3R9SA

Structure of a carnitinyl-coa dehydratase from mycobacterium avium 104
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
260
structure length
260
Chain Sequence
b'APGALAERRGNVMVITINRPEARNAVNAAVSIGVGDALEEAQHDPEVRAVVLTGAGDKSFCAGADLKAIARRENLYHPDHPEWGFAGYVRHFIDKPTIAAVNGTALGGGTELALASDLVVADERAQFGLPEVKRGLIAAAGGVFRIAEQLPRKVAMRLLLTGEPLSAAAARDWGLINEVVEAGSVLDAALALASAITVNAPLSVQASKRIAYGVDDGVVVGDEPGWDRTMREMRALLKSEDAKEGPRAFAEKREPVWQAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carnitinyl-CoA dehydratase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium avium
molecule tags Lyase
total genus 94
structure length 260
sequence length 260
chains with identical sequence B, C
ec nomenclature ec 4.2.1.-:
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 3r9sA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3r9sA01
4I42A 5E0NX 5DTPA 1N6EA 1N6FA 3H0SA 4QIIA 1HNOA 3QK8A 3TT7A 3R9TA 1UYVA 3H0QA 4GM2A 1YG6A 4JCRA 1VRGA 4FJWD 2F9IA 5G1RA 3VIVA 2VSUF 5JBXA 3MT6A 2FW2A 2VSSA 2Q35A 3TV5A 3DORA 2DEOA 4K2NA 4WZ8B 3TVUA 4F47A 2GTRA 5C90A 1UYSA 3HE2A 2BZRA 3T88A 4JCQA 3STAA 3JU1A 4ELSA 4RCNA 2FZSA 3NJDA 2J5IA 2PG8A 4JYLA 3ZWCA 4K29A 2FBMA 4RYFH 3Q0GA 2A7KA 2ZL3A 3KTGA 4EMMA 4ZDCA 2W3PA 3QXIA 2A81A 2F9IB 5CTCA 4B3IA 1DCIA 3OMEA 2CBYA 3I47A 2VSSE 2HW5A 3M6MA 1UYTA 3GMAA 3ST9A 4FNBA 3GF3A 1WZ8A 4L6WA 3L3SA 5E0SA 4OG1A 4NNQA 2D3TA 1JXZA 2NP9A 2A7SA 5INGA 2J5IB 4JYJA 4ZDBA 3H0JA 4I52A 5KDRA 4FB8A 2ZL4A 3H81A 2Q34A 3TVWA 2PPYA 3N6RB 3QWDA 3ZWAA 4FNDA 1FCFA 4KWBA 4U19A 3K8XA 4K3WA 3TRRA 3TDCA 4ELWA 3TZ3A 4L8KA 4MOUA 4LK5A 4OMRA 4OLQA 1XNWA 2ZL2A 4U1AA 4RYFA 3QMJA 3TLFA 3RSIA 5DZKH 2PBPA 4Q1IA 1EF9A 5G1QA 3QYRA 5E0SH 4EMPA 1XO6A 1WDKA 4FN7A 3WG5A 1PIXA 2F6QA 4KNPA 1XX4A 4FZWA 2VSUA 1X0UA 3R9QA 1PJHA 3ZWBA 4KPKA 3ISAA 4WYOB 2VX2A 5FIFA 4ASIA 2ZQQA 5IKLB 1FC7A 3U9RB 1UIYA 3H0UA 1XNVA 1RJNA 3KQFA 3RSTA 3R9SA 1ON3A 1HNUA 4B3HA 3PEAA 3HRXA 1XNYA 3H02A 3NJBA 5DZKA 1OD2A 2VSUE 3ZW8A 5C9GA 3ZW9A 3BPPA 2Q2XA 3Q0JA 2J5GD 3Q7HA 4JFCA 5DUCA 5FUSA 3MYBA 4Q0GA 3KTHA 3M6NA 5INIA 1UYRA 2CE3A 3P5MA 4B3JA 2QQ3A 4ZDFA 3QKAA 3PZKA 3OC7A 2J5SA 2F9YA 3PE8A 1EF8A 3KTJA 2EJ5A 2IEXA 4HC8A 4IZDA 3LAOA 3IB9A 4U0GH 4JOTA 3HINA 3P2LA 3GF7A 1YG8A 1WDLA 5DU8A 1OD4A 5KDRB 3HLN1 4IZCA 3IBBA 2C8TA 3MFMA 4FZWC 2VSUC 5INFA 4JWVA 4Z0MA 1HZDA 4MXIA 2F9YB 3P85A 4ELXA 3TT6A 5MGBA 3T3WA 3GLMA 1NZYA 5DL1A 3Q1TA 1TYFA 3LKEA 3FF6A 2X24A 4QFEA 2DUBA 2X58A 4GHNA 4U18A 4ZDEA 4KD6A 1EY3A 5CTBA 4G2RA 4JCTA 4NEKA 2VSSF 3HP0A 4JVTA 2ZL0A 1RJMA 3BEZA 3V5IA 4ZU2A 3T8AA 3QXZA 1FC6A 3U9TB 1N6DA 5DU4A 5KJPA 1Q51A 2J5II 4FN8A 4U0GA 3DJAA 4MI2A 3FDUA 2VREA 4WCZA 1NZYB 3MOYA 1K39A 3SLLA 2ZQRA 3K50A 3T8BA 3KTIA 3RRVA 1TG6A 1K32A 3KTKA 3T89A 1FC9A 4I4ZA 1DUBA 4JJTA 4ZDDA 3G64A 2WTBA 1WDMA 2F6IA 5DTWA 3R6HA 4JCSA 4DI1A 5JBWA 4IZBA 1SG4A 1O8UA 4QIJA 3IAVA 2UZFA 1J7XA 1MJ3A 3SWXA 1SZOA 4HNKA 3GKBA 3V5EA 3R0OA 3BF0A 3OT6A 2J5GA 5DU6A 4YLHA 3U9SB 5DUFA 1Q52A 5G1SA 4JSBA 1Y7OA 3QREA 1W2XA 4EMLA 5DKPA 4U0HA 3PGQA 1ON9A
chains in the Genus database with same CATH superfamily
4I42A 5E0NX 2YJGA 5DTPA 1N6EA 4HDTA 1N6FA 3H0SA 4QIIA 1HNOA 3QK8A 3TT7A 3R9TA 1UYVA 3H0QA 4GM2A 1YG6A 4JCRA 1VRGA 4FJWD 2F9IA 5G1RA 3VIVA 2VSUF 5JBXA 3MT6A 2FW2A 2VSSA 2Q35A 3TV5A 3DORA 2DEOA 3A4MA 4K2NA 4WZ8B 3TVUA 4F47A 2GTRA 5C90A 1UYSA 3HE2A 2BZRA 3T88A 4JCQA 3STAA 3JU1A 4ELSA 4RCNA 2FZSA 3NJDA 2J5IA 2PG8A 4JYLA 3L8JA 1Y64B 3ZWCA 4K29A 2FBMA 4RYFH 3Q0GA 2A7KA 2ZL3A 3KTGA 4EMMA 4ZDCA 2W3PA 3QXIA 5CTCA 2A81A 2F9IB 4B3IA 1DCIA 3OMEA 2CBYA 3I47A 2VSSE 2HW5A 3M6MA 3BPTA 1UYTA 3GMAA 3ST9A 4FNBA 3GF3A 1WZ8A 4L6WA 3L3SA 5E0SA 4OG1A 4NNQA 2D3TA 1JXZA 2NP9A 2A7SA 5INGA 2J5IB 4JYJA 4ZDBA 3H0JA 4I52A 5KDRA 4FB8A 2ZL4A 3H81A 4J2UA 2Q34A 3TVWA 2PPYA 3N6RB 3QWDA 3ZWAA 3ADDA 4FNDA 1FCFA 4KWBA 4U19A 3K8XA 4K3WA 3TRRA 3TDCA 4ELWA 3TZ3A 4L8KA 4MOUA 4LK5A 4OMRA 4OLQA 1XNWA 2ZL2A 4U1AA 4RYFA 3QMJA 3TLFA 3RSIA 5DZKH 2PBPA 4Q1IA 1EF9A 3AJMA 3L8IA 5G1QA 3QYRA 3ADCA 5E0SH 4EMPA 1XO6A 1WDKA 4FN7A 3WG5A 3W8HB 1PIXA 2F6QA 4KNPA 1XX4A 4FZWA 2VSUA 1X0UA 3R9QA 1PJHA 3ZWBA 4KPKA 3ISAA 4WYOB 2VX2A 5FIFA 4ASIA 4GEHB 3A4LA 1UX5A 2ZQQA 5IKLB 1FC7A 3U9RB 1UIYA 3RQEA 3H0UA 1XNVA 3W8IB 1RJNA 3IRBA 3KQFA 3RSTA 3R9SA 1ON3A 3AM1A 1HNUA 4B3HA 3RQGA 3PEAA 3HRXA 1XNYA 5HUQA 3H02A 3NJBA 5DZKA 1OD2A 2VSUE 3ZW8A 5C9GA 3ZW9A 3BPPA 2Q2XA 3Q0JA 2J5GD 3Q7HA 4JFCA 5DUCA 3MYBA 5FUSA 4Q0GA 3KTHA 3M6NA 5INIA 3O4XE 1UYRA 2CE3A 3P5MA 4B3JA 2QQ3A 4ZDFA 3QKAA 3PZKA 3OC7A 2J5SA 2F9YA 3PE8A 1EF8A 3KTJA 2EJ5A 2IEXA 4HC8A 3RQFA 4IZDA 3LAOA 3IB9A 4U0GH 4JOTA 3HINA 3P2LA 3GF7A 1YG8A 1WDLA 5DU8A 1OD4A 5KDRB 3HLN1 4IZCA 3IBBA 2C8TA 3MFMA 1UX4A 4FZWC 2VSUC 5INFA 4JWVA 4Z0MA 1HZDA 4MXIA 2F9YB 3P85A 4ELXA 3TT6A 5MGBA 3T3WA 3GLMA 1NZYA 5DL1A 3Q1TA 1TYFA 3LKEA 3FF6A 2X24A 4QFEA 2DUBA 2X58A 4GHNA 4U18A 4ZDEA 4KD6A 1EY3A 5CTBA 4G2RA 4JCTA 4NEKA 2VSSF 3HP0A 4JVTA 2ZL0A 1RJMA 3BEZA 3V5IA 4ZU2A 3T8AA 3QXZA 1FC6A 3A4NA 3U9TB 1N6DA 5DU4A 5KJPA 1Q51A 2J5II 4FN8A 2P63A 4U0GA 3DJAA 4MI2A 3FDUA 2VREA 4WCZA 1NZYB 3MOYA 1K39A 3SLLA 2ZQRA 3K50A 3T8BA 3KTIA 3RRVA 1TG6A 1K32A 3KTKA 3T89A 1FC9A 4I4ZA 1DUBA 4JJTA 4NARA 4ZDDA 3G64A 2WTBA 1WDMA 2F6IA 5DTWA 3R6HA 4JCSA 4DI1A 5JBWA 4IZBA 1SG4A 1O8UA 4QIJA 3IAVA 2UZFA 1J7XA 1MJ3A 3SWXA 1SZOA 3ADBA 4HNKA 3GKBA 3V5EA 3R0OA 3BF0A 3OT6A 2J5GA 5DU6A 4YLHA 3U9SB 5DUFA 1Q52A 5G1SA 4JSBA 1Y7OA 3QREA 1W2XA 4EMLA 5DKPA 4U0HA 3PGQA 1ON9A
chains in the Genus database with same CATH topology
4I42A 5E0NX 2YJGA 5DTPA 1N6EA 4HDTA 1N6FA 3H0SA 4QIIA 1HNOA 3QK8A 3TT7A 3R9TA 1UYVA 3H0QA 4GM2A 1YG6A 4JCRA 1VRGA 4FJWD 2F9IA 5G1RA 3VIVA 2VSUF 5JBXA 3MT6A 2FW2A 2VSSA 2Q35A 3TV5A 3DORA 2DEOA 4K2NA 4WZ8B 3TVUA 4F47A 2GTRA 5C90A 1UYSA 3HE2A 2BZRA 3T88A 4JCQA 3STAA 3JU1A 4ELSA 4RCNA 2FZSA 3NJDA 2J5IA 2PG8A 4JYLA 3ZWCA 4K29A 2FBMA 4RYFH 3Q0GA 2A7KA 2ZL3A 3KTGA 4EMMA 4ZDCA 2W3PA 3QXIA 2A81A 2F9IB 5CTCA 4B3IA 1DCIA 3OMEA 2CBYA 3I47A 2VSSE 2HW5A 3M6MA 3BPTA 1UYTA 3GMAA 3ST9A 4FNBA 3GF3A 1WZ8A 4L6WA 3L3SA 5E0SA 4OG1A 4NNQA 2D3TA 1JXZA 2NP9A 2A7SA 5INGA 2J5IB 4JYJA 4ZDBA 3H0JA 4I52A 5KDRA 4FB8A 2ZL4A 3H81A 4J2UA 2Q34A 3TVWA 2PPYA 3N6RB 3QWDA 3ZWAA 4FNDA 1FCFA 4KWBA 4U19A 3K8XA 4K3WA 3TRRA 3TDCA 4ELWA 3TZ3A 4L8KA 4MOUA 4LK5A 4OMRA 4OLQA 1XNWA 2ZL2A 4U1AA 4RYFA 3QMJA 3TLFA 3RSIA 5DZKH 2PBPA 4Q1IA 1EF9A 5G1QA 3QYRA 5E0SH 4EMPA 1XO6A 1WDKA 4FN7A 3WG5A 1PIXA 2F6QA 4KNPA 1XX4A 4FZWA 2VSUA 1X0UA 3R9QA 1PJHA 3ZWBA 4KPKA 3ISAA 4WYOB 2VX2A 5FIFA 4ASIA 2ZQQA 5IKLB 1FC7A 3U9RB 1UIYA 3H0UA 1XNVA 1RJNA 3KQFA 3RSTA 3R9SA 1ON3A 1HNUA 4B3HA 3PEAA 3HRXA 1XNYA 5HUQA 3H02A 3NJBA 5DZKA 1OD2A 2VSUE 3ZW8A 5C9GA 3ZW9A 3BPPA 2Q2XA 3Q0JA 2J5GD 3Q7HA 4JFCA 5DUCA 5FUSA 3MYBA 4Q0GA 3KTHA 3M6NA 5INIA 1UYRA 2CE3A 3P5MA 4B3JA 2QQ3A 4ZDFA 3QKAA 3PZKA 3OC7A 2J5SA 2F9YA 3PE8A 1EF8A 3KTJA 2EJ5A 2IEXA 4HC8A 4IZDA 3LAOA 3IB9A 4U0GH 4JOTA 3HINA 3P2LA 3GF7A 1YG8A 1WDLA 5DU8A 1OD4A 5KDRB 3HLN1 4IZCA 3IBBA 2C8TA 3MFMA 4FZWC 2VSUC 5INFA 4JWVA 4Z0MA 1HZDA 4MXIA 2F9YB 3P85A 4ELXA 3TT6A 5MGBA 3T3WA 3GLMA 1NZYA 5DL1A 3Q1TA 1TYFA 3LKEA 3FF6A 2X24A 4QFEA 2DUBA 2X58A 4GHNA 4U18A 4ZDEA 4KD6A 1EY3A 5CTBA 4G2RA 4JCTA 4NEKA 2VSSF 3HP0A 4JVTA 2ZL0A 1RJMA 3BEZA 3V5IA 4ZU2A 3T8AA 3QXZA 1FC6A 3U9TB 1N6DA 5DU4A 5KJPA 1Q51A 2J5II 4FN8A 4U0GA 3DJAA 4MI2A 3FDUA 2VREA 4WCZA 1NZYB 3MOYA 1K39A 3SLLA 2ZQRA 3K50A 3T8BA 3KTIA 3RRVA 1TG6A 1K32A 3KTKA 3T89A 1FC9A 4I4ZA 1DUBA 4JJTA 4NARA 4ZDDA 3G64A 2WTBA 1WDMA 2F6IA 5DTWA 3R6HA 4JCSA 4DI1A 5JBWA 4IZBA 1SG4A 1O8UA 4QIJA 3IAVA 2UZFA 1J7XA 1MJ3A 3SWXA 1SZOA 4HNKA 3GKBA 3V5EA 3R0OA 3BF0A 3OT6A 2J5GA 5DU6A 4YLHA 3U9SB 5DUFA 1Q52A 5G1SA 4JSBA 1Y7OA 3QREA 1W2XA 4EMLA 5DKPA 4U0HA 3PGQA 1ON9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I42 A;  5E0N X;  5DTP A;  1N6E A;  1N6F A;  3H0S A;  4QII A;  1HNO A;  3QK8 A;  3TT7 A;  3R9T A;  1UYV A;  3H0Q A;  4GM2 A;  1YG6 A;  4JCR A;  1VRG A;  4FJW D;  2F9I A;  5G1R A;  3VIV A;  2VSU F;  5JBX A;  3MT6 A;  2FW2 A;  2VSS A;  2Q35 A;  3TV5 A;  3DOR A;  2DEO A;  4K2N A;  4WZ8 B;  3TVU A;  4F47 A;  2GTR A;  5C90 A;  1UYS A;  3HE2 A;  2BZR A;  3T88 A;  4JCQ A;  3STA A;  3JU1 A;  4ELS A;  4RCN A;  2FZS A;  3NJD A;  2J5I A;  2PG8 A;  4JYL A;  3ZWC A;  4K29 A;  2FBM A;  4RYF H;  3Q0G A;  2A7K A;  2ZL3 A;  3KTG A;  4EMM A;  4ZDC A;  2W3P A;  3QXI A;  2A81 A;  2F9I B;  5CTC A;  4B3I A;  1DCI A;  3OME A;  2CBY A;  3I47 A;  2VSS E;  2HW5 A;  3M6M A;  1UYT A;  3GMA A;  3ST9 A;  4FNB A;  3GF3 A;  1WZ8 A;  4L6W A;  3L3S A;  5E0S A;  4OG1 A;  4NNQ A;  2D3T A;  1JXZ A;  2NP9 A;  2A7S A;  5ING A;  2J5I B;  4JYJ A;  4ZDB A;  3H0J A;  4I52 A;  5KDR A;  4FB8 A;  2ZL4 A;  3H81 A;  2Q34 A;  3TVW A;  2PPY A;  3N6R B;  3QWD A;  3ZWA A;  4FND A;  1FCF A;  4KWB A;  4U19 A;  3K8X A;  4K3W A;  3TRR A;  3TDC A;  4ELW A;  3TZ3 A;  4L8K A;  4MOU A;  4LK5 A;  4OMR A;  4OLQ A;  1XNW A;  2ZL2 A;  4U1A A;  4RYF A;  3QMJ A;  3TLF A;  3RSI A;  5DZK H;  2PBP A;  4Q1I A;  1EF9 A;  5G1Q A;  3QYR A;  5E0S H;  4EMP A;  1XO6 A;  1WDK A;  4FN7 A;  3WG5 A;  1PIX A;  2F6Q A;  4KNP A;  1XX4 A;  4FZW A;  2VSU A;  1X0U A;  3R9Q A;  1PJH A;  3ZWB A;  4KPK A;  3ISA A;  4WYO B;  2VX2 A;  5FIF A;  4ASI A;  2ZQQ A;  5IKL B;  1FC7 A;  3U9R B;  1UIY A;  3H0U A;  1XNV A;  1RJN A;  3KQF A;  3RST A;  3R9S A;  1ON3 A;  1HNU A;  4B3H A;  3PEA A;  3HRX A;  1XNY A;  3H02 A;  3NJB A;  5DZK A;  1OD2 A;  2VSU E;  3ZW8 A;  5C9G A;  3ZW9 A;  3BPP A;  2Q2X A;  3Q0J A;  2J5G D;  3Q7H A;  4JFC A;  5DUC A;  5FUS A;  3MYB A;  4Q0G A;  3KTH A;  3M6N A;  5INI A;  1UYR A;  2CE3 A;  3P5M A;  4B3J A;  2QQ3 A;  4ZDF A;  3QKA A;  3PZK A;  3OC7 A;  2J5S A;  2F9Y A;  3PE8 A;  1EF8 A;  3KTJ A;  2EJ5 A;  2IEX A;  4HC8 A;  4IZD A;  3LAO A;  3IB9 A;  4U0G H;  4JOT A;  3HIN A;  3P2L A;  3GF7 A;  1YG8 A;  1WDL A;  5DU8 A;  1OD4 A;  5KDR B;  3HLN 1;  4IZC A;  3IBB A;  2C8T A;  3MFM A;  4FZW C;  2VSU C;  5INF A;  4JWV A;  4Z0M A;  1HZD A;  4MXI A;  2F9Y B;  3P85 A;  4ELX A;  3TT6 A;  5MGB A;  3T3W A;  3GLM A;  1NZY A;  5DL1 A;  3Q1T A;  1TYF A;  3LKE A;  3FF6 A;  2X24 A;  4QFE A;  2DUB A;  2X58 A;  4GHN A;  4U18 A;  4ZDE A;  4KD6 A;  1EY3 A;  5CTB A;  4G2R A;  4JCT A;  4NEK A;  2VSS F;  3HP0 A;  4JVT A;  2ZL0 A;  1RJM A;  3BEZ A;  3V5I A;  4ZU2 A;  3T8A A;  3QXZ A;  1FC6 A;  3U9T B;  1N6D A;  5DU4 A;  5KJP A;  1Q51 A;  2J5I I;  4FN8 A;  4U0G A;  3DJA A;  4MI2 A;  3FDU A;  2VRE A;  4WCZ A;  1NZY B;  3MOY A;  1K39 A;  3SLL A;  2ZQR A;  3K50 A;  3T8B A;  3KTI A;  3RRV A;  1TG6 A;  1K32 A;  3KTK A;  3T89 A;  1FC9 A;  4I4Z A;  1DUB A;  4JJT A;  4ZDD A;  3G64 A;  2WTB A;  1WDM A;  2F6I A;  5DTW A;  3R6H A;  4JCS A;  4DI1 A;  5JBW A;  4IZB A;  1SG4 A;  1O8U A;  4QIJ A;  3IAV A;  2UZF A;  1J7X A;  1MJ3 A;  3SWX A;  1SZO A;  4HNK A;  3GKB A;  3V5E A;  3R0O A;  3BF0 A;  3OT6 A;  2J5G A;  5DU6 A;  4YLH A;  3U9S B;  5DUF A;  1Q52 A;  5G1S A;  4JSB A;  1Y7O A;  3QRE A;  1W2X A;  4EML A;  5DKP A;  4U0H A;  3PGQ A;  1ON9 A; 
#chains in the Genus database with same CATH topology
 4I42 A;  5E0N X;  2YJG A;  5DTP A;  1N6E A;  4HDT A;  1N6F A;  3H0S A;  4QII A;  1HNO A;  3QK8 A;  3TT7 A;  3R9T A;  1UYV A;  3H0Q A;  4GM2 A;  1YG6 A;  4JCR A;  1VRG A;  4FJW D;  2F9I A;  5G1R A;  3VIV A;  2VSU F;  5JBX A;  3MT6 A;  2FW2 A;  2VSS A;  2Q35 A;  3TV5 A;  3DOR A;  2DEO A;  3A4M A;  4K2N A;  4WZ8 B;  3TVU A;  4F47 A;  2GTR A;  5C90 A;  1UYS A;  3HE2 A;  2BZR A;  3T88 A;  4JCQ A;  3STA A;  3JU1 A;  4ELS A;  4RCN A;  2FZS A;  3NJD A;  2J5I A;  2PG8 A;  4JYL A;  3L8J A;  1Y64 B;  3ZWC A;  4K29 A;  2FBM A;  4RYF H;  3Q0G A;  2A7K A;  2ZL3 A;  3KTG A;  4EMM A;  4ZDC A;  2W3P A;  3QXI A;  5CTC A;  2A81 A;  2F9I B;  4B3I A;  1DCI A;  3OME A;  2CBY A;  3I47 A;  2VSS E;  2HW5 A;  3M6M A;  3BPT A;  1UYT A;  3GMA A;  3ST9 A;  4FNB A;  3GF3 A;  1WZ8 A;  4L6W A;  3L3S A;  5E0S A;  4OG1 A;  4NNQ A;  2D3T A;  1JXZ A;  2NP9 A;  2A7S A;  5ING A;  2J5I B;  4JYJ A;  4ZDB A;  3H0J A;  4I52 A;  5KDR A;  4FB8 A;  2ZL4 A;  3H81 A;  4J2U A;  2Q34 A;  3TVW A;  2PPY A;  3N6R B;  3QWD A;  3ZWA A;  3ADD A;  4FND A;  1FCF A;  4KWB A;  4U19 A;  3K8X A;  4K3W A;  3TRR A;  3TDC A;  4ELW A;  3TZ3 A;  4L8K A;  4MOU A;  4LK5 A;  4OMR A;  4OLQ A;  1XNW A;  2ZL2 A;  4U1A A;  4RYF A;  3QMJ A;  3TLF A;  3RSI A;  5DZK H;  2PBP A;  4Q1I A;  1EF9 A;  3AJM A;  3L8I A;  5G1Q A;  3QYR A;  3ADC A;  5E0S H;  4EMP A;  1XO6 A;  1WDK A;  4FN7 A;  3WG5 A;  3W8H B;  1PIX A;  2F6Q A;  4KNP A;  1XX4 A;  4FZW A;  2VSU A;  1X0U A;  3R9Q A;  1PJH A;  3ZWB A;  4KPK A;  3ISA A;  4WYO B;  2VX2 A;  5FIF A;  4ASI A;  4GEH B;  3A4L A;  1UX5 A;  2ZQQ A;  5IKL B;  1FC7 A;  3U9R B;  1UIY A;  3RQE A;  3H0U A;  1XNV A;  3W8I B;  1RJN A;  3IRB A;  3KQF A;  3RST A;  3R9S A;  1ON3 A;  3AM1 A;  1HNU A;  4B3H A;  3RQG A;  3PEA A;  3HRX A;  1XNY A;  5HUQ A;  3H02 A;  3NJB A;  5DZK A;  1OD2 A;  2VSU E;  3ZW8 A;  5C9G A;  3ZW9 A;  3BPP A;  2Q2X A;  3Q0J A;  2J5G D;  3Q7H A;  4JFC A;  5DUC A;  3MYB A;  5FUS A;  4Q0G A;  3KTH A;  3M6N A;  5INI A;  3O4X E;  1UYR A;  2CE3 A;  3P5M A;  4B3J A;  2QQ3 A;  4ZDF A;  3QKA A;  3PZK A;  3OC7 A;  2J5S A;  2F9Y A;  3PE8 A;  1EF8 A;  3KTJ A;  2EJ5 A;  2IEX A;  4HC8 A;  3RQF A;  4IZD A;  3LAO A;  3IB9 A;  4U0G H;  4JOT A;  3HIN A;  3P2L A;  3GF7 A;  1YG8 A;  1WDL A;  5DU8 A;  1OD4 A;  5KDR B;  3HLN 1;  4IZC A;  3IBB A;  2C8T A;  3MFM A;  1UX4 A;  4FZW C;  2VSU C;  5INF A;  4JWV A;  4Z0M A;  1HZD A;  4MXI A;  2F9Y B;  3P85 A;  4ELX A;  3TT6 A;  5MGB A;  3T3W A;  3GLM A;  1NZY A;  5DL1 A;  3Q1T A;  1TYF A;  3LKE A;  3FF6 A;  2X24 A;  4QFE A;  2DUB A;  2X58 A;  4GHN A;  4U18 A;  4ZDE A;  4KD6 A;  1EY3 A;  5CTB A;  4G2R A;  4JCT A;  4NEK A;  2VSS F;  3HP0 A;  4JVT A;  2ZL0 A;  1RJM A;  3BEZ A;  3V5I A;  4ZU2 A;  3T8A A;  3QXZ A;  1FC6 A;  3A4N A;  3U9T B;  1N6D A;  5DU4 A;  5KJP A;  1Q51 A;  2J5I I;  4FN8 A;  2P63 A;  4U0G A;  3DJA A;  4MI2 A;  3FDU A;  2VRE A;  4WCZ A;  1NZY B;  3MOY A;  1K39 A;  3SLL A;  2ZQR A;  3K50 A;  3T8B A;  3KTI A;  3RRV A;  1TG6 A;  1K32 A;  3KTK A;  3T89 A;  1FC9 A;  4I4Z A;  1DUB A;  4JJT A;  4NAR A;  4ZDD A;  3G64 A;  2WTB A;  1WDM A;  2F6I A;  5DTW A;  3R6H A;  4JCS A;  4DI1 A;  5JBW A;  4IZB A;  1SG4 A;  1O8U A;  4QIJ A;  3IAV A;  2UZF A;  1J7X A;  1MJ3 A;  3SWX A;  1SZO A;  3ADB A;  4HNK A;  3GKB A;  3V5E A;  3R0O A;  3BF0 A;  3OT6 A;  2J5G A;  5DU6 A;  4YLH A;  3U9S B;  5DUF A;  1Q52 A;  5G1S A;  4JSB A;  1Y7O A;  3QRE A;  1W2X A;  4EML A;  5DKP A;  4U0H A;  3PGQ A;  1ON9 A; 
#chains in the Genus database with same CATH homology
 4I42 A;  5E0N X;  2YJG A;  5DTP A;  1N6E A;  4HDT A;  1N6F A;  3H0S A;  4QII A;  1HNO A;  3QK8 A;  3TT7 A;  3R9T A;  1UYV A;  3H0Q A;  4GM2 A;  1YG6 A;  4JCR A;  1VRG A;  4FJW D;  2F9I A;  5G1R A;  3VIV A;  2VSU F;  5JBX A;  3MT6 A;  2FW2 A;  2VSS A;  2Q35 A;  3TV5 A;  3DOR A;  2DEO A;  4K2N A;  4WZ8 B;  3TVU A;  4F47 A;  2GTR A;  5C90 A;  1UYS A;  3HE2 A;  2BZR A;  3T88 A;  4JCQ A;  3STA A;  3JU1 A;  4ELS A;  4RCN A;  2FZS A;  3NJD A;  2J5I A;  2PG8 A;  4JYL A;  3ZWC A;  4K29 A;  2FBM A;  4RYF H;  3Q0G A;  2A7K A;  2ZL3 A;  3KTG A;  4EMM A;  4ZDC A;  2W3P A;  3QXI A;  2A81 A;  2F9I B;  5CTC A;  4B3I A;  1DCI A;  3OME A;  2CBY A;  3I47 A;  2VSS E;  2HW5 A;  3M6M A;  3BPT A;  1UYT A;  3GMA A;  3ST9 A;  4FNB A;  3GF3 A;  1WZ8 A;  4L6W A;  3L3S A;  5E0S A;  4OG1 A;  4NNQ A;  2D3T A;  1JXZ A;  2NP9 A;  2A7S A;  5ING A;  2J5I B;  4JYJ A;  4ZDB A;  3H0J A;  4I52 A;  5KDR A;  4FB8 A;  2ZL4 A;  3H81 A;  4J2U A;  2Q34 A;  3TVW A;  2PPY A;  3N6R B;  3QWD A;  3ZWA A;  4FND A;  1FCF A;  4KWB A;  4U19 A;  3K8X A;  4K3W A;  3TRR A;  3TDC A;  4ELW A;  3TZ3 A;  4L8K A;  4MOU A;  4LK5 A;  4OMR A;  4OLQ A;  1XNW A;  2ZL2 A;  4U1A A;  4RYF A;  3QMJ A;  3TLF A;  3RSI A;  5DZK H;  2PBP A;  4Q1I A;  1EF9 A;  5G1Q A;  3QYR A;  5E0S H;  4EMP A;  1XO6 A;  1WDK A;  4FN7 A;  3WG5 A;  1PIX A;  2F6Q A;  4KNP A;  1XX4 A;  4FZW A;  2VSU A;  1X0U A;  3R9Q A;  1PJH A;  3ZWB A;  4KPK A;  3ISA A;  4WYO B;  2VX2 A;  5FIF A;  4ASI A;  2ZQQ A;  5IKL B;  1FC7 A;  3U9R B;  1UIY A;  3H0U A;  1XNV A;  1RJN A;  3KQF A;  3RST A;  3R9S A;  1ON3 A;  1HNU A;  4B3H A;  3PEA A;  3HRX A;  1XNY A;  5HUQ A;  3H02 A;  3NJB A;  5DZK A;  1OD2 A;  2VSU E;  3ZW8 A;  5C9G A;  3ZW9 A;  3BPP A;  2Q2X A;  3Q0J A;  2J5G D;  3Q7H A;  4JFC A;  5DUC A;  5FUS A;  3MYB A;  4Q0G A;  3KTH A;  3M6N A;  5INI A;  1UYR A;  2CE3 A;  3P5M A;  4B3J A;  2QQ3 A;  4ZDF A;  3QKA A;  3PZK A;  3OC7 A;  2J5S A;  2F9Y A;  3PE8 A;  1EF8 A;  3KTJ A;  2EJ5 A;  2IEX A;  4HC8 A;  4IZD A;  3LAO A;  3IB9 A;  4U0G H;  4JOT A;  3HIN A;  3P2L A;  3GF7 A;  1YG8 A;  1WDL A;  5DU8 A;  1OD4 A;  5KDR B;  3HLN 1;  4IZC A;  3IBB A;  2C8T A;  3MFM A;  4FZW C;  2VSU C;  5INF A;  4JWV A;  4Z0M A;  1HZD A;  4MXI A;  2F9Y B;  3P85 A;  4ELX A;  3TT6 A;  5MGB A;  3T3W A;  3GLM A;  1NZY A;  5DL1 A;  3Q1T A;  1TYF A;  3LKE A;  3FF6 A;  2X24 A;  4QFE A;  2DUB A;  2X58 A;  4GHN A;  4U18 A;  4ZDE A;  4KD6 A;  1EY3 A;  5CTB A;  4G2R A;  4JCT A;  4NEK A;  2VSS F;  3HP0 A;  4JVT A;  2ZL0 A;  1RJM A;  3BEZ A;  3V5I A;  4ZU2 A;  3T8A A;  3QXZ A;  1FC6 A;  3U9T B;  1N6D A;  5DU4 A;  5KJP A;  1Q51 A;  2J5I I;  4FN8 A;  4U0G A;  3DJA A;  4MI2 A;  3FDU A;  2VRE A;  4WCZ A;  1NZY B;  3MOY A;  1K39 A;  3SLL A;  2ZQR A;  3K50 A;  3T8B A;  3KTI A;  3RRV A;  1TG6 A;  1K32 A;  3KTK A;  3T89 A;  1FC9 A;  4I4Z A;  1DUB A;  4JJT A;  4NAR A;  4ZDD A;  3G64 A;  2WTB A;  1WDM A;  2F6I A;  5DTW A;  3R6H A;  4JCS A;  4DI1 A;  5JBW A;  4IZB A;  1SG4 A;  1O8U A;  4QIJ A;  3IAV A;  2UZF A;  1J7X A;  1MJ3 A;  3SWX A;  1SZO A;  4HNK A;  3GKB A;  3V5E A;  3R0O A;  3BF0 A;  3OT6 A;  2J5G A;  5DU6 A;  4YLH A;  3U9S B;  5DUF A;  1Q52 A;  5G1S A;  4JSB A;  1Y7O A;  3QRE A;  1W2X A;  4EML A;  5DKP A;  4U0H A;  3PGQ A;  1ON9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...