3R9XB

Crystal structure of era in complex with mggdpnp, nucleotides 1506-1542 of 16s ribosomal rna, and ksga
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
235
structure length
235
Chain Sequence
LVSEGVLKKIAEELNIEEGNTVVEVGGGTGNLTKVLLQHPLKKLYVIELDREMVENLKSIGDERLEVINEDASKFPFCSLGKELKVVGNLPYNVASLIIENTVYNKDCVPLAVFMVQKEVAEKLQGKKDTGWLSVFVRTFYDVNYVMTVPPRFFVPPPKVQSAVIKLVKNEKFPVKDLKNYKKFLTKIFQNRRKVLRKKIPEELLKEAGINPDARVEQLSLEDFFKLYRLIEDSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase Era
publication title The Era GTPase recognizes the GAUCACCUCC sequence and binds helix 45 near the 3' end of 16S rRNA.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/transferase/rna
total genus 65
structure length 235
sequence length 235
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2011-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3r9xB02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3r9xB01
2ZTHA 3BKWA 3KR0A 2KW5A 4KWCA 1QANA 4HG2A 4CKBA 1T43A 1YZ3A 3KPUA 5EHIA 3V8VA 3BKXA 2JJQA 3E23A 4L7VA 2H00A 2AR0A 4EMSA 2P7HA 1HMYA 3B3JA 3MAGA 3OZTA 3NWEA 3H2BA 4R6WA 1JG2A 5DX8A 5LQCA 5EMLA 1FJXA 3TM5A 5KVAA 3VYWA 5DTQA 1R6AA 3SSOA 1BKYA 1JQ3A 1FP1D 2LD4A 3OU2A 3TR6A 1NBHA 2ZZKA 5EPEA 3ID6C 4BP3A 4YUWA 1L3BA 4DM3A 3MB5A 4QDJA 2GB4A 4RV9A 1KYZA 2GLUA 3EEOA 4RWZA 5CVJA 4FR0A 4HSGA 5KYGA 1JSZA 2BM8A 2YXLA 2IH4A 4WXHA 4OA5A 3SX0A 1SG9A 3VSEA 3SM3A 3I58A 2JH8A 4FT4A 5K05A 2EJTA 3LCVB 4Y30A 2DPMA 4GOND 5D1NA 3L8DA 3T7RA 1VPTA 3NWBA 3KPWA 4RVFA 4V0RA 1JQDA 3LCCA 1WXXA 2BR3A 1VL5A 3MTIA 5K0LA 1KP9A 4YUYA 4GOMD 2ZCJA 5EGSA 5JUWA 3LSTA 3JWHA 3SGLA 5BW5A 2IH2A 1F3LA 5FULA 4BLWA 4RTPA 4DQ0A 1BC5A 3G2QA 3MERA 3PX3A 5EIFA 2EG5A 2G70A 2ZIGA 5ICCA 4ISCA 3GWZA 2OYRA 3I53A 4F85A 5E9WA 2PXCA 4EKIA 5FUBA 5DSXA 5GWXA 3PB3A 5EKXA 3QV2A 4PYIA 5LQJA 2ZZNA 2XYRA 5EVJA 5LQAA 5DLYA 4E2XA 3B3FA 5HILA 2OZVA 5EEGA 5M5BA 2P3QA 3LDUA 1VQ1A 1NBIA 4GOOD 1XCJA 1XTPA 4LWPA 4ER0A 4IV8A 2PT9A 1SQFA 1IM8A 2WA2A 4FSXA 5KS2A 3O31A 3EVAA 3OFKA 3C3YA 4FT2A 3SSNA 5E9JA 3FTCA 5HOQA 5DT2A 4E70A 5LQRA 4RTOA 2NP7A 3FPEA 5DM2A 2H1RA 2QY6A 1HNNA 2YQZA 3P8ZA 1Q0TA 1B42A 3PVCA 3LBFA 4XUEA 4OQEA 3P2KA 3AY0A 1P91A 2I6GA 3R0QA 1IY9A 2YXDA 4GOLD 5FA8A 5BXYA 3EGIA 1SVUA 10MHA 5E2BA 4HTFA 4IWNA 2I7CA 2IGTA 3DXXA 3CBGA 1YZHA 1X1AA 2ZWAA 1EIZA 3FPJA 2O05A 1DL5A 3P97A 5FTWA 2ZVJA 2FHPA 2ADMA 3EVDA 3HCCA 2ZLBA 4PIPA 1R74A 3FRIA 4HTFB 2P3OA 4MHTA 4NECA 2AN4A 3A7DA 5HEKA 5K0CA 3SSMA 2PWYA 2AVNA 1TPYA 4RTQA 4UOEA 3RIEA 4KDRA 3S68A 1D2CA 1M6EX 2B2CA 2G71A 1TW2A 2R3SA 4BLVA 5LQUA 3JWGA 5F2KA 3HTXA 1WG8A 3P9NA 5F2OA 4DA4A 3A4TA 5ICEA 2Z6QA 4RSRA 2WA1A 1R00A 4H0NA 4RVHA 5ERGB 2GH1A 3P9IA 2A14A 5CD1A 2O06A 4RTRA 3EVEA 4R8SA 1KXZA 1SUIA 5EQJB 4HGZA 4CTKA 3KQWA 4QPNA 2AOUB 5KQRA 4XUCA 2I62A 3GXOA 3TOSA 2QYOA 4PIMA 3VC2A 4CXMA 5E9QA 2YX1A 3E7PA 3OU6A 4KRGA 5FQOA 5DTMA 2FK7A 5DX1A 4GC9A 2CMHA 3UJ8A 3O4FA 5HFJA 3GO4A 3P2IA 1G60A 4PONA 1VE3A 5FA5A 4AZTA 1VLMA 2XYVA 3THRA 2I9KA 5JR3A 4M38A 2CL5A 2AOTB 3HEMA 5E2AA 4ER6A 2NXNA 3P2EA 2PSSA 3G2OA 2P41A 2G1PA 1MHTA 2OBFA 1JTEA 4GF5A 3FTDA 1EQAA 5DM1A 4Y2HA 4FS8A 1U2ZA 1D2HA 1ZKDA 3E05A 3GCZA 5GM1A 3CC8A 1P1CA 5EMKA 5DWQA 3UZUA 5GOZA 4R8RA 3TMAA 2P3LA 2PJDA 4EVIA 2OKCA 1KPGA 3G8BA 5C9ZA 3HCDA 1AQJA 1Y8CA 2B3TA 2IDKA 3M33A 4JXJA 2VS1A 2B9EA 4E2WA 1RJGA 4RVDA 4AUKA 3JWJA 3G8AA 4GEKA 3KQYA 4X61A 2IIPA 3NDJA 4G56A 1D2GA 2JG3A 4B17A 3NJRA 4QQNA 5T6BA 1XVAA 3GRRA 1QAOA 5FCDA 2BM9A 2VDVE 5GP1A 5CVVA 5DSTA 2V7EA 3U81A 1RI1A 3CJQA 3EPPA 3C3PA 1G6Q1 3KR2A 3GDHA 4PYOA 5EKUA 3LL7A 1R8XA 3DUWA 1ZHFA 1OR8A 3QOXA 3BWBA 4QPPA 3KQMA 2ORED 2HNKA 2AS0A 2PVCA 2WK1A 1QYRA 1X1CA 3LPMA 4QDKA 3IEIA 1DCTA 2IPXA 4PCAA 5EC8A 4QVKA 5HIMA 3GRVA 4ER5A 3Q87B 5K0JA 2C7PA 2IBTA 4KDCA 1VIDA 1EJ6A 5EOVA 4YV0A 1Q0SA 3FUWA 1I4WA 3CVOA 1M0EA 2PX4A 3FPFA 1N7IA 3FYDA 4X41A 3CJTA 3AJDA 3LX6A 3OPNA 3EVBA 1PRYA 2OB1A 4KW7A 4ATNA 4AX8A 4C08A 2PKWA 4OQDA 3TKYA 4YV2A 2ERCA 3Q7EA 3SR4A 4R6XA 4RTNA 3ER9A 3PLAE 4PNEA 1L9KA 3HCAA 3T7TA 3BWYA 1FPQA 3ELDA 1RJDA 2AVDA 3PS9A 5EIWA 3SVZA 4RX1A 2BZGA 1AV6A 2GAFA 2P40A 2F8LA 2PLWA 3DR5A 5E1MA 3TRKA 3AWIA 3KHKA 3OZSA 1JR4A 1NV9A 4PYQA 2UZ4A 3TQSA 1VP3A 3LKDA 5DTRA 3HCEA 1NW8A 3UJDA 1N2XA 3CKKA 4PYKA 4C06A 3EGVA 2NP6A 3UFBA 3NVKI 4PYLA 5FADA 3FUXA 2FCAA 5GM2A 4C03A 2JHAA 3IV6A 5CM2Z 2C7QA 4P7JA 3A7EA 1NW7A 3DXZA 3DH0A 1XDUA 5DXAA 5CCBA 5K8VA 3EMBA 3HVIA 5FWAA 4MQ4A 3T7SA 3BT7A 3KQTA 1VBFA 1ZGJA 2HWKA 3LGAA 4YUXA 2ONZA 1KR5A 3B3GA 3BGVA 1KHHA 3HA7A 5EG5A 1YUBA 2ZBQA 5P8WA 2IP2A 3VC1A 2O07A 2IDJA 5FQNA 5G02A 5U4XA 4GBED 4DCGA 3A27A 3JWIA 4RVGA 4LG1A 2EFJA 2AOVA 2ZBRA 3P71T 4BLUA 1NKVA 3LHDA 2IBSA 2XBMA 5HIKA 3NW9A 5E8RA 1WZNA 3DXYA 4LWOA 1KPHA 4C04A 3G2PA 4A6EA 1ORIA 3C6MA 1QAMA 3IHTA 4OA8A 3UJBA 4EQZA 2XVAA 4CKEA 2PXAA 1RI4A 3DMHA 2UYOA 3MQ2A 3OE4A 5EZSA 3MCTA 2FRXA 5EMJA 3RODA 5FHQA 4CWAA 3TM4A 3KQOA 3QOWA 4QTTB 3UJCA 3NTVA 5DXJA 3MHTA 4GC5A 3PFHA 4QQKA 1YB2A 4F86A 2HTEA 4YUZA 5DPMA 4FZVA 5CVDA 5E1DA 3REOA 2EJUA 1JG1A 1I1NA 2AOUA 5F2NA 2IH5A 3TLJA 5IH3A 4QTUB 1YFJA 5LQNA 3UJ9A 4DCMA 1X1BA 5C1IA 2PXXA 3B7PA 4E31A 3LCUA 3B89A 3GIWA 1NV8A 5GIPE 4YMHA 2JH9A 2BR5A 4M7RA 4R05A 2AN3A 2EX4A 3R3HA 4E33A 1FBNA 3NDIA 9MHTA 3RW9A 4E2YA 3DULA 3GNLA 5K0GA 2AOTA 3EVGA 4PGHA 2BH2A 1NW5A 1RJEA 2C7OA 3BGDA 2Z6AA 5EHGA 2PT6A 3C6KA 2ESRA 3K0BA 3M6VA 5DM0A 3UA3A 1YFLA 3KKZA 3CCFA 2PX5A 3DLCA 5LSAA 3EGEA 3G5TA 1X1DA 3UJ7A 4P58A 3OE5A 3ERCA 2C7RA 1R18A 3X0DA 3FPGA 4YMGA 5E8JA 3OU7A 4KIGA 1SUSA 2O0LA 2UYCA 2GPYA 1RI5A 4RTJA 3GRZA 3FTEA 3FZGA 2CWWA 3T0IA 1ZG3A 4OX9Y 2GS9A 2PBFA 1INLA 3G89A 3K6RA 3P9CA 4PCLA 3B5IA 5GINE 1UIRA 3UJ6A 2YXEA 3A26A 3SXJA 5HIJA 2Y1XA 4X1OA 5BP7A 1G55A 5EEHA 4EKGA 2YVLA 4E2ZA 1DUSA 3SMQA 3GU3A 3UBTA 1M6YA 2B25A 3HCBA 1SKMA 3HVJA 1JTFA 1O9GA 2PWPA 2AZTA 2ZBPA 4PYJA 4RTLA 4AZSA 2ZIFA 4DMGA 3G7UA 4C07A 4C4AA 5K0FA 3V97A 1N7JA 4IV0A 3HVKA 3M70A 5MHTA 3NMUF 2OB2A 4ZTBA 5K0BA 3TPZA 3PFGA 2FK8A 7MHTA 3LDFA 3O7WA 4LECA 3GJYA 5K0NA 3PTAA 2YR0A 4M36A 2ZULA 5DRTA 2B78A 4E32A 5KQSA 3ER8A 2P7IA 3NVMB 1AQIA 5E1BA 1XJ5A 2NXJA 2N47A 1F38A 2ZIEA 4E30A 4GQBA 5DRYA 4DF3A 2P35A 2P8JA 1WXWA 1QZZA 3HA5A 3EVFA 2HR1A 3I9FA 3AXSA 4RTSA 1JG4A 3G5LA 3MGGA 4PINA 4KVZA 3HCFA 4MTLA 3LDGA 2PY6A 1NW3A 2V74B 5CCXA 3ANXA 4GUAA 2BR4A 3KR9A 3ORHA 4IKPA 2OO3A 3M4XA 3UWPA 3KPYA 5EMMA 4XCXA 4X60A 4ER3A 1TW3A 3FTFA 4AZWA 1IXKA 3EMDA 4PWYA 4OBXA 4BY9E 1O9HA 4M37A 1NE2A 3BWMA 3D2LA 2R6ZA 1P39A 2ZW9A 2E5WA 2ZZMA 2VDWA 1EAMA 1I9GA 3FYCA 1XDSA 2YTZA 4QVGA 1XCLA 3C0KA 3EVCA 3TKAA 1XXLA 2CKDA 2AOXA 5DX0A 5E1OA 3KU1A 1XDZA 1L3CA 4P7FA 1WS6A 2O57A 3EEYA 3KQVA 1EJ0A 1ZQ9A 1G38A 4RTKA 2IFTA 5LQKA 5CVEA 5CIYA 2VP3A 2VZ9A 3BGIA 3HP7A 4HC4A 4HGYA 5CVUA 4WVLA 8MHTA 3DLIA 3E8SA 4RTMA 3KR1A 2ZFUA 4RYLA 3DOUA 5ICFA 1MJFA 3HA3A 3CJRA 1KYWA 5T67A 3LECA 4CKCA 4KIFA 3ELYA 3BUSA 4C05A 2OY0A 4X63A 5CUQA 5K0EA 1O54A 3BZBA 2CMGA 2NYUA 4A6DA 1L1EA 4FP9A 1JSXA 3DMGA 1NW6A 4P7GA 4EK9A 2G8NA 5HZMA 1P1BA 2OPBA 3BWCA 3KQSA 2PX8A 5B1SA 2UYQA 3G88A 2QE6A 3M6UA 4HH4A 3FRHA 4F84A 3GRUA 2Y1WA 5FHRA 4PYMA 3F4KA 3KPVA 1Z3CA 1QAQA 4U7PB 3LBYA 1KPIA 1ORHA 2YUIA 3MTEA 4V0QA 2XYQA 1R8YA 2ONYA 5H02A 2AN5A 2JHCA 5GIOE 2HV9A 4K6MA 5IKMA 1L3IA 4BP1A 1JG3A 3ELWA 5T64A 3ELUA 4PYNA 3EVZA 1JQEA 3M6WA 4PGGA 2Z6UA 3DMFA 4CTJA 3A25A 1X19A 2AOWA 1BHJA 3DTNA 3G2MA 2HMYB 2ZWVA 3P9KA 1BOOA 1UFKA 3OZRA 4MIKA 4MWZA 4OBWA 1H1DA 5HIIA 3FPHA 3MCZA 2OXTA 1FP2A 3GGDA 3KQQA 3UA4A 2H11A 2FYTA 4YUVA 4DKJA 1KIAA 2DULA 5LR6A 2QM3A 3CGGA 2QRVA 4AZVA 2P1DA 1YF3A 5K01A 2G72A 1WY7A 4HRAA 4DZRA 3HNRA 3PT9A 5C0OE 2QRVB 3ME5A 2JHPA 2PV0A 2PX2A 2PGXA 3R24A 1ZGAA 5EZQA 4POOA 4P7KA 1PJZA 5K09A 2NXCA 3KPJA 3R9XB 1V39A 3LKZA 1AF7A 1G8SA 3M6XA 4O29A 2GA9A 3R6TA 3I64A 4XUDA 2K4MA 2ZSUA 3PX2A 3THSA 4YV1A 1NT2A 2FPOA 3OFJA 5K03A 2NNWB 5ICGA 1RI2A 3OCJA 1SQGA 3GRYA 3HM2A 3FUVA 3KQPA 1VP9A 3FUUA 3FUTA 1G8AA 3DP7A 3HVHA 2XVMA 1RI3A 4FSDA 2UYHA 3IYLW 4U7TB 5DM4A 2VDUE 1UWVA 2NXEA 4ER7A 3UJAA 3I5UA 3BXOA 1RJFA 2Q41A 4FGZA 5D1HA 4Z2YA 3TFWA 5BW4A 3AXTA 5FWDA 1EG2A 3WSTA
chains in the Genus database with same CATH superfamily
2R5NA 3NS7A 4Q12A 3VPCA 2FZGA 4OXXA 3D8RA 1TL7C 2WU0A 2RAVA 2I3BA 4OXNA 4XQ0A 2HPZA 3LVQE 3T4UA 1NUHA 1CJSA 2X40A 3EXHA 4QU8A 4LHEA 5CK5A 4BMOB 2H3EA 1S2GA 1NG1A 4AIIA 3NH6A 4WA7A 2JFBA 2Q3FA 4L8RC 4DNOA 3WK7A 1RM4A 2OZVA 4C0WA 2XCLA 2A9QA 5JJLA 3CW8X 2WHXA 5JANA 3K20A 4NATA 2GXAA 1C4KA 4TUYF 2BGLA 2FHPA 3ACBA 4DIKA 2E7ZA 4DIUA 4FCTA 3F5QA 3V1LA 1QUSA 1PJBA 4ZO8A 3C8ZA 3QQ5A 1YONA 2ETXA 3ENWA 3IKLA 2H59A 1VYTA 1IIBA 4XD7A 3P2IA 2BUBA 3ZHXA 4YGYA 4QWMA 5KHOC 4QUGA 2YIVX 1HTTA 3MTJA 3G9TA 4I66A 1T3ZA 4RM2A 1EFUA 3UK2A 1OC4A 5B7PA 4AMBA 5HJEA 4WZBA 3WL8A 4P53A 1P5ZB 1QGED 3E3MA 3FCXA 2VZ0A 2YHIA 3GHYA 1U8XX 2D54A 1EP3B 1MU0A 3L79A 1IEVA 1S01A 5KKNB 3D7SA 4FB5A 1FZQA 4ARCA 5GGYA 4RF0A 4Q16A 1LFAA 1YJXA 1QVRA 3EGDA 1WBJB 4HT3B 1LF5A 3IVRA 1Z3IX 4ZQEA 1R0KA 1ZMOA 4BKRA 4F3TA 4BXOB 1ZGJA 1KR5A 3D6AA 1WVGA 3HA7A 1O89A 1Y1KE 1YV9A 3VO1A 2NV0A 4KE8A 1F7VA 3KJHA 4R1QA 1L1ZA 4M8LA 3H86A 3B3QA 4G23A 3CLUD 3OQIB 3EWSA 1SA0B 5ALFA 1GILA 3TRJA 1Y5LA 5IKOA 1YZKA 2CHEA 4R81A 9MHTA 2K7ZA 4II2A 3RAJA 1XTTA 4NOJA 2C7RA 1KVQA 5JCZA 4BUCA 5A4DA 4RTJA 5AIAA 1MX5A 5AIBA 3GQVA 1V3UA 4MROA 3MB8A 1ZIDA 1M6NA 4F5ZA 1SKMA 4DGQA 4RD2A 2PLAA 1YDEA 1OXTA 4EYGA 4B35A 1A2BA 4UD2A 5B7QA 4YRMA 2VNAA 1UOEA 3RSCA 3Q3GE 1U2PA 4B3FX 2HR1A 1YSYA 4LXIA 3G5LA 1CNFA 2FG6C 5CFPA 4MVXA 5ENZA 2IUEA 4RGBA 2C4NA 3EMDA 1ESMA 1ACMA 1NE2A 1ZBQA 1EA7A 3KSZO 4LKRA 2XZDA 1C7IA 3CPJB 4UVGA 3RBXA 2AXEA 5T67A 3LECA 4E09A 2EKBA 5D5QA 3E9NA 1ZHOA 3PC2A 3ZVMA 4DSAA 2OGWA 3MTQA 4FC6A 4MVJE 1U3DA 2RHOA 4KPFC 4I99A 2MYUA 1YT5A 2YDYA 1L2CA 4Q47A 2AOWA 3JD4A 4MNTA 5CHEA 4NYJQ 3TPFA 3GGDA 3DTVA 4UUNA 5M2QA 4AZVA 1YJQA 4GEWA 4E5KA 1LLUA 2CDRA 5AM1A 2ODNA 4DLPA 5JNLA 2HWYA 4PLVA 3DD5A 3NCHA 2FPOA 4BIIA 3AETA 1Z82A 1R15A 3Q3JB 3QWLA 1UWVA 1F4IA 3L8EA 1RACA 1KDTA 2EP7A 4XBOA 3KHSA 4CNQA 3HO1A 1E9AA 1HI9A 2Q5CA 4OBEA 4KG7A 2H06A 3Q2KA 4HTAA 3ZI7A 1YI1A 2Q8NA 3FVQA 4PGAA 4H2DA 1N75A 3AP1A 4EYQA 5HCUA 5K0LA 2KZUA 3CR7A 2IH2A 3KJZA 4HADA 4RY0A 4DREA 3ZWDA 1I14A 3WRWA 1K68A 4H4DA 2ZYIA 1YACA 3W34A 4DA7A 3AVVA 4X66M 4IWNA 3BDIA 4JUIA 4C6RA 2AFIE 4FYMA 2VT7A 2G9QA 2P9CA 3B1VA 3C3XA 1NQAO 1RKUA 5IYZA 2BFNA 3PFWO 2E82A 5JSHA 4Z7NB 1U0JA 4Y2RA 3ZWOA 3A6ZA 4ENTA 3TD9A 1FFDA 3SBOA 3RWBA 3E7WA 1H2XA 1CULC 3UHFA 4A7PA 1SIWA 3O4FA 2N46A 3HBLA 2O5CA 1CUFA 3HE3A 2ERYA 1FIUA 3F3KA 4XUGB 5KWEA 5T7BA 3M2PA 4O2LA 3B85A 1E2QA 4RFSB 5I48A 3ER6A 4NH0A 3DZ8A 4G1EB 3UATA 2W2QA 4RIIA 3HFRA 2CDBA 5EJ8A 3C3CA 2XKAA 4Q3OA 4EKEA 2FTKE 1NLFA 3IUPA 2ZTSA 2VPYA 4LHYA 5L7TA 3PLAE 3HCAA 4L4ZA 1GITA 2VAXA 2XB4A 1W76A 1U65A 3QHAA 3LHFA 1ZA2A 2QUJA 4PU0A 4AJ2A 5H16A 2XDAA 4C03A 2D5LA 4QOJA 2NPIA 3U4QB 4US0R 3DLTA 4EABA 2R4EA 1GFSA 2KNZA 5IC6A 3ETEA 1T5OA 1O8CA 1VEKA 4RVGA 4AY4A 3AY7A 1J0AA 1YKGA 4HD8A 3V6LA 3KFXA 1PT7A 4LRYA 1U2DC 4X94A 3KQOA 2XVYA 4KMRA 2LVAA 3SX4A 1X7WA 5LB2A 4Q4CA 4V0OA 2W6ZA 3G2IA 2BSAA 5H3CA 4E2YA 3EVGA 4PGHA 1P5HA 4OSEA 1DKMA 3BK7A 1OIVA 1Z07A 2PMDA 1DAOA 2JK0A 4EMUA 4XB1A 3A9TA 3HWX1 4J0FA 2ZI3A 4ZVRA 2IHUA 3E0XA 3K9PA 2V98A 3ORRA 2H1SA 2QUHA 2A5LA 4KN8A 1E4EB 4B47A 2FN8A 2IV3A 3RC7A 1E2IA 3IAXA 4E5PA 2IEIA 2VDNB 5JSZA 3OTOM 5I9TA 2C5SA 1E3WA 4Z51A 5L4SA 5KWVA 2DVWB 4BU0A 2Q3EA 2EX1A 3E4CA 3D7KA 4DLWA 2OD9A 4EAQA 4GGMX 4KUEA 1NX9A 1HYHA 1U7ZA 4M37A 3VBCA 2PKXA 3H1AA 4ODIA 3H1PA 2E0IA 2GD2A 3KXLA 3E8SA 2KW0A 4ZYZA 4O25A 3IBGA 2SECE 3MXTA 3ETHA 5HOEA 1AUOA 1YK0A 4ZIRA 4PPFA 2SKEA 1XD9A 2JUJA 3KSDO 4CM1A 4OU5A 3GARA 4R1OA 1DJLA 1WHTB 2Z58A 4GYWA 4UE3S 3H5VA 1W4RA 2GA8A 2LVOC 3T7KA 2B5WA 4UMVA 1MKYA 2DUMA 3TCNA 4Q3AA 1Q2XA 3F90A 2PV0A 3NRJA 3F3SA 5G53C 1GG9A 1DX4A 4RKEA 1GT6A 1UWCA 4P31A 3TQTA 2XTMA 2WZCA 3PKZA 5A02A 4RZHA 3TSCA 4L16A 1BROA 3WSTA 3FD8A 3C58A 2W48A 2XWSA 4D9JA 1JKMA 3DOAA 3V2HA 4QDJA 4RV9A 3P4UA 2AGVA 4CF6A 6ABPA 4IDPA 2FJUA 5J5CA 2PLNA 2QMOA 3W77A 4DNFA 4CEIB 1DTWB 2YVUA 1DGFA 1JEJA 4PXSA 3B8HA 1CQWA 3G9QA 2BI8A 4PBRA 4M87A 2D8AA 1CB7A 3FHLA 4Q4AB 1CRPA 4C1BA 3HP1A 2PUBA 1XCJA 4EHNA 3ORYA 1UFZA 4HEJA 1D9XA 2CVFA 2PRJA 2NP7A 3KDPA 4G4SP 5DM2A 3ZU2A 3B7GA 1GPYA 3LT1A 1SCIA 4ITVA 4EARA 4Q7LA 5K5EA 1H8ED 5BORA 4KFUA 1SQSA 4P36A 4TVBA 4TRNA 1OMOA 5A9RA 1WXQA 5FUVA 4ZO6A 4GT1A 4CKWB 1H5UA 1E2EA 3PNVA 2V97A 3HV2A 3BQNB 4TXJA 3FSGA 3QEMB 5MN5A 4RVHA 3D8UA 2I6XA 5DYWA 2B6NA 5G1OA 4EG3A 4YRQA 2RI0A 1GRCA 3OU6A 1Z0ZA 4G67A 1I5OA 4Z4QA 2W90A 4B79A 3DPUA 1Q19A 4ZOCA 4LJAA 3NGXA 2QU8A 1AQJA 1Z6TA 5CB4F 4N12A 5BO5A 1O94A 4FE3A 2V0CA 3NANA 5IZCA 1YBFA 2XUHA 3EG9B 1TK2A 2E6KA 1VDZA 1ULUA 4LK3A 2J6BA 2OK8A 1DAGA 5C4MA 3OAAD 1MGPA 3HCRA 5ED0A 1BE0A 3F96A 3ZD6A 2AUTA 1PSZA 4ERNA 1OU4A 1GLVA 2J59A 4KQEA 1JAXA 3ESCA 5IH7A 3SHVA 4P3KA 2JKZA 1JHAA 3I9JA 3OQPA 2OO9A 4AJLA 1RLJA 1F5SA 3LTEA 1Y81A 1KGDA 4BNZA 3T1QA 2XKKA 4FPXA 1M54A 1UBLS 4DIBA 5TIIA 5K99A 3P71T 2R1VA 4LF9B 1NR5A 4HNVA 1JP7A 1QGAA 1FW6A 2PYZA 4NRVA 3SARA 1DARA 4DCMA 3CPEA 1IDN1 3ZX4A 2IYWA 3V8PA 4MUXA 4NTZA 2FPGB 1KK0A 3EN0A 4P58A 4UW9A 2CNNA 2WIJA 1Z25A 4RKFA 2OFOA 2C0QA 5J4VA 4ND1A 3VOSA 2O52A 5KYUB 4R8MA 2D1FA 3AJAA 1UJ2A 2NAPA 4BN5A 2I4TA 4BFYA 4G07A 3EGCA 4NBNA 2J87A 3BMCA 5JXGA 1VRCA 5A6SB 3VHXB 3OQ6A 2E5LM 4QOEA 3NNSA 1NHGA 1O4VA 2FEKA 2HHJA 4BMCA 2BKAA 3LY5A 1OAAA 1R0SA 3ETDA 5F2EA 2XSZD 3AEXA 5JNTA 1HDZA 3WB1A 3AEKA 2DM6A 1OYVA 4C20A 5BQFA 1I9GA 2WY2D 4UTRA 4W82A 3VX4A 1H4SA 1JKJA 3ONVA 3NT4A 1C9NA 4RTKA 2FNAA 4X3PA 2WIFA 1SY7A 1X94A 1D1QA 4FI3C 3KQUA 2J9RA 4E12A 4UFNA 3R0VA 1NNSA 3CF2A 1K9SA 1QTQA 1GEEA 4CL8A 4UBLA 3KUUA 5BUCA 4PPYA 3NT5A 5KVCA 4JJFA 5B30A 4QBHA 4IINA 3QPAA 4MUBA 4PGGA 1TM7E 5DK4A 5F3RA 5FUMA 1QQ5A 2GYYA 1V5EA 2HWXA 2VBFA 2IYSA 3P0EA 1FDIA 1U7UA 2V9ZA 2ZXUA 2QSYA 1BS1A 1I51A 3NBMA 3MJ4A 4RGVA 5ICGA 2PR7A 1U6KA 3JATA 4FHCA 4LX8A 2F9LA 2G8LA 1OBCA 5LIRA 4G5FA 1DGHB 4M89A 4YT4A 2QDKA 4OJMX 4EMSA 4AS3A 1UKEA 1W7AA 4TTIA 3BD6A 1ZIYA 3F3MA 1URPA 5AVQA 3SYMA 2EA0A 4PG5A 4IIHA 3H1TA 4LDQA 3JWHA 3TD2A 2HU5A 2RC5A 3G2QA 5CIWA 2JFFA 4EIWA 4E51A 4Z0HO 4D8VA 1XJ0A 3B5JA 4XKJA 4DYHA 1PL8A 3AI7A 1M5RA 1UEJA 3AIKA 3ROGA 4U3JB 5LQRA 1ENYA 1POXA 4QUEA 3UWOA 3OOWA 2PGOA 4XIJA 4GOLD 3LY9A 1JFRA 3T6PA 2I7CA 2V5VA 1HR0B 4DGSA 3P97A 2RGBA 5HCIA 2ZLBA 2OQ4A 2FW7A 2HN9A 4NECA 2GPWA 4TWBA 3JWGA 3L06A 3P4YA 4RQBA 2QVLA 2ID4A 1WG8A 3O3MB 3LX8A 4OTZA 1F8GA 3D8TA 1IBCA 3T34A 4MLZA 1W4AA 1RBQA 4PSKA 1NZFA 4XYBA 4OXYA 5E9QA 2DZLA 5DHSA 4UHCA 4NBSA 2UXBM 1EK1A 5L53A 1X80B 4X8HA 1SMKA 3PA6A 4HDRB 2OORC 5CVTA 4TTSA 4XJTA 4E21A 1R6XA 3E81A 2QJRA 4ZQIA 2I8CA 3ADPA 5KAPA 2GOYA 4RL6A 1N3BA 5FCDA 2JXNA 3MBIA 3KKKA 3B38A 2B7CA 4QGHA 3EXIA 5DLEA 2FWAA 3ICPA 4G09A 4TUYB 2QSZA 4AMGA 2GN0A 5CJ2A 1EDOA 1TUEA 3DR5A 3UUFA 5FBHA 4L0MA 1MJGM 4GICA 1BHSA 4P7JA 5CM8B 1MRNA 1CF9A 1RWBA 4L4UA 1MPXA 2VLBA 3IUBA 3RIYA 4UZFA 1OLUA 3O6VA 1RHMA 4DLBA 4I55F 1XTBA 3DKVA 5CYFA 1MX1A 1NLUA 2G36A 5DB4A 2IE0A 4NYIQ 2BFEA 4Z3KA 2A5DA 2CLMB 2WSSA 2DWQA 3L6BA 4YCCA 1PTJA 1AKMA 5HDBB 3TLEA 2WTMA 4EDFA 5CVDA 2ZUBA 3H8WA 4MQEA 1LBTA 4K9NA 5LKAA 4UNRA 4IOKA 2Q5LA 4BO7A 3AVQA 4J16C 3EQZA 3NDRA 2PX5A 2C0PA 1OKKD 4ZGGA 2GXUA 4HQLA 1IDOA 3BOSA 1S02A 3D6HA 2Y3IA 1YMQA 1FFEA 2AW3A 3FTEA 1HORA 3NV9A 2B34A 2AYZA 3F0TA 5J63A 3IJ5A 2R47A 2BMJA 4AL4A 3HVKA 1L5FA 2OV6A 2PZ8A 3E5NA 1SEVA 1ZZGA 3SJ7A 1KJJA 1OX5A 1U11A 1HV8A 4AVYA 2HIGA 1IBLM 3QXHA 3G1WA 4MTLA 3O38A 5A4AA 4MDYA 3ZDBA 3WJ1A 3AEUA 2KBFA 1ZD1A 4C4XA 3JVIA 2V3VA 4YRLA 1DOZA 2MSNA 2VHZA 1LK7A 1NVWQ 2OCAA 1B76A 3N2NA 1NJ1A 4DSNA 3DLBA 1SKQA 3PFBA 4B80A 3BGIA 5EZ6B 4BO8A 1WPQA 1XQVA 3OM1A 1EP2B 2PAFA 2PL5A 3IDZA 3ASUA 6CHYA 1NULA 5FFNA 3BCHA 1R0BA 4B43A 3KQSA 2CE2X 5FHRA 2GAJA 3LQKA 3IG8A 1E32A 4CRWB 4TUWA 2BD0A 2FZCA 5C5CA 3D3JA 3NBAA 4AQYB 4DUYM 3KQNA 1DEKA 3GJTA 2OXTA 1KVTA 4IG4A 1TIKA 1SCBA 3UUWA 2WSFF 1JH8A 1SZDA 2QYSA 5LMUB 3PCTA 2W2LA 5TV2A 2GWRA 2I2AA 4ZCTA 3T0FA 3T61A 3L6UA 2FU5C 1AB5A 2HQBA 4P22A 4HNAA 2OSVA 2DNAA 4L9SA 3TG8A 3SJAA 2YWXA 4LF7B 1AUPA 4J43A 4DR4B 1CUVA 4ID9A 4PT5A 1EUDB 1D1TA 1E98A 3KFVA 1RT9A 5AHXA 3IHPA 3VGJA 1V3QE 1SCNE 4EY6A 3OZUA 1MB0A 1JLRA 2NVUB 2OXRA 3ZNQA 4ZCRA 2AXQA 1KR2A 4HDOB 2IUYA 1G8GA 3DE3X 3QVJA 4NG5A 4BV2A 4EW3A 4EY7A 4BNYA 2AQ8A 1HQDA 5F23A 1LDMA 2WSMA 4B76A 1IG3A 1KS2A 4FYXA 1EX7A 1AO3A 4N03A 2FKNA 1P77A 1GZSA 2CNDA 4MYSA 3PVCA 3X1WA 3MK6A 1CTQA 3THXA 1LPPA 4CUJA 1O97D 4MV3A 1U28C 1JWLA 4MWTA 4TT8A 4JYCA 1L7QA 3CUVA 3H3JA 1GDTA 4BLVA 1PFWA 2WA1A 3UWDA 3WSVA 4DR1M 3RTCA 5TNXA 1KI1A 4DDWA 2OCPA 4CJ6A 3Q8XB 4M8KA 2OCXA 3T1VA 3F97A 4J0DA 3FTDA 1XMQM 4TL7A 4CISA 2PIDA 4N54A 5LZ7A 1T29A 3OM9A 3CU5A 4G6ZA 1OZGA 4DR7M 3TMKA 4E4YA 3NHYA 2OG2A 1NURA 1DXOA 3EZXA 3OX3A 4JLBA 3THYB 2V7GA 3GRVA 4PN3A 4Y6RA 5AW8A 1PG0A 1NMSA 4IDEA 4X00A 3M1AA 1HY3A 3U0BA 2BTEA 1BMTA 5E1MA 3OWOA 3ZTWA 1AOXA 1REQB 4TGLA 5KUTA 3P5BA 4G0VA 1QO0A 4H1WA 1VRVA 1LDYA 2IA5A 5BUQA 2VQEB 4D6YA 4B7ZA 5HKAA 3VZDA 1FNDA 1X9HA 2DMRA 3A9CA 3D2CA 2ZB7A 1KMQA 4LRSB 3ADBA 3WWDA 2HLNA 3WMWA 1WULS 4YWHA 5E6UA 1EWRA 2V6IA 2IYLD 3B48A 1EKXA 2X41A 4JHLA 2Q2NA 4NDAA 5EJ6A 4IIJF 3FROA 3PD0A 2IEDA 3MWYW 5AI5A 4UNSA 4DJJA 3ZCBB 4PLCA 1NW5A 2QPLA 5EHGA 4X90A 5DN6D 3NU1A 3MYRA 2VUIB 1JAHA 1FUIA 4DCVA 2JJ2D 4ZCSA 1U02A 2JBAA 3B5IA 2DBZA 3OA2A 5K51A 1KJNA 1XA0A 2ZQYA 2IHVA 2BIFA 4WE3A 4KXVA 2E89A 4DANA 2R11A 2J0QA 2WMNB 1ZVMA 2Q5IA 1QGDA 3OZGA 3J81S 3WLTA 1AZTA 5CA0F 1TJ4A 3PRYA 3ORSA 2JJYA 3G0OA 2FVXA 4C7OA 5CCXA 1JLLA 5FL7A 1E63A 3PDIB 3W5DA 3N8DA 3KNZA 4DV5M 2WM2A 3FJYA 1XMIA 2RGDA 3MMSA 3GP3A 2O2ZA 5K0SA 5K3SA 4Y0VA 721PA 2PH5A 3GG9A 4L3WA 3R3ZA 3TLZA 1HDIA 4HGYA 5C18A 2R86A 3CJRA 4XAQA 2F9MA 4L07A 3IESA 4DSZA 1E1NA 1L2DA 2B8JA 3U7RA 3VXKA 5I4BA 4PTYA 2I71A 1L5NA 2VYQA 4WFQA 4BB0A 4L5IA 1W73A 2PFSA 1NF2A 2XIQA 2AB0A 2QRVB 1C0EA 1WSBA 4ND2A 1PRBA 1FUKA 1K06A 5EGNA 3JQBC 3S1SA 1U9ZA 5JDCA 3V8RA 2BY4A 4BE9A 3DBIA 1ZJWA 4YO7A 5CDFA 4L7VA 4B6FA 3IDSA 4A0RA 3SSOA 1AKYA 4IEIA 3K0FB 1QDUA 3OT5A 2H2DA 5CVJA 4MR9B 3ZWKA 5L4LA 3T1YM 4YUYA 1ZINA 3VPBA 2OOKA 4NCJA 3TOZA 4OQPA 1AS2A 1WLYA 3U6DA 3C6XA 4AURA 4YRDA 1MB4A 4LHXA 1A8QA 3BGOS 4AY3A 4HGOA 1MH1A 1SAYA 3T3NA 2H2FA 4Z86A 2GBLC 1P91A 1VE7A 3LD9A 2CXTA 2IW1A 3UJ3X 1XJCA 1BW9B 2B99A 3TE6A 2JB9A 4PZZA 1RWWA 5I9BA 1WGNA 1EB8A 1E0SA 2XWJI 2YY5A 2J0UA 4G8CA 3L07A 1KMNA 1WBDA 4LPSA 4XK8F 3GPLA 3Q15C 5AW6A 4PIMA 4LPKA 4ENUA 3L9WA 4GC9A 2B2XA 2FMHA 2JGKA 1X39A 2JI6A 2YS6A 4XX1A 4BFVA 3LMMA 5ALSA 5LZ2A 3F7TA 4IUDS 4E5VA 4RH0A 3GUVA 3A45A 1T2EA 2IIQA 1UXKA 2A5GA 1NLYA 2IPXA 5EC8A 1WUIS 2C4KA 5DV9A 3KB2A 2F00A 3G5MA 3CVOA 1SKYE 3PYMA 4OM8A 4HAWA 1TM4E 3HN2A 4HB0A 4CNBA 4B09A 3FDJA 1ZJ6A 2M1XA 4MVCA 3GRCA 5F77A 2PZEA 2JIBA 2A0WA 3Q0EA 1IFYA 2CXHA 3DYVA 5DXAA 1C9KA 4L9RA 1UPAA 3NC0C 2JAPA 5TEWA 5L3QA 4G4SO 2MINA 2ODEA 4ZQBA 4DOMA 2ZRLA 3N86A 2ZBRA 3P5SA 4ALMA 2XITA 1U2GA 3OM8A 1EAYA 4LOIA 5CB4B 1E2PA 1AZWA 1BQEA 3R76A 2O9JA 3F73A 3G0GA 5BN4A 2BSXA 2EX4A 3U9LA 1C41A 1CUWA 3K53A 3C7TA 3EIUA 5EMHA 2RBGA 5JTTA 1KYYA 3VMMA 3RVNA 3WTBA 4OHOA 3C7KA 1HFKA 2R00C 3PGVA 4F21A 1T8WA 1LLFA 1JR3D 3G49A 1GRRA 4OD0A 5JQGA 4YMUA 4HDAA 4DQKA 2L7HA 1E4YA 4GDFA 1X38A 3JAKA 1M0WA 3W1WA 2A57A 1NVMA 3DCJA 4GO1A 2YMPA 2C1XA 5ER9A 1WJ7A 3LUFA 1C7ZA 1WDWB 2AUNA 3WGTA 4AY2A 2W2KA 4HV4A 1AGRA 1LVHA 5U4QA 2RHWA 3OQNA 4DJAA 4LVUA 1Y9AA 2IFTA 3LW8A 1U98A 2A5JA 3RGSA 1FTQA 3PF9A 4I9NA 1C3EA 1L1EA 3K35A 1W1IA 2Q6VA 5BYKA 4GMXA 4HBZA 1Y4DE 1Y63A 2JEOA 2ZUCA 1QHXA 4TLCA 1Y6ZA 5JCPA 2GAIA 1JQEA 1M5UA 5A9SA 1QFJA 4DMGA 1Y82A 1M1UA 1I6WA 4YUVA 4REMA 2O8DB 3SATA 3ZJ5A 3SYRA 3R9XA 3ZV3A 1OILA 2JHPA 4POOA 3BMOA 1TUBA 3QMMA 3EIHA 3FYUA 3LKZA 5U1PA 1OX6A 4UVHA 3S0JA 1LSOA 1YZVA 4F0JA 2LVBA 2JPDA 1TCVA 3IVMA 3LP5A 4WASA 4TS3A 2OHHA 2GM3A 4HMPA 1ONOA 4KACA 4HEA1 5AVOA 3RROA 2EFYA 4GSKA 3OZAA 2AJDA 2Q1YA 2EERA 2VF7A 1L4HA 4S1WA 3T1NA 1C29B 5J3JA 3OJ0A 4BMZA 4DTIA 1I7PA 3OE7A 3Q6NA 4EEXA 4EEZA 5CCEA 1FYXA 3IEKA 3SASA 5ICSA 2E4ZA 3HDGA 3EFOB 1U0SY 1V26A 2IDMA 3AG6A 3L1KA 5AK5A 3O73A 1G21B 4IDDA 4QG7A 1K98A 1PKEA 4FJ0A 2JLZA 3KVOA 1H6CA 2IXBA 4MA0A 4QFCA 4YLYA 3ZQUA 1YB5A 3EVAA 3F8SA 3HZRA 1GPNA 1Y9EA 4LBWA 3WYEA 3RK4A 3RAGA 1L4MA 3IAS1 4XD7D 3TRIA 1NR7A 1LLQA 2DHYA 4LJ5A 4EGQA 2RB4A 2SBTA 5KTRA 4ZC8A 2CMDA 1T13A 2X8BA 1ZD2P 3GB9A 3MS4A 4MK4A 5EKDA 4E6PA 4QXOA 3FM9A 3IELA 4LWQA 2IUSA 4TTQA 2O8CA 3E9ZA 1NF9A 4R7TA 2C9MA 4JVMA 3SMPA 1IQPA 1A1SA 1A04A 1VE3A 3DHWC 3IQXA 3KL4A 5IABA 2AOTB 5E2AA 1W5EA 1U81A 3G2OA 1OTXA 4IXWA 3DFUA 1N6HA 4HMOA 1GVNB 3TCKA 3JX9A 4CLOA 2V6FA 3R5KA 2NZUG 3IE2A 3BJRA 2BDTA 2IQIA 4GS5A 4G56A 2HGZA 5F7OA 4B4WA 3F78A 1Q7GA 1R8XA 4KAJA 1QNFA 2P6PA 1OBOA 3ACDA 1JB0F 1P2SA 2A33A 4ACBA 1DTSA 2OECA 4CR7A 4HOYA 4I7EA 1J0BA 1ULZA 3DF7A 2P9BA 2X1HA 4GVPA 4DG8A 5EJAA 4HCJA 2AEFA 1DKLA 1DAIA 2Q0HA 5IUKC 1H9AA 3T4PA 1HE4A 4HEA6 2HLHA 3R4CA 3VSAA 2JFVA 4BP8A 3RB8A 4YY3B 1R4NB 4JOCA 3W5SA 1LPMA 2G1JA 3L0BA 2OO5C 4B6QA 3P0IA 4OA8A 4A3VB 2D0DA 2IHJA 5CB0A 3TDMA 2Y1GA 2V8OA 2VF8A 1OLOA 1DRJA 3LYLA 1OWMA 1XROA 3QOWA 4QTTB 1KAGA 3DZIA 4CMEC 5J4YA 5AM3A 2XUKA 3ZDDA 2F4VB 1WIWA 5FNVF 1O3YA 1XG5A 3LQYA 4TLDA 2ES4A 5EUQB 2A30A 3VR2A 2HREA 3BMXA 4R1SA 4JITA 3EDYA 4NYMR 3HA2A 1IH8A 5HYVA 1XCBA 3IAS6 4Z0PA 2YVLA 4NXNB 4BATA 2G17A 5LP1A 5LA6A 1YL5A 1K8QA 1FRVA 3W79A 4I55B 4IGAA 2VQ6A 5IASA 2CXXA 4PX5A 5AOBA 1R4ZA 4HNTA 2J5XA 1ADFA 4H59A 4EZBA 2D6FA 4L7QA 2C31A 1WAMA 4TX1A 5A2QA 5KHLB 4BY9E 2X13A 1V5WA 4ME6A 3KQVA 5JBNA 3R75A 1WRBA 4QO7A 3DTVD 3HA3A 2ZE8A 4PRYA 4P5PA 4MGYE 4O2AB 1XMXA 4HVAA 2Y2UA 1CC1S 2OPBA 4PHFA 3K6SB 3TW0A 4IDBA 4L3OA 3N8KA 1KO8A 2JNHA 2R8PA 4IJQA 3MTEA 3R5HA 4DM7A 2DJ5A 3T1HM 5AKXA 4Y2PA 2XB8A 4HNGA 4LTNA 1N7GA 2OBLA 2RHLA 3Q3HA 1AO0A 1NW4A 2O50A 2IS1A 4GOJA 2XCOA 4DVJA 4PX3A 4CHGA 2IIBA 1XQYA 3UV7A 3STVA 3C43A 4FOTA 2BUCA 4Y2SA 3O9MA 3L41A 1QC5B 3OTIA 4REZA 1G18A 5L3SB 5BR8M 3PX2A 2EGGA 2YIJA 3AW8A 1MA3A 2AJCA 2Q3HA 2P27A 1C1YA 3PC8A 5TS2A 1RQRA 5DM4A 4OAPA 3RCBA 4Y2JA 1KSHA 2OGSA 4PC3A 2CLEB 4NIMA 1RHUA 4YR7A 3GUHA 4XCVA 5JCOA 3CA8A 3LVFO 3PZRA 2C5HA 2A94A 2NZWA 4RS4A 4PRKA 5EHXA 4W6ZA 1KRHA 1YJAA 1QVAA 4FDUA 4LS3A 5K3DA 3A0UA 4NSNA 8GPBA 1AVTA 3D7RA 4I4CA 2J9ZB 4XWWA 4JLWA 1X7ZB 1E18A 4Y6SA 4JA0A 1K27A 4A8JA 3HVRA 4S2EA 1M75A 2D5AA 2RE8A 1WU8A 4HVCA 3EQ6A 1QUFA 4WBNA 4MB2A 1VHJA 3VR5A 4ES6A 1RYNA 4NJOA 5AK0A 4LWZA 2NTNA 4H7HA 2F3TA 4A0FA 3WX0A 4B7CA 2WVGA 3TXYA 5B7GA 4KHPB 3AFGA 2P2CA 5L7WA 3HUDA 1BE1A 4M98A 1BG6A 2Q5QA 2C2GA 1I7NA 3QFHA 1RPTA 1ZH6A 5F2KA 1SR8A 4OOEA 5FWYB 5GTDA 3C3BA 4B3SM 3I6QA 4XUCA 4BMVA 3QHQA 4KRGA 3K6KA 4RMIA 3I4LA 3RABA 4JAVC 3PWTA 2EFDB 3R7WB 5A0FA 3CC8A 2HF7A 3OBIA 5JC8A 3IVCA 4G4QA 3O9VA 5A7GA 3SWWA 1AKVA 3O84A 4X1KA 4IDCA 1SU7A 4HAYA 5FTMA 3UOAB 4HYQA 4KZKA 2LIPA 2GNOA 4UM8B 3MTBA 5G0WA 3D02A 1WMDA 2VXYA 5JASA 3WR5A 3CNBA 3UW3A 4FDLA 3SAUA 2PUHA 3H4JA 3EVBA 3G8CA 4EO7A 2XXAB 1XGKA 4M1ZA 1LPNA 1P44A 1OC2A 5FH9A 2WTNA 4UNPA 3QE9Y 2I3GA 1C4OA 1QU2A 3GBSA 4JR2A 2GKOA 5ALZA 1P75A 3QIVA 3EMBA 3TWOA 1EXNA 1JHPA 2HMVA 3B2QA 4NXMM 1P9OA 3B8EA 3MWJA 4S35A 2YHBA 5EG5A 3ABRB 1CU1A 2DENA 2JEYA 3DMPA 1GT91 2GVNA 3O1JC 3BB3A 5JMWA 3IPLA 1KJWA 3ZTYA 1WVIA 1S2DA 5AP9A 3RI3A 3WLMA 4YYZA 3L4BC 4B32A 4FMDF 1DAMA 4F96A 2JI4A 1U9YA 4CYMA 1SQ6A 1E0JA 5G3YA 3ONDA 5DMXA 4F3NA 2XOEA 3U5ZA 1OKSA 1KZ9A 5DW0A 5D87A 1PUJA 1UPCA 2UVPA 3RYCB 3H6HA 3RSLA 4X71A 3HX3A 3SXPA 1NWCA 5ITRA 1D4OA 5AXBA 1JR3E 3T3EA 4ND8A 2XH8A 4V0LA 4Q9KA 3G89A 4Q3EA 1BGWA 2YXEA 5E7QA 1GFIA 3IHLA 1QJCA 2C9YA 4ZEXA 4TM8A 3VU0A 4L8YA 5LMCA 4DCNA 3S2ZA 3WJ7A 3GV0A 3FSJX 3LDFA 3AOEC 3NEJA 4TMZA 3PTAA 1KI6A 3II6X 2WWGA 3F5SA 1X3SA 5AKEA 5ECGC 1LS1A 4ZICA 5FI1B 3BB4A 2DH6A 1O9HA 2BVNA 1K8RA 4IIJB 4OFWA 4M1YA 1GJTA 4L6AA 3AHIA 4IJVA 2WG0A 4YIKA 5EHZA 4GQAA 3AU9A 4KR2A 4HGPA 1EHCA 3SFVA 4BE4A 2ID8A 1R3DA 2GBCA 3GQ5A 3QW2A 4ECEA 3DZJA 1VFPA 3V80A 3KVWA 1L3IA 2R7KA 3ESDA 3A25A 1Y8GA 3AX6A 3B74A 3ZDRA 3VC7A 4QGSA 4XTRA 2IDZA 3EXG1 2FPPB 1U7WA 4Y1EA 2JVJA 2FZKA 4HDNB 1JDUA 1V39A 3HZOA 3IUNA 1TO1E 4AU1A 3LUBA 1W2WB 4XIYA 2Y68A 5DCLA 2W37A 2W6CX 1DEOA 4C6SA 1T6YA 2QRPA 5KTPA 1TIPA 1WDTA 2IY7A 4IVRA 2JZ1A 1Z18A 4NBVA 1NBHA 4JXXA 1HPLA 3DB2A 1CUZA 1Y8QB 8OHMA 1CUSA 5KTSA 5D1NA 1S3IA 3ZVKA 3TGWA 3I2YX 2YQ5A 4OKIA 5FOQA 1DVRA 4DIEA 4X64M 3PB3A 4PLPA 4BU1A 1BE8A 3FSGD 1NR1A 4FT2A 3D6NB 3RKUA 4BO4A 2DUNA 2X8WA 3ZOKA 1ESCA 5EKSA 2EZTA 2FZLA 2EXXA 3HP4A 5E2BA 4WZBE 3CKMA 1Z0FA 1G63A 2YWJA 1TYCA 5IUJC 3T99A 4KREA 4A26A 3JQAB 1W88A 5CH5A 3EA5A 1O94D 1P0IA 1FP6A 4JI5B 3ZE6A 1XTQA 3MIIA 3WJ2A 5EJ4A 3I72A 3FBGA 3EQ9A 5I5EA 2E5LB 1GZDA 5ALOA 5TB5A 2O1WA 4AJOA 1DU4A 3HBMA 3QOFA 4URHA 1UEIA 4L78A 4MPDA 1YE5A 2IDKA 1DDGA 3CWZA 3AP2A 3DFFA 3HU5A 5IF3A 3NYRA 1NY5A 1GA4A 4RZSA 3BM5A 2O2HA 3MQ4A 1E61A 4C7VA 2X9NA 2PM8A 2PKQP 4LF8B 3FDIA 1E7QA 3M7GA 4HI0E 3S2FA 3TL4X 3JQFC 3D7MA 3SY8A 3KRTA 1GCOA 4R31A 2XEPA 1M8PA 1JFVA 4D4KA 2IYXA 2NTVA 4QASA 1JHRA 1D03A 2GCPA 2HV8A 3OT1B 1N0UA 3H0CA 2E4VA 2ZR8A 2IDJA 3KQKA 2A1UB 2C95A 1FVFA 4DR2B 2H0QA 3D7NA 5CM9C 4WKBA 2MMCA 3RU2A 4UU0A 2PZBA 3ZU4A 4GU5A 2GHRA 1ZK0A 2G3QA 4LNUA 3I6MA 2W4QA 2C61A 1Z6AA 1DDIA 4L5BA 4YMHA 2YBEA 1S8FA 3M4YA 2VAWA 1JFLA 3RYHB 4LF6M 2B5VA 1DO0A 2VP5A 3N05A 2PH7A 1M2GA 1V95A 1P4GA 1FXWF 2BFFB 5CEJA 1BDJA 1MIHA 1E99A 2WJWA 5IK2A 4HAXA 4FHEA 2IXDA 2O2DA 4OYHA 1NQXA 4FGJA 4CIBA 3CWQA 2TYSB 3HCBA 1DFIA 3KHUA 2ZIFA 1HEUA 3ZBUA 2OB2A 4S12A 2FSIA 3FDXA 2FK8A 5BOVA 5HQ3B 5JAOA 1S2OA 2NXJA 4KDEA 3UMBA 1HFWA 5GJVC 5ECYA 3OF2A 1E1DA 4C4PA 3UWPA 3KKPA 1CKEA 3LOPA 2V1UA 2QR3A 5M04A 4IIWA 1Z37A 2H4JA 4EFNA 1RIFA 1KU6A 3F4BA 3Q40A 4XWKA 2Z1MA 1Z45A 5AR1A 4EYOA 4OGLA 4S3MA 3KR1A 2D2EA 4MKFA 3QE4A 1BXRB 3O26A 4J3JA 2WVJA 3AILA 4P35A 3PGKA 2OV3A 2JAOA 1PLLA 3VKVA 5M34A 1DKNA 3CN7A 4RHEA 5EQDA 3G85A 2FF7A 4A1FA 3GYBA 1CR0A 3FPHA 3IE1A 2E4WA 1YF3A 2F8SA 3W6NA 3TIVA 5LB4A 2Q21A 3TGPA 1MO6A 3DOFA 1EGMB 1T9AA 4MW1A 2ADFA 1FA9A 5K0TA 3FR8A 1DCFA 3PG5A 1F17A 3BORA 1K89A 4BNMA 4RK0A 1VLZA 5C1BA 3SICE 4ZV9A 1E1RA 3G1TA 3GA7A 2ZTHA 2JGJA 1RXCA 4JL6A 2B4TO 1OYYA 4O2BB 5DX8A 1QBGA 1YQWA 2C2YA 2XQGA 1K0FA 3WYGA 2Z5FA 3HB1A 3RRFA 4M1QA 5IARA 1M34B 3LCVB 1CUXA 3KCNA 3VFDA 1F6WA 3ZDCA 1F3LA 2QZ9A 2PL9A 3UTDA 3GQBB 1SC6A 1X1SA 1AX9A 4ER0A 1NGSA 2VHQA 3WDKA 1E6KA 4WTOA 1Q0ZA 1SXJB 1L7PA 2ZSHA 3LQ1A 3HJHA 2J3HA 3UN1A 2ZS8A 3OCXA 2WHPA 3K5HA 1UMCB 1V1MA 2WAXA 3P0RA 2P3OA 4F4IA 1KYTA 3DEIA 5JO0A 3GJXC 3AHEA 3TTYA 3NETA 5K45A 3O5AA 2ZSAA 3BJZA 4ZV4A 2YCBA 4RDIA 4LSZA 1P6UA 2VR1A 3A1NA 1E0AA 4GMQA 3ONWA 5JR3A 4UZEA 4ARBA 2RARA 5L9AA 4M6WA 3UMYA 1A9XA 1VA5A 3HCDA 4JJ6A 3UT5A 3FPAA 4MW2A 4L6CA 3RKRA 3MFYA 5A4JA 1S1MA 2WG1A 3TL3A 3LPMA 4BVGA 2F7SA 2H9YA 1FSSA 2NVOA 4LGVA 1ZM7A 2R97A 1MO3A 1F0NA 4MUIA 1QFXA 4ZC1A 3PQDA 3SVZA 4BWGA 2W2MA 2WSSD 2WSCF 5J2TA 3ZK8A 3OZSA 1JR4A 3TQSA 3GO8A 2AKYA 3UXEA 2FW1A 1KI7A 2G40A 4WOPA 5F21A 4I1PA 1YA6A 3KLBA 1GD1O 1FYEA 3U7QA 1M2VB 1U63A 3C6MA 1G8KA 3AR9A 4OHUA 1PP4A 5F12A 1NVVQ 1R88A 1IY8A 1Q22A 4AAYA 2VQ3A 3CLSD 1RRGA 2DHRA 1FEZA 1OB5A 2GBPA 2JLQA 1OJLA 4ARAA 4WWHA 4M9SA 3HR8A 4UM7A 1CHDA 5C80A 1UK9A 3UYLA 5KSPA 3ANLA 4JNKA 4KBFA 5ERXA 1T1GA 5DLDA 4RNDB 1YDFA 5IJ9A 2B25A 4JT2A 5ICMA 3IVGA 4V24A 2ZJ6A 1LA2A 4YI5A 1BA3A 2TMGA 1PNRA 2NG1A 5D7NA 4PX2A 4Q1DA 1WV0A 3EXFB 3ROMA 4R2MA 5LXTF 1QZZA 2R44A 1KE1A 1T5SA 5EHNA 3ZZ0A 1M33A 1SCAA 2Q1SA 4BLPA 4YEDA 5BN5A 4NPAA 5LFAA 2XNJA 1EDDA 4LOLA 4J94A 1C8LA 1MAHA 4BL5A 1BN7A 4M0KA 2VZ9A 1KAMA 3FLBA 4K9DA 4OHMA 4C05A 4MVJG 2ZUSA 2P9EA 3I2GA 1O54A 4N65A 4IGEA 3CV3A 2I54A 4EK9A 4JYBA 2RHRA 1QTNA 3LBIA 5B1SA 3I0ZA 2W2LD 4MRMB 1QCZA 3KXIA 3EFEA 4JJ7A 2A2ZA 5BWMA 1CUGA 2R8YA 2WILA 1XYYA 2VJKA 3WAKA 1US8B 3TQIA 3IDOA 3ELUA 3DTNA 2GILA 2WD7B 5DFLA 3WGZA 3P9XA 2XZOA 1DXHA 2Q0QA 3RBVA 2A0KA 1ZMWA 1UJCA 5F4BA 2FLWA 1G8SA 4EUNA 4PNPA 2FG7C 1WIVA 3RRYA 5I8PA 2AK3A 3DDUA 4ZPJA 3KZOA 2ZRCA 3REQA 1TX4B 3ZXSA 1LSUA 4C4SA 1T43A 4G0UA 1ZM4A 4U6SA 2P7HA 5F3WA 1KORA 1BCRB 3VZSA 4ZD6A 4Y6QA 5B1DA 4PVDA 3PLNA 2A92A 1SU6A 1ONNA 5AI8A 8ADHA 2PH3A 1ZYUA 3ESZA 4ENSA 1O7JA 1W8IA 3RAFC 1TYEB 5J4KA 5K05A 4IGFA 3CB2A 1TEHA 1OFTA 4TQUS 1ONBA 3KYDA 4WLFA 3TZHA 3KLPX 1Q39A 2ZCVA 2C92A 1QSGA 1YHZA 3OETA 1H23A 1GIAA 5I9SA 2EDCA 3AY0A 3HFJA 5HUHA 2XWPA 2WV7A 3SHGB 3IQWA 4JQZA 3R6DA 3SC2A 4LF5B 4U2DA 5HEKA 1TPYA 2JIPA 2HGSA 3JQ7A 3RFXA 3EVEA 2HA2A 4P93A 1PD0A 2MDTA 3UTCA 4NU6A 3E7PA 3UT0A 4N7JA 3JARB 1ESDA 5KO3A 2NTJA 2HSWA 3V5NA 3CLRC 3JAMS 3I8SA 5IAKA 3S2YA 2DEUA 3GDFA 1S8OA 2RAPA 4FFOA 2WUWE 4RVDA 2FHSA 5HKOA 2TSYB 4DV5B 4TVKA 2J6IA 1F1JA 3FOWA 3K15A 4GR4A 1S0UA 4BJ5A 1QO0D 2ZIVB 1FYFA 3SNKA 4I50F 4DADA 4PCAA 5JJKA 2BRUC 4QHSA 5EOVA 2JLCA 1VLJA 2FWIA 1PRYA 4JEHA 4BX2A 5COAA 5IDVA 1R37A 1ZH0A 3CKLA 2BISA 4C06A 4YQYA 4RY8A 3VAZA 3IV6A 4EELA 2C7QA 1P3JA 4XZ3A 5JSUA 1Z7YA 1R64A 1K6EA 3I6IA 2Y4NA 1KEEB 3CISA 1E2MA 2GJSA 4K0KB 4GBED 4DCGA 3IQIX 5CIQA 1JTVA 1RM0A 2J33A 3QKRB 3UJCA 2DRIA 1RC0A 2ILTA 4HB4A 2IK8A 5ITSA 4IOMA 4FZVA 2ZPUA 4KWIA 3V7NA 2C58A 1MOQA 4BX0A 2X0EA 2CMFA 3IIIA 3LH5A 2DHEA 3B7QA 1RYBA 1L5GB 5BVHB 2HX1A 4BWYA 4IH4A 1UC5B 4NU5A 1O0BA 1G8JA 4UQLA 3NTRA 1O03A 1ZG3A 2ZUWA 3CVVA 3PUKA 1U8ZA 5FL7D 1QX4A 3FHOA 1B00A 4A10A 1P7VA 5A1TA 3I12A 1VPVA 4I9FA 4R84A 4MUHA 3ZC7B 5BOSB 1NI4B 1Q7EA 4WKOA 4JI0B 2CUZA 2N47A 4TRJA 1T35A 1DIBA 2D0IA 2R4QA 4FMDB 1ZGGA 2WRZA 4MHOA 1BIFA 2IL1A 2A67A 4BXOA 4B83A 4Q6WA 2QT1A 4F4HA 5TMDA 4MGYR 1QDTA 2I34A 3DE2X 3P9RA 3QVXA 1G38A 4RTMA 3KYCA 4AK9A 3OZ7A 5DNYB 4ZAWA 4MP6A 5DH9A 3WKBA 5DNAA 3URMA 2Y92A 3BWCA 3LT5A 4P2BA 3RT7A 5B55A 2H4HA 3SF0A 5E4YA 3ZE0B 2ZKLA 2IYEA 1ZNWA 3X1XA 5DIZA 1RQGA 2X4GA 2QTFA 3SX2A 3IVXA 2E21A 2JS7A 2B7LA 3HV0A 5LR6A 3DE5X 3IXMA 2XMDA 5DHRA 3IA2A 2OHIA 4KH0A 1QKKA 2CYCA 5AD1A 4DSUA 3ME5A 5EWMA 1IN8A 4F1KA 1ZVKA 1VB3A 4BWFB 4TMTA 1I9CA 3H0KA 4E13A 4YMLA 2PIAA 1B0AA 4FZ3A 2R1ZA 2OAGA 3CR3C 2VDMB 1J2UA 3O94A 4K28A 3IYLW 2C2WA 4W9NC 2PUVA 4QNNA 1I3MA 2QM0A 3GHHA 1UBEA 4PO9A 2ZSBA 4H16A 3BKXA 4XGQA 3CZCA 4EB3A 1BKYA 2X0IA 3GZNB 2PANA 4MI6A 3W5BA 4M1TA 1YTLA 1QVZA 4TWJA 4X54A 5BNIA 3Q5DA 3AQIA 5K6RA 2PZGA 3WMEA 1PN3A 1ZJZA 3W5AA 1XD2B 4JBIA 4QQRA 3MJRA 5ISMA 3IR5A 3KUKA 2B98A 1TU0A 1U7XA 2ZIGA 3FSEA 2PLFA 5E9WA 4EKIA 1QE0A 3EGOA 1F0KA 1X7HA 1C7YA 4URVR 4JT4A 1NJFA 4WKGA 3NTLA 5TSDA 1BXGB 2DXIA 3IOBA 5KS2A 1FSZA 5E9JA 2O3UA 4MCAA 3BQ9A 2JI7A 4GR5A 1P1FA 2FPXA 1E66A 1SVUA 4N9WA 1N6PA 2O05A 3JZMA 2HA5A 1DAPA 1UKCA 4YCJA 1ZCAA 1B16A 5IANA 4NJMB 1XT6A 1VMAA 5T8KA 3MJEA 3G9ZA 5DHUA 1MFPA 4CETA 1XAHA 2HJGA 4R8SA 1NQUA 3IEXA 3K4QA 3NXKA 4YK7A 1W93A 4M9QA 4FFBA 1SVSA 5H81A 2PBZA 2HAEA 2GUGA 3E7DA 4NCAA 4I9UA 1Y8RB 1Z5ZA 3EH1A 2L4EA 1YFZA 4ZFNA 3DPIA 4WH0A 1GU7A 2BMDA 1C14A 5LMZA 3X1YA 4I3GA 3VDNB 4AP9A 1J0EA 1QIEA 1X1CA 2ZJ7A 4CLHA 2V7TA 1FDWA 4PW0A 3ROEA 4DZZA 4EITA 2JA1A 1GYPA 4AJPA 4ND4A 3BWYA 4FFMA 3H11A 3H1BA 4ETMA 2AMYA 2G76A 1KF0A 1Q20A 1LF0A 1WVMA 1V92A 1M7BA 3KB8A 1D6JA 3K9GA 3PEYA 1LQTA 1AHPA 2HAKA 1E7YA 3KW6A 4B3BA 4PAWA 2BEWB 2OMEA 4FM9A 1NOIA 4JYPA 1PR0A 1HLFA 4FD3A 2P30A 3ZWMA 2NYRA 4H17A 1V8PA 2CJYA 5AM2A 5JD3A 3GH1A 2JVIA 2FCRA 1QYDA 4YXWA 4AMVA 2SICE 3BH7A 3M2TA 2VT2A 2KB0A 4QJ3A 2KRUA 3UGKA 1ZK3A 5KJCA 3ZHRA 1YFJA 3NIWA 1C0LA 1QFSA 3PEUA 1XSEA 3AI1A 4XSGA 1JB1A 4GECA 4BNUA 1T0JB 1H2EA 3UA3A 2B8TA 3IXQA 1I7QB 1YHYA 3U49A 3TLBA 4B5KA 2P4EA 1R18A 3FPGA 2OCYC 1JIVA 2PUEA 5KAMA 2QQEA 4G41A 2JZCA 1SRQA 4UUOA 2XE7A 4TWZA 3EUEA 5E6JA 4C07A 5JAQA 3DE0X 3PWSA 1FJGM 4QUDA 4Q7JA 4PPNA 4FS3A 5BYBA 2AFHB 2Q62A 3ND8A 2B78A 2JLUA 3U4GA 2PKQO 3GP5A 2WE8A 1CY7A 1YI0A 3ZJYA 2OE2A 3DHVA 2HJVA 4JMLA 4EG4A 1AJEA 5K8CA 2FV8A 3U4QA 1FNCA 2O8VA 3KLMX 5F64A 4NAUA 4ZPXA 2LNHC 4G84A 3KLNA 4A0GA 2O57A 2VO1A 2CNKA 1WP4A 5EHQA 4D46A 3O8RA 4C01A 1ACJA 1NDHA 3L8ZA 5CUQA 1YXMA 2C4WA 3VYTB 3TNLA 4XGRA 1JIJA 2CJWA 3Q98A 4EFKA 4RF4A 1A9SA 3A9WA 1L7RA 1PCXA 1CR1A 1PJQA 3ES9A 3DGFC 3L05A 1M67A 4OIFA 4PYNA 5KHAA 1KVRA 3DL4A 1CEEA 1XQ1A 1ZIXA 3DNMA 3DDNA 1I13A 1FTYA 1SD5A 3HN7A 3JR4A 1CLEA 3OE7D 521PA 2PRIA 1BAPA 1E4EA 1PWYE 3B5EA 4X7BA 4HWSA 4TSRA 1W25A 3UK7A 4IO1A 2GCGA 4HWGA 1VFNA 2Z8XA 1KFCB 4Z0TA 2EYUA 3L0OA 4NHEA 3WWYA 4PO1A 4NMHA 4JP2A 5JEDA 2QORA 1MHPA 3F47A 1BXKA 3HVUA 4X93A 1UC4B 5EPEA 1OROA 2GLUA 2KS6A 4AJNA 4DBLE 2P5YA 3BIJA 2O1SA 3H5RA 3QXXA 1Q16A 3E58A 2QB5A 1QGUB 3MERA 3VNAA 1K6IA 4QM6A 1SO8A 5FUBA 4E07A 1M66A 2H5JA 3AFIA 3LDUA 2QG9A 3R0JA 4IDFA 3EIXA 2VDRB 1CQPA 2JCGA 3VH1A 4YA6A 2H1RA 1JEYA 2W70A 2X0FA 5KJ1A 1RYEA 5CT4A 3DMTA 1Z73A 1MAUA 4YCMA 4JLMA 4AZ0A 4LN1A 3ZGZA 2O0KA 3H1GA 3RC1A 3F98A 3TD6A 1BJTA 3DBHB 4H3SA 5E3JA 2EVWX 5TLSA 3BXGA 4HDCA 4U02A 2JY7A 1FFGA 1RZ3A 3AFMA 1ID1A 3TWLA 4N39A 5D3MB 5FUQA 1J23A 2CD7A 2WLTA 2PSSA 2BFBB 2NZVG 3HYTA 1LPSA 4YONB 3H5LA 1SUFA 1TCBA 2B9EA 4EG1A 3U7HB 3CF4A 2ZJ3A 1BS2A 1XEFA 5MGNA 2GJ9A 2MIIA 1ABFA 1OR8A 2IIVA 3N07A 4CEIA 1W36D 1THMA 1JYFA 3NEAA 1T9HA 4FEAA 5BWLA 2AD1A 4U7JA 3OPNA 2PYDA 1W85A 4TKUB 2KA6B 1OX4B 8LDHA 2VHJA 2XIJA 4NU8X 3GROA 3KB1A 2OBNA 3NIDB 1JYSA 2BTQB 3R4VA 1OGJA 4XQCA 4IIDA 2VNSA 3JQ6A 2BEUB 3IJPA 4RZUA 5FQNA 4KBYA 4WHMA 5B58C 1C1HA 4YR9A 3T5TA 3NW9A 4H3VA 4G5RA 3VR2D 4B71A 2I3DA 1RI4A 2F3QA 1PR4A 2X3YA 4DWVA 3GJ8A 3QEMA 4O02B 1AY0A 4FKBA 1GTMA 1S2IA 5HCNA 3AJ8A 1CG6A 4A92A 1A8SA 3E0QA 3VR0A 4PR0A 3GFRA 3UH0A 5DIFA 3V8NA 3WGHA 1YS7A 2Q5FA 3GELA 4S1PA 1AA9A 1F51E 3UMGA 1JILA 3ND7A 3UMSA 3H5AA 3HYLA 4YECA 1DQPA 1P2FA 2OK7A 5IULC 1EUCB 3EIOA 1H93A 4JT9A 4JHXA 3B12A 1T0UA 2I2XB 1V41E 1ZK1A 5JVDF 1DXQA 3NASA 3HB0A 1XFDA 2DKOA 4EVQA 2P35A 5FPYA 3CX3A 1MAVA 2ID7A 3KXDA 2MT9A 3DQQA 2R62A 2I2FA 3C0KA 2E6UX 3KU1A 3NUGA 3K9OA 1Z88A 2V03A 1KDVA 3UKJA 4OF4A 5CP8A 1JDPA 2Y05A 3THWB 2QZSA 1M10A 3ZUPA 4C6TA 3O8LA 4GZ3A 2RGCA 5HMLA 1PWZA 4C0QC 1UZAA 5ALVA 4BO2A 2DKLA 5CITA 5CDFE 3N39C 5T57A 2FPGA 4MIYA 3LE8A 4FQ8A 4ZJPA 1U9IC 4HBGA 4I19A 2GM4A 1PU2A 4PC2A 1D6MA 1U7HA 3WBFA 5J1TB 4PD2A 4PPGA 5LXTB 3OSUA 3ZZTA 1XVLA 4JN6B 3Q5EA 2RSLA 1D09A 2AMJA 2D7EA 4Y9RA 2IVFA 2WSBA 2J3DA 1GGNA 3SM9A 3UJAA 5A6SA 2Q41A 5BW4A 4CM9A 4XVQA 2NU9B 2FFHA 3SVTA 2JJQA 4N76A 1GCUA 3HFGA 3VR5D 4CKBB 3CUTA 2C4TA 2L09A 2AR7A 4IBDA 1B26A 1UK6A 4GM1A 3SHFA 3A6FA 2EYQA 3D64A 5JLJA 1G7SA 3WE7A 4UHHA 3T7RA 3IUQA 1XVTA 3O47A 5GJCA 1D6NA 2Y1LA 2A9RA 1N2EA 1QB8A 1EGVB 1A9PA 4WY2A 5EKXA 1RRFA 3I2HA 1NMZA 1G3RA 1SQFA 4RVNA 5KPZA 2ZAIA 2AQIA 1QGOA 1C4WA 2C3PA 2UUBM 1CCWA 5LIPA 3MUEA 1GL7A 3E9DA 2F1HA 1YZHA 2ZWAA 3EASA 2I29A 1SWWA 3CINA 1H2ZA 1VL8A 4DEVA 1VIYA 1MNQA 3IP5A 4UUMA 4AIRA 1W35A 2HA7A 5KOJB 4BJHB 1YQUA 4TV8F 3UJ8A 4OHVA 2GZ2A 5F1PA 5BT8A 5IN4A 1E2DA 1U2ZA 4ADSG 3WLRA 5EP4A 2V7QA 2F3UA 5F7ZA 2VS1A 5LD2C 1EZ4A 2YMLA 2WICA 1C50A 2ZR0A 3RJZA 4I1SA 3E46A 2RGNC 1GAEO 5MFPA 3HJTA 1NQWA 3JZIA 4G4IA 5ITWA 1V1JA 4QPZA 1HLPA 1JB9A 1OI3A 3U61B 1K7FB 3VRHA 2F8MA 2I87A 1JMVA 1ZUNB 4WD3A 4KAXA 2X8JB 4FFDA 3RSFA 3WZLA 4DWOA 1M1XB 4X66B 4LV6A 2VCEA 2RGHA 1XCPA 2WQZA 1DAKA 2G04A 1CJMA 1PLKA 4EYKA 6PFKA 1Z7EA 4IW3B 1RRMA 3IKVA 1ML3A 1W94A 4KIUA 3S2EA 5HM8A 4K9KA 2HDWA 4EG7A 1J8DA 1KOJA 4GX0A 4EAAA 3DQPA 2PXAA 2DPXA 2XB9A 2XTZA 4GKBA 2V7BA 4CKEB 1O97C 1JE1A 3CPSA 1K8YB 2LXNA 1U8YA 4JXZA 2KLHA 4I50B 5IAGA 4CL2A 1NX6A 3SQOA 1N2CB 4KLRA 2DAKA 2GYWA 4K3VA 1A9RA 1RKQA 4OGWA 1R4MA 1VKOA 2WOOA 4Q00A 4P86A 4YMGA 5KYNA 1Q3KA 2JCSA 1YE9A 2C4VA 3GU3A 2YW9A 3VU9B 3UG7A 3LIPA 3L1HA 2VQDA 5JS8A 3D81A 5AK4A 5K0NA 4NC6A 1NVBA 1S9HA 2DQKA 4GBJA 5GV8A 4JYAM 1OAKA 3W5CA 2YRFA 3MTGA 2HQSA 5DNVA 1I94M 5EMMA 1M8GA 1E1CB 2FEXA 4JI2M 4J1QA 1WJGA 2H31A 3KOMA 3TK1A 4DLYA 4XASA 3CZPA 1ZQ9A 3HRKA 5REQB 2FGJA 1CJVC 3UWKA 1L4BA 4XI9A 3GIDA 2X6TA 1KAEA 1HE8B 4LGYA 1E2FA 2WTBA 3Q72A 4QDTA 2Z8YM 2P6OA 1P1BA 3NIBA 3HJSA 1ZLYA 1DG3A 3M6LA 4HEQA 4G25A 5JZBA 5GONF 1XOIA 2XZFA 1L7MA 1HH4A 3F6SA 3BE6A 4NCBA 5JDIA 3CG4A 4I5GA 2I33A 2J6CA 3MT7A 3LUJA 4CI0B 1AS0A 3HNRA 3U6KA 2NU8A 3T9CA 3RSGA 2QL6A 3OTOB 3WL4A 2J3QA 1WUKS 5AVRA 4JKOA 5FFMA 1W49A 2VT3A 1ADGA 2F43B 1AU9A 3SKYA 2AV6A 1K5PA 3JQPA 3OKPA 2Y4OA 1P8AA 1QANA 4J9VA 3LZDA 1J8QA 1MCZA 5KQGA 1QUEA 3K1JA 1GR1A 1VGQA 2CFSA 1J9EA 1JZQA 2P75A 2Y1CA 3KTFA 2D0OB 4ESOA 4J0CA 4ZVUA 4IDNA 1NU8A 3ITKA 3I58A 2W5UA 3ETNA 2X0RA 4DCUA 2EFCB 1WKBA 1PJAA 1OXKB 3R3SA 3ZY5A 1M8KA 7MDHA 3OESA 3BILA 5HTKA 3FMFA 5HILA 4NCKA 4G26A 4D0NA 3C3YA 1KDYA 1THGA 3EGXA 3PPVA 2QY6A 2HLDA 2XUDA 5HQTA 2DR3A 4B3CA 3SHTA 2WAAA 3JSAA 2R46A 4NEHB 2HYDA 4WN3A 5E26A 1YS1X 4MYCA 1GTVA 2AH5A 1G4AE 3GFVA 1BX3A 2OPHA 2GH1A 1Y3HA 4RTRA 4RORA 3AESB 1K3XA 3T5MA 1P74A 2VZLA 4WPGA 1SHLA 1PQPA 3GFQA 4JQYA 3OFVA 2UZIR 4EQ6B 4F1WA 2Z43A 5SYAA 1EHIA 3PL5A 3U3DA 4UUPA 1DJPA 4EB8A 4QYWA 4CUZA 2YMQA 3GGOA 4PAOA 1PG2A 4QQNA 4R01A 3LWBA 4KQHA 2EU8A 5ALXA 1AE1A 3I83A 4ZI2A 3C3MA 2UZAA 4D4LA 4K8RB 2QVYX 3DONA 4HGRA 3STTA 1ZH4A 2JGMA 4O3MA 1WZEA 1ZGCA 1IZ0A 1W4ZA 1VE9A 1MIOB 2HSDA 4X45A 1KAQA 5FL3A 1UR5A 3PC4A 4RNAA 3C48A 2HNBA 3WLSA 3LGAA 3MCAA 4WUVA 4JJAA 5P8WA 2O07A 3WQRA 4O5OA 3CZ4A 3LHDA 3QJYA 4HN9A 2DWUA 1XTJA 2RJOA 3HSSA 1FDSA 5IK2D 3W05A 4ZVQA 3N0TA 4BMDA 5B3KA 4AP5A 2FEAA 3JYNA 1XC7A 4ZK2A 3W9YA 1WUHS 3Q8XA 2ZVPX 3STHA 4J1TA 4RKQA 1EUQA 3D4LA 2ZRDA 4J9UE 5CA0B 1W34A 3EHDA 3AR6A 1DFGA 4L50A 2G0NA 5G1PA 3LT0A 4TLEA 1N2IA 2XRFA 4KQMA 3H4VA 1BRMA 3KELA 3S7ZA 3WMGA 3J7BA 1D0MA 1KTVA 3RYIB 1ZUIA 1HT0A 5FYDA 3G9UA 1VSTA 2ZETA 4MA4A 1EDBA 2QYHA 3MINB 3R23A 4D74A 3SK0A 4RQUA 3PYLA 1AQIA 1OJ7A 3CH5A 2P8JA 4EHBA 2DLCX 3AF3A 3EYWA 2K6GA 3FYSA 4CM8B 1ZRMA 2FSFA 1D0IA 4EHLA 1D8AA 3QMVA 3I39X 2A1TR 2GNAA 3C2QA 4LFAM 5DLPA 4ZVTA 5IN5A 1H69A 3A3YA 5CNJA 4PZCA 4UUBA 2W2TA 2QAIA 3QX7A 2WEKA 4FP9A 4BX9A 2EL7A 1K2WA 3FPLA 2PHZA 2AN9A 2B0JA 3FNGA 3INNA 1I1QB 3GGJA 2REQA 5D6OA 3GMDA 1NM5C 3NX4A 4D0LB 4REQB 4EPVA 5KQLA 1X19A 1PUXA 4UREA 3OZRA 1E1RD 4M8IA 3CQ9A 5EFZA 4RIHA 3D3EA 2XVXA 1V4BA 1KIMA 3PGA1 3EZLA 2YZ2A 3FUUA 1ZXBA 3H1EA 3UB3A 2JJMA 1TCUA 4FGZA 1OV6A 2KDLA 2QR5A 1E1QA 4TMVA 5ITXA 1A2OA 1VG1A 2ZYHA 1U0NA 4JX8A 1U8FO 1ELOA 2WWVD 4U7FA 1CRZA 4NJEA 1P1KA 3QNUA 2NO7A 4MWCA 1J2RA 2ZUUA 4LOAA 1YDMA 1VPDA 3K09A 3K72B 4J4TA 2UV8A 4EY3A 4ANRA 4B1FA 5CDUA 3W4IA 2VWPA 3L18A 5DBOA 2QZPA 3EUFA 1Z15A 5IHXA 2XECA 3PUWA 3TQRA 2PE5A 2B21A 2L82A 1OPXA 4YC7A 2JW5A 5FOSA 1X1AA 4QICA 4Z4CA 5J4LA 5JJBA 2AJ8A 4DPKA 4Q3NA 1ZSYA 2PUJA 1EX1A 5DJ5A 3PGXA 4HZUB 4R1LA 1W59A 1YB1A 1VKRA 1NLMA 1F8YA 2I65A 4JJZA 4C78A 4MUMA 2C2MA 1L7VC 5A6VA 4BB5A 2HNAA 1RLIA 3DJFA 3QELB 5KI6A 5DM60 3M3DA 5TJHA 2OBFA 3SEZA 3UJHA 1C9DB 2QP3A 3WLNA 4XYGA 1RRVA 3EXHC 4YHHM 2GFQA 1RWNA 3V1MA 1IQRA 1MVLA 3K0FA 5TEVA 2JLXA 1XTVA 2J9YB 5K3FA 1UBMS 3SIXA 3U1VA 4YV0A 5DNWA 4Q1EA 5EIBD 3N8NA 1IQUA 1I3NA 2WU8A 1P61B 4V0NA 1NUQA 4CM7A 2YY6A 3L7KA 4HWOA 3ZLJA 4Y2YA 5H9VA 4LXQA 1M2FA 1AD2A 3K05A 2E4AA 2D7DA 4LJRA 5DTJA 1GRVA 3KQTA 1W44A 1O5OA 4I1RA 3IIEA 3H6GA 2LHGA 2PTGA 5LLTA 1BW9A 4AKTA 5B2ZA 2EFJA 1WCWA 3KJFA 1OXSC 3JD3A 5KC8A 2UXBB 3E1SA 1IL0A 2BOVA 3U19A 4QNRA 4L6V6 4H27A 4Z1MA 2HB6A 2OQVA 2P69A 4CLXA 4CEHB 3R7AA 1G5PA 4IVNA 3KKLA 4LFCM 4U9IS 3AKYA 4UU1A 3GT3A 2AUMA 4ZT3A 4BECA 1H0SA 3GAFA 3UBTA 4LEIA 3GVCA 2ZB4A 3N2IA 3UIEA 5DM70 5IJ0B 2VJQA 1GSOA 4E32A 5KQSA 4W5QA 2IYRA 2CP8A 3N75A 2NAFA 1IMJA 5CJJA 2G88A 4LE0A 3SHOA 5HJ7A 4D3DA 2GYUA 3X1KA 1Z5VA 1FMLA 2NYUA 2QVZX 1R9MA 2WAMA 4P0TA 3G23A 4RADA 4JI7M 3PHLA 4POAA 3L49A 4RAOA 3W2EA 4JX9A 3HZHA 4CZ2A 3O3NB 2H48A 1T8SA 4B7XA 1K3WA 3S5UA 4JT8A 5JHGB 5JVDB 5AI6A 1GFWA 1QVVA 3RTEA 4E7OA 3MJHA 3AUXA 4JVOA 4P7KA 4CMAA 1G3QA 4LRUA 4S1OA 3IS3A 2EKQA 3GVHA 4L75A 1AKQA 4DV1M 2H92A 1M9NA 1W4CA 1XWIA 1QIDA 5E4TA 1RJFA 3K9HA 3GGPA 4DR3M 3QI2A 3QVWA 1IBLB 2BEVB 4AECA 3HXKA 1WSDA 1TQ6A 5TY0A 3V46A 5J1SB 4NDNE 2GSWA 3RS4A 1X8KA 2X4LA 4KVFA 1WP9A 4MH0E 4DWJA 2SCUB 1XLUA 4Y30A 5FULA 1XPRA 4H0FA 2JCXA 3GWZA 2WVHA 1PGPA 4J29A 1I0IA 3COPA 1T5BA 2O0HA 2Q6IA 2QX4A 3KIPA 5FTJA 2DKNA 2YHSA 4HDSA 2BBTA 2Z6VA 1PJ3A 2QJWA 3AHFA 4DUYB 3E15A 1U8UA 4YN3A 2JAXA 3WY9A 5AJZA 3FKSA 1U0BB 1F2TB 1I7SB 5GMOA 5B3AA 1ZISA 1KYVA 2PJZA 5AT1A 1V1RA 2PL1A 3AFOA 4UOEA 3ENQA 1AUVA 1T8YA 2RD2A 4BEJA 4Y2UA 1BVUA 1R00A 1P0MA 1B8VA 3R3YA 2I3ZA 3ZJ4A 5IT4A 3KXPA 3FTNA 2FXVA 1NU6A 1TZCA 1DJMA 3HKBA 2QM7A 3DAGA 3R7FA 2NYAA 1EK0A 2PJDA 3SYTA 3WNZA 2X5OA 3O4RA 3IP9A 2H1FA 4R68A 3WQQA 3V1NA 3AB8A 1C30B 2HY7A 1B23P 1NVFA 3EPPA 1UDXA 1U7PA 4QIHA 1RLOA 4QC2A 1TAQA 3P9SA 3JW8A 1VTKA 2I03A 2IZZA 3PDWA 2QTRA 1Q7CA 3PXXA 2H17A 3NDBB 2WKWA 3U6PA 1XZDA 2PZLA 4GX5A 4LRQA 5HZGA 2D1TA 1PR3A 2DF8A 4B3JA 5KQPA 4OJNA 1A77A 3NTQA 1C3OA 2IEZA 4L4SA 2O2JA 1XX6A 3ZU5A 1RWOA 3FNIA 3BWXA 5FJJA 1G71A 2FX3A 5FNVB 3KUCA 2GPBA 3L27A 4Q9DA 1HE3A 3NBUA 1P1IA 3X2EA 3T94A 4GBGA 5EJGA 1WCIB 3T5DA 1RHJA 2VDQB 2YXBA 2YVQA 1I3LA 4EGJA 1IWOA 4N5IX 3KVVA 3DEZA 4AFNA 4DR1B 3AKEA 1NVAA 1IC6A 4TXLA 3TM4A 3OJWA 5LCXA 4D1YA 5JU6A 2VWHA 2QY9A 3CLUC 3I62A 4ID3A 4ZOQI 1Q1NA 1UQTA 1XMQB 5C5DA 2FMXA 2AOTA 2X5KO 4LZPA 1TZ2A 1GVNA 3VO9A 5I7OA 3OHMA 4DR7B 4B4UA 3RVRA 2ZM6M 3BSWA 4D9GA 1G8HA 5LNK1 3KSAC 3X0DA 1UMDB 4C29A 4A0HA 5MN6A 5HK8A 3IEUA 4RHUA 2CJFA 1QR2A 3I34X 4EJ6A 1U31A 3UB2A 5EAIA 1Z9BA 5LOVF 2V6ZM 3JYPA 1J33A 1RLUA 1VM6A 4YLEA 5AVWA 2QOEA 1U6IA 3L2OB 4NNJA 1MO2A 1M2EA 1Z38A 4DF3A 1J39A 3N9IA 3UO8B 1P7WA 4LV8B 3D0KA 5H68A 3IAEA 3N8GA 4UXIA 1L2TA 5FEUA 2VYCA 5CLGA 1QHGA