA 4B3RF 1VIXA 4C8OA 5M2UA 2LEBA 2CJAA 1SKSA 4BDPA 1P1LA 2VC0A 1OIAA 4DHVA 3V81B 1WF1A 2HZCA 2R8GA 2IRYA 2XLKA 2WSCC 3MAQA 2MKSA 3CW2C 3KLFA 1IVZA 1VQPS 4V19X 2JNJA 2RE1A 2OPRA 3KK1A 2BVZA 1TFYA 4OJ3A 3DYAB 4OI1A 4M94A 3UDLA 2DR9A 3O44A 2DH9A 1C1CA 4A8MP 2CJYB 2IYIA 2YKPA 4FYYB 1WC0A 2M9KA 2NUHA 1MW7A 2K1RB 4LJMA 4HDHA 4H54A 1VIOA 2ZH6A 1F5BA 5B0DA 2E9ZA 2RRAA 3US5A 4LF7F 5E3PA 2I8EA 2FIUA 1JJ2R 1MMDA 3CCVS 2FJBB 1SJFA 1RWUA 4XK8C 4DV3F 3E2EA 1Q8IA 3CXCR 3W5ZA 5A8KA 3HJFA 3OBIA 1N34F 5ITHA 1IR1A 2W2QP 4Y2MA 4DV7F 2B9YA 4CT8A 4A8KA 5L9XA 2MQMA 3UVJB 4F2SA 3H5SA 4FS2A 2AEFA 5DZ7A 4OI2A 4AT1B 4ELUA 2Y1JA 2BZ2A 4HI2A 4GKKF 2F8MA 2KB2A 3QRPA 3TWZA 4NLSA 3TI0A 3DNCA 2JLFA 5GADU 2MQ8A 4RW6B 2ZJQQ 3D68A 3EE3A 4DFMA 5DG8A 1TKXA 3HKWA 2E5LF 3LGMA 4DG1A 3KHHA 1N33F 2FY8A 3M4XA 1S0OA 4IG0A 5KFVA 1RI7A 3TA1A 2W2OP 4K4XA 3QQCD 1T9XA 4ECYA 4CO1A 2BQUA 4DN0A 5A8RB 3D4JA 4OI6A 5EN1A 1RACB 3CJ5A 3R7SB 3ZTSA 1VQ5S 2L08A 1IBMJ 4ILRA 4KPCA 3JQJA 4RUAA 1S59A 4A8WA 4ZCIA 4NPOA 5B09A 3EMTA 2CQPA 2AJ1A 3N28A 1UETA 4WXOA 2OO4A 4OX9F 5CCLA 2DGXA 2A3JA 1IQZA 5GVQA 4Y28C 3U7JA 1GMUA 4PWDA 2FZCB 4HT5A 3KXDA 4FPRA 1WI6A 3IRXB 4AE5A 4ECSA 1B0PA 4X4QA 1T95A 1S9GB 2RF2B 3OL8A 1RWNB 3ZTRA 1GFWB 2R8HA 5D0EA 2BACA 2Y1IA 1VQYA 2R42A 1S6PB 3BEGB 3UD5A 1ZZNA 5DS7A 4I6WA 1EX8A 2RUSA 3AY0A 2GIQA 4TYAA 3W8GA 1YRUA 1FERA 5J2NA 3MM8B 2YNGA 1NO8A 3R8YA 3EYZA 8RUCA 4ERDA 2LECA 5DDOC 5GMKa 4G3IA 1CJTB 5AJ3J 4OIXA 4ZDNA 3P6YC 2XG8A 4RNHA 3M2UB 2RT3A 2KL8A 2OPPA 5JJBA 4K5SA 1D9FA 4XAKA 1JIHA 4HEA9 4NCGB 3CJ4A 3HFZB 5K8OA 3LW5C 2XB2D 7FD1A 4IG3B 4OZ5A 4AUKA 2CJ9A 2RDJA 2CPIA 4UW2A 2GQ2A 3HVRA 4BS2A 1AZSA 1LWFA 4UZCA 1RT4A 3NKYA 2ZH8A 2NPFA 1UEVA 2AIRB 1TK8A 4MTPA 3DXSX 2QMWA 3VAGA 3I0SA 4LFCF 3J7A1 3SQGA 1HFEL 1TL1B 4NWBA 1FVSA 1JLGA 4DR1F 1WSVA 3HFKA 3LALA 3PRDA 2A0FB 4J9KA 2LFVA 1Q0NA 4CLZA 2DNHA 2JC0A 2JWNA 4RNOA 1C0TB 4P9SA 3PIPQ 1KQKA 2WW4A 4DN9A 3K8VA 2NS1B 5KG0A 3AOCA 4YR3A 2RS2A 4NLQA 5GMDA 4OL8A 3Q8PB 4X4OA 2VF3A 1RLDA 2DO0A 3G6YA 1Y0HA 2ZFHA 1IKXA 1EP4B 4ED6A 2WZ1A 3MXHP 1HHTP 2HGNA 3KTQA 3BPSP 1DHMA 2GMJA 3VR1A 5L1IA 2K8GA 3ITHA 3SCIE 4KFBA 2R7UA 2ZNZA 3CO0P 4ED0A 3EPGA 5HATA 1KRPA 1JKHA 2C42A 3PDNA 5B0GA 1BQNA 2FZKB 3MEEA 4LF6J 4CQ1A 4O3NA 5HAOA 3G86A 1RT1B 1KLMB 3TJ8A 1F9HA 1DQ8A 3KLEB 4U95A 4NYPA 3TUIC 3PTWA 3V4IA 2GJFA 3MR3A 1X9SA 2CZVC 2QSFA 1T02A 3GCWP 1BY9A 2AWZA 4JV2A 2QA4G 4I4BA 2E7WA 3MDFA 3OR2B 1UW9A 3VVUA 1NPRA 3DRYA 1RWWB 4XDDA 2FHOB 4DF8A 2UUCJ 2QC3A 1KFSA 4B3SF 5ETNA 2HFSA 1A9NB 1DLOA 3AODA 4A47A 1S72S 4P6QA 5E5NA 2BANA 1I94J 1AXQA 4WFBQ 5DDPC 1Y00A 4P71A 1RAIB 3KLIA 3IN5A 2I5JB 2HQDA 3HSGA 1K1QA 2BW7A 3EX7B 2RKIA 4I67A 5AE1A 5T41A 4LSZB 5HMYA 2Y8YA 5GAGI 4DSJA 4JB8B 1D8ZA 2IJFA 2H5JB 2VBWA 2VQFJ 3KG0A 4YY3F 5KT6A 1ZYQA 4LF8J 1S1XB 5J2MB 4B9SA 1TKZB 1U0HB 1FNOA 1FEEA 2CQGA 2DGVA 2CPYA 4OMFG 1U8SA 4N76A 2BV3A 2YPZA 1RT2B 3I9ZA 3G6VA 5DGAA 4ZP9A 1T94A 4IDKA 1C2PA 4CLLA 2HURA 4MIBA 1CC7A 3NBPB 3BO2A 3UDEA 2YY3A 2KJVA 3EM1A 3HT0A 1F1BB 3KDNA 1XR7A 1AFJA 3W3SA 1RTJB 3FQKA 1KHVA 4DFPA 1N5YB 5J1PA 1JMTA 4K4SA 2NR0A 1ULRA 5HSPA 3MM7B 2MZTA 3VGUA 1SXLA 3SI8A 1LWEA 1OWXA 3SDEB 2Q6CA 2DNQA 3TJ9A 4ZN1A 1D3WA 1FKOA 4EYIB 3BQ1A 1J5OA 2DGTA 4J9RA 1ACMB 2E9TA 2OPSB 2ZUAA 2CJKA 4RW9A 2RQMA 3JQMA 4ZLPA 5IV4A 4DR3F 1F3VA 1FKAF 4WP3A 1O51A 4QIFA 4QWAA 2HYIB 2YKOA 1PKUA 2GVZA 4NX9A 3NGSA 4NZ6A 2VD3A 1RT5B 2CNNB 4RLEA 3BR8A 2MZJA 4LIRA 1EETA 2RQKA 2GNKA 2WBMA 2J0SD 3LUYA 3N9UC 4JUZA 4RBTA 3FVYA 3IS9B 2BJ1A 1NK7A 4Q0BB 3MPDA 2K3IA 3CJRA 4TKTA 1PO6A 3CCLS 5DDRC 2BMBA 5JVHQ 2JEJA 4K2JA 2HBQB 3MM5A 2QGFB 3Q2SC 1NSQA 3U1NA 2E9RX 2C2ZB 1Z1ZA 2XI3A 1XMBA 1K9MT 4LF4F 4C7QA 4CWBA 4LF5J 2R7TA 4Z2XA 2V2ZA 1TKTB 3B54A 3OQ2A 1NBEB 3T1YJ 3ULHA 3MCMA 3DYAA 2ABYA 2L48A 1O8BA 4DV5F 5BYSA 5IQQA 2FD2A 3CC2S 4RU9A 4LREA 4ETXA 1HNIA 3BJYA 2ASYA 1X7VA 1VK3A 1XEZA 4U96A 2M52A 2V34A 2K1RA 3H2LA 2AU0A 2LQBA 2B51A 1XNRJ 1U45A 2FPHX 2B9WA 2Z56B 3ZNUA 1NCLA 4Y34A 2YKMA 1WJ9A 1PAEX 3I4PA 1XK8A 2LKZA 3D0GE 3KJVB 4K50A 1HNZJ 1CQMA 3BZQA 3NS5A 3GLJA 4CLTA 3BYRA 4CRJA 1R0AB 3EUNA 1IBLF 2VFTA 2M7SA 1EIYB 1U8WA 2DGWA 4RL1A 1KBRA 3VAIA 3BBFA 3DDIA 2G4BA 1RB0A 3IR7B 5C7PA 4DUZJ 2IJRA 1LV5A 2BJ7A 2APOA 1D9AA 2J76E 1XIQA 4I68A 2HVDA 2XWYA 3QIPB 4JI5J 4NLOA 1VQ7S 1QM9A 2GV1A 1TAUA 3N0VA 1UCNA 3EGVA 3JSMB 2HHVA 4RW6A 4AL7A 4X84A 2QYCA 4ECQA 5EWEA 5KFAA 3ET6B 3TOQA 4OHYA 3BS9A 3J7YU 3R5GA 3UNGC 5AXKA 4CLPA 2F9DA 4X2BA 1VK8A 4JYAJ 5F8NA 1Y3KA 5A8RA 4X4UA 2JFDA 4DX8H 4ECTA 4XPEA 3PR4A 2ZOMA 3OJSA 5IT9U 1LXJA 1RHRB 3HULA 1QSYA 4FVMA 3BGRA 1DRZA 1NK5A 2UXBF 2F4FA 2HK2A 1RBOB 4NMLA 4LBPA 1U47A 2NPIA 3JAMY 1M5VC 1HNXJ 2D9OA 1BXNA 2VBXA 3MECB 4J9SA 2JFKA 1S0VA 1CEZA 3DDNA 2ZZTA 2V0NA 1URRA 3E8OA 4N41A 3K17A 2PO4A 3ZC4A 1X31C 3PXGa 1S6PA 1OY8A 4CNYA 2DRAA 2FB0A 4ALZA 4J9OA 4EZ9A 3PR5B 4DFJA 4M5IA 5A0YB 4LSNA 4K0KJ 2FLOA 3RGIA 3VHQA 1OYDA 4MKAA 1UAWA 4P2XA 3D1HA 3T5HA 3KK2B 2ZE2B 1CJTA 4HTIA 2B4VA 4UOHA 4DL7A 4CLWA 3K58A 2QMXA 5DQHA 4DQQA 2XEXA 2I2YA 1PJ7A 2QA2A 4NCGA 1N36F 4IH5A 5LOQA 2HHXA 4WBFA 3W2VB 1FJEB 4DU7A 4IFYB 1IR2A 2CQCA 1F3FA 1RQ0A 1Y4ZB 2QSWA 2CAJA 3ILLA 2BJ3A 1RWMB 3IXQA 3ZTQA 3JYTB 1DY3A 1WHXA 3C6TB 5C24A 1YJVA 2MTLA 2DRDA 4TYBA 4Y2IA 2R2SA 3KUGA 3DRSB 5KFBA 2MQPA 3DOLA 2H9ZA 4HI1A 4I69A 1ZM3A 2A6OA 1TL1A 3HFVA 2HVHA 4ZVHA 3NNCA 4Q5VA 5HK4A 4K4YA 1RWOB 2VDHA 3SCKE 3I56S 5A2QY 1H6KX 3BQ0A 2M4MA 3CD5A 2J9DE 2WAQD 3D28A 1ZA2B 4LT6A 2DTJA 3CMES 3M8QA 1GXTA 1L3UA 3T3FA 1WOOA 2ZJPQ 2L9WA 2UVVA 4FXDA 3QAEA 1FDBA 2C1EB 2DB1A 2HNYB 1N4LA 2ASLA 3TARA 3BREA 3IO1A 4KJIA 2MXYA 2IMWP 4K2XA 1BE4A 1WD6A 3CJ0A 2LEAA 3HVWA 4CH1A 5SZTA 1RLCL 5EX3A 1YTYA 5KFOA 3I9V9 1XJWB 3EDRB 1X4AA 4ZVEA 2DIUA 3A3NB 5D15A 2J9EA 4IQMA 1YIJS 1DQAA 4DSKA 4CCHA 3NWGA 1TAQA 4DPOA 3PFEA 1PILA 1H2UX 2HS3A 4USMA 2CADA 1KLMA 4ECUA 1FRIA 3KLEA 5IT4A 3UN5A 3OTEA 2NZ4A 4B3MJ 3VALA 5J2PB 2WCXA 2KKHA 1H2VZ 2AJFE 4QPTA 2CVIA 3DXBA 2JLGA 3EICA 5JMNA 4I2PB 2XMWA 4I2QB 2KXHA 3PYGA 3QRRA 1P9QC 1RK8A 1S5ZA 3OR2A 1X4CA 4CP5A 2XMVA 3MTJA 1QTNB 3NCQA 3LP2B 2HGLA 1R7IA 4QIGA 3PFOA 1HBNA 1PYSB 1TV6B 5DLGA 3KJNB 3SV4A 2W01A 4YB6A 3S1TA 2XMTA 2OUGA 4KHPF 4QWDA 2QFIA 1HBOB 3HMJG 4L3NA 3BQ2A 3FUYA 3NCRA 1RKIA 3OFFA 2RIJA 3DLKB 2VC1A 3FSXA 1VRUB 5HMXA 4G1PA 2ZHOA 2B4UA 2CRLA 3QZ8A 4J5OA 1U0HA 2ZH1A 4LFAF 3OVAA 3HZGA 3OFEA 1RT2A 2VFSA 5LSRA 1H3DA 1FFSB 2OHDA 1SC1B 3BH7B 4IOAQ 5LMNJ 4GC7A 1VQNS 4AFFA 2ZBQA 3VV2B 2QLFB 5D3GB 3BDPA 3NBPA 2RB7A 3IG1A 1FWLA 3MFHA 2KYXA 2FJVA 2FJDB 4QR1A 2A6MA 1P9YA 5KFSA 3WBZA 1G6BA 4NXMF 2CNOB 2HW3A 1KQSR 2NREA 3MPWA 1PYOB 1RTHB 3A8IA 3K5LA 3FQLA 4C98A 4X66J 2RMLA 1IM4A 1JB0C 2JJ4D 1PIEA 3MM7A 4LRDA 2MB0B 5DGBA 1V3RA 4ZLLA 3PJWA 3K5NA 2J7KA 4YEAA 1NHVA 4WFYA 4A8SA 5B0CA 4KYZA 1I5OB 2ZJRQ 2HFOA 2O5DA 3FK4A 5L1LA 3LGNA 1VGYA 2HVZA 2EFQA 2OPSA 5EWFA 3C14B 3JTNA 1L3TA 3NGKA 3A8JA 1REVB 3W5YA 1KOOA 2HNZA 1LW2A 2AJ2A 4B3TJ 4KBIA 4HL9A 4NLUA 5LSOA 4URGA 3J7AN 5CYQB 1RT5A 4RKUC 1R6YA 2XCAA 2SXLA 1K73T 2CQHA 3MM6A 1KKHA 3DI6B 2R2TA 3KLGB 1R8PA 2NZCA 4K4UA 2FLPA 2MKHA 2HMIA 3IS9A 4P2FA 4ZCLA 2YX4A 3DOMB 3M30B 4KH1B 5KFDA 2ZHBA 2DISA 3KK3B 1MMLA 1M5KC 3MZIA 7FDRA 3AD7C 1Q8BA 2VL1A 2WTFA 4WCEQ 2EC2A 3BGLA 3H98A 3V2UC 3CJ8A 3DGPA 4LF9F 1PAUB 2Z8QA 3TVKA 3R2CJ 4KAIA 2DY9A 2HRYA 1TKTA 1JLQB 4DV4F 1ZM2A 4PXBA 1QVFR 3TP2A 2RS8A 4IQXA 1TR0A 3H7HB 2KHCA 4M5LA 3G8SA 4USIA 2ROPA 4DCJB 3S6EA 1NZ8A 3PJXA 2E5HA 1U26A 2G2ZA 1W2BR 4NMXA 5HJYA 1X5PA 5IFMA 1WELA 2CYYA 5JUMA 1HYSB 1BGXT 5KFHA 4ECWA 2HIQA 3NOCA 4P7TA 4M5MA 5HROB 4MJKA 1UA1A 1JLEB 1JXVA 1WTFA 3RTVA 4C3LA 4X64J 1A6LA 1H98A 3GE9A 4ZS6A 2YQ1A 3I4HX 2MSSA 3CC7S 3KJVA 2G1HA 4B3RJ 3HCXA 3UI3A 3T41A 1RGVA 3ICLA 1CS4A 3RZAA 4BLGA 1KP6A 1WDDA 4OX8A 4ZVOB 4H4MB 3I82A 3C19A 1BWVA 5D4NA 3FEYB 1X9WA 3G96A 2GAGC 1SC6A 4ZPDA 2G1DA 3P5TL 2V9WA 1WG4A 3AOAA 3K59A 4C4WA 3MR7A 3DCAA 4RWWA 1KOHA 2JVRA 1SUQA 3CE8A 3MEGA 4I0WA 3QIPA 4MKVA 5HANA 3MHYA 2IY5B 1VBXA 3DRRA 3NY0A 3MEDA 2KXFA 3SZ2A 4KB7A 1S1UB 5LXRA 1IWGA 3JSMA 5D4LA 1R8HA 3F41A 1JK9B 2H3EB 3CSKA 4W98A 1X5TA 3ET6A 4OI3A 1RHMB 1Z2LA 5B0BA 4NLGA 1VLYA 3D3CJ 1NLKL 1T05A 2MZSA 3TZYA 4X65F 2CG4A 4KT0C 2G0IA 2GGPB 4N77A 5ETTA 4LF7J 3IRWP 4PR6A 2XYPB 4U8VA 3RAQA 4DV3J 5KFEA 3R5AA 1Y5LB 3CCQS 3W2WB 2B7CB 4C48A 1G1XA 3ONQA 1U7LA 1N34J 2YQ3A 3HXMA 3MMAB 4DV7J 2OMLA 1NDCA 3LF0A 1KHWA 1FO1A 2XS2A 4CYUA 1FX4A 1PCAA 2KVQE 2G13A 4H4OA 5CYMA 4RUCA 3PYEA 3T5LA 3PO5A 4A46A 3NOGA 4WZMA 1EQMA 2IJNA 4GKKJ 5D0HA 2C3MA 2MKJA 2XYHB 4ZPWR 3HT3A 2KM8B 2QL5B 1HHQA 1WHWA 4I1TA 1URNA 4AXIA 2XO6A 4EO6A 2AD9A 1LK7A 3VQSA 2KO1A 1SQEA 4TN2A 4L72B 2PEHA 2WHOA 5E3QA 2E5LJ 3D6HB 2HFUA 5FIIA 1N33J 3POTB 4Y0FA 3GJSB 4LSLB 2JH3A 3HDSA 2B6AB 2ZZMA 3ZZOA 3OFHA 1F9FA 1TELA 3KK2A 3KYLA 4NLYA 1E6YB 2FY1A 2L9NA 5KFYA 1RZMA 2V2KA 2XLIA 4K4VA 4WFAQ 4FYXB 1N5SA 2ZVIA 1PSDA 5CAAA 2KFZA 2HZVA 4KR0B 4HLBA 3VWSA 4W92B 1K44A 1X5SA 1GX5A 1D9DA 2V67A 4RBUA 3MURP 3UN3A 3TEHB 4AD6A 4ES3A 2A2CA 5KFUA 1DQ9A 4OX9J 2BKPA 4TVAB 3RRGA 5ETVA 3PHTA 1JJCB 3CCZA 3GIJA 1RTIB 2RD5C 2F40A 3M8RA 2AZ1A 2B4OA 3P96A 1YBUA 3K89A 3ETOA 3C6TA 4RW8B 1RT7A 1VRTA 3RU0A 2WVFA 4DUYJ 2HSEB 3D6MB 2CXEA 2KU7A 3E51A 2GX8A 1ZS6A 3I0RB 3BV8A 4P2MA 1FKPB 2MKYA 3QFHA 4PG5A 2V50A 3H5YA 3CVKA 3MR2A 1SL0A 1R43A 1VQ8S 4MAKA 3E01B 1B4SA 4FXVA 1WC5A 4DSFA 1D0EA 4I6YA 3BYPA 3OTBA 3HHLD 2EFNA 4FN5A 3L4BC 1YK9A 3CGIA 4Q44A 4NEZA 3EVOA 4ER8A 4AL6A 4IKAA 1VMBA 3OJUA 3LOUA 4JI4F 1KLNA 2E29A 1ZPVA 3EZOA 4IR9A 2HNDB 4YDDB 2BUNA 3AQPA 2C28A 5IC4B 3MUVP 2GQCA 4Z7CA 3AB2B 4OYXA 3FGVA 1DURA 4IFVB 1UKUA 1LKZA 2YNFB 2MHNA 2J0XA 2BJ9A 1PYTA 4YB5A 2QFJA 5AE2A 3IM9A 2GMLA 3MR6A 5FLXY 2DH7A 1WC1A 2V63A 3MM9A 1HKAA 2DVIA 3K0JA 2V8PA 3CULA 2ZD1B 2VA2A 1M90T 2GS8A 2MPUA 5E3AA 2YX7A 5AE3A 2K7KA 1SH2A 3DMJB 2VKZG 4LFCJ 4NA1A 1R6VA 3PV8A 1KSPA 2LLZA 1T11A 2HFNA 4U7UD 1U2RA 2JX2A 4DR1J 2PIIA 2Q6BA 2WVEA 3DLEB 4EI2A 5L38A 2VICA 1SPBP 2PMWA 4K4TA 1YJ7A 3GTYX 4R25A 3D54A 3PM9A 3NLCA 3L95X 2JDJA 2OAUA 3LP0B 1NM2A 1GAOA 4EYHB 2JEIA 1KONA 3GILA 2HKEA 3MCNA 2ZHAA 1UFWA 3SMZA 3LP2A 1HQUB 2A18A 4PABA 4DQIA 2LQ9A 3F73A 2NYIA 1TV6A 1FDAA 1SH0A 4L3KA 5F8JA 2D3OR 4JI0F 1X4EA 1MSWD 1HBOA 5F8MA 3D1OA 4K59A 3PHEA 3M2VB 3SSRA 2C3UA 4J37A 3QYYA 1B0TA 4RU2A 1WHYA 3IWLA 5C2GA 3NWRA 1LFPA 2CJXB 2WB4A 5E3RA 5HVHA 2VBZA 2KT3A 2YH1A 2NUUG 3B4DA 1RJJA 4CLKA 3IP0A 4QYRA 2MHEA 3NGRA 4F26A 5CABA 1RAOA 3UCGA 3KWMA 2YNHB 1V3SA 5D3GA 5F8IA 4WXWA 1KDNA 1D8YA 1TL4A 1UWBA 1VJWA 1ZH5A 4NLRA 3OR1A 1T9YA 2P5VA 2EFOA 2QX0A 2FVSA 4B3SJ 3FC9A 1NJZA 9RUBA 3O6QA 3QBCA 3CF5Q 2EWHA 2VQEF 3ZZUA 5F41A 1Q79A 4ED2A 3G9CA 1JJ4A 2H4WB 4IOCQ 4NLVA 3WC0A 1RAEB 4F25A 1E6VB 2U2FA 1C1BA 1EHWA 1KEKA 1U1QA 2VUGA 3VGVA 3JQKA 4A8YA 4ID5B 1JLCB 5KG5A 4CTAA 2ZVSA 3FRYA 3C14A 2BR0A 3FFIB 3EXCX 2RJZA 1REVA 3EVWA 3N5FA 1R8AA 3GP9A 1HBMB 3GYNA 2R9LA 5A8WB 2A10A 3O8WA 2DBBA 2W9BB 2R4FA 3IBFB 5CYQA 2OD6A 3VVTA 4E8UA 1VQSA 2M70A 3IR5B 3PIOQ 1B0VA 1HIYA 4O23A 1TL7B 1RAGB 4C9DA 2XSFA 3BBCA 2N7YA 4YDXA 5D78A 3DI6A 4OQJA 2FVQA 3KLGA 2RVJA 2R7OA 3OLBA 3JAMU 3PNIA 2CQ3A 3DLGB 1XQIA 4G1QB 3RBEA 3D7SB 2KZZA 5D0RA 3DOMA 3J7YI 1R27B 4ZVFA 3G82B 4CLYA 5H9EK 4IRKA 3DC2A 4NI2B 2HEKA 3DOKB 1U49A 2F3JA 1HQ2A 2QT7A 2AGPA 2ERRA 3Q8YA 5IQ6A 4B9VA 2YPYA 2XWXA 1MG7A 3MR5A 3OV7A 2NSBA 4ED3A 2F9JA 4CO2A 5I4MA 1FVQA 1UW4A 2VPWB 4WU3A 1YSJA 2Q43A 4NCAA 3AHPA 3R7NB 3M1VB 4DR3J 3QT8A 3G2XA 3T6BA 2EK1A 1VC0A 4EO8A 1RAHB 1S1WB 4OI0A 3RB3A 1Q5VA 1UMJA 4EK2A 4WP8A 2XBPA 4JV0A 3FMWA 5EX0A 1YJUA 1JLEA 3TQEA 1FWPA 3HHEA 4PEOA 1Y9OA 3CWJA 1AUDA 1X4GA 4YFUA 4YB7A 2UUBF 1G7CB 4RW7A 2DPJA 3X1LB 1WNEA 3CEDA 2CQBA 1WEZA 3CO9A 2E1MC 1Q53A 4RPFA 1CVJA 1LWCB 4QYZK 4OYPA 3P5BP 2XMJA 4H4MA 2OGUA 2RNEA 1NKCA 1YLXA 3LA0A 2HQ3A 3D0IE 2XHWA 5HJXA 2DGSA 5KG6A 2DGUA 4DPWA 4LF4J 1OPIA 2DNMA 4B9TA 1I51B 3QAUA 5I42A 4EZ6A 1ICEB 1V5VA 3DHWC 2M2BA 1Q16B 4RW4B 4URSA 3B82A 2WVBA 1BUXA 5AJ3F 4DV5J 1F9EB 5KG7A 4TY9A 4V1Ak 3RRHA 2NYHA 4R0EA 1S1UA 2MZ1A 1XWLA 5CQGA 3ZZPA 3TR5A 1RUSA 4Y2AA 4P72A 1GXLA 2EG1A 2QRRA 1FE0A 5ETSA 4JI1F 3PYFA 2B7BB 5K5MA 4WKRA 1HQEA 3KDOA 1HR0F 2DHHA 4J9VA 4B02A 3CNQP 1JNZB 3R6GB 2EFVA 1X8DA 4OZ2A 5CD4A 4P10A 5HMWA 4TY8B 3JSYA 4RJVA 1KQGB 2DH8A 1M1GA 3CJ3A 3CIMA 3UD4P 1NK9A 1YBAA 2C2OB 1VQ6S 3L7UA 4EFAC 4FXWA 5KG3A 1S1VB 3GB0A 2IBKA 4DL2A 5IV3A 1UP1A 5G0RB 4DDFA 1VQKS 3K5PA 3M8PA 1XTZA 1FJ7A 4ANEA 3ENQA 2CWKA 3WIVA 2XGPA 4MIAA 3CDWA 1S97A 3GIIA 4IO9Q 3TAMA 1JLBA
chains in the Genus database with same CATH topology
3NGSA 3WX8A 2HURA 1NHKL 1LEOA 3EMTA 1NDKA 2HVEA 2DXEA 2DXDA 2DXFA 5CAAA 3EVMA 3NGRA 2NCKL 3EVOA 3PRVA 3ZTPA 1WKLA 3G2XA 3EM1A 1K44A 2BX6A 5CABA 1NPKA 3DKDA 3Q8VA 1NCLA 3VVUA 3VVTA 1WKKA 1NDCA 2B8QA 4EK2A 2DY9A 4FKYA 1HIYA 4ENOA 1MN7A 3BBCA 3B6BA 1PAEX 3MPDA 3FBFA 3FBBA 1LWXA 4O0NA 3R9LA 1S57A 3ELHA 1KDNA 2VU5A 1F6TA 3EJMA 5IOLA 2B8PA 1XQIA 4HR2A 3BBBA 3ZTRA 1NSQA 3FKBA 1B99A 3FC9A 1U8WA 3EE3A 3FBCA 3GPAA 3VGUA 1BHNA 4UOFA 4UOHA 2AZ1A 4ANDA 1VYAA 3PJ9A 1HHQA 3BH7B 3L7UA 3BH6B 3FCVA 3BBFA 3DDIA 3Q86A 2AZ3A 1W7WA 3FCWA 4DI6A 3EICA 2BEFA 1ZS6A 5C7PA 4W98A 4DZ6A 4FKXA 1S5ZA 1NLKL 3NGUA 3NGTA 3B54A 1JXVA 4DUTA 1NSKL 4C6AA 3Q8YA 1WKJA 3ETMA 1MN9A 1XIQA 4CP5A 1EHWA 1NDPA 2ZUAA 4WBFA 4ANEA 2HVDA 4F36A 3VGVA 4S0MA 5BXIA 3Q89A 1NSPA 3ENAA 1B4SA 1F3FA 2CWKA 3FBEA 3ZTSA 1NDLA 1NB2A 3VGTA 1BE4A 1UCNA 3JS9A 3Q8UA 4ANCA 1NUEA 3EVWA 3ZTQA 4F4AA 1HLWA 1BUXA 4KPCA 1PKUA 3VGSA 3ZTOA 3GP9A 1S59A 3Q83A 2DYAA 4UOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NGS A;  3WX8 A;  2HUR A;  1NHK L;  1LEO A;  3EMT A;  1NDK A;  2HVE A;  2DXE A;  2DXD A;  2DXF A;  5CAA A;  3EVM A;  3NGR A;  2NCK L;  3EVO A;  3PRV A;  3ZTP A;  1WKL A;  3G2X A;  3EM1 A;  1K44 A;  2BX6 A;  5CAB A;  1NPK A;  3DKD A;  3Q8V A;  1NCL A;  3VVU A;  3VVT A;  1WKK A;  1NDC A;  2B8Q A;  4EK2 A;  2DY9 A;  4FKY A;  1HIY A;  4ENO A;  1MN7 A;  3BBC A;  3B6B A;  1PAE X;  3MPD A;  3FBF A;  3FBB A;  1LWX A;  4O0N A;  3R9L A;  1S57 A;  3ELH A;  1KDN A;  2VU5 A;  1F6T A;  3EJM A;  5IOL A;  2B8P A;  1XQI A;  4HR2 A;  3BBB A;  3ZTR A;  1NSQ A;  3FKB A;  1B99 A;  3FC9 A;  1U8W A;  3EE3 A;  3FBC A;  3GPA A;  3VGU A;  1BHN A;  4UOF A;  4UOH A;  2AZ1 A;  4AND A;  1VYA A;  3PJ9 A;  1HHQ A;  3BH7 B;  3L7U A;  3BH6 B;  3FCV A;  3BBF A;  3DDI A;  3Q86 A;  2AZ3 A;  1W7W A;  3FCW A;  4DI6 A;  3EIC A;  2BEF A;  1ZS6 A;  5C7P A;  4W98 A;  4DZ6 A;  4FKX A;  1S5Z A;  1NLK L;  3NGU A;  3NGT A;  3B54 A;  1JXV A;  4DUT A;  1NSK L;  4C6A A;  3Q8Y A;  1WKJ A;  3ETM A;  1MN9 A;  1XIQ A;  4CP5 A;  1EHW A;  1NDP A;  2ZUA A;  4WBF A;  4ANE A;  2HVD A;  4F36 A;  3VGV A;  4S0M A;  5BXI A;  3Q89 A;  1NSP A;  3ENA A;  1B4S A;  1F3F A;  2CWK A;  3FBE A;  3ZTS A;  1NDL A;  1NB2 A;  3VGT A;  1BE4 A;  1UCN A;  3JS9 A;  3Q8U A;  4ANC A;  1NUE A;  3EVW A;  3ZTQ A;  4F4A A;  1HLW A;  1BUX A;  4KPC A;  1PKU A;  3VGS A;  3ZTO A;  3GP9 A;  1S59 A;  3Q83 A;  2DYA A;  4UOG A; 
#chains in the Genus database with same CATH topology
 3OL7 A;  2ZH7 A;  1SB6 A;  1GTH A;  1SL2 A;  3SSQ A;  4X4R A;  2F5G A;  1FDD A;  4RNM A;  3NEK A;  2YWF A;  1JX4 A;  2KXN B;  1N6Q B;  3NRB A;  5HVG A;  2BYC A;  2XCP A;  2DEI A;  1M1H A;  3GV8 B;  3C6U B;  2C2M B;  5E41 A;  4IH7 A;  3POT A;  1U1R A;  4DR6 F;  1WG1 A;  2GA7 A;  3VZH A;  1D09 B;  4DLE A;  2AT1 B;  4ZPC A;  3PAC A;  1E6Y A;  1IJF B;  3W64 A;  2GHV C;  3QT6 A;  2EBE A;  4J9U E;  2VFR A;  2YX1 A;  4QIE A;  3BN4 A;  4NA2 A;  2XM3 A;  3OTO F;  1VCT A;  2AJ0 A;  2UXB J;  2DGQ A;  2L3M A;  3T5K A;  1F60 B;  1T0T V;  1S7I A;  4WF9 Q;  4Y6I A;  1MRO A;  3RBZ A;  1FDN A;  2UVR A;  3M6X A;  2LQJ A;  2PMH A;  2RHS B;  3THT A;  4P7V A;  5KFL A;  2MKI A;  4UST A;  4ANC A;  3OXF A;  3FDS A;  4OYB A;  4UOG A;  2QLB B;  1NDK A;  1RTI A;  3QT7 A;  1U6B A;  2HQC A;  4PYA A;  2KHD A;  4OZ1 A;  4RW8 A;  3NS6 A;  3R1L A;  1NRK A;  1TZ0 A;  5BYR A;  3I0R A;  4UUX A;  2COL A;  3P45 B;  2YKQ A;  1H73 A;  3PX4 A;  1VR6 A;  2BE9 B;  1C4C A;  1WAC A;  3OVS A;  3MMB A;  1N0U A;  2ZH5 A;  5KT5 A;  4KTQ A;  2M0G B;  3DRP B;  4PWW A;  5B0F A;  1RA7 A;  2X1G A;  1O5J A;  4OZ3 A;  1RE1 B;  1UEK A;  5KT4 A;  2AYM A;  4OYW A;  5KFZ A;  1HI1 A;  4Z7Y A;  1FRH A;  2Y1L B;  3NGU A;  3WIU A;  3J80 U;  1F0X A;  4O4G B;  1MN9 A;  5D4O A;  4DWI A;  4DR2 F;  4USW A;  1VHF A;  3D6T B;  5BXI A;  4ZJO A;  2VG5 B;  4B3O B;  3QT5 A;  2HND A;  2DIV A;  1YIT S;  1HD1 A;  1TUV A;  2FJE B;  2JZ5 A;  2D1C A;  5AT1 B;  1N36 J;  3LP1 B;  3AH6 A;  3PEH A;  3LWM A;  2YNF A;  4KHM A;  2ZEJ A;  2RRN A;  1VS3 A;  1XER A;  3FNN A;  3M2R A;  1HI0 P;  2B5J A;  3D1Q A;  2V8H A;  2CWX A;  2HLT A;  2YXL A;  3S7R A;  1WKL A;  2CFX A;  4RNF A;  4NLD A;  2IC3 B;  5E7O B;  2WVD A;  4PQA A;  2ZD1 A;  1UVN A;  2BAB A;  2ACY A;  2FLL A;  1DTT A;  4ED4 A;  3EJM A;  3TEG A;  3A4T A;  2HK3 A;  3BDE A;  4QW8 A;  3SQO P;  3MCS A;  3OL6 A;  3N6N A;  2ADC A;  1IKW A;  3TYT A;  5GAH I;  3BH6 B;  3ENV A;  3ILO A;  3CJ2 A;  3AXK A;  4KKO A;  3DLE A;  3GYX B;  4DL4 A;  1RTD B;  2BKO A;  1BLU A;  1WOP A;  1PBA A;  3GSD A;  3H59 A;  4ELT A;  5IM0 B;  5HBM B;  3LP0 A;  1YBT A;  4ID8 A;  3T5J A;  5L1J A;  2CPJ A;  4OYZ A;  1RU1 A;  2UV8 A;  2DHX A;  3B78 A;  1FEH A;  1S77 D;  4QWB A;  2POK A;  3CDU A;  5KG4 A;  1VC5 A;  2D41 A;  2DXF A;  4L75 A;  3PRV A;  5HP1 A;  3JSB A;  2EC0 A;  5JXS A;  1FT8 A;  4ZIW A;  2AF6 A;  1JXE A;  3C15 A;  4GVB B;  1TU0 B;  1VI7 A;  3OSP A;  1IJE B;  4HAC B;  2CPF A;  1VQM S;  3IFE A;  3M2V A;  2ZM6 F;  2HWH A;  4PXD A;  4ZVQ B;  3M9O B;  3BO4 A;  2Z2M A;  4IRD A;  4HR2 A;  1FK9 B;  5KT3 A;  4MIW A;  1UEU A;  2OEL A;  5J2Q B;  1N88 A;  1UPP A;  2BBE A;  2QYG A;  3BKF A;  3MOZ A;  2KFY A;  4RBV A;  1NSK L;  3HP6 A;  3CD6 S;  2HIY A;  1CUL A;  1GMV A;  4N47 A;  3QSY B;  1TK5 A;  5F8H A;  5KFX A;  4PUO B;  4CO5 A;  5L9N A;  3ZFV A;  1S99 A;  3N6M A;  2HVE A;  3HK2 A;  1AFI A;  2PC6 A;  4KV8 A;  2GVD B;  1ZTT A;  4ZK7 M;  1BC6 A;  4WE1 A;  2K3K A;  5HLF B;  4KHP J;  2WRM A;  2X1A A;  4I56 A;  4R0J A;  3EZ5 A;  1Y10 A;  3OHA A;  4ECX A;  1SC3 B;  1CJV A;  1KD1 T;  3AJ1 A;  1HNZ F;  1JLC A;  2OSR A;  3J81 U;  3FBC A;  3PCO B;  2BKN A;  2RUG A;  3IR6 B;  4LFA J;  5A8W A;  4YN3 B;  1VQL S;  2W9B A;  4DZD A;  2I9S A;  1S79 A;  2BOP A;  2XZT B;  1ZBT A;  2CNK B;  2HBY B;  3OUY A;  3CJQ A;  3GIK A;  5MLC V;  3D0H E;  4CM0 A;  3HHL B;  1B70 B;  1TL7 A;  3KLF B;  4USH A;  2OPR B;  3ILJ A;  4PG6 A;  1N52 B;  1JLA B;  2W25 A;  1U09 A;  4JV5 F;  2CPZ A;  4NXM J;  3ZZT A;  4DJB A;  3ZTO A;  4DMZ A;  2W7O A;  1I3O B;  4AQY J;  2JL9 A;  3G82 A;  4OHW A;  5CZX A;  2HAF A;  1H7X A;  2VG7 B;  3R97 A;  2VBY A;  2CA9 A;  1QAY A;  3DOK A;  3TO8 A;  1RU2 A;  3EWG A;  2BJD A;  1Q7Y T;  2PD1 A;  1NKB A;  2GMH A;  4F50 A;  4Q45 A;  4MK8 A;  5CCM A;  2V2V A;  3KHL A;  4RR5 A;  2V6A A;  2VPX B;  2PT0 A;  3HVT B;  3A1Y G;  3NCP A;  1VYA A;  5BR8 F;  2AZ3 A;  1T03 B;  3M1V A;  2OEM A;  3BKU A;  3W60 A;  5BJR A;  2XNQ A;  4FNI A;  1FFG B;  2Q79 A;  1S1W A;  2P6S A;  4NAS A;  2MJU A;  2NXN A;  1T9U A;  4ED1 A;  1EKS A;  3KHG A;  3P4U B;  2EVZ A;  1JXL A;  1RT3 A;  3CJK B;  1CPZ A;  3Q8U A;  3MOJ B;  4M5D B;  4ZPB A;  1B7F A;  3CJT A;  2AYB A;  2KFN A;  2XS7 A;  1LWC A;  3CUN A;  2LQ8 A;  1YJ9 S;  1SC4 B;  2LDY A;  1UL3 A;  1TKX B;  3IWX A;  2AGO A;  4MFB B;  1S1T B;  2RSQ A;  4JI6 J;  3M8S A;  1RWX B;  1GQE A;  3ELH A;  4K0K F;  4LF9 J;  4IG0 B;  3CCR S;  1UFK A;  4PXE A;  1PC5 A;  1MMN A;  4DV4 J;  3BF4 A;  2EG2 A;  2JLE A;  4RW4 A;  2VJV A;  1HW9 A;  1F2G A;  4KY3 A;  2C2R A;  4GC6 A;  2VOP A;  1GMW D;  1U1M A;  2KTQ A;  3UQS A;  2OKQ A;  4YR0 A;  1C0U A;  3GFY A;  3G8T A;  2ZBP A;  4PG7 A;  1W25 A;  3P3D A;  3G8Q A;  1G2E A;  4S0M A;  2DHS A;  5MAO A;  3W61 A;  2MYF A;  4H4K C;  1SJ4 P;  3P8B B;  2BXJ A;  3IAS 9;  2DCL A;  1YWX A;  1WI8 A;  3IA0 A;  4Q43 A;  3QRQ A;  3GV7 B;  3W9J A;  1XN9 A;  3J7Z 5;  3RR8 A;  1M5H A;  4WWS A;  4QQB A;  2IM1 A;  1NPK A;  3BPD A;  4MMO A;  5FLX U;  1CG2 A;  2YVS A;  1S1V A;  4GO5 X;  5F8L A;  2CQ2 A;  4JI7 J;  5K14 B;  3PZP A;  4NXN F;  3L3C A;  3QO9 A;  3G71 S;  4YP3 A;  3DDK A;  5CD4 H;  3FKB A;  2HZA A;  3F0N A;  5FD1 A;  5I3U A;  2GIF A;  4ETZ A;  4TU8 A;  2IRU A;  1YRX A;  2GC8 A;  1Y3J A;  4DI6 A;  2BEF A;  2UXD F;  4XPC A;  2MKC A;  1FJC A;  4O44 A;  1OYE A;  4ZPT R;  1X9M A;  2MQO A;  2QZ8 A;  5D8H B;  4OX7 A;  1VBK A;  3FZB A;  4DV0 F;  3C6U A;  4X65 J;  1UVI A;  4ILL A;  2HLU A;  3D9B A;  4PRF A;  5C25 A;  4K5R A;  1TMJ A;  3C3L A;  1QE1 B;  1LWF B;  4H4K A;  2UVW A;  2W2M P;  1KR4 A;  3GON A;  2KYZ A;  4Y3C A;  3PEJ A;  1IUJ A;  2LU2 A;  1A0O B;  3I5B A;  4F3M A;  1RT4 B;  1X4B A;  3SCL E;  3K7R A;  3S8S A;  2DGO A;  3D66 A;  1X4F A;  2W9A A;  5L1K A;  5K9F A;  3CCT A;  1S49 A;  2DK2 A;  1W2I A;  1JLG B;  2N3L A;  3SIP B;  1WOS A;  3UCU P;  1Q95 G;  3TUJ C;  2HHW A;  2CQD A;  3PKM A;  1ZOT A;  3J7Z T;  1T3N A;  5A6P A;  1F5C A;  4JOU A;  1FD2 A;  3THP A;  3OVB A;  1KFD A;  1IKV A;  1QD1 A;  5KFR A;  2CIM A;  3LAN A;  1Y7P A;  4WFX A;  2FHM A;  4A48 A;  3Q24 A;  2OTJ S;  2FYX A;  2AKW B;  1SI9 A;  3C16 A;  2I6W A;  3I32 A;  3M9M B;  5KFF A;  1SL1 A;  1QUP A;  2CDQ A;  1IKX B;  7AT1 B;  1U25 A;  3D3B J;  4UT4 A;  3IM8 A;  2ZH3 A;  1VJQ A;  2W9C B;  4AL5 A;  4YS2 A;  3M6V A;  1MN7 A;  2PMZ D;  3V81 A;  1W26 A;  4KGK A;  5E3C A;  3ITH B;  4KFB B;  3T9Z A;  2JEG A;  3F56 A;  1JKH B;  1AYE A;  4N7T A;  3TX0 A;  3AJD A;  3WX4 A;  3PKY A;  5KOX A;  3TZZ A;  2H54 B;  3MEE B;  2VG5 A;  4B3O A;  3QWP A;  1GTE A;  4CZC A;  1CLF A;  2VIH A;  2AP6 A;  2HGM A;  4LVO P;  3MAA B;  5KFN A;  1Q8L A;  1OY6 A;  2Y0S D;  3M6W A;  2D3O 1;  3ILI A;  2FJA B;  3OSN A;  4MK7 A;  2IC3 A;  4CM2 A;  2W2N P;  1H74 A;  3LGH A;  3MTK A;  1YHQ S;  4WFN Q;  5DQI A;  2IFX A;  1YJT A;  2ZIT A;  4F0K A;  4NL5 A;  1FXD A;  1HPZ B;  1R8B A;  2X1B A;  1GEH A;  4PPZ A;  4N8O A;  4X62 F;  1VBY A;  5EUH A;  2V8G A;  4HHU A;  1XR6 A;  2FHK A;  1NK4 A;  3MPV A;  4MYT A;  2UP1 A;  1YJR A;  4LFB F;  2BE7 D;  1UVM A;  1RTD A;  3CCS S;  4RX6 A;  5DM6 Q;  4OZ0 A;  1KS2 A;  4C3K A;  2KRB A;  2RKI B;  5IM0 A;  3R3T A;  3DU6 A;  4BWM A;  5HBM A;  3IWN C;  3UVJ A;  4JI4 J;  4RZR A;  1S4F A;  2B43 A;  1UA0 A;  1V5I B;  3FMB A;  1S48 A;  1XMO F;  1QVG R;  3IBC B;  4YHH F;  3MUM P;  3U1M A;  5C42 B;  5CHC B;  2Y1R I;  2ZH4 A;  3OLA A;  5DG7 A;  4DZ6 A;  3RJM B;  3PW7 A;  1IWA A;  1TVR B;  4KRW A;  3QJJ A;  2H1Y A;  2QLW A;  4IH6 A;  4P2S A;  5M2P A;  1WC6 A;  1S4E A;  3K5O A;  2ADB A;  4HAC A;  5T7L B;  2ZDO A;  4X4T A;  3JB9 k;  2YWK A;  3CMQ A;  4NEY A;  4QWC A;  5DQG A;  2H5E A;  2MMY A;  2PEB A;  2BJE A;  3O3L A;  1VC6 A;  2YWG A;  3PVX A;  2N7C A;  3UR3 C;  2X7I A;  4CI0 B;  3MFI A;  4ZJL A;  2DXE A;  4F0H A;  4R8U B;  4LRF A;  5J2Q A;  3HHL C;  4F4Y A;  1Q4R A;  2GJI A;  4ZVP B;  2IYG A;  5GAE I;  2M88 A;  1RHU B;  3KUH A;  4DV2 J;  2ZWO A;  3VAJ A;  2O1P A;  3IAM 9;  2FQQ B;  3Q0A A;  5EDW A;  1WUU A;  1FKO B;  1FES A;  2MLY A;  2OFH X;  1J5O B;  3WZ0 A;  1LXN A;  2MEW A;  4ILM A;  3DM2 B;  4AND A;  3ZO7 A;  4PUO A;  1NU4 A;  2ASJ A;  1S9E B;  1J27 A;  2UXC F;  2C2E A;  3NAH A;  1RTZ A;  2C3Y A;  3EGW B;  2VA3 A;  3IRX A;  5CH7 B;  1FRL A;  2Q3P A;  4YME A;  2YNI B;  1S9G A;  2RF2 A;  4DUT A;  4X4S A;  1TQL A;  4DR4 F;  4F36 A;  2GZO A;  2DR6 A;  2KG1 A;  4USU A;  4HKQ A;  4KQZ A;  4ZVG A;  1SJR A;  3HF5 A;  5LMU F;  4M5N A;  3BN7 A;  1FNM A;  3UO0 A;  4LMZ A;  4LR7 A;  1HWI A;  3HX9 A;  3MM8 A;  4DV6 F;  3TJA A;  3EVM A;  1EAY C;  3ZZ0 A;  4HH1 A;  3RB6 A;  3MM5 B;  1ARO P;  3J81 j;  5KFT A;  3HLU A;  2AJQ A;  5FDL B;  2JC1 A;  3AXM A;  3MPU B;  5LT5 A;  2G0J A;  3ZZR A;  2EEY A;  1FI4 A;  3SBM A;  1S12 A;  1AW0 A;  5IC6 B;  1H72 C;  3M2U A;  3HHL A;  1SQG A;  1F6T A;  1OSD A;  4RUH A;  1U1O A;  3PW2 A;  4EWT A;  1JLA A;  1YJN S;  4F2R A;  1YX2 A;  4NLT A;  1HNI B;  4IG3 A;  2X3D A;  3TUZ C;  1U2C A;  2VAS A;  2IHR 1;  2WSE C;  1TP7 A;  3C2P A;  1SJ1 A;  2DNZ A;  2VG7 A;  1DJ0 A;  3ISN D;  2VQE J;  2AYG A;  3SXL A;  3SFG A;  4OLO A;  2CQ4 A;  3HKZ D;  2YKM B;  2MQQ A;  1UTA A;  1HLW A;  3GR0 A;  1HHS A;  3EGN A;  4KC5 A;  4PQU B;  4F4X A;  1HWU A;  3HVT A;  4FZV A;  4QJV A;  1IBK F;  3CD7 A;  2FHJ D;  4WYL A;  2W8L A;  3IGV A;  2QEX S;  2Q1L A;  1T03 A;  4M5H A;  4OFZ A;  2CJB A;  1RHK B;  2JEF A;  4FYV B;  1C0T A;  5K8N A;  4NYZ A;  1M5P C;  3A3O B;  3U1L A;  1TK0 A;  5KG2 A;  3C8Y A;  3H8Y A;  3KG4 A;  4MYU A;  1B99 A;  1ITP A;  3CJK A;  3TAP A;  1KQF B;  4M5D A;  2DNG A;  1X4H A;  1H2T Z;  1QUV A;  1KVJ A;  2XQC A;  2OP5 A;  1X5O A;  3DLB A;  2ASD A;  2FGO A;  2J0Q D;  1EP4 A;  4ZJQ A;  1U0S A;  2HQG A;  2B9X A;  3JSR A;  4PWU A;  4D3G A;  2GJ2 A;  2GQQ A;  4MFB A;  4ZOS A;  4WJB A;  5DM7 Q;  1S1T A;  2BW2 A;  2EFG A;  3PY8 A;  3UPF A;  3R5B A;  2GIR A;  1NB2 A;  2QE5 A;  3K5M A;  3JS9 A;  2HRT A;  3VAK A;  2H5I B;  1YGY A;  1TUG B;  3AT1 B;  3L9Z A;  2OJ3 A;  1M5S A;  1VIS A;  1RT1 A;  2UU9 F;  2MST A;  4U6P A;  3Q23 A;  4ED5 A;  1FWK A;  2BX6 A;  1WKK A;  4DQP A;  1S6O A;  3BB5 A;  1ZAV A;  5KT2 A;  3BGR B;  2FZG B;  4ZHR B;  2RAQ A;  4OYA A;  1YG0 A;  4I7F B;  4YR2 A;  1J2V A;  1TFW A;  3GJT B;  4O3R A;  1RA6 A;  5F0W A;  3HPO A;  4C8N A;  3GMG A;  3PO4 A;  3BBB A;  2CPE A;  3UD3 P;  2ZBI A;  2PA3 A;  1G3O A;  2OH2 A;  2QL7 B;  2HG4 A;  1P6T A;  1RSC A;  4RNN A;  2BQ3 A;  4DOZ A;  4DX7 A;  3BSO A;  1UZD A;  3QWU A;  3MMJ A;  2UUB J;  2YWW A;  3V6K A;  2LDI A;  3X3U A;  2ZDP A;  1EJ7 L;  4DUY F;  4F7V A;  4Q8E A;  3UFC X;  1SV5 B;  4KO0 B;  1GX6 A;  2LQ5 A;  2EXU A;  4BWJ A;  1BQX A;  2I5J A;  4XIU A;  4NLW A;  5K14 A;  2BDP A;  1B3T A;  4LSN B;  3UCZ P;  2R7Q A;  2DNK A;  2FLN A;  1RWV B;  4NCB A;  1ROF A;  1S1X A;  5J2M A;  2MDA A;  5HMZ A;  4OJG A;  1TKZ A;  2OFG X;  1F5A A;  2F4V F;  4ES2 A;  2VOO A;  1R0C B;  4OYM A;  4A8F A;  2N4C A;  4NLX A;  2YBV A;  2LEP A;  3MF5 A;  1FTC A;  1KVK A;  3OXG A;  1CBK A;  4JI1 J;  2Z58 B;  2R7X A;  1LOU A;  2KRR A;  4B9U A;  1YKW A;  1BQM B;  1HR0 J;  4DFK A;  3G4S S;  1RTJ A;  3QZ7 A;  3KMQ A;  4FYW B;  2FVP A;  3N6L A;  4O4R A;  1N5Y A;  2Y9H A;  3I5A A;  4FKX A;  4F0M A;  5CA5 A;  5KFJ A;  1QE1 A;  3RBD A;  2KT5 A;  5C24 B;  2PGC A;  4FF1 A;  3OHB A;  3K57 A;  1PJ5 A;  2VJU A;  3BSN A;  2H51 B;  2M8H A;  3CCJ S;  3RW7 A;  3J80 Y;  1Z4U A;  1L3V A;  1I1G A;  2R8J A;  2VOD A;  2IA0 A;  4HHJ A;  3DOL B;  3SDE A;  5GAH U;  3ZZY A;  1MWZ A;  4DLG A;  5M2R A;  2QN6 B;  4DR7 F;  5DRK A;  3QID A;  4ZCM A;  4OLP A;  3UN2 A;  4P75 A;  5SUH A;  1YQH A;  2O67 A;  3Q8R B;  4NOH A;  3W63 A;  4CH0 S;  1GK8 A;  2A1B A;  1MU2 B;  3M8Q B;  1DBD A;  1PG5 B;  2WVC A;  4XO0 A;  2O66 A;  4EEY A;  3RW6 A;  3QFW A;  2ILY A;  1NK0 A;  1JWW A;  3V5R A;  1KNZ A;  2N82 B;  2C2D A;  4U67 Q;  3MD1 A;  4JBC A;  1APS A;  1NH7 A;  5F9N A;  4Q0B A;  4DR6 J;  4RO0 A;  1FA0 A;  2NXU A;  4FBT A;  1XNQ F;  2NXJ A;  4KE5 A;  1EB0 A;  1L3K A;  1AA1 B;  4N56 A;  2W9C A;  2AW0 A;  2QJ3 A;  2OEK A;  1NND A;  1HI8 A;  2D3Z A;  2KH9 A;  3OTO J;  1Q86 T;  3T1H F;  4TQS A;  3QPI A;  2NQP A;  5LSL A;  4ZN3 A;  3FEX B;  2QTW A;  3GG1 A;  1DAR A;  3MAA A;  4LUB A;  2RDI A;  1TUW A;  4BC9 A;  3ZZZ A;  2OI2 A;  5U47 A;  1K8A T;  2PN6 A;  3GWC A;  1RCX B;  2QA4 S;  2HRU A;  3F44 A;  1QTM A;  2G9O A;  3KLH B;  5DZ6 A;  2DY1 A;  1IM6 A;  1HPZ A;  2E7V A;  3H20 A;  4ICL B;  4B17 A;  8AT1 B;  1HBN B;  2XZW A;  3BKT A;  1K0V A;  4GMK A;  2NXC A;  4G6V B;  4EBD A;  4UF4 A;  1R0A A;  1C4A A;  1Y5N B;  1UPM B;  2E1A A;  3PYD A;  4GKJ F;  2I1R A;  5IXU A;  3NMR A;  4M5G A;  1B7Y B;  4LRA A;  3PX6 A;  2BE2 B;  4KIA A;  1HMV B;  4FNH A;  4ZP7 A;  4F4A A;  4UY8 5;  4DR2 J;  4KHR A;  2YKN B;  1FJG F;  1HNV B;  2DNP A;  3LPY A;  4XDC A;  2KJW A;  2RIL A;  5C42 A;  3W1Y C;  1RIS A;  3KFW X;  1S6Q B;  4DR5 F;  2HQI A;  1MLA A;  1U6F A;  1N54 B;  1TVR A;  1VRQ C;  2XUL A;  4DPX A;  2WOM B;  3GIM A;  3FBF A;  4C97 A;  4ZIV A;  1RT6 B;  4OYI A;  2PFD A;  2UUW A;  1N56 A;  3NGD A;  3G6E S;  2DNO A;  3HHK A;  5KFQ A;  3IG1 B;  1VDH A;  5T7L A;  2YTC A;  4ZCK A;  1S7H A;  1X4D A;  3OT9 A;  4JI8 F;  1D1U A;  2L41 A;  4J7C A;  1UVL A;  3U02 A;  3J81 Y;  1RXO B;  3ISZ A;  5IT0 A;  2V4J B;  2ZKU A;  4R8U A;  3QGP A;  3T9N A;  4G65 A;  5K8M A;  3W7B A;  1RAD B;  3PRB A;  4L76 A;  3K2Y A;  4ZIT A;  4X4P A;  1HNW F;  4BBY A;  5ETL A;  4ZPA A;  3A13 A;  3QMQ A;  1YI2 S;  4QR2 A;  2V4R A;  3BGF A;  3VGT A;  4JI3 F;  3HM9 A;  1FE4 A;  4O3Q A;  1PBU A;  3DM2 A;  2QIF A;  4J90 A;  4P52 A;  2Z30 B;  3MEC A;  1S9E A;  2HNZ B;  1LW2 B;  1VBZ A;  4ENO A;  2CVE A;  2H4Y B;  2YNI A;  2LXI A;  3H5U A;  2AYE A;  4ES1 A;  4BHQ A;  3R7B B;  3NXZ A;  4QU7 A;  2D9P A;  4WK1 A;  3N01 A;  4QBU A;  2JSX A;  6FDR A;  2W4D A;  2B3T B;  3MM6 B;  2A2D A;  1XMQ F;  1PJ6 A;  4Y2K A;  3W9H A;  2XI2 A;  3H42 A;  4Y2C A;  2HMI B;  4W4M A;  2V8V A;  2ZM6 J;  4F3Q A;  2DRB A;  2QMU B;  5A0Y A;  4UY8 T;  1HW8 A;  3JXO A;  1R0B G;  2IDE A;  3EXY A;  2ZE2 A;  1UZH A;  5FDL A;  4N5S A;  3M6U A;  3EGZ A;  4RUB A;  2CZ9 A;  2Y0B B;  4L6V 3;  3DGP B;  2MQN A;  3CD0 A;  1Y5I B;  2MY8 A;  3OL9 A;  2CDR B;  1Q81 T;  4LVN P;  4GRS A;  4I64 A;  4DBQ A;  4DL6 A;  5DG9 A;  2BRK A;  3G87 A;  3W2V A;  3ZTP A;  3CCM S;  4IR1 A;  5KFP A;  1EZZ B;  4IFY A;  4WTO B;  4E0D A;  2B8Q A;  2XY7 A;  1FXR A;  3I55 S;  2AQ4 A;  4FS1 A;  3PW4 A;  4HYK A;  3JYT A;  1DAX A;  1JLF B;  4QZV B;  5CZV A;  4C2M A;  2XTJ P;  4USK A;  5LJ3 Y;  4LRC A;  5LM7 E;  4C8K A;  2DO4 A;  2HBR B;  2WON B;  3Q2T C;  3DRS A;  5EHH A;  2GO9 A;  4PQU A;  4YUD A;  2ROG A;  1AT1 B;  2IBO A;  3GR1 A;  1G4C A;  2PDA A;  4Q2L A;  1HBU B;  2V2Q A;  3GIR A;  2KVI A;  4N8N A;  3FSI A;  1CS4 B;  4ZA1 A;  1TL3 B;  2J9D A;  2D3U A;  1OSC A;  2DNY A;  1UVK A;  2DT9 A;  2MQL A;  1K1S A;  1ZPW X;  2MY7 A;  4JI2 F;  3W8P A;  4YB1 P;  4DV1 F;  2ATC B;  2EPI A;  1N32 F;  4YOE A;  2UUA F;  1RAJ A;  4FBU A;  1YZ6 A;  2DR8 A;  4B9M A;  6FD1 A;  3EDQ B;  3RR7 A;  1SUQ B;  3MEG B;  3KNA A;  3C46 A;  2VFV A;  4DSI A;  4J9L A;  3L09 A;  2HNY A;  4JV5 J;  2DHA A;  3DRR B;  3MED B;  4J9N A;  4Q2M A;  2F7V A;  3TUP A;  4TNO A;  2HHH F;  1ELO A;  3LAK A;  3FJ2 A;  3IC1 A;  3WHI A;  1T05 B;  1NME B;  1U48 A;  3IGN A;  1H0H B;  2VPY B;  2DHG A;  3T6J A;  2IVF B;  3GFH A;  2AHO B;  4EU0 A;  1ZET A;  1CC8 A;  1I6J A;  4FF2 A;  2MJN A;  3M8Y A;  1U1N A;  1X0F A;  5BR8 J;  1CJK B;  4ZHR A;  4PG4 A;  5J2P A;  4I7F A;  2WSF C;  5RUB A;  2J7U A;  1VQ9 S;  3QJL A;  2DNR A;  2W4C A;  3T1A A;  4CYU B;  4I2P A;  1T3O A;  4WP9 A;  4I2Q A;  4H4O B;  5CYM B;  2R7W A;  3VGS A;  1NK8 A;  3A12 A;  3TNV A;  2J7W A;  3TA0 A;  3OD2 A;  3W62 A;  4CH7 A;  1OJ4 A;  2RH3 A;  3DLH A;  4U9R A;  3RBX A;  2W1B A;  2FUG 9;  2HQF A;  4O3P A;  1V6H A;  1GH8 A;  5IWA F;  3Q8V A;  5A6W A;  2HFZ A;  1QSS A;  2CNL B;  1RWP B;  3M8Z A;  3AAW B;  2ZWP A;  2AGQ A;  1LNQ A;  4UQT A;  1SV5 A;  2ZC4 A;  1SQF A;  4KO0 A;  4DPT A;  5KFK A;  4B08 A;  2UVU A;  3N79 A;  4WII A;  4C8L A;  2W4P A;  2IAJ B;  3SV3 A;  5F9L A;  1J5E F;  4WKY A;  3DLK A;  2B0G A;  1VRU A;  1R3N A;  1HWK A;  4KGM A;  3UWT A;  2ZKT A;  4QWE A;  2L9D A;  2WW8 A;  1NKE A;  2ALY B;  4NZ0 A;  3H4B A;  3HVA A;  2V94 A;  3MD3 A;  3H5X A;  4DPU A;  2F1F A;  5KAK A;  2B4P A;  3TAQ A;  1N5V A;  4F3O A;  4M95 A;  1IQT A;  1SJ3 P;  4QPX A;  1BQM A;  3KUE A;  2FC8 A;  4O3S A;  2RHQ B;  4B9L A;  3CCU S;  3H0P A;  3H2U B;  1AUS L;  1RTH A;  2F65 A;  3BM7 A;  1DTQ B;  1F2H A;  3GU0 A;  1M1K T;  3HO1 A;  4ECR A;  5HL7 Q;  5EGY A;  4DU8 A;  2ATL A;  1RT7 B;  1VRT B;  1M0S A;  4CIO A;  1S9F A;  2VU5 A;  2R7V A;  2HHP A;  4TLR A;  3R5D A;  1KVI A;  4LR8 A;  4NXN J;  1RYS A;  1NHU A;  3FCV A;  1SKR A;  1RYR A;  1FTR A;  1W7W A;  2JVO A;  1YRT A;  2ZUG A;  4OZN A;  2J6S A;  3VF0 B;  1Y11 A;  4YY3 J;  4OV6 A;  4LF1 A;  2XHC A;  1MU2 A;  1QJH A;  3V4M A;  4C0O C;  2UXD J;  3PW0 A;  3LH2 S;  4CO3 A;  2VZ9 A;  1T9W A;  2VG6 B;  2Z2Y B;  1WHV A;  2B9E A;  2HAI A;  4KGV B;  2BRL A;  3HD1 A;  1LEO A;  1FRK A;  2XMM A;  1OQ3 A;  4USV A;  4QIV A;  4DV0 J;  3CIZ A;  4X4V A;  4ED7 A;  2QLJ B;  2DD8 S;  4E98 A;  3Q8Q B;  3M30 A;  1Q7L B;  2VH7 A;  4FYD A;  2ZH9 A;  4C8Y A;  5KT7 A;  4DS5 A;  3FBB A;  3RYL A;  3KK3 A;  2XSJ B;  3MM9 B;  2AMC B;  4CT9 A;  4WYW A;  2MGZ B;  2C22 A;  4R5P B;  2E1C A;  4Q8F A;  5GAE U;  1DZ5 A;  3VAF A;  4CDI A;  3RAM A;  1JLQ A;  1SCJ B;  3AA8 A;  3DN9 A;  2RU3 A;  1P27 B;  1BMQ B;  1CSJ A;  4QU6 A;  2YH0 A;  2IDL A;  3I5C A;  3CT9 A;  1IBM F;  2F8E X;  2YWH A;  3CB4 A;  1QLN A;  5ETK A;  1JJH A;  5HQM A;  2IM3 A;  3ENA A;  1HYS A;  3FCH A;  3FBE A;  4ED8 A;  4OJH A;  4LBI A;  1MWY A;  1WF2 A;  2P9G A;  3NG8 A;  3SFU A;  5K8P A;  4O0I A;  3GJR B;  5HRO A;  1GMW A;  3KLH A;  3LQV A;  5G4D A;  3Q83 A;  2OLW A;  4MT1 A;  2OMO A;  2P9C A;  1NZA A;  2Y3Y A;  4OI4 A;  4DS4 A;  2E1P A;  2JHE A;  1QAX A;  1RCO B;  3Q22 A;  4ICL A;  5AXL A;  3GFZ A;  1K0T A;  4Y00 A;  2KT2 A;  2YWE A;  1N5T A;  4M5K A;  4QOT A;  1S10 A;  1FRM A;  1N8R T;  2CQ0 A;  2I38 A;  2K7J A;  3V6D B;  3ENW A;  2J8A A;  4UOC A;  2ZBC A;  1K47 A;  3MMC B;  2BE2 A;  1LW0 B;  2Z2Z A;  3DLL Q;  2C2K B;  3TZX A;  1HMV A;  4PZV A;  1WG5 A;  2OPQ B;  2CG8 A;  3BO3 A;  2KM8 C;  3VZI A;  4QIW D;  2YKN A;  2E5G A;  1HNV A;  3I87 A;  5DDQ C;  2R3V A;  3CCE S;  2IA6 A;  4C6A A;  2X1F A;  1S6Q A;  4ZP8 A;  4Z37 A;  4DL5 A;  2WOM A;  5AXN A;  2BOA A;  4F67 A;  1O6X A;  1RT6 A;  2VKR A;  2LXF A;  4DX6 A;  4A8Q A;  2NSC A;  3L7O A;  3WQP A;  2EFP A;  3TRG A;  1IBC B;  5D0G A;  2DNN A;  1UWB B;  2GCF A;  1GT8 A;  2RQC A;  3OR1 B;  2GGP A;  1RBA A;  4X62 J;  3DKD A;  4AQY F;  3MEK A;  5K20 B;  2V4J A;  4L74 A;  5C5J A;  4OX6 A;  2R2R A;  1VFJ A;  1RAF B;  2GAH C;  3AD9 C;  4A8X A;  4O0N A;  4IUF A;  4TU9 A;  3I96 A;  4LFB J;  4ZVT B;  1IBL J;  3W2W A;  5ETM A;  5L46 A;  3MMA A;  3TVZ A;  1C1B B;  1T7P A;  2BM1 A;  1IKY B;  4M1K A;  4IYQ A;  4F4K A;  4PXC A;  4CTA B;  1UJ6 A;  2XYG B;  1XMO J;  5H9F K;  3M32 B;  5AXM A;  4V19 J;  2DIT A;  2MZR A;  4J9M A;  4YHH J;  2K2P A;  2R8I A;  3NL0 A;  4KPY A;  4L73 A;  3NMA A;  4ZKA A;  3N4W A;  1FXL A;  4MKB A;  3OTD A;  3AD8 C;  2FVC A;  3O1L A;  3QLH B;  4OJ1 A;  1RAB B;  1MNE A;  4EBE A;  1UJ5 A;  1ZAW A;  3UE2 A;  1T9V A;  5H9E J;  2XMK A;  5GAD I;  4C8Z A;  1LFW A;  3HSJ A;  1A7G E;  1HD0 A;  2DEJ A;  2XY5 A;  3M05 A;  3TAN A;  4LSL A;  4M5J A;  1ZM9 A;  3T19 A;  2B6A A;  5I3Q A;  1S0N A;  2FDN A;  2QV6 A;  2FGC A;  4JI6 F;  3KOA A;  3OFG A;  3QGH A;  3R27 A;  2D69 A;  5KFI A;  2AV5 A;  4GVL A;  4LF6 F;  1YDL A;  5IS2 A;  4UQG A;  3D2W A;  1U4B A;  3ADA C;  1Q78 A;  5HQL A;  2HWT A;  4E2F B;  2CPD A;  4JV1 A;  4LQ3 A;  2FTR A;  3D5M A;  4DCO B;  2F63 A;  2UXC J;  1WWH A;  3G6X A;  1UJ4 A;  4C3M A;  4ECZ A;  3VTI A;  3IBW A;  4UTG A;  3I31 A;  3HI9 A;  1JLF A;  1WC4 A;  3KKF A;  2E5J A;  2HBZ B;  2W7P A;  1R89 A;  5E0O A;  2V8D A;  1FKP A;  4DR4 J;  3KNG A;  4QYZ J;  2WON A;  2DXD A;  5B7W A;  4FF4 A;  2UUC F;  1SH3 A;  2RQ4 A;  5LMU J;  2CZ4 A;  4RW7 B;  5F8G A;  2J0W A;  1O0P A;  5E33 A;  3E01 A;  4NZ7 A;  1RWK B;  1NXI A;  2OD4 A;  1HBU A;  4NLP A;  1VQ4 S;  1VLO A;  2MLX A;  1OQ6 A;  1I94 F;  4DV6 J;  1WSR A;  2KDO A;  2AEJ A;  5KFG A;  4J91 A;  2W2P P;  3H2V E;  4TXS A;  1TL3 A;  1FCA A;  1LWX A;  4JI7 F;  4EUV A;  4FP9 A;  4BC7 A;  3QAT A;  3JTP A;  1KN6 A;  4UOF A;  5J1E B;  1ZM4 A;  2VQF F;  5I42 B;  4LF8 F;  1QSL A;  1P8G A;  2PFF B;  1FRJ A;  2W8K A;  3LO3 A;  3MGJ A;  2Z4P A;  2QA1 A;  4IFV A;  3GZ7 A;  3NP5 A;  4ELV A;  3MCO A;  1YZ7 A;  1R8C A;  5B0E A;  2C3O A;  2LCW A;  4CO4 A;  2MKK A;  1HQE B;  5D6G A;  4QW9 A;  4F4Z A;  1FFW B;  2FJX A;  4ZMM A;  1RHJ B;  4PYD A;  4OHV A;  2VB6 A;  3D6F B;  5LL6 d;  2K06 A;  2Y8W A;  4D3H A;  1H38 A;  4LIW A;  3PW5 A;  1U1K A;  5I3P A;  3L7P A;  1U6Z A;  3HD2 A;  1SKW A;  3DMJ A;  2UUT A;  4NRT A;  4UZB A;  1SVD A;  3H90 A;  2XO7 A;  1CJU B;  1R31 A;  2M8D B;  4MH8 A;  4A8O A;  1IBK J;  5LJ5 Y;  4ZVR B;  4CO0 A;  2E1R A;  2P2C B;  4C11 B;  1CJK A;  2B8P A;  4DX5 A;  3SCJ E;  5H9F J;  5L8R C;  3TX8 A;  3VAM A;  1NAQ A;  3M8P B;  4YQW A;  2AJ4 A;  3GPA A;  2LVW A;  4IRC A;  2LP4 A;  4DF4 A;  1KC8 T;  4ATN A;  1WTB A;  1HAR A;  1S0M A;  4MK9 A;  3TAM B;  1JLB B;  2X51 A;  2Z2L A;  2NLW A;  3PX0 A;  1HQU A;  1N0V C;  1NPP A;  3H40 A;  3R5J B;  3ETM A;  5D4P A;  4Y65 A;  3DLJ A;  4OV1 A;  2IMO A;  1U1L A;  3WDO A;  2XZD B;  3ISN C;  1QAJ A;  2HHU A;  1UVJ A;  2R7S A;  3WC2 A;  2IAJ A;  3W9I A;  5ETR A;  4TLQ A;  2PE8 A;  4USJ C;  2EBG A;  2BJ8 A;  4FPI A;  4ZPV R;  2VV5 A;  3SEO A;  2G2O A;  2UU9 J;  1S57 A;  5IOL A;  1T8E A;  5J1N A;  3K8W A;  4LF5 F;  2KI2 A;  2YNH A;  3LPE A;  1MRO B;  4J9Q A;  4URQ U;  3SYZ A;  3T1Y F;  1JNR B;  3BGU A;  1TKD A;  3FCW A;  3AOB A;  4KGX B;  4KGZ B;  2BQR A;  2MLZ A;  4OZJ A;  4WIQ A;  4QCL A;  1DFD A;  1WKJ A;  1DTQ A;  1HWL A;  1SBR A;  4K7Q A;  3M9N B;  1XNR F;  3GYG A;  4LR9 A;  2PSZ A;  2RDD A;  3Q8S B;  3M7V A;  3GQC A;  3DHX A;  5F0U A;  2ZZN A;  3CTR A;  5THW A;  4PG8 A;  5BYQ A;  1E6V A;  3MMB B;  2W7A A;  3E3X A;  3P49 B;  2B56 A;  2LXU A;  3D67 A;  4ID5 A;  1QDU B;  1NJY A;  2N4D A;  5DET A;  2V69 A;  4GO7 X;  3FFI A;  2GFF A;  4LQ9 A;  3OTC A;  3QGG A;  2WB1 D;  4C0B A;  5GAG U;  1HBM A;  3B8H A;  3GCX P;  4X4N A;  5FJ4 A;  2F4V J;  2J8S A;  2V68 A;  1M5O C;  1NJI T;  2UZA A;  2FHJ A;  4ZLJ A;  4M63 A;  2DPI A;  2VG6 A;  8ATC B;  3CJS A;  4DUZ F;  4FDF A;  2BA9 A;  4DSL A;  2QG9 B;  2MZQ A;  1NK6 A;  2FC9 A;  2ALZ A;  3I6P A;  3KK1 B;  5LXY A;  1PC4 A;  4JI5 F;  1WEX A;  4ECV A;  1MWQ A;  1PGZ A;  3R6L B;  3DLG A;  2HS4 A;  2CUY A;  5C2C A;  3MUT P;  4G1Q A;  1HWJ A;  2O3D A;  3M2R B;  1KWM A;  3DU5 A;  1C1C B;  1KTQ A;  2B5J B;  2RRB A;  4CLU A;  1TTH B;  2XY6 A;  3R1H A;  3OPK A;  2XNR A;  3Q89 A;  2LA6 A;  1FX2 A;  3W66 A;  5L39 A;  2XSJ A;  1OS5 A;  2ZOF A;  2EI5 A;  4NI2 A;  1NDL A;  1U1P A;  5HI7 A;  4HVZ A;  3DRX A;  2MGZ A;  3VAH A;  1FNX H;  3M8W A;  3QNW B;  4WZQ A;  4R5P A;  1DTT B;  1WC3 A;  4JYA F;  1Q5Y A;  2PI4 A;  2NCK L;  4DR7 J;  2P9E A;  2DNL A;  3KLV A;  2KN4 A;  4P74 A;  1IKW B;  4F8R A;  3B6B A;  3GV5 B;  6AT1 B;  4KKO B;  2XGQ A;  2UV8 G;  3SSS A;  2XC9 A;  4DV2 F;  5A8K B;  2OSQ A;  3R9L A;  2ILZ A;  2V9K A;  4EMD A;  2CQI A;  4JP8 A;  5ETP A;  2QLX A;  3W65 A;  4PKD B;  3RRK A;  1HNX F;  4DXL A;  3UDC A;  3QJP A;  1WF0 A;  2J9C A;  4UUW A;  5GME A;  4IOB A;  4OYO A;  3TQ1 A;  2DR5 A;  3RB4 A;  1NDP A;  1XNQ J;  3AJ2 A;  5HP1 B;  2E5I A;  3NNA A;  1X0P A;  2C2N A;  4DL3 A;  4I6A A;  3C15 B;  4OHX A;  5ETQ A;  5ETO A;  3V6D A;  1NUE A;  4C0H A;  4K4W A;  1P1T A;  4B9N A;  3MMC A;  2HHT A;  4ZVS B;  4DG1 B;  2IVM A;  5KG1 A;  1LW0 A;  3KJQ B;  2J6T A;  1EKR A;  3VQT A;  2ROE A;  1REG X;  4TQR A;  3T1H J;  2OPQ A;  3S01 A;  5KTQ A;  1H7W A;  3LAM A;  1IXK A;  5KFM A;  4CNZ A;  1NJW A;  3OW2 R;  2JRS A;  4LF2 A;  3RUB L;  2QO3 A;  2DCU B;  4HTJ A;  2IM0 A;  3GG0 A;  3GFX A;  1HA1 A;  1CUL B;  3HZE A;  3GJQ B;  2CPX A;  3VCD A;  1NJX A;  2QL9 B;  2AX1 A;  4ZP6 A;  3PG9 A;  1RAA B;  1ZAX A;  1LQ9 A;  2GHP A;  4PWD B;  2GHW A;  1AB8 A;  2O01 C;  4TY8 A;  2CPH A;  1N48 A;  2CKW A;  4KV8 B;  4AXJ A;  2HS0 A;  3IMQ J;  4AYB D;  4WE1 B;  2EK6 A;  3CPW R;  2RU9 A;  4G1I A;  2GO8 A;  4K8R A;  5D77 A;  1TMM A;  2N3O A;  1OPZ A;  1SJQ A;  1BWE A;  2G2Y A;  3BSC A;  2XMA A;  2ZC3 A;  2YQ0 A;  4GKJ J;  3QSI A;  5G0R A;  3EPI A;  3V6J A;  4NA3 A;  1NHK L;  1CJV B;  1VQO S;  1IKY A;  5F3Z A;  3FSY A;  1UFL A;  2HHS A;  1ZA1 B;  4C8M A;  3HSD A;  5B0A A;  5J2N B;  3AQO A;  2YNG B;  1FJG J;  3M32 A;  2E66 A;  3A8E A;  1RKJ A;  1WEY A;  1OMS A;  1V3Z A;  3UR0 A;  1ZTW A;  3MPY A;  4EBC A;  3HHD A;  1OO0 B;  1NEE A;  4DR5 J;  4DL0 C;  2U1A A;  3OUY B;  2G0C A;  3QLH A;  2EKN A;  3DFE A;  2I0X A;  2OPP B;  5F3T A;  3CDB A;  1Z2Z A;  3RAX A;  1N6Q A;  5A76 A;  2HVI A;  2R7R A;  4ZVU B;  2D7S A;  2HHQ A;  4JI8 J;  1IR0 A;  2AX0 A;  2CQ1 A;  4DEZ A;  2D74 B;  3V6H A;  4PCQ A;  1AZS B;  1NH8 A;  2ZOG A;  2LU1 A;  4TU7 A;  3THV A;  2J5A A;  2FJW A;  4F4W A;  3TZW A;  1HNW J;  1Q1K A;  2ZH2 A;  1RHQ B;  4BCA A;  3WX8 A;  3R2D J;  4U8Y A;  5T14 A;  1UWA A;  3I0S B;  4EGL A;  2VPZ B;  2KZM A;  3UW1 A;  3W5X A;  4HH0 A;  4JI3 J;  2F8H A;  3SQG B;  4QR0 A;  1S6U A;  3NNH A;  4U7U K;  4M8L A;  3FZ2 A;  1RDR A;  3N5B A;  4J9P A;  4O3O A;  2IRX A;  3KG1 A;  5HN0 A;  2P6T A;  3DGV A;  5HVF A;  1YJW S;  4B3M F;  1RP5 A;  1X60 A;  5DO2 A;  2ZBR A;  5CXT A;  4RWX A;  3OXL A;  3A8K A;  1U02 A;  4PPD A;  4F02 A;  5H1S V;  3RG6 A;  5KFW A;  2V4Q A;  4F04 B;  3AFG A;  4OZL A;  3CC4 S;  1XMQ J;  2GW8 A;  4KH0 B;  3NS7 B;  1NSA A;  1RT3 B;  2WK4 A;  3QGI A;  1WOR A;  4WFZ A;  4Q7A A;  3NGT A;  1S76 D;  2Q66 A;  3RB0 A;  4ZLN A;  4P73 A;  1HL6 A;  5B08 A;  5IT9 Y;  4WTY A;  3DRP A;  1NSP A;  1IN0 A;  2M5Y A;  2VON A;  3MWB A;  4IO1 A;  2IM2 A;  1U24 A;  3CDE A;  1U2F A;  2DYA A;  3KJF B;  1GNK A;  4O4G A;  2VDI A;  5J1E A;  2DR7 A;  4U7C A;  4DPY A;  5HQ8 A;  1BQN B;  2Z57 B;  4CLF A;  4WK3 A;  1EQ0 A;  3MAH A;  1T9T A;  5ADZ A;  1FF2 A;  2OEJ A;  4DQR A;  2BM0 A;  3NAI A;  3LP1 A;  9ATC B;  2E7X A;  2HFV A;  4KSE B;  3V4I B;  2E44 A;  1CQN A;  5A2Q U;  5LMN F;  3MI7 X;  1C0U B;  2OIH A;  3CMA S;  1Q82 T;  4K4Z A;  1XBW A;  1Q8K A;  1L5U A;  3FRZ A;  3Q86 A;  3O5T B;  2AEM A;  1L3S A;  1VOM A;  2W24 A;  5DJB A;  1YVF A;  2V5H G;  4MKY A;  2HWI A;  2IVY A;  3UNY A;  1QAI A;  4CLS A;  1V9O A;  4X66 F;  1NB7 A;  3BR9 A;  4HT7 A;  4LRB A;  1CJU A;  1DLO B;  4WPA A;  2C3P A;  2H48 B;  2BAN B;  2WBR A;  3LWL A;  4C11 A;  1OY9 A;  3KHR A;  2DKO B;  5KOW A;  1XC9 A;  1TL5 A;  3KLI B;  3QO9 B;  3CCW A;  4JI2 J;  4DV1 J;  4HHH A;  1SIZ A;  4A4J A;  5CYJ A;  1N32 J;  2UUA J;  2EW9 A;  1JQG A;  4FKY A;  5I3U B;  3CDA A;  5DLF A;  2PI5 A;  1WDT A;  3B4M A;  4XTT A;  4B3T F;  4NYO A;  2IPO B;  4DCP B;  4HDG A;  2LMI A;  2OTL S;  4NRU A;  4O44 B;  1BD6 A;  2XS5 A;  4IDK B;  4WU2 A;  2PA8 D;  3BSA A;  3U27 A;  2HHH J;  4ITS A;  2VFU A;  2EKY A;  4DQS A;  3BGO P;  1VHI A;  3PJ9 A;  3GSI A;  4GVB A;  3C66 A;  1SKU B;  2IIH A;  3UDV A;  3TVY A;  3LTO A;  2Z0G A;  1LK5 A;  3KMS A;  1FK9 A;  2H65 B;  2LA4 A;  5C25 B;  1N5Q A;  5IZH A;  1SIW B;  4LBH A;  4PAA A;  2DJW A;  4DSE A;  5EWG A;  2YKA A;  3TW0 A;  2ACM A;  3ZNJ 1;  2J6U A;  1LWE B;  2XLJ A;  3AB4 B;  4FVC A;  5JVG Q;  2ZNY A;  3TA2 A;  3H4D A;  2R2U A;  2P8I A;  1KTV A;  4RW9 B;  1FRX A;  3EZU A;  2KG0 A;  1FD8 A;  5IWA J;  3JTO A;  3HHN B;  5HO4 A;  1B64 A;  5KFC A;  3FEZ A;  4NE9 C;  2GVD A;  1ZZF A;  3H25 A;  2NXE A;  2GVZ B;  1GXU A;  3O2I A;  3ZXW A;  2XMU A;  1BHN A;  5HLF A;  3AA9 A;  1IKV B;  1EET B;  2HPU A;  1FHT A;  1RBL A;  1QY7 A;  2X3G A;  4JI0 J;  2LYV A;  2JOQ A;  3R5C A;  1EAR A;  2CJQ A;  3C16 B;  2M3D A;  5E2Q A;  4X64 F;  4OHZ A;  3A3P B;  1XR5 A;  4FF3 A;  4W90 B;  3HJV A;  2VHG A;  2FVR A;  1J5E J;  2R8K A;  3HSZ A;  4B3R F;  1VIX A;  4C8O A;  5M2U A;  2LEB A;  2CJA A;  1SKS A;  4BDP A;  1P1L A;  2VC0 A;  1OIA A;  4DHV A;  3V81 B;  1WF1 A;  2HZC A;  2R8G A;  2IRY A;  2XLK A;  2WSC C;  3MAQ A;  2MKS A;  3CW2 C;  3KLF A;  1IVZ A;  1VQP S;  4V19 X;  2JNJ A;  2RE1 A;  2OPR A;  3KK1 A;  2BVZ A;  1TFY A;  4OJ3 A;  3DYA B;  4OI1 A;  4M94 A;  3UDL A;  2DR9 A;  3O44 A;  2DH9 A;  1C1C A;  4A8M P;  2CJY B;  2IYI A;  2YKP A;  4FYY B;  1WC0 A;  2M9K A;  2NUH A;  1MW7 A;  2K1R B;  4LJM A;  4HDH A;  4H54 A;  1VIO A;  2ZH6 A;  1F5B A;  5B0D A;  2E9Z A;  2RRA A;  3US5 A;  4LF7 F;  5E3P A;  2I8E A;  2FIU A;  1JJ2 R;  1MMD A;  3CCV S;  2FJB B;  1SJF A;  1RWU A;  4XK8 C;  4DV3 F;  3E2E A;  1Q8I A;  3CXC R;  3W5Z A;  5A8K A;  3HJF A;  3OBI A;  1N34 F;  5ITH A;  1IR1 A;  2W2Q P;  4Y2M A;  4DV7 F;  2B9Y A;  4CT8 A;  4A8K A;  5L9X A;  2MQM A;  3UVJ B;  4F2S A;  3H5S A;  4FS2 A;  2AEF A;  5DZ7 A;  4OI2 A;  4AT1 B;  4ELU A;  2Y1J A;  2BZ2 A;  4HI2 A;  4GKK F;  2F8M A;  2KB2 A;  3QRP A;  3TWZ A;  4NLS A;  3TI0 A;  3DNC A;  2JLF A;  5GAD U;  2MQ8 A;  4RW6 B;  2ZJQ Q;  3D68 A;  3EE3 A;  4DFM A;  5DG8 A;  1TKX A;  3HKW A;  2E5L F;  3LGM A;  4DG1 A;  3KHH A;  1N33 F;  2FY8 A;  3M4X A;  1S0O A;  4IG0 A;  5KFV A;  1RI7 A;  3TA1 A;  2W2O P;  4K4X A;  3QQC D;  1T9X A;  4ECY A;  4CO1 A;  2BQU A;  4DN0 A;  5A8R B;  3D4J A;  4OI6 A;  5EN1 A;  1RAC B;  3CJ5 A;  3R7S B;  3ZTS A;  1VQ5 S;  2L08 A;  1IBM J;  4ILR A;  4KPC A;  3JQJ A;  4RUA A;  1S59 A;  4A8W A;  4ZCI A;  4NPO A;  5B09 A;  3EMT A;  2CQP A;  2AJ1 A;  3N28 A;  1UET A;  4WXO A;  2OO4 A;  4OX9 F;  5CCL A;  2DGX A;  2A3J A;  1IQZ A;  5GVQ A;  4Y28 C;  3U7J A;  1GMU A;  4PWD A;  2FZC B;  4HT5 A;  3KXD A;  4FPR A;  1WI6 A;  3IRX B;  4AE5 A;  4ECS A;  1B0P A;  4X4Q A;  1T95 A;  1S9G B;  2RF2 B;  3OL8 A;  1RWN B;  3ZTR A;  1GFW B;  2R8H A;  5D0E A;  2BAC A;  2Y1I A;  1VQY A;  2R42 A;  1S6P B;  3BEG B;  3UD5 A;  1ZZN A;  5DS7 A;  4I6W A;  1EX8 A;  2RUS A;  3AY0 A;  2GIQ A;  4TYA A;  3W8G A;  1YRU A;  1FER A;  5J2N A;  3MM8 B;  2YNG A;  1NO8 A;  3R8Y A;  3EYZ A;  8RUC A;  4ERD A;  2LEC A;  5DDO C;  5GMK a;  4G3I A;  1CJT B;  5AJ3 J;  4OIX A;  4ZDN A;  3P6Y C;  2XG8 A;  4RNH A;  3M2U B;  2RT3 A;  2KL8 A;  2OPP A;  5JJB A;  4K5S A;  1D9F A;  4XAK A;  1JIH A;  4HEA 9;  4NCG B;  3CJ4 A;  3HFZ B;  5K8O A;  3LW5 C;  2XB2 D;  7FD1 A;  4IG3 B;  4OZ5 A;  4AUK A;  2CJ9 A;  2RDJ A;  2CPI A;  4UW2 A;  2GQ2 A;  3HVR A;  4BS2 A;  1AZS A;  1LWF A;  4UZC A;  1RT4 A;  3NKY A;  2ZH8 A;  2NPF A;  1UEV A;  2AIR B;  1TK8 A;  4MTP A;  3DXS X;  2QMW A;  3VAG A;  3I0S A;  4LFC F;  3J7A 1;  3SQG A;  1HFE L;  1TL1 B;  4NWB A;  1FVS A;  1JLG A;  4DR1 F;  1WSV A;  3HFK A;  3LAL A;  3PRD A;  2A0F B;  4J9K A;  2LFV A;  1Q0N A;  4CLZ A;  2DNH A;  2JC0 A;  2JWN A;  4RNO A;  1C0T B;  4P9S A;  3PIP Q;  1KQK A;  2WW4 A;  4DN9 A;  3K8V A;  2NS1 B;  5KG0 A;  3AOC A;  4YR3 A;  2RS2 A;  4NLQ A;  5GMD A;  4OL8 A;  3Q8P B;  4X4O A;  2VF3 A;  1RLD A;  2DO0 A;  3G6Y A;  1Y0H A;  2ZFH A;  1IKX A;  1EP4 B;  4ED6 A;  2WZ1 A;  3MXH P;  1HHT P;  2HGN A;  3KTQ A;  3BPS P;  1DHM A;  2GMJ A;  3VR1 A;  5L1I A;  2K8G A;  3ITH A;  3SCI E;  4KFB A;  2R7U A;  2ZNZ A;  3CO0 P;  4ED0 A;  3EPG A;  5HAT A;  1KRP A;  1JKH A;  2C42 A;  3PDN A;  5B0G A;  1BQN A;  2FZK B;  3MEE A;  4LF6 J;  4CQ1 A;  4O3N A;  5HAO A;  3G86 A;  1RT1 B;  1KLM B;  3TJ8 A;  1F9H A;  1DQ8 A;  3KLE B;  4U95 A;  4NYP A;  3TUI C;  3PTW A;  3V4I A;  2GJF A;  3MR3 A;  1X9S A;  2CZV C;  2QSF A;  1T02 A;  3GCW P;  1BY9 A;  2AWZ A;  4JV2 A;  2QA4 G;  4I4B A;  2E7W A;  3MDF A;  3OR2 B;  1UW9 A;  3VVU A;  1NPR A;  3DRY A;  1RWW B;  4XDD A;  2FHO B;  4DF8 A;  2UUC J;  2QC3 A;  1KFS A;  4B3S F;  5ETN A;  2HFS A;  1A9N B;  1DLO A;  3AOD A;  4A47 A;  1S72 S;  4P6Q A;  5E5N A;  2BAN A;  1I94 J;  1AXQ A;  4WFB Q;  5DDP C;  1Y00 A;  4P71 A;  1RAI B;  3KLI A;  3IN5 A;  2I5J B;  2HQD A;  3HSG A;  1K1Q A;  2BW7 A;  3EX7 B;  2RKI A;  4I67 A;  5AE1 A;  5T41 A;  4LSZ B;  5HMY A;  2Y8Y A;  5GAG I;  4DSJ A;  4JB8 B;  1D8Z A;  2IJF A;  2H5J B;  2VBW A;  2VQF J;  3KG0 A;  4YY3 F;  5KT6 A;  1ZYQ A;  4LF8 J;  1S1X B;  5J2M B;  4B9S A;  1TKZ B;  1U0H B;  1FNO A;  1FEE A;  2CQG A;  2DGV A;  2CPY A;  4OMF G;  1U8S A;  4N76 A;  2BV3 A;  2YPZ A;  1RT2 B;  3I9Z A;  3G6V A;  5DGA A;  4ZP9 A;  1T94 A;  4IDK A;  1C2P A;  4CLL A;  2HUR A;  4MIB A;  1CC7 A;  3NBP B;  3BO2 A;  3UDE A;  2YY3 A;  2KJV A;  3EM1 A;  3HT0 A;  1F1B B;  3KDN A;  1XR7 A;  1AFJ A;  3W3S A;  1RTJ B;  3FQK A;  1KHV A;  4DFP A;  1N5Y B;  5J1P A;  1JMT A;  4K4S A;  2NR0 A;  1ULR A;  5HSP A;  3MM7 B;  2MZT A;  3VGU A;  1SXL A;  3SI8 A;  1LWE A;  1OWX A;  3SDE B;  2Q6C A;  2DNQ A;  3TJ9 A;  4ZN1 A;  1D3W A;  1FKO A;  4EYI B;  3BQ1 A;  1J5O A;  2DGT A;  4J9R A;  1ACM B;  2E9T A;  2OPS B;  2ZUA A;  2CJK A;  4RW9 A;  2RQM A;  3JQM A;  4ZLP A;  5IV4 A;  4DR3 F;  1F3V A;  1FKA F;  4WP3 A;  1O51 A;  4QIF A;  4QWA A;  2HYI B;  2YKO A;  1PKU A;  2GVZ A;  4NX9 A;  3NGS A;  4NZ6 A;  2VD3 A;  1RT5 B;  2CNN B;  4RLE A;  3BR8 A;  2MZJ A;  4LIR A;  1EET A;  2RQK A;  2GNK A;  2WBM A;  2J0S D;  3LUY A;  3N9U C;  4JUZ A;  4RBT A;  3FVY A;  3IS9 B;  2BJ1 A;  1NK7 A;  4Q0B B;  3MPD A;  2K3I A;  3CJR A;  4TKT A;  1PO6 A;  3CCL S;  5DDR C;  2BMB A;  5JVH Q;  2JEJ A;  4K2J A;  2HBQ B;  3MM5 A;  2QGF B;  3Q2S C;  1NSQ A;  3U1N A;  2E9R X;  2C2Z B;  1Z1Z A;  2XI3 A;  1XMB A;  1K9M T;  4LF4 F;  4C7Q A;  4CWB A;  4LF5 J;  2R7T A;  4Z2X A;  2V2Z A;  1TKT B;  3B54 A;  3OQ2 A;  1NBE B;  3T1Y J;  3ULH A;  3MCM A;  3DYA A;  2ABY A;  2L48 A;  1O8B A;  4DV5 F;  5BYS A;  5IQQ A;  2FD2 A;  3CC2 S;  4RU9 A;  4LRE A;  4ETX A;  1HNI A;  3BJY A;  2ASY A;  1X7V A;  1VK3 A;  1XEZ A;  4U96 A;  2M52 A;  2V34 A;  2K1R A;  3H2L A;  2AU0 A;  2LQB A;  2B51 A;  1XNR J;  1U45 A;  2FPH X;  2B9W A;  2Z56 B;  3ZNU A;  1NCL A;  4Y34 A;  2YKM A;  1WJ9 A;  1PAE X;  3I4P A;  1XK8 A;  2LKZ A;  3D0G E;  3KJV B;  4K50 A;  1HNZ J;  1CQM A;  3BZQ A;  3NS5 A;  3GLJ A;  4CLT A;  3BYR A;  4CRJ A;  1R0A B;  3EUN A;  1IBL F;  2VFT A;  2M7S A;  1EIY B;  1U8W A;  2DGW A;  4RL1 A;  1KBR A;  3VAI A;  3BBF A;  3DDI A;  2G4B A;  1RB0 A;  3IR7 B;  5C7P A;  4DUZ J;  2IJR A;  1LV5 A;  2BJ7 A;  2APO A;  1D9A A;  2J76 E;  1XIQ A;  4I68 A;  2HVD A;  2XWY A;  3QIP B;  4JI5 J;  4NLO A;  1VQ7 S;  1QM9 A;  2GV1 A;  1TAU A;  3N0V A;  1UCN A;  3EGV A;  3JSM B;  2HHV A;  4RW6 A;  4AL7 A;  4X84 A;  2QYC A;  4ECQ A;  5EWE A;  5KFA A;  3ET6 B;  3TOQ A;  4OHY A;  3BS9 A;  3J7Y U;  3R5G A;  3UNG C;  5AXK A;  4CLP A;  2F9D A;  4X2B A;  1VK8 A;  4JYA J;  5F8N A;  1Y3K A;  5A8R A;  4X4U A;  2JFD A;  4DX8 H;  4ECT A;  4XPE A;  3PR4 A;  2ZOM A;  3OJS A;  5IT9 U;  1LXJ A;  1RHR B;  3HUL A;  1QSY A;  4FVM A;  3BGR A;  1DRZ A;  1NK5 A;  2UXB F;  2F4F A;  2HK2 A;  1RBO B;  4NML A;  4LBP A;  1U47 A;  2NPI A;  3JAM Y;  1M5V C;  1HNX J;  2D9O A;  1BXN A;  2VBX A;  3MEC B;  4J9S A;  2JFK A;  1S0V A;  1CEZ A;  3DDN A;  2ZZT A;  2V0N A;  1URR A;  3E8O A;  4N41 A;  3K17 A;  2PO4 A;  3ZC4 A;  1X31 C;  3PXG a;  1S6P A;  1OY8 A;  4CNY A;  2DRA A;  2FB0 A;  4ALZ A;  4J9O A;  4EZ9 A;  3PR5 B;  4DFJ A;  4M5I A;  5A0Y B;  4LSN A;  4K0K J;  2FLO A;  3RGI A;  3VHQ A;  1OYD A;  4MKA A;  1UAW A;  4P2X A;  3D1H A;  3T5H A;  3KK2 B;  2ZE2 B;  1CJT A;  4HTI A;  2B4V A;  4UOH A;  4DL7 A;  4CLW A;  3K58 A;  2QMX A;  5DQH A;  4DQQ A;  2XEX A;  2I2Y A;  1PJ7 A;  2QA2 A;  4NCG A;  1N36 F;  4IH5 A;  5LOQ A;  2HHX A;  4WBF A;  3W2V B;  1FJE B;  4DU7 A;  4IFY B;  1IR2 A;  2CQC A;  1F3F A;  1RQ0 A;  1Y4Z B;  2QSW A;  2CAJ A;  3ILL A;  2BJ3 A;  1RWM B;  3IXQ A;  3ZTQ A;  3JYT B;  1DY3 A;  1WHX A;  3C6T B;  5C24 A;  1YJV A;  2MTL A;  2DRD A;  4TYB A;  4Y2I A;  2R2S A;  3KUG A;  3DRS B;  5KFB A;  2MQP A;  3DOL A;  2H9Z A;  4HI1 A;  4I69 A;  1ZM3 A;  2A6O A;  1TL1 A;  3HFV A;  2HVH A;  4ZVH A;  3NNC A;  4Q5V A;  5HK4 A;  4K4Y A;  1RWO B;  2VDH A;  3SCK E;  3I56 S;  5A2Q Y;  1H6K X;  3BQ0 A;  2M4M A;  3CD5 A;  2J9D E;  2WAQ D;  3D28 A;  1ZA2 B;  4LT6 A;  2DTJ A;  3CME S;  3M8Q A;  1GXT A;  1L3U A;  3T3F A;  1WOO A;  2ZJP Q;  2L9W A;  2UVV A;  4FXD A;  3QAE A;  1FDB A;  2C1E B;  2DB1 A;  2HNY B;  1N4L A;  2ASL A;  3TAR A;  3BRE A;  3IO1 A;  4KJI A;  2MXY A;  2IMW P;  4K2X A;  1BE4 A;  1WD6 A;  3CJ0 A;  2LEA A;  3HVW A;  4CH1 A;  5SZT A;  1RLC L;  5EX3 A;  1YTY A;  5KFO A;  3I9V 9;  1XJW B;  3EDR B;  1X4A A;  4ZVE A;  2DIU A;  3A3N B;  5D15 A;  2J9E A;  4IQM A;  1YIJ S;  1DQA A;  4DSK A;  4CCH A;  3NWG A;  1TAQ A;  4DPO A;  3PFE A;  1PIL A;  1H2U X;  2HS3 A;  4USM A;  2CAD A;  1KLM A;  4ECU A;  1FRI A;  3KLE A;  5IT4 A;  3UN5 A;  3OTE A;  2NZ4 A;  4B3M J;  3VAL A;  5J2P B;  2WCX A;  2KKH A;  1H2V Z;  2AJF E;  4QPT A;  2CVI A;  3DXB A;  2JLG A;  3EIC A;  5JMN A;  4I2P B;  2XMW A;  4I2Q B;  2KXH A;  3PYG A;  3QRR A;  1P9Q C;  1RK8 A;  1S5Z A;  3OR2 A;  1X4C A;  4CP5 A;  2XMV A;  3MTJ A;  1QTN B;  3NCQ A;  3LP2 B;  2HGL A;  1R7I A;  4QIG A;  3PFO A;  1HBN A;  1PYS B;  1TV6 B;  5DLG A;  3KJN B;  3SV4 A;  2W01 A;  4YB6 A;  3S1T A;  2XMT A;  2OUG A;  4KHP F;  4QWD A;  2QFI A;  1HBO B;  3HMJ G;  4L3N A;  3BQ2 A;  3FUY A;  3NCR A;  1RKI A;  3OFF A;  2RIJ A;  3DLK B;  2VC1 A;  3FSX A;  1VRU B;  5HMX A;  4G1P A;  2ZHO A;  2B4U A;  2CRL A;  3QZ8 A;  4J5O A;  1U0H A;  2ZH1 A;  4LFA F;  3OVA A;  3HZG A;  3OFE A;  1RT2 A;  2VFS A;  5LSR A;  1H3D A;  1FFS B;  2OHD A;  1SC1 B;  3BH7 B;  4IOA Q;  5LMN J;  4GC7 A;  1VQN S;  4AFF A;  2ZBQ A;  3VV2 B;  2QLF B;  5D3G B;  3BDP A;  3NBP A;  2RB7 A;  3IG1 A;  1FWL A;  3MFH A;  2KYX A;  2FJV A;  2FJD B;  4QR1 A;  2A6M A;  1P9Y A;  5KFS A;  3WBZ A;  1G6B A;  4NXM F;  2CNO B;  2HW3 A;  1KQS R;  2NRE A;  3MPW A;  1PYO B;  1RTH B;  3A8I A;  3K5L A;  3FQL A;  4C98 A;  4X66 J;  2RML A;  1IM4 A;  1JB0 C;  2JJ4 D;  1PIE A;  3MM7 A;  4LRD A;  2MB0 B;  5DGB A;  1V3R A;  4ZLL A;  3PJW A;  3K5N A;  2J7K A;  4YEA A;  1NHV A;  4WFY A;  4A8S A;  5B0C A;  4KYZ A;  1I5O B;  2ZJR Q;  2HFO A;  2O5D A;  3FK4 A;  5L1L A;  3LGN A;  1VGY A;  2HVZ A;  2EFQ A;  2OPS A;  5EWF A;  3C14 B;  3JTN A;  1L3T A;  3NGK A;  3A8J A;  1REV B;  3W5Y A;  1KOO A;  2HNZ A;  1LW2 A;  2AJ2 A;  4B3T J;  4KBI A;  4HL9 A;  4NLU A;  5LSO A;  4URG A;  3J7A N;  5CYQ B;  1RT5 A;  4RKU C;  1R6Y A;  2XCA A;  2SXL A;  1K73 T;  2CQH A;  3MM6 A;  1KKH A;  3DI6 B;  2R2T A;  3KLG B;  1R8P A;  2NZC A;  4K4U A;  2FLP A;  2MKH A;  2HMI A;  3IS9 A;  4P2F A;  4ZCL A;  2YX4 A;  3DOM B;  3M30 B;  4KH1 B;  5KFD A;  2ZHB A;  2DIS A;  3KK3 B;  1MML A;  1M5K C;  3MZI A;  7FDR A;  3AD7 C;  1Q8B A;  2VL1 A;  2WTF A;  4WCE Q;  2EC2 A;  3BGL A;  3H98 A;  3V2U C;  3CJ8 A;  3DGP A;  4LF9 F;  1PAU B;  2Z8Q A;  3TVK A;  3R2C J;  4KAI A;  2DY9 A;  2HRY A;  1TKT A;  1JLQ B;  4DV4 F;  1ZM2 A;  4PXB A;  1QVF R;  3TP2 A;  2RS8 A;  4IQX A;  1TR0 A;  3H7H B;  2KHC A;  4M5L A;  3G8S A;  4USI A;  2ROP A;  4DCJ B;  3S6E A;  1NZ8 A;  3PJX A;  2E5H A;  1U26 A;  2G2Z A;  1W2B R;  4NMX A;  5HJY A;  1X5P A;  5IFM A;  1WEL A;  2CYY A;  5JUM A;  1HYS B;  1BGX T;  5KFH A;  4ECW A;  2HIQ A;  3NOC A;  4P7T A;  4M5M A;  5HRO B;  4MJK A;  1UA1 A;  1JLE B;  1JXV A;  1WTF A;  3RTV A;  4C3L A;  4X64 J;  1A6L A;  1H98 A;  3GE9 A;  4ZS6 A;  2YQ1 A;  3I4H X;  2MSS A;  3CC7 S;  3KJV A;  2G1H A;  4B3R J;  3HCX A;  3UI3 A;  3T41 A;  1RGV A;  3ICL A;  1CS4 A;  3RZA A;  4BLG A;  1KP6 A;  1WDD A;  4OX8 A;  4ZVO B;  4H4M B;  3I82 A;  3C19 A;  1BWV A;  5D4N A;  3FEY B;  1X9W A;  3G96 A;  2GAG C;  1SC6 A;  4ZPD A;  2G1D A;  3P5T L;  2V9W A;  1WG4 A;  3AOA A;  3K59 A;  4C4W A;  3MR7 A;  3DCA A;  4RWW A;  1KOH A;  2JVR A;  1SUQ A;  3CE8 A;  3MEG A;  4I0W A;  3QIP A;  4MKV A;  5HAN A;  3MHY A;  2IY5 B;  1VBX A;  3DRR A;  3NY0 A;  3MED A;  2KXF A;  3SZ2 A;  4KB7 A;  1S1U B;  5LXR A;  1IWG A;  3JSM A;  5D4L A;  1R8H A;  3F41 A;  1JK9 B;  2H3E B;  3CSK A;  4W98 A;  1X5T A;  3ET6 A;  4OI3 A;  1RHM B;  1Z2L A;  5B0B A;  4NLG A;  1VLY A;  3D3C J;  1NLK L;  1T05 A;  2MZS A;  3TZY A;  4X65 F;  2CG4 A;  4KT0 C;  2G0I A;  2GGP B;  4N77 A;  5ETT A;  4LF7 J;  3IRW P;  4PR6 A;  2XYP B;  4U8V A;  3RAQ A;  4DV3 J;  5KFE A;  3R5A A;  1Y5L B;  3CCQ S;  3W2W B;  2B7C B;  4C48 A;  1G1X A;  3ONQ A;  1U7L A;  1N34 J;  2YQ3 A;  3HXM A;  3MMA B;  4DV7 J;  2OML A;  1NDC A;  3LF0 A;  1KHW A;  1FO1 A;  2XS2 A;  4CYU A;  1FX4 A;  1PCA A;  2KVQ E;  2G13 A;  4H4O A;  5CYM A;  4RUC A;  3PYE A;  3T5L A;  3PO5 A;  4A46 A;  3NOG A;  4WZM A;  1EQM A;  2IJN A;  4GKK J;  5D0H A;  2C3M A;  2MKJ A;  2XYH B;  4ZPW R;  3HT3 A;  2KM8 B;  2QL5 B;  1HHQ A;  1WHW A;  4I1T A;  1URN A;  4AXI A;  2XO6 A;  4EO6 A;  2AD9 A;  1LK7 A;  3VQS A;  2KO1 A;  1SQE A;  4TN2 A;  4L72 B;  2PEH A;  2WHO A;  5E3Q A;  2E5L J;  3D6H B;  2HFU A;  5FII A;  1N33 J;  3POT B;  4Y0F A;  3GJS B;  4LSL B;  2JH3 A;  3HDS A;  2B6A B;  2ZZM A;  3ZZO A;  3OFH A;  1F9F A;  1TEL A;  3KK2 A;  3KYL A;  4NLY A;  1E6Y B;  2FY1 A;  2L9N A;  5KFY A;  1RZM A;  2V2K A;  2XLI A;  4K4V A;  4WFA Q;  4FYX B;  1N5S A;  2ZVI A;  1PSD A;  5CAA A;  2KFZ A;  2HZV A;  4KR0 B;  4HLB A;  3VWS A;  4W92 B;  1K44 A;  1X5S A;  1GX5 A;  1D9D A;  2V67 A;  4RBU A;  3MUR P;  3UN3 A;  3TEH B;  4AD6 A;  4ES3 A;  2A2C A;  5KFU A;  1DQ9 A;  4OX9 J;  2BKP A;  4TVA B;  3RRG A;  5ETV A;  3PHT A;  1JJC B;  3CCZ A;  3GIJ A;  1RTI B;  2RD5 C;  2F40 A;  3M8R A;  2AZ1 A;  2B4O A;  3P96 A;  1YBU A;  3K89 A;  3ETO A;  3C6T A;  4RW8 B;  1RT7 A;  1VRT A;  3RU0 A;  2WVF A;  4DUY J;  2HSE B;  3D6M B;  2CXE A;  2KU7 A;  3E51 A;  2GX8 A;  1ZS6 A;  3I0R B;  3BV8 A;  4P2M A;  1FKP B;  2MKY A;  3QFH A;  4PG5 A;  2V50 A;  3H5Y A;  3CVK A;  3MR2 A;  1SL0 A;  1R43 A;  1VQ8 S;  4MAK A;  3E01 B;  1B4S A;  4FXV A;  1WC5 A;  4DSF A;  1D0E A;  4I6Y A;  3BYP A;  3OTB A;  3HHL D;  2EFN A;  4FN5 A;  3L4B C;  1YK9 A;  3CGI A;  4Q44 A;  4NEZ A;  3EVO A;  4ER8 A;  4AL6 A;  4IKA A;  1VMB A;  3OJU A;  3LOU A;  4JI4 F;  1KLN A;  2E29 A;  1ZPV A;  3EZO A;  4IR9 A;  2HND B;  4YDD B;  2BUN A;  3AQP A;  2C28 A;  5IC4 B;  3MUV P;  2GQC A;  4Z7C A;  3AB2 B;  4OYX A;  3FGV A;  1DUR A;  4IFV B;  1UKU A;  1LKZ A;  2YNF B;  2MHN A;  2J0X A;  2BJ9 A;  1PYT A;  4YB5 A;  2QFJ A;  5AE2 A;  3IM9 A;  2GML A;  3MR6 A;  5FLX Y;  2DH7 A;  1WC1 A;  2V63 A;  3MM9 A;  1HKA A;  2DVI A;  3K0J A;  2V8P A;  3CUL A;  2ZD1 B;  2VA2 A;  1M90 T;  2GS8 A;  2MPU A;  5E3A A;  2YX7 A;  5AE3 A;  2K7K A;  1SH2 A;  3DMJ B;  2VKZ G;  4LFC J;  4NA1 A;  1R6V A;  3PV8 A;  1KSP A;  2LLZ A;  1T11 A;  2HFN A;  4U7U D;  1U2R A;  2JX2 A;  4DR1 J;  2PII A;  2Q6B A;  2WVE A;  3DLE B;  4EI2 A;  5L38 A;  2VIC A;  1SPB P;  2PMW A;  4K4T A;  1YJ7 A;  3GTY X;  4R25 A;  3D54 A;  3PM9 A;  3NLC A;  3L95 X;  2JDJ A;  2OAU A;  3LP0 B;  1NM2 A;  1GAO A;  4EYH B;  2JEI A;  1KON A;  3GIL A;  2HKE A;  3MCN A;  2ZHA A;  1UFW A;  3SMZ A;  3LP2 A;  1HQU B;  2A18 A;  4PAB A;  4DQI A;  2LQ9 A;  3F73 A;  2NYI A;  1TV6 A;  1FDA A;  1SH0 A;  4L3K A;  5F8J A;  2D3O R;  4JI0 F;  1X4E A;  1MSW D;  1HBO A;  5F8M A;  3D1O A;  4K59 A;  3PHE A;  3M2V B;  3SSR A;  2C3U A;  4J37 A;  3QYY A;  1B0T A;  4RU2 A;  1WHY A;  3IWL A;  5C2G A;  3NWR A;  1LFP A;  2CJX B;  2WB4 A;  5E3R A;  5HVH A;  2VBZ A;  2KT3 A;  2YH1 A;  2NUU G;  3B4D A;  1RJJ A;  4CLK A;  3IP0 A;  4QYR A;  2MHE A;  3NGR A;  4F26 A;  5CAB A;  1RAO A;  3UCG A;  3KWM A;  2YNH B;  1V3S A;  5D3G A;  5F8I A;  4WXW A;  1KDN A;  1D8Y A;  1TL4 A;  1UWB A;  1VJW A;  1ZH5 A;  4NLR A;  3OR1 A;  1T9Y A;  2P5V A;  2EFO A;  2QX0 A;  2FVS A;  4B3S J;  3FC9 A;  1NJZ A;  9RUB A;  3O6Q A;  3QBC A;  3CF5 Q;  2EWH A;  2VQE F;  3ZZU A;  5F41 A;  1Q79 A;  4ED2 A;  3G9C A;  1JJ4 A;  2H4W B;  4IOC Q;  4NLV A;  3WC0 A;  1RAE B;  4F25 A;  1E6V B;  2U2F A;  1C1B A;  1EHW A;  1KEK A;  1U1Q A;  2VUG A;  3VGV A;  3JQK A;  4A8Y A;  4ID5 B;  1JLC B;  5KG5 A;  4CTA A;  2ZVS A;  3FRY A;  3C14 A;  2BR0 A;  3FFI B;  3EXC X;  2RJZ A;  1REV A;  3EVW A;  3N5F A;  1R8A A;  3GP9 A;  1HBM B;  3GYN A;  2R9L A;  5A8W B;  2A10 A;  3O8W A;  2DBB A;  2W9B B;  2R4F A;  3IBF B;  5CYQ A;  2OD6 A;  3VVT A;  4E8U A;  1VQS A;  2M70 A;  3IR5 B;  3PIO Q;  1B0V A;  1HIY A;  4O23 A;  1TL7 B;  1RAG B;  4C9D A;  2XSF A;  3BBC A;  2N7Y A;  4YDX A;  5D78 A;  3DI6 A;  4OQJ A;  2FVQ A;  3KLG A;  2RVJ A;  2R7O A;  3OLB A;  3JAM U;  3PNI A;  2CQ3 A;  3DLG B;  1XQI A;  4G1Q B;  3RBE A;  3D7S B;  2KZZ A;  5D0R A;  3DOM A;  3J7Y I;  1R27 B;  4ZVF A;  3G82 B;  4CLY A;  5H9E K;  4IRK A;  3DC2 A;  4NI2 B;  2HEK A;  3DOK B;  1U49 A;  2F3J A;  1HQ2 A;  2QT7 A;  2AGP A;  2ERR A;  3Q8Y A;  5IQ6 A;  4B9V A;  2YPY A;  2XWX A;  1MG7 A;  3MR5 A;  3OV7 A;  2NSB A;  4ED3 A;  2F9J A;  4CO2 A;  5I4M A;  1FVQ A;  1UW4 A;  2VPW B;  4WU3 A;  1YSJ A;  2Q43 A;  4NCA A;  3AHP A;  3R7N B;  3M1V B;  4DR3 J;  3QT8 A;  3G2X A;  3T6B A;  2EK1 A;  1VC0 A;  4EO8 A;  1RAH B;  1S1W B;  4OI0 A;  3RB3 A;  1Q5V A;  1UMJ A;  4EK2 A;  4WP8 A;  2XBP A;  4JV0 A;  3FMW A;  5EX0 A;  1YJU A;  1JLE A;  3TQE A;  1FWP A;  3HHE A;  4PEO A;  1Y9O A;  3CWJ A;  1AUD A;  1X4G A;  4YFU A;  4YB7 A;  2UUB F;  1G7C B;  4RW7 A;  2DPJ A;  3X1L B;  1WNE A;  3CED A;  2CQB A;  1WEZ A;  3CO9 A;  2E1M C;  1Q53 A;  4RPF A;  1CVJ A;  1LWC B;  4QYZ K;  4OYP A;  3P5B P;  2XMJ A;  4H4M A;  2OGU A;  2RNE A;  1NKC A;  1YLX A;  3LA0 A;  2HQ3 A;  3D0I E;  2XHW A;  5HJX A;  2DGS A;  5KG6 A;  2DGU A;  4DPW A;  4LF4 J;  1OPI A;  2DNM A;  4B9T A;  1I51 B;  3QAU A;  5I42 A;  4EZ6 A;  1ICE B;  1V5V A;  3DHW C;  2M2B A;  1Q16 B;  4RW4 B;  4URS A;  3B82 A;  2WVB A;  1BUX A;  5AJ3 F;  4DV5 J;  1F9E B;  5KG7 A;  4TY9 A;  4V1A k;  3RRH A;  2NYH A;  4R0E A;  1S1U A;  2MZ1 A;  1XWL A;  5CQG A;  3ZZP A;  3TR5 A;  1RUS A;  4Y2A A;  4P72 A;  1GXL A;  2EG1 A;  2QRR A;  1FE0 A;  5ETS A;  4JI1 F;  3PYF A;  2B7B B;  5K5M A;  4WKR A;  1HQE A;  3KDO A;  1HR0 F;  2DHH A;  4J9V A;  4B02 A;  3CNQ P;  1JNZ B;  3R6G B;  2EFV A;  1X8D A;  4OZ2 A;  5CD4 A;  4P10 A;  5HMW A;  4TY8 B;  3JSY A;  4RJV A;  1KQG B;  2DH8 A;  1M1G A;  3CJ3 A;  3CIM A;  3UD4 P;  1NK9 A;  1YBA A;  2C2O B;  1VQ6 S;  3L7U A;  4EFA C;  4FXW A;  5KG3 A;  1S1V B;  3GB0 A;  2IBK A;  4DL2 A;  5IV3 A;  1UP1 A;  5G0R B;  4DDF A;  1VQK S;  3K5P A;  3M8P A;  1XTZ A;  1FJ7 A;  4ANE A;  3ENQ A;  2CWK A;  3WIV A;  2XGP A;  4MIA A;  3CDW A;  1S97 A;  3GII A;  4IO9 Q;  3TAM A;  1JLB A; 
#chains in the Genus database with same CATH homology
 3NGS A;  3WX8 A;  2HUR A;  1NHK L;  1LEO A;  3EMT A;  1NDK A;  2HVE A;  2DXE A;  2DXD A;  2DXF A;  5CAA A;  3EVM A;  3NGR A;  2NCK L;  3EVO A;  3PRV A;  3ZTP A;  1WKL A;  3G2X A;  3EM1 A;  1K44 A;  2BX6 A;  5CAB A;  1NPK A;  3DKD A;  3Q8V A;  1NCL A;  3VVU A;  3VVT A;  1WKK A;  1NDC A;  2B8Q A;  4EK2 A;  2DY9 A;  4FKY A;  1HIY A;  4ENO A;  1MN7 A;  3BBC A;  3B6B A;  1PAE X;  3MPD A;  3FBF A;  3FBB A;  1LWX A;  4O0N A;  3R9L A;  1S57 A;  3ELH A;  1KDN A;  2VU5 A;  1F6T A;  3EJM A;  5IOL A;  2B8P A;  1XQI A;  4HR2 A;  3BBB A;  3ZTR A;  1NSQ A;  3FKB A;  1B99 A;  3FC9 A;  1U8W A;  3EE3 A;  3FBC A;  3GPA A;  3VGU A;  1BHN A;  4UOF A;  4UOH A;  2AZ1 A;  4AND A;  1VYA A;  3PJ9 A;  1HHQ A;  3BH7 B;  3L7U A;  3BH6 B;  3FCV A;  3BBF A;  3DDI A;  3Q86 A;  2AZ3 A;  1W7W A;  3FCW A;  4DI6 A;  3EIC A;  2BEF A;  1ZS6 A;  5C7P A;  4W98 A;  4DZ6 A;  4FKX A;  1S5Z A;  1NLK L;  3NGU A;  3NGT A;  3B54 A;  1JXV A;  4DUT A;  1NSK L;  4C6A A;  3Q8Y A;  1WKJ A;  3ETM A;  1MN9 A;  1XIQ A;  4CP5 A;  1EHW A;  1NDP A;  2ZUA A;  4WBF A;  4ANE A;  2HVD A;  4F36 A;  3VGV A;  4S0M A;  5BXI A;  3Q89 A;  1NSP A;  3ENA A;  1B4S A;  1F3F A;  2CWK A;  3FBE A;  3ZTS A;  1NDL A;  1NB2 A;  3VGT A;  1BE4 A;  1UCN A;  3JS9 A;  3Q8U A;  4ANC A;  1NUE A;  3EVW A;  3ZTQ A;  4F4A A;  1HLW A;  1BUX A;  4KPC A;  1PKU A;  3VGS A;  3ZTO A;  3GP9 A;  1S59 A;  3Q83 A;  2DYA A;  4UOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...