3R9XB

Crystal structure of era in complex with mggdpnp, nucleotides 1506-1542 of 16s ribosomal rna, and ksga
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
235
structure length
235
Chain Sequence
b'LVSEGVLKKIAEELNIEEGNTVVEVGGGTGNLTKVLLQHPLKKLYVIELDREMVENLKSIGDERLEVINEDASKFPFCSLGKELKVVGNLPYNVASLIIENTVYNKDCVPLAVFMVQKEVAEKLQGKKDTGWLSVFVRTFYDVNYVMTVPPRFFVPPPKVQSAVIKLVKNEKFPVKDLKNYKKFLTKIFQNRRKVLRKKIPEELLKEAGINPDARVEQLSLEDFFKLYRLIEDSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase Era
publication title The Era GTPase recognizes the GAUCACCUCC sequence and binds helix 45 near the 3' end of 16S rRNA.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/transferase/rna
total genus 65
structure length 235
sequence length 235
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2011-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3r9xB02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3r9xB01
3CBGA 2NXEA 1Z3CA 5EKUA 1IXKA 1IY9A 2VDUE 1FJXA 1ZKDA 1N2XA 3LKZA 4KIFA 4M37A 1DUSA 1F38A 1VLMA 3AXTA 1YFLA 3RIEA 1G55A 4CXMA 5GM2A 4QPPA 2ZZNA 1VP3A 3HA3A 2JJQA 4X63A 5CM2Z 5EHIA 1X19A 3UJBA 3IYLW 4RTMA 2AOTA 2ZSUA 3R9XB 2AN4A 5ERGB 5FWAA 2VDVE 1VL5A 3GNLA 3EEYA 3REOA 1QYRA 2AOTB 4QPNA 5DLYA 5E1DA 3V97A 2FCAA 2GH1A 4OX9Y 5LQUA 2Y1WA 1G6Q1 2ZBQA 3C6KA 3HCBA 2UYHA 4KRGA 3OCJA 3GO4A 3MTIA 2ESRA 2PWPA 3EGEA 4C03A 5K0BA 3FTCA 3EMBA 1TPYA 3VC2A 4WVLA 4CTKA 2PV0A 2PVCA 8MHTA 3CCFA 4DZRA 2GS9A 2IDJA 2ONYA 3HCDA 2P1DA 1L3BA 4PGHA 1HMYA 1NKVA 2N47A 2BR5A 2ZVJA 2IBTA 1XCJA 5HFJA 5IKMA 1XXLA 5DM0A 2EJUA 4BY9E 1NBHA 4H0NA 1VIDA 4FGZA 3VSEA 4EVIA 2ZCJA 10MHA 4PYLA 2UYQA 4EQZA 2IP2A 3DMGA 2YTZA 4P7KA 3E05A 4RTLA 3HA5A 2IGTA 1QZZA 3FPHA 3OU7A 3E7PA 3TPZA 2CMGA 2YUIA 3MCZA 2EJTA 2ZFUA 3BZBA 5DTQA 2ZWAA 4HRAA 2P8JA 5CD1A 1ZQ9A 2ZIFA 1G8SA 4ATNA 1VE3A 2GPYA 3LSTA 5FULA 2F8LA 4EK9A 1YZ3A 1D2CA 3FRHA 4M36A 3TKYA 2AS0A 3P2IA 5GWXA 3GWZA 3UA3A 1AV6A 3G2MA 4CKCA 5KS2A 5EQJB 3KR2A 1KYWA 1WZNA 4PYMA 4QDJA 1RJFA 2XVAA 1RJDA 3H2BA 2AVDA 4ER6A 5K8VA 1IM8A 5C9ZA 1JG4A 3NTVA 5K03A 4PCAA 1WXXA 3KPVA 3DLCA 1UIRA 3PS9A 5KVAA 1RI4A 2Z6QA 2IH2A 5DTRA 7MHTA 4XCXA 3EVEA 2HWKA 2XYQA 2WK1A 3BUSA 3HVJA 4X60A 1QAQA 4GOMD 3SX0A 3GU3A 2O06A 4P7GA 2R6ZA 4M38A 5P8WA 3ER8A 1JG2A 3I9FA 3O7WA 4L7VA 2ERCA 2VS1A 5K0EA 4ER0A 2OZVA 3CC8A 4AZVA 2PT6A 1HNNA 2P35A 3M33A 1G38A 1X1AA 2FK8A 5G02A 3KQSA 4GOOD 3KQPA 5E1OA 4C05A 3TLJA 4OBXA 3I53A 5D1HA 5MHTA 2FRXA 3DXZA 2P3QA 3MERA 1JQEA 4KVZA 4FSXA 5HIIA 4AZWA 5BP7A 1FP2A 4V0RA 5CVEA 2IFTA 4DMGA 5DXJA 4LG1A 1M6EX 1SUSA 2C7OA 3AY0A 4C06A 5KQSA 4EMSA 3JWGA 1L3IA 4YMGA 4GC5A 3C3YA 2PX8A 3SSMA 1FBNA 3UFBA 1JSZA 1JR4A 2BM9A 5HIJA 3DXYA 4YUXA 4GC9A 1MHTA 5JUWA 3A4TA 3EVCA 1BOOA 4QTTB 3IHTA 2AN5A 1O9GA 5E2BA 1EQAA 5K0GA 5FQNA 1Q0SA 3SSOA 3PTAA 2G70A 2B2CA 1JQDA 4CKEA 1TW2A 5FCDA 5M5BA 2I9KA 3EEOA 3FPJA 1SG9A 5DM2A 5EMJA 1ZGJA 2PJDA 2NP6A 1EJ0A 4RVDA 2HNKA 2YXLA 3DR5A 3P9KA 4OA5A 4C4AA 3FUTA 3SMQA 1XJ5A 3HCFA 3ELUA 5CVDA 2E5WA 1YUBA 3R6TA 4ZTBA 3DP7A 4YV2A 4XUCA 2OO3A 3FUVA 1KXZA 1M6YA 5DM1A 1INLA 1ZHFA 3DMFA 1JQ3A 2YXDA 3FRIA 3TQSA 2P40A 3B89A 5LQRA 4MQ4A 2JH9A 1UFKA 3JWHA 3C6MA 2PX5A 3P2EA 4C07A 3HNRA 4PYIA 4KWCA 1XDZA 4GEKA 3T7TA 1JG1A 3NWEA 5CUQA 2C7QA 3DLIA 2ORED 2UYOA 4E32A 5E9QA 2ZIEA 2ZWVA 2Q41A 4RYLA 5E8JA 2ZULA 3S68A 4EKGA 4ER5A 3B3JA 5BW5A 3PT9A 4GBED 3M4XA 4X1OA 3FUWA 3LECA 3MGGA 4GF5A 3MTEA 3OPNA 4ISCA 5B1SA 2G72A 2BR3A 3HM2A 3EVGA 2BZGA 2CKDA 3ORHA 2DPMA 2QRVA 1M0EA 1EIZA 2HV9A 3F4KA 4O29A 3G2PA 2QRVB 3LDGA 4R8RA 4U7TB 1R00A 3G2QA 4RX1A 5CVJA 5EEGA 4CTJA 4PGGA 3WSTA 4E30A 5JR3A 2HR1A 4C04A 4PIMA 1U2ZA 3LGAA 4FZVA 1R8XA 2PWYA 5F2OA 3OZTA 1XDUA 4PNEA 3M6VA 4RTRA 3TOSA 1KPGA 3UA4A 2NYUA 3M6UA 4QVKA 4OA8A 1JG3A 5ICEA 3M70A 5FA8A 4FT2A 4LWOA 3GRVA 3KPUA 3LDUA 3FPFA 4KDRA 4E31A 3IV6A 3CKKA 1NT2A 3HP7A 3CGGA 4DKJA 3A27A 3B3FA 5LR6A 4PINA 5CIYA 3B5IA 4CWAA 3D2LA 2FYTA 1N7JA 4UOEA 1P91A 3A7DA 4Y2HA 4AZSA 1WG8A 2P3OA 2QE6A 3HCAA 5HOQA 2NP7A 3O4FA 4POOA 2CWWA 2ZZKA 4KDCA 4BLUA 2ZIGA 1D2HA 4NECA 3SM3A 1O9HA 2C7RA 2FK7A 3EVBA 2P3LA 3OZSA 3BGDA 2IH4A 3MAGA 3LX6A 2UYCA 3EPPA 4IV8A 5DSXA 3BGIA 3KPJA 4XUDA 3SSNA 2ZBPA 3M6WA 4V0QA 3UJ8A 5HZMA 4F86A 5ICCA 2C7PA 2EFJA 4GUAA 4LECA 4ER3A 1R74A 4DA4A 2V7EA 2OYRA 3G5LA 3KQTA 4HGYA 5BW4A 1O54A 4YUVA 5LQAA 5EMMA 5GINE 3GGDA 1NV8A 3MHTA 3KQVA 3CJTA 1QAMA 3SGLA 3P71T 1XTPA 5EKXA 3T7SA 2PBFA 4RTNA 3E23A 1X1BA 4HG2A 5DM4A 4A6DA 3AWIA 1WS6A 3VYWA 3G89A 4B17A 3RODA 4E33A 3UJ9A 5E1MA 1B42A 5E9WA 5EEHA 2AOXA 3GDHA 2G1PA 5GIOE 4RTKA 3L8DA 2VDWA 3ELYA 4FS8A 2PXAA 3GJYA 3EGIA 5DWQA 4GQBA 4RWZA 2AOWA 1FPQA 3NVMB 2OKCA 2PKWA 3ELWA 3PFGA 5DRYA 1KP9A 3FZGA 4P58A 3QV2A 4HC4A 4DF3A 3G7UA 3GRZA 4RVHA 1FP1D 5KYGA 5GOZA 3UWPA 1KPIA 3BWCA 3K6RA 2G71A 3KQOA 3LBFA 1R6AA 2AZTA 4E2WA 2ADMA 3EVAA 3LPMA 3QOWA 1X1DA 2PXXA 3G88A 3NW9A 4K6MA 4PONA 3TR6A 1VPTA 3DULA 2YX1A 5E1BA 3GCZA 3P9NA 4AUKA 3LCCA 5K01A 5EIWA 2OPBA 1KYZA 3A26A 4FR0A 4QQKA 3PB3A 1OR8A 3LDFA 5F2KA 3BKWA 5FTWA 3VC1A 3NWBA 3UJ7A 2G8NA 2QYOA 1QAOA 1F3LA 2PT9A 3PX2A 4QVGA 2K4MA 3IEIA 2ZW9A 3I5UA 3KPYA 3P8ZA 4E2ZA 1P1BA 2B9EA 3FUXA 1I9GA 5DPMA 5K0NA 1R8YA 3P2KA 1V39A 1BKYA 5LQJA 3NMUF 3R3HA 3TKAA 2GAFA 2FHPA 4Z2YA 4PYQA 2B3TA 4HSGA 4RVFA 3KKZA 3KQYA 3SXJA 1YFJA 1L9KA 1RI1A 4DCMA 4GOLD 3UJCA 4E2XA 2PX4A 1NW3A 1PRYA 1SUIA 3HVKA 2VZ9A 3LBYA 5T67A 2AOVA 2IBSA 4F84A 5LQCA 1RI2A 4OQDA 4XUEA 3KPWA 5HILA 2JH8A 2YR0A 3KQQA 2PX2A 3SVZA 1VBFA 1VQ1A 5EMKA 2IH5A 4MHTA 3G8AA 5HEKA 4GOND 1QANA 1ORIA 3HVIA 9MHTA 3C3PA 5HIMA 5FWDA 4YMHA 1Q0TA 2JHCA 4U7PB 5K0LA 5EMLA 3OFJA 3U81A 4RTPA 1UWVA 2O07A 2ZLBA 3CVOA 3SR4A 2YQZA 4KIGA 3KR9A 5FADA 3THSA 5LSAA 2EG5A 2XVMA 2HTEA 2ZBRA 3AXSA 3LL7A 5ICGA 4HTFA 5K05A 4MTLA 5K0FA 3RW9A 1BC5A 3OU2A 5KQRA 1NW5A 1NW6A 4HTFB 3G2OA 3R24A 4PYNA 1G60A 2GA9A 3K0BA 2GLUA 3THRA 3GRUA 1D2GA 3G8BA 3KQWA 4X61A 3FUUA 4IWNA 5EPEA 2OY0A 3CJRA 3FTEA 4G56A 4LWPA 4AZTA 2B78A 2PSSA 3LCUA 2NXNA 1RJEA 3ANXA 4FT4A 5DSTA 5GIPE 1H1DA 3GRRA 2BR4A 3DTNA 3P9CA 2JG3A 3PVCA 1BHJA 2OXTA 2UZ4A 2P7IA 3HTXA 3OU6A 1SKMA 5ICFA 2B25A 3OFKA 2VP3A 1AQIA 5H02A 5CVUA 4YUYA 3UBTA 5E2AA 3ID6C 3QOXA 5EVJA 3HVHA 1PJZA 3G5TA 2IPXA 1L1EA 3FTDA 3KQMA 5EG5A 4PYJA 1YF3A 3FTFA 1ZGAA 3PLAE 2WA1A 3FPEA 3P9IA 4ER7A 2FPOA 1JTFA 4AX8A 2AN3A 1YB2A 2P7HA 3MCTA 2ZZMA 3BT7A 4EKIA 3B3GA 2OB2A 3DUWA 4PIPA 3JWIA 1MJFA 3A25A 2IIPA 4R6XA 1JTEA 5T6BA 1L3CA 2GB4A 4P7FA 3UJDA 4BP1A 1P1CA 4WXHA 3AJDA 1NV9A 3UZUA 2KW5A 3KR1A 4PYKA 1I1NA 4R8SA 5DX1A 5BXYA 3KU1A 1NE2A 1NW7A 1X1CA 1EAMA 2O05A 4MWZA 2QY6A 1DCTA 2AR0A 2PGXA 3LKDA 1Y8CA 3TMAA 2NNWB 3R0QA 1NBIA 3HEMA 2XYVA 3NDJA 3ERCA 4M7RA 2A14A 2I7CA 5U4XA 4OBWA 3LCVB 4QQNA 3JWJA 4BLVA 1EJ6A 5FHQA 3FPGA 4E70A 3EVFA 2PLWA 4DCGA 1RI3A 4IV0A 2H11A 3E8SA 3T7RA 1XDSA 3P97A 4YV1A 5DTMA 4YUZA 1ORHA 3B7PA 2HMYB 4HGZA 1KIAA 3C0KA 3UJAA 2H1RA 3DMHA 4IKPA 2JHPA 5T64A 2DULA 1NW8A 2WA2A 4RTJA 3M6XA 3BKXA 5FA5A 1I4WA 3EGVA 3OE5A 4QTUB 1KHHA 3DOUA 2O0LA 2ONZA 3Q7EA 3NDIA 3PFHA 3EMDA 5C0OE 3TM4A 2XBMA 4JXJA 2ZTHA 3NVKI 4E2YA 3HCEA 1WY7A 3Q87B 2NXCA 3LHDA 2YVLA 2OB1A 5EC8A 5EOVA 2PY6A 3BWMA 4CKBA 1YZHA 1N7IA 4DM3A 4RTOA 3KHKA 1TW3A 1AQJA 2H00A 4QDKA 1P39A 4P7JA 2BM8A 1RJGA 5IH3A 3DXXA 1SVUA 4FSDA 2NXJA 5EZSA 4X41A 2O57A 2IDKA 1KR5A 3PX3A 3UJ6A 2PXCA 5DXAA 3KR0A 3V8VA 3I58A 1ZG3A 2EX4A 4RTQA 4HH4A 4OQEA 5EGSA 5F2NA 3T0IA 2CL5A 4A6EA 5GM1A 3EVZA 3MB5A 2P41A 4PYOA 5HIKA 3NJRA 1AF7A 4RV9A 2XYRA 3OE4A 4PWYA 5LQNA 5FHRA 2Z6UA 3GRYA 1G8AA 2QM3A 3CJQA 3MQ2A 4R05A 5CVVA 4BLWA 1XCLA 3TFWA 3I64A 1EG2A 2AVNA 2Y1XA 5C1IA 2YXEA 4C08A 1DL5A 2JHAA 2I62A 1SQGA 1RI5A 3FYCA 3FYDA 2R3SA 5FUBA 4YV0A 4MIKA 3ELDA 4F85A 3OZRA 3ER9A 2AOUA 4R6WA 2V74B 5DRTA 5E8RA 5K09A 4RVGA 5LQKA 3BXOA 2AOUB 5GP1A 5EZQA 5CCBA 3HA7A 2BH2A 3A7EA 4RSRA 1R18A 3DH0A 1SQFA 3ME5A 4Y30A 3EVDA 2Z6AA 4DQ0A 3BWYA 5CCXA 5EHGA 1JSXA 1XVAA 5DT2A 1KPHA 3HCCA 5D1NA 1WXWA 3GIWA 3GXOA 3TM5A 5E9JA 3TRKA 1T43A 3X0DA 4YUWA 5DX0A 5K0CA 3O31A 5FQOA 4RTSA 2CMHA 4FP9A 3BWBA 4BP3A 5DX8A 2OBFA 4PCLA 4KW7A 5EIFA 2I6GA 2LD4A 3BGVA 5K0JA 1VP9A
chains in the Genus database with same CATH superfamily
2XUZA 3PKJA 3GVCA 2IKQA 2ZTUA 2QOEA 3W2EA 4NESA 1XAHA 1ODIA 4S1TA 1YOVB 4DLUA 1SIUA 4UEKA 4B71A 3C6QA 1EEXB 2PVCA 2J7KA 4QGHA 3RUAA 5FXMA 5F9FA 3VJRA 1VYHA 4S0XA 5DWDA 3HA5A 3FPHA 1JH9A 1H05A 1R0ZA 5DV9A 3ZX5A 1BD4A 1B8OA 3PZBA 1MX5A 2M6KA 2VRCD 1Z13A 5COAA 2IHBA 2ZIAA 1K89A 1KI6B 3K0AA 5G1OA 2R66A 4KTVE 3D5TA 4P7GA 5P8WA 4IBCA 4XX0B 1G71A 1JWLA 4IWYA 4FIDA 1XJCA 3KZKA 2QR3A 1FDTA 3UMFA 1NN1A 3H1AA 5ICSA 1NLMA 3U6MA 1UPFA 2FWJA 1Q0ZA 1BRMA 3A1NA 1A95A 1Q0UA 1MF7A 3TOZA 3KC2A 3V2IA 2WM9B 2ZUSA 3FHTA 3RYTC 1AJEA 1UK6A 4N0QA 3MAAC 4XUCA 4TRNA 1C9JA 1ADBA 2R7AA 3U4MA 1TVMA 3VR1A 4N01A 4GF5A 3EY9A 1BFDA 2ACEA 1PK9A 3BIFA 4RNCA 4JYPA 4NSOB 4AY3A 1R00A 5FOUA 4L5CA 1EDEA 5MN5A 1CEEA 16PKA 4RO0A 1LX7A 5J2UA 3PGMA 5KCZA 4UOEA 1WV0A 2IYAA 1SXQA 2BDTA 2P3LA 4TM7A 4B6EA 2FKNA 1M75A 3MWEA 1C0EA 3WLLA 3PKZA 4ZYYA 3QVKA 1Z4NA 3EH2A 4Q21A 1FXWA 2ZIXA 2ABWA 3H4VA 2QPLA 4QUAA 3RODA 1Y82A 4FHCA 3ESRA 2Y2VA 4P38A 4QGBA 2VSXA 4GQBA 3LNCA 5JY6A 4F5EA 5DEOA 1UEIA 5I4KA 1Z5OA 4GKJB 3QA9A 3RIXA 1FK8A 4NBUA 1RQ7A 4ADSG 3RT7A 2R1TB 5HCNA 5FTWA 1VMEA 1O6BA 4MR8B 4KWHA 4IHJB 2H4FA 2C2WA 4CDMA 3ZQ4A 2QR2A 4UUMA 2DPGA 1C7FA 3TLCA 1B2LA 3ESDA 4E2XA 1Y81A 4CIXA 3S81A 1ZWLA 1RI2A 1M5UA 4OGGA 1Q14A 5JZMA 3RFTA 3TZHA 2PRSA 1BC5A 4EQ6A 3HXMA 1ZNWA 2I87A 3THGA 4QFMA 4UU7A 3ZHSA 1E99A 3A4MA 3ETCA 1RWNA 3QFHA 3VDNB 3CLHA 2VDBB 3QYPA 3E21A 2PMDA 4OD0A 4NWIA 5JPDA 1D0SA 1NVTA 3CNNA 5F4BA 1BHO1 3DD5A 1TX4B 2OB2A 3QVSA 4RPIA 5TS3A 1TO6A 4KQIA 4N47A 1C3JA 5DN6D 1DRKA 3UV7A 5GGXA 3VVBA 4KOEC 4C5BA 3DOIA 1AUAA 2CJYA 4MAAA 1Y5NA 3AX6A 3IMFA 5KSOA 2JHPA 4TWRA 4AJ2A 2UU9B 2BDUA 1H6CA 3DCYA 3USZA 2R4TA 2CVQA 2PZ8A 5D3QA 2WTXA 4XPIA 4NZZA 1ANKA 4ZFNA 4FGKA 4BBPA 1YI1A 2O52A 2V3CC 5J58A 1FLNA 4MI3A 3HNOA 1GZUA 1JJVA 2RKWA 4CM8B 1QDLB 2XCRB 1DBRA 3ND6A 5TSDA 5BUZA 5KYKA 2VXOA 4A0FA 3DDHA 3B6ZA 4GZ3A 1DL5A 4MH0E 4MIKA 2FR8A 1OH5A 1J2UA 1ESMA 4KHZA 4WESB 1K92A 2IHJA 2XPCA 1JDUA 1K4KA 1DC5A 1Z8HA 3LOQA 1MB0A 1ZMBA 2WLTA 5CEEA 4KN9S 4QICA 1C8VB 1FSZA 1YIOA 3PNSA 4UTVA 2VIIA 3CZ9A 2NSDA 4QXRA 1KNXA 2FEXA 4R69A 2QTTA 1GJSA 3SOZA 2ZPTX 3LX8A 4DGSA 4K9OA 2QNJA 2ONYA 3A6FA 4J4HA 1N2OA 2XQGA 1E9EA 3IUNA 4BEBA 3FFWA 1I1QB 1KA9H 2AI2A 2PUCA 1GTSA 1ZMVA 1YFKA 1W5EA 2H08A 2WE7A 1Z8FA 3G2HA 5EIOA 2V4UA 4ND1A 3K0AB 3KZMA 1ZD3A 4AS1A 1UBMS 3QHAA 1WUYA 3G9UA 1ZI8A 4M21A 2EQ5A 4TXMA 1X7HA 5A4IS 5BSHA 4QLAA 3EXIA 1KZGB 1WBBA 2WOOA 2I5PO 4KPUA 2XLBA 3UV6A 4I55B 5FQNA 5JCOA 2R6DA 1JDVA 2I9KA 3LQFA 2YN4A 1ZM7A 3EF0A 4MYTA 4HH0A 2D7DA 1INLA 1RRVA 3H18A 2V6BA 1YQTA 2EJWA 3IDOA 2PQ2A 2JC3A 1ZD5A 4RAOA 2COKA 4V3BA 4FWDA 3AVYA 3FZEA 1AS0A 3LX5A 4C4RA 1Z0AA 2UUCB 2EBHX 3G2QA 5J1SB 3BH7A 1PS8A 3BORA 2V7XA 4ZK6A 1MB3A 3C1OA 3SDBA 4W5QA 4TPKA 3ESYA 3RSOA 2F1OA 1Q50A 3WMFA 2LNHC 3NLLA 2W4QA 3BRWD 3MWEB 1E9AA 1H2ZA 3O8OA 4JI7M 3TQTA 5C8XA 1HDIA 2NTJA 2C5RA 1KZ7B 2VHQA 3QVGA 3E23A 4EHNA 3TQFA 4P84A 4TZTA 4IJWA 4MUBA 3S0JA 3TD9A 4Z49A 4YQYA 4PHHA 1CIJA 3U7HB 3UMGA 4TLBA 5TLSA 5A4DA 2R87A 4P58A 1VRVA 4MWTA 1C4KA 3LBFA 1GT6A 1BE6A 2UYGA 2ONCA 3HYSA 3B9QA 1G17A 3IOCA 5ELMA 2WTNA 4LHYA 2IZ0A 2R1UA 1I2MA 3GLIA 2W7TA 2G4VA 3H9BA 4US2R 1HE1C 4O2BF 3ZVNA 2V59A 3FJYA 3WQHA 4DJFC 3JYHA 3PTLA 3WWZA 1EM8A 4LJ7A 3ZLUA 4ZKDA 4EQ6B 4PZ9A 4Z6YA 4P80A 4BP8A 3WICA 4EELA 1NDHA 4ZAZA 4IIEA 2XFTA 2BTEA 4D25A 2AJ8A 1PGOA 2AX3A 1SU8A 5JXHA 3V8BA 4QG7A 1DKMA 3AJDA 4L5IA 4JR0A 1ZONA 4ZOAA 3VMMA 4P4SA 2AE2A 1ACLA 1R0YA 1G7SA 1N78A 1LBTA 3T7RA 2NU9B 4NICA 3NBIA 1ISHA 4QTUB 1DBQA 3QVJA 1KY3A 1TEVA 3WRYC 1O03A 4XPIB 3NUZA 4G0NA 4OQMA 1U6KA 2H8KA 1YZHA 4NBNA 1GG2A 3LUCA 1PZNA 3TTWA 1L7XA 2X5NA 1VJ0A 1JN0A 1IDOA 1Q57A 4HPWA 3HZRA 5LLDA 2IEAA 3OQ1A 2YFQA 1MGPA 2GJKA 1U4OA 5EPUA 3JW8A 1HT3A 2AEMA 2LGJA 3R3VA 2HMWA 3H7IA 4KXUA 4TLMB 3DB2A 2WPNA 4C87A 2VRCA 3N58A 3OURA 2PUDA 1KC3A 1QRAA 2F8SA 2QSYA 5EHZA 4UPVA 3ADCA 4M37A 1LFDB 1BCRA 4HNRA 4L6AA 4X63A 4YJ3A 4UATA 3SXUA 1CY4A 3R9XB 2EWVA 4B6OA 1L5HB 2VF2A 4GH9A 3LA8A 1N77A 3V8RA 3KDPA 4ZVTA 3F5SA 3ICPA 5DYYA 2OBXA 4TMVA 1N2CE 1NQUA 3KVNA 1CUAA 4L4RA 3IUJA 3IVXA 3IP9A 2DY0A 1EK5A 2BFFA 2PJRA 2O2XA 3LIPA 3I05A 2CZQA 5ICMA 3SJCA 3UA3A 2HWJA 2FTKE 2C4MA 4LNAA 4B3HA 5EL0A 4P2BA 4HDNB 4O8ZA 2O8FA 4KXFB 1L5LA 1DX4A 1E1KA 2BIFA 1ZK4A 4KVZA 1SUDA 5A6VA 2HHCA 4JA2A 1Z62A 3WXMA 3TD2A 4LYYA 1EHCA 4KXYA 4KITB 4KPUB 2H5EA 2XB2A 4WOPA 1KMCA 3EH1A 5FWXB 4FR2A 5BW6B 4WZBA 2Q5EA 2IVZA 4RGQA 5F5XA 1AGNA 2YXDA 4BNIA 2L82A 2QD2A 3NWEA 4PPQA 3FD8A 3PNQA 5AM0A 4DWWA 2JJ2D 2DC1A 1OBHA 3BM5A 3NAGA 3B78A 3O9ZA 4K5QA 3PV0A 3ZDDA 2ZSKA 1JG3A 2IU3A 3PC6A 4JJFA 5CPFA 4HDMA 3KZOA 1YASA 3NDBB 4ZQFA 5CLJA 4ZZIA 1LWNA 1P9LA 3PDJA 3AIKA 2ZJ3A 1DEHA 3CF6R 3X1XA 3HYRA 3EQZA 1GFSA 4J2HA 4ITRC 1CZLA 2FWNA 3F73A 4PDIA 4IR7A 3QVGB 4I4NA 3QRWA 4B85A 1EWRA 2BGLA 4G4SP 2A5GA 4ZGGA 3EOZA 1G1AA 2Q3MA 3G7UA 3M6IA 4NV0A 2PZJA 1JHDA 4KC0A 1JLMA 3LRPA 1S2LA 4G9BA 3L8MA 4R2JA 1LDMA 2PXXA 1ESEA 2ZYUX 3OZCA 1WX1A 3F9IA 4RD3A 4IHJF 2J33A 3GNQA 3GLIB 1H2AS 1ONBA 4XB6B 1KS9A 5DN6A 1Z15A 2PYZA 3NONA 1UFZA 1CJBA 3KWMA 3N70A 2J1LA 2FFQA 4TRRA 5KX5A 5CP8A 2QM8A 4C89A 1EM8B 3CVVA 2H4XA 4F4JA 2IOQA 3F6BX 4WVFA 2H31A 2F6RA 4ZV7A 5LM3A 3ZI7A 2C2BA 1MG0A 1AXRA 3S44A 5LPNA 2W8ZA 3H0EA 5A9RA 2EL9A 1PJZA 2FUCA 1IEVA 3I3SR 4EB6A 6YASA 4V3CA 1J25A 4HAZA 4PIPA 3JWIA 4BP1A 4MQUA 3BHJA 5A3SA 2W6QA 3KR1A 2KW5A 1XZIA 5DHUA 6LDHA 2O05A 5KZMB 2C8VA 5BURA 2C4TA 1WNTA 3LKDA 1BHQ1 4P4SB 721PA 2D0OB 1FMJA 1DAEA 2DJ5A 3D6NB 2DULA 2R48A 4HPXB 5A3VA 4JXJA 3W2GA 2OCYC 2Z7JA 1RABA 3B2QA 3TJRA 4GXNA 5DTJA 1WSBA 1HR0B 4ZVNA 4KLNA 1BQ4A 1F5SA 4B2IA 2ZT8A 5ALWA 5C53B 1R4MA 2K9DA 1JLHA 4PLHA 4BLWA 1EVJA 3QWLA 3Q1KA 1GFWA 2ID9A 1P5FA 4QL3A 2JBAA 3QY0A 4RF4A 2HU8A 2HH9A 4NBSA 3C87A 3LBAA 3QITA 5KWSA 4DJEC 2LHGA 4GSYA 1OWLA 2X6RA 3DWIA 3AL2A 4JIMA 1Z2PX 4EL5A 3IDSA 4YJ3B 3SXUB 4ZEVA 1TR8A 1JIXA 3UT5A 2ZTCA 4AURA 3VNUA 3DE2X 1RWWA 5G41A 3F47A 1E94E 2XDQB 4YLYA 2AR9A 3EARA 3FSRA 2RC6A 1NF2A 2VTVA 3GJ8A 1O87A 1I5OA 2BFFB 4J6FA 5ITUA 1ZQ1A 3WL8A 3C5HA 3W3ZB 4O33A 3DQQA 4KMSA 2ERCA 3IXMA 2OHFA 3R5SA 3V9PA 3USCS 2FK8A 5ECGC 5JRZA 3FE3A 5JARA 2O8FB 1H3EA 4IIGA 2YKGA 1K3WA 4DMGA 5CXSA 4PFQA 4K9PA 4F91B 4KXMA 4DMKA 3TLKA 1H8EA 4FGLA 4Q7LA 3RJ9A 5HIJA 2D5LA 1VE7A 1AQ6A 1NATA 1E9SA 3HHYA 3W5VA 3OZWA 5DM2A 1EHIA 2Q9AA 3D6MA 4D57A 3ROFA 3BRWA 4H6VA 1CUHA 1OB2A 5M2QA 2VPQA 3OY2A 1F2UA 1TU3A 2AFRA 4UHCA 1P4RA 2O2CA 4J3NA 5BMOA 3X2EA 4NARA 2FLWA 2JY6B 5D85A 2H1OA 4G25A 4EUEA 1SCQA 3L0CA 5IVPA 3T3GA 3HLKA 2M60A 4FQ8A 3IQEA 1GV0A 5IC6A 4B08A 3CTPA 3ESXA 5J2UF 3BMCB 4DUPA 3W5SA 4MUFA 4POOA 5BV2P 3EF1A 4HNTA 1GKUB 4HFNA 4DG5A 5CH3A 2A1IA 1N32M 2Z95A 4GRIA 5C7IO 1R74A 2FI1A 4DSAA 1XV5A 5ER9A 2JD2A 3UICA 2X19A 3TG2A 2G77B 1JA9A 3P9YA 1NHGC 2DBRA 4FS8A 3LT5A 1PM5A 4WY2A 1U3GA 4IIVA 3ECCA 5BOVA 1NULA 4QBHA 2V7TA 2QLLA 1TF5A 3IFSA 3L0PA 1LSOA 2R60A 3E7FA 5EIWA 3JQBC 1Q84A 4C3VA 4WBSA 3U09A 2CUZA 4P31A 3NS7A 3GROA 4MPJA 1W48A 1PJAA 3VTZA 1EHYA 5EKTA 5FBHA 1JH8A 4DR1M 2CCKA 3R3HA 3JSAA 1RWKA 3W6ZA 1K8XB 3U60A 1D07A 4X90A 1JQBA 5SZIA 3NV7A 1HFEL 4ERXA 2YY7A 3ZHYA 1EDOA 3DF7A 2XTMA 3BSYA 1ZUNA 5KX5B 4YN3A 1Q12A 3G0OA 2XQKA 1H1DA 3L8HA 3AY7A 4MGIR 3JQ6A 3UBTA 5CNMA 5JXGA 3ZTWA 5C34B 2AXQA 3TUIC 4EB6B 4MRPA 4DLZA 2PAFA 4J07A 3PFWO 4PYKA 2HO5A 3M4JA 1JIIA 2DFLA 1IWPB 1QHSA 4RJ2A 2XYVA 2FWBA 2ZJ2A 2XUAA 4H1VA 2BEKA 5AOAA 3N0VA 4BDTA 4Z1MD 1XQ1A 1DARA 4YV1A 5DTMA 1WR1B 2JFUA 1H9CA 2WA2A 2XQFA 4OL0A 3U7GA 2J9FA 1GJTA 3WC4A 2W2LA 3LFUA 4LX8A 4FZ3A 4KO8A 4JI8B 4JLAA 4F71A 5KNCD 2IEGA 1E7QA 3L40A 4NYMQ 2JAPA 2B1QA 4YAEA 5CURA 1X7XB 1R4MB 2FF7A 1QGOA 4X44A 4ZK2A 1FYWA 2JHAA 1KZHA 1W30A 1U80A 3DYIA 3BOSA 3AHCA 3S2EA 3Q8KA 4L4SA 2JBAB 4RH0A 1MN6A 3SZMA 4RZSA 4HVTA 1IN7A 1OI2A 3QLEA 1NXTA 1NJSA 2OBFA 1VP9A 3WNZA 2HSEA 2IPLA 2X2PA 2C0QA 1Y1TA 4IIXA 1CW2B 5ALZA 3HACA 3EUWA 2NTVA 5AUQA 1E9BA 4GPAA 1G6Q1 3UT5B 2HQ1A 5F51A 4YO8A 3PA8A 1XD8A 3HJCA 4KFRA 2VJYA 3FHLA 3FVWA 2NZXA 2FFHA 3KKOA 3LQ4A 5AXCA 3LU1A 4LVNA 2XVAA 2VDJA 5HNKA 3NTVA 2BLNA 4LY9A 4E5UA 1RJWA 1M1YE 1WKCA 5FAXA 4N3AA 1FFGA 4IBFA 3OLQA 4UTOA 5KSYA 3A0UA 2Q0HA 5BSWA 1G38A 5KMGA 1L1FA 1EFCA 1V11B 4TVBA 5AVJA 1MJGA 3Q4GA 5IDXA 1W4CA 3A6LA 3KT0A 3PHIA 3PUZA 4V0RA 4PXAA 5CT8A 3U7EB 3W5IA 2CDCA 4PAGA 2OV8A 3IQZA 3BRSA 3I8XA 4DUYB 2NZJA 3AF5A 5JI2E 1I2AA 4UFNA 2C4HA 4WOJA 2ZR7A 4DEVA 2BJVA 3SF0A 2VPPA 4DNFA 4CHTB 1E6CA 4WNCA 2I1QA 3A2LA 2XBLA 2ISCA 2Q1WA 2P1ZA 1Q0TA 2WMOB 4BBAA 2DTEA 4E32A 3A06A 1F2UB 2J87A 1D4ZA 1OE0A 3GEGA 4LHVA 4EVQA 2BCJQ 3EG9A 1I2CA 5KQMA 1SHTX 2QQGA 1JHYA 1XDUA 3ILKA 1MOQA 2PD3A 4JAVC 4MO2A 5CIYA 2FE4A 2SHKA 5CT6A 1LPSA 1P91A 3O95A 4Y2HA 4W6QA 2WB4A 1U0BB 2HPHA 5JAUA 4J29A 4A1OA 2GETA 4H1HA 4LECA 1QQTA 1RKVA 2OENG 4YCLA 3R6LA 4Q18A 2R18A 1LVHA 1KI9A 2IZZA 4H6PA 4UAUA 4HTAA 3BHMA 1LPBB 3AINA 3MCWA 4RH3A 2CHGA 2GX6A 2FQXA 4H7JA 1W4RA 1N6LA 3UHJA 1N6PA 1E3JA 2WKQA 4YO7A 2HLDD 3CLSD 3E1KA 3SQLA 1OR8A 5C37A 3H86A 2BCEA 1XHLA 2CVZA 5AKXA 3TTSA 4UTNA 4W5HA 2IXDA 4OKIA 4L72A 1RPTA 2X1VA 2AZMA 3EIOA 4YUAA 3U60B 4OU4A 2J4CA 3GT7A 1VI6A 2AE1A 1ZUNB 1SVKA 4MP8A 4IXTA 3RW9A 3G2OA 3PICA 4U8GA 1RWBA 3FYTA 5DSTA 2VYVD 2NWQA 2LIVA 3ZU3A 2FZCA 5C31A 1JAIA 1RKBA 3WB0A 3QF7A 4BQEA 2X2EA 3UM9A 4IYRA 2XUDA 2EFYA 1TNDA 4A27A 2IE0A 3BSFA 3WLQA 4G5YA 5DX1A 4IGEA 3F5FA 3QBEA 4KI0A 1Z25A 2CB9A 1ZUIA 3NANA 3B1VA 2ZM5A 4BO6A 2NYVA 3IMEA 2GZ2A 3PFKA 1KZ9A 4KKXB 1QHNA 3SP1A 1CK4A 1G6OA 4XD7A 1NY5A 1BXRA 2RGAA 2XBMA 2J9FB 3OTOB 4BIIA 2D13A 3MBKA 3IDAA 4OAOA 1NBME 3ABSB 3HUFA 4EFDA 2IS2A 3AHEA 1GZ6A 2HRBA 1J70A 1AA9A 5JXIA 2W71A 4OQEA 3FCOA 4UJ3A 2YDYA 4BVKA 5EJIA 1PR4A 4DR3M 4FNMA 3LCRA 2HCRA 3LOPA 1WUKS 2JJ1A 3WDMA 1PS0A 2WWXA 1VPDA 1HNWM 3M2TA 4X62B 2Z3VA 1MC5A 2Q1XA 4DPKA 1PDWA 2HEIA 2GZDA 5JWHA 2QG9A 1UKYA 4NCKA 2Z8XA 2IK8A 1ESNA 5E1DA 4OJQA 2GSWA 3PDWA 2D1QA 5I48A 5ALQA 3UAWA 5KYTA 1ZJ6A 2C99A 3HCOA 1O7JA 2F3QA 1OROA 1QNFA 3R3XA 2Y66A 1E92A 2ADOA 4REZA 5CX4A 4ARUA 4DR2M 4RNAA 1YZ3A 1D2CA 4WKGA 1AV6A 1Z83A 4LRWA 2LVNC 2AUTA 2UUBB 4J2TA 2CZGA 4M38A 3J7BA 5FL3A 3ODGA 2I4OA 2Q4TA 2C7BA 5KMGB 5JNRA 2JLBA 2XLCA 3GAMA 2J3DA 2WYHA 3H4TA 4EYQA 5TXGA 4I5DA 3OOYA 3VDUA 3OPVA 3JARA 1HRDA 5EE0A 5KTOA 2UDPA 1IEXA 4P4TA 1SA0B 3FGOA 3OUTA 4AMZA 2I33A 1MR3F 1A9TA 3K2EA 2B98A 2YXPX 1UC5B 3P2EA 4U7DA 2I1LA 3AOEC 3N74A 2XYGA 4F93B 3S2ZA 4GI3A 3ZNQA 3PG5A 3EG9B 1ZBDA 1SBQA 2C5FA 4H1UA 3LC1O 4Z9BA 3WSTA 3N2GA 5C8YA 2X9QA 3K0CC 2G9ZA 3WZLA 3JRWA 4JBWA 5DNAA 2X23A 3LDUA 2OXEA 4FFSA 5HBRA 3WRYA 4DKJA 1PLJA 3OM1A 3O74A 5EZ6B 1P5JA 4PIVA 3HCAA 1XZHA 2VHXA 3SU8A 4DXHA 4DV3B 3I12A 5IYZF 1RLOA 2PKCA 1CS0A 3UQYS 3K32A 1NLUA 1XRJA 1OYYA 4I46A 4WN3A 2ID4A 3IAFA 2V0GA 3H6HA 3MWGA 2KZUA 4R2MA 4KQMA 3ZHCA 3VO8A 2XMBA 4HNUA 2L69A 1QTIA 3DR3A 4QHYA 1V26A 3PXDA 4ZCLA 3HHZA 2FOLA 2PRIA 2C92A 4ZVRA 1OIPA 1QX3A 2H7YA 1AMUA 5ALRA 5E0OA 5H7XA 1N34M 5GJWC 1YHNA 1CLUA 5J59A 3OC6A 3RHZA 3IEIA 4R0NA 2GK3A 4D4JA 3FJOA 1QR2A 2H2DA 3VV3A 3TKAA 2DNAA 1A2BA 2O3TA 3AV0A 5IUNC 2Q9BA 1KZ1A 3T41A 2PX2A 3EFHA 5AVOA 4DBZA 4YAIA 1SZDA 3JQRA 4Z1MA 3THSA 4EYOA 3ZV6A 4WACA 1DRUA 1G3QA 2BFAA 5LOVA 3P2YA 1PW5A 1WEHA 2V1CA 1RJEA 3H04A 5FPQA 1QZ3A 2BGGA 2O8DA 4FZJA 4G5RA 3T12A 1U3CA 2FWPA 1CX9B 3HX3A 4NY1A 2WWFA 1DBIA 5LL6P 5C5DA 4DV6B 1KJJA 1YJBA 1KH2A 1Y48E 3RRNA 2L2DA 3IEUA 3IKVA 1CETA 1GGHA 2CFTA 2HA6A 4FUTA 4F7DA 1E3EA 5AKHA 4JL5A 1KQNA 4M1ZA 5IRCD 1NDUA 1KI6A 2NYAA 1IOLA 3PQ7A 2A84A 3EGVA 3GJ0A 4PM4A 1PT7A 2W83A 3OIUA 1BXRB 3GMDA 3BWMA 1BTOA 4B3TM 1XRSB 3ZDCA 2AG0A 5JBIA 1C3VA 5B4UA 3OCYA 1WR8A 2XUPA 4B3CA 1SKBA 4BJHB 1TO1E 4H4CA 2QM3A 4JS0A 5HJEA 5DBFA 3FB1A 4PWZA 2CGEA 2E87A 4JP2A 2ILTA 3OTGA 2MJ5B 1TMGE 3EWNA 2I7TA 2TYSB 4WXYB 1QK4A 3V3KA 1XTSA 2UAGA 1MRZA 1T0BA 3CWZA 3C8UA 1GRQA 2RGYA 3DDCA 5BSVA 1HTBA 2K7FA 1WVMA 1UZUA 3UGKA 4B8WA 4BN4A 5CRIA 2NV0A 1NHWC 1S89A 2OK8A 1E1MA 1CEXA 3RS2A 2QR5A 4B32A 2WUFA 4PVCA 5KWVA 5DEIA 4EB3A 4DJDC 1KY4A 1IHUA 1NIJA 1DO8A 2VBGA 2PZGA 4D26A 1RLMA 3HADA 3LSTA 2H07A 1XLTC 1R4AA 3EZYA 4AJOA 2D1YA 2MH8A 4YMIA 4PYMA 2Q5HA 1RYNA 5D3ZA 2CLDX 3H2KA 3EVEA 4YRJA 2ZU0C 4Y9RA 2CVHA 1SM4A 2OXRA 4G0ZA 1RYMA 1JR6A 2DWCA 3PXAA 4HJXA 3AIOA 2GARA 5FUQA 3GOHA 3ZBPA 3LW5F 3IA7A 1SVMA 4IL5A 4DV4M 1XZKA 2F1IA 4WCVA 1JSZA 4WOCA 1UBFA 3JARB 4CDNA 4RVOA 5ED0A 1OQAA 2ZOSA 1T5OA 4JC4A 4XJSA 3VK7A 4PO9A 2F9MA 1XZCA 2D7HA 5ESDA 3C3MA 3WRWA 5I7EA 2UXBB 4LZPA 1NVVR 1MN3A 3I0ZA 1EDDA 3WTBA 5KINB 4PVDA 4IS2A 4WINA 1V5IA 1NXOA 3INNA 4GGOA 5C8YB 5FUVA 5T4EA 1HKHA 4PN7A 1QG6A 1C3EA 4HZUA 4DV2B 3DOFA 5L8RF 4KDCA 3WL4A 4FMCB 3S8YA 3F5MA 2DAKA 3PRKE 1CS0B 1YVRA 2OCKA 4DCJA 2MJLA 3ZD6A 5TF4A 1KFJB 3GNSA 3EIFA 4GKVA 2DBYA 4ZHQA 2FOIA 3NAZA 3CZCA 2F00A 5EEHA 2V58A 1W581 1X39A 4LDPA 1F1JA 3H2SA 1QP8A 2XADA 1Z0ZA 2ZYVX 4H1TA 3G7SA 2MDTA 4D5EA 2G67A 2W2PA 3MGKA 5JADA 1GIAA 4R0VA 1T3LA 3ZKAA 5DIZA 4G3XA 4JI2M 4NYIQ 4F92B 2OOAA 2P9YA 3AK4A 4ZVQA 2RGOA 3EXHC 2WM2A 1SUBA 4RVFA 3H9GA 3NP7A 1NW3A 1NA5A 3AV0B 2V3VA 5F5LA 3GP8A 3IE2A 1TZMA 4EG7A 1E3IA 2IIQA 1SC1A 4QU5A 2PKXA 1G5IA 1UKBA 3L1VA 1M1NA 4M1YA 1VYUA 3R24A 5LOVB 2X13A 5BQFA 4KO1S 4D3FA 4MLPA 4IJKA 3C1UA 3SR0A 2O8DB 4JYZA 1VEGA 4C76A 2MYNA 2ZJ1A 1VKJA 2IV7A 3TW8A 2IHYA 5DT9A 2X0RA 4G2TA 1ULHA 2A0XA 3COJA 1JA1A 4B3MB 4DW8A 1DDOA 1E1DA 1N0VC 1NQOA 4D9IA 2G8LA 1GUAA 4WW0A 4RL4A 5I4CA 2R4JA 1HGXA 1KTIA 2J3QA 1C7JA 5A0VA 2GHTA 4PZEA 4LGCA 1ARZA 2G1PA 3I9V6 4OIFA 3RE1A 1GD1O 3HVUA 1FTGA 4EW6A 4OX9B 3MIIA 3HUUA 4OXIA 2QLTA 3CN7A 2I3ZA 4MVJE 3IXLA 3JPWA 4WN9A 1NN5A 4BBJA 2BI7A 3G1TA 5J47A 4HEQA 1W2WB 4I55A 3DFFA 1LLCA 3Q3HA 4FX2A 4RVGA 3D0OA 1NYQA 1QCYA 4G8CA 1Y1LA 2QN1A 2WKSA 2FA9A 3RBXA 1XRMA 1E1LA 5C7OO 2OLJA 2G5GX 4JYAM 5H70A 1MU0A 4ANRA 4EW1A 3K72B 3ZI4A 4CETA 4PZ0A 2BKVA 3ZVKA 5HS6A 1CZOA 1NHGA 1ADGA 1WETA 3TFOA 4FFVA 4BTEA 2WRZA 2D4AA 2R8RA 4OB8A 5B2EA 3K96A 4GLJA 4WNYA 2V54A 1WHSB 1Q1ZA 2Y0BA 3R41A 3JQBA 4J7AA 3KSZO 1CB7A 3FRHA 4GZ6A 4DBGB 3OMWA 3HJGA 4HN4B 4W99A 3TL4X 2C2OA 1NQXA 1P6UA 3IOBA 1CULC 2QVBA 3HKEA 3OLZA 1P2DA 1CEYA 2AFHA 3GG2A 3D31A 4RU1A 3D02A 1DFGA 2PVPA 1US8A 1GQQA 1VLQA 1ADFA 1IBCA 2DSTA 1RFLA 4US0R 2V7WA 2VC2B 3TXYA 1OYOA 3RGWS 3KOXA 2ZRKA 2A6PA 1I7LA 1ZI6A 3KXDA 3N8KA 1X1RA 1CLEA 1H8HD 3EEFA 5EUMA 2DY1A 4DCSA 4RMHA 2OPFA 1SU4A 2VQ6A 2WEKA 2QPTA 3KZ1E 1UFKA 4YLEA 4M46A 4HLCA 1U0HC 5I7WA 2DUNA 2VQEM 1ZK2A 4ZVSA 1J9EA 1T0HB 3PGA1 2E48A 4AN1A 5HM6A 3JAWA 1QGAA 1Q92A 4AP6A 3AL0C 4MCAA 3FPAA 4EX7A 1QQ6A 4HNAA 4HZUB 3Q3VA 3USES 1VSUA 1XEAA 4BVJA 4ND4A 2P2NA 1XOIA 2PSDA 3KOWA 1DIAA 4AP5A 2I7NA 3JR5A 1XX6A 1F12A 4YUVA 4Z86A 3PVZA 4L9RA 4ZHQB 5LDGA 2NU9A 1J2EA 1WW8A 1XZLA 5HCIA 4Z9FA 1T91A 1YZUA 2BUAA 2PFGA 5H9VA 1YB4A 2AOWA 4X3OA 4KSCA 2VF5X 2QUKA 3HN7A 1R6AA 4COKA 5JSUA 3QOWA 4BO9A 1VKHA 2E6KA 4C0HA 2QYOA 4U7FA 3DL2A 1GNSA 3KVYA 5I45A 1N2JA 2NX2A 4QUBA 4AZFA 2FHPA 3AUSA 3EFEA 1AN9A 1BS9A 2HW8A 2G9QA 4NBLA 3CZ5A 1WHCA 5AJXA 3UYKA 1TGUA 1C80A 1ULTA 1V25A 4RTPA 1XNRB 4IRUB 3VPXA 5FADA 1P9OA 5IX8A 1E2FA 4CFZA 1F7VA 4MW0A 1M1NB 2GN2A 4ND3A 3K0BA 1M2GA 5C35A 2EZ9A 3H75A 1CY8A 1J5XA 3R9XA 1OV4A 3RPEA 1VCMA 1KO7A 3E8MA 1L5HA 3GUYA 4K2AA 3VU3A 3OOSA 3FTFA 4M0CA 2P7HA 3SC3A 3TL6A 3TW8B 4EIWA 1YCHA 3RVMA 4EP1A 4HMQA 4JLNA 1UBNA 5SV2A 1NE2A 1ZEMA 3W90A 4BBZA 2I3BA 4IIWA 3H05A 2IUEA 1T9CA 1P75A 1NJ8A 4ZV9A 4NH4A 1IN8A 4D74A 2WF7A 1XEWX 1L7EA 2CLOB 2JDIA 4M1MA 1SHKA 2ZI3A 4R1NA 4QJBA 1DUVG 3UANA 4EJ2A 1AKWA 4FNGA 4JLJA 4HDNA 3ZIUA 4QBFA 5CA0A 3QVUA 1CY7A 1U7XA 4ZC1A 2XAUA 4OMCA 2EVWX 2Z9DA 1E2LA 1GKIA 2WT8A 4LBVA 3M6AA 3SSAA 1CRLA 5GZ1A 2HA0A 2IJGX 4BB5A 4WN9B 5BSFA 2G1UA 3L8ZA 1E7MA 4OFZA 5AHKA 4U2FA 3ZY2A 1N0IA 1Z4PX 4X7MA 5FWXA 2N3ZA 3ZLBA 5DHPA 1MTOA 2YV1A 1PJRA 3DO8A 1OGJA 5DF1A 2JVIA 1JWBB 5CFMA 1LDGA 1EIWA 1YRYE 1L1RA 3R6DA 3ULKA 1FFSA 2AQ8A 4N5HX 2XZDA 2B8EA 3DM9B 5FLYA 1PGPA 4KHPB 4PX5A 2FB9A 1FUUA 4JI5M 2VDVE 3RRMA 3I01A 4J0QA 3S28A 5BRNA 5AYVA 2NAPA 3IJ5A 1QB7A 1H8ED 4CTKA 4XDHA 1TU0A 1FFWA 4MB2A 2J0QA 4H0NA 1YBMA 1X8JA 3E05A 2CMGA 3ZJTA 3DEAA 1CXZA 1B8PA 3LW7A 4PLYA 1LLDA 3PJGA 3T3OA 4ZPXA 5SY4A 4BUJA 1XXHE 3LH5A 4KE8A 4ER6A 3S27A 5DCLA 5A06A 4KACA 1R9JA 4LXHA 4EG4A 4MUXA 1R5BA 2PFKA 4QXOA 3AEZA 3FKJA 5AICA 3RVBA 1PP4A 3G5MA 2UZIR 3KSBC 3QNUA 2MOKA 3HKEB 4KNVA 2WABA 3N76A 2AFHB 2PKEA 4B87A 1GFIA 1YTLA 2AZXA 1Q7RA 4BP9A 1N5MA 5HCUA 4YAJA 1US8B 1W5FA 3QMPA 1AY0A 2CNNA 3C3YA 1BXGA 1I3KA 2VCHA 3GQ3A 4LW8A 3O8RA 5FAKA 4DHEA 3ZGLA 5JATA 1E3TA 1TK2A 4YA6A 5JAZA 2FSHA 3RYIB 1VHWA 4TVKA 1SKUA 3TSYA 2HI0A 3CA8A 2JFWA 3QXSA 2GCEA 1VCHA 3HUTA 4D9CA 3HJBA 2H1VA 3T3EA 2ZIUB 5MN6A 2JL1A 5DCYA 1X7DA 3RS9A 3OTWA 1WXQA 2GBFA 3EQ2A 5BT8A 4OCZA 5CB6A 1PR9A 1QU3A 4OU7A 2BZ1A 4H7HA 2PWYA 5C8YF 1A9OA 5B30A 4L8GA 5C80A 3DFKA 4DBLC 2P30A 1Z9BA 2ODTX 3JAWB 5M29A 3SJZA 1PZXA 3F96A 3WLHA 4HNAB 2OK7A 5CDSA 5DSXA 2L18A 3LXXA 3CG4A 5GAJA 3F7OA 2L2QA 3E1SA 5FH9A 2GQFA 4WXRA 1WLSA 2QP9X 1Z5NA 1N8SA 3FCUB 1B42A 2I4TA 3SNKA 4M55A 2PXAA 2SKDA 1FNDA 5CB0A 4PFSA 3KEFA 2HK9A 1QHEA 4CEHA 1YRQA 1ZU5A 1FFYA 1GPLA 3O0DA 4KGXA 4AJEA 3VYRB 4F6CA 2D7JA 1PD1A 2ZP1A 2MIIA 3HZHA 3FUXA 4HRYA 4IGAA 1B8VA 1ZJYA 3IIJA 2QN2A 1ENZA 2EKBA 1YB5A 1KMMA 1FMCA 4ARIA 2DCMA 3KPWA 2MSEB 4JUBA 4OSEA 4MRAA 3OECA 3STTA 3U81A 1AKRA 5HUJA 4DA6A 4PPGA 3QVOA 1LPPA 1QGZA 1EZZA 4LMBA 3WBJA 3G8BA 4CQJA 2W2LD 3F8SA 3IR5A 1EVKA 2HNAA 4FFLA 5CJPA 3FNQA 4AO7A 4D6YA 3OD1A 1MC4A 1J8MF 4AJJA 4M0PA 1L1EA 3OZDA 1XTTA 4KNWA 2QROA 3KBOA 2OSBA 4GRDA 2ZTVA 2OGWA 1KEWA 4FK8A 1Y6JA 2NTNA 3N3BC 3KETA 2XDQA 2OCBA 3GMSA 3GZJA 1SEPA 2QSFX 4C4XA 3WLNA 3RIGA 5FEUA 4BO1A 2XWJI 2PMBA 1AVTA 5GKNA 3TMYA 3FOBA 1HT0A 1LV8A 5HIAA 2HMYB 3UJAA 2FPKA 1XELA 4Q1VA 4HNHA 2HIMA 2IYZA 2JUJA 4BB9A 1ZJJA 1DJOA 4YMSA 4LOAA 5EC8A 4IZIA 4LZOA 3MK6A 5AOCA 3AOEA 5CA0B 1WEKA 3OJLA 4MVJI 3I2HA 3TLBA 3ILHA 3HJTA 4NMXB 1NYLA 1L6RA 2QQEA 1LDNA 2OBYA 1E2UA 4J0JA 3K0CA 5THKA 4FNOA 1BDBA 1VLHA 5C3UA 3WWEA 2YHAA 2IPAB 1NRIA 4Z8XA 4CIWA 2Y0DA 4YASA 5LZ7A 1W0KA 5M7EA 3WP0A 3UMSA 2B4RO 4D80A 1BU8A 4MWSA 4IJUA 4K3UA 2ODNA 3VPSA 2MR5A 1EUZA 5IHPA 2GEFA 4EUFA 1YS1X 2I3DA 2ZXUA 5J23A 2C5AA 2PV0A 4PLCA 4UM7A 2RHDA 1XRPA 2JLSA 2KHZA 4EUNA 3LPNA 1IMJA 1WMSA 1VIDA 3BMCA 3EW7A 3AF0A 3DMGA 1FSSA 2OHOA 1XJ0A 3UFXA 3BL8A 1UC9A 1HF3A 2QU8A 4JC0A 3Q2OA 4HAIA 1Q5PA 3GEDA 2W0MA 2AS0A 2X4GA 5ARCA 3QUAA 1H8HA 2GTIA 3E9RA 3H2BA 1EFDN 2PG3A 3TUZC 2IH2A 4E14A 1GLGA 1FTSA 1FQKA 1A76A 2ZYAA 4GX0A 1NU6A 4S0ZA 5D1HA 3RRZA 2FRXA 5HIIA 3Q8XA 1LZKA 4LFCM 4ETMA 1VE1A 3THYA 3K0SA 4H60A 1QP0A 5F7ZA 2R68A 2F48A 1GCAA 1BXGB 3R2JA 4UNSA 1RWXA 3DKRA 3ZHBA 1IDN1 2KDLA 2V1UA 3DFIA 2YXLA 2E4AA 4Y7DA 4GI5A 2Q9UA 4CG1A 4KREA 1KXJA 4ZOQI 3Q41A 3ORHA 2R6GA 1OAIA 5G3ZA 2HPZA 3F7MA 2Y1FA 2V7BA 2X4DA 1TQDA 3EIWA 4JI6M 3QAUA 2XZPA 1JHQA 1FQJA 4JZKA 5EWJB 3AZQA 3Q72A 2YWRA 2YJTD 3IS3A 4RKEA 4EA6A 3WIEA 1T5HX 1NUPA 4PQRA 5U9CA 2QT0A 3M1LA 2V9CA 3FGNA 3W2HA 4F5WA 4NU5A 4GR9A 4OK5A 3KHSA 4ZHQF 3SN6A 1UXIA 2ZCUA 1RYEA 3I9OA 4OU5A 3U5ZA 3C7DB 5IS2A 2E9SA 3TZQA 1EXDA 1ZN7A 2OKCA 3ELWA 3PQ2A 3A1FA 1E62A 3UWPA 4EBFA 3VZDA 3LUBA 3L93A 2TSYB 4XJXA 1K4YA 1IBMM 3D7SA 4CEHB 4EJ6A 3IIIA 1E2NA 2ZIWB 3DONA 1VHLA 3UCFA 1X7XA 2WF9A 4GAEA 2B6HA 1NHWA 3I92A 2H5LA 5ESWA 3UB4A 4RPGA 4NTZA 4UDXX 2YZKA 3LCJA 4NMLA 3M5PA 5EMKA 4DRXA 4F8JA 1FB5A 4TLLB 4OBBA 5JJCA 5DW3A 3U3MA 2BTOA 4XD7D 4D92A 1XLTA 4HVLA 4IUBS 3QYAA 3SC6A 1G6KA 4JVLA 5AXDA 4FXPA 4E1VA 4HUTA 2ZR0A 3QOXA 1GSAA 3F3KA 2HQBA 2JLUA 3FYUC 2JJ1D 2BGMA 2VXCA 4F96A 2W4IA 1S3FA 5FHQA 5TARA 3AJRA 4G5HA 4YUZA 3RJTA 4IJ5A 2I7VA 1YRAA 1CV2A 2VA9A 3A2KA 2G28A 2PBZA 4GRAA 3DOUA 2XLJA 1Z28A 3DMNA 4DCVA 1AZTA 3WRXC 1V11A 3FTQA 1XAGA 3QU2A 1JHZA 3ETNA 1TA0A 5B57C 2LVAA 1B2RA 4BCBA 4W7SA 4HH4A 1JKJA 3DAYA 1TAQA 5IZ4A 3TVYA 4LZAA 1FMLA 2Q45A 1ECLA 5FHRA 1OGIA 1HQKA 3ZZ0A 3DNPA 3QYEA 1ZIYA 1RI5A 3FYDA 4I55F 2QMEA 1EUDA 3L0SA 4DB4A 2DAMA 4CHTA 2WWTA 3SMVA 1X2EA 4B79A 4OGFA 1WKBA 3JQFC 1T0PA 3HCCA 2XMSA 2X7JA 3IB3A 4BGDA 2CMHA 2UZ1A 1FJGM 5JG7A 2QZJA 2P9CA 3T99A 2CHVA 2W2OA 2PL5A 2YJ5A 3HCNA 3GFFA 3I2JA 1XG5A 4DG9A 3AFNA 3DLHA 3FCXA 2F5OA 4WVLA 2DLCX 1L3BA 3R5TA 2IXBA 3G9TA 1AMNA 4LV8B 4N7BA 4P7KA 4N82A 1SOVA 3UFXB 2GPYA 2VNHA 3IVAA 3EYWA 1G4HA 2VP9A 4P3OA 1KQGA 5HK9A 3KAKA 1GO5A 2N1MA 4JL6A 3CH7A 1V92A 1T5BA 1IUPA 3U6QA 1RI4A 2W93A 3EXHA 3VVLA 1WVIA 5DTRA 3DZIA 5IXYA 3ECSA 2RBGA 2A33A 1FXWF 3ER8A 3ZCRA 3D8RA 3BGWA 2GJ9A 4MR9A 1BGXT 2GAOA 3RS5A 3X1ZA 1JQEA 1EP3B 2IYYA 1WUIS 3QFFA 3Q8XB 4DLYA 1SUSA 2C5GA 5FUWA 4FIZA 3T15A 3THYB 1LF0A 1N57A 3LY8A 1Z68A 3CONA 3D5EA 2VWPA 4ALIA 4P8RA 4TTRA 3E9EA 1OV6A 4BX2A 5FPSA 5FT9A 5CNIA 1WDWB 2XD4A 1U7UA 2AMJA 3K73O 1H2XA 4P4UA 4BFUA 3RTBA 4GL4A 4EY6A 1Q7GA 4NR0A 1T8WA 7ADHA 1YE5A 4LXTA 1ID8A 1FFDA 1FNCA 2Z8ZA 3INGA 1CERA 1K08A 1RHJA 1GILA 2HRCA 4FN5A 4FHZA 4DIKA 3G2NA 5BSMA 3VVCA 1LPMA 4MGZR 2O0JA 2VA8A 3C41J 4F3YA 3KJQA 1HDZA 2AG8A 5ESRA 3AI3A 3AR6A 2C83A 2J3EA 4QGFA 2MSNA 3S7ZA 4RSGA 3W2TA 4DAEA 1Z56C 1JHPA 2W6MA 5I7UA 3ZWXA 1ORWA 2QRNA 1UKEA 3WHKA 2JFQA 3W8FA 3QOYA 3TZ6A 3U5ZB 1XD9A 1XU7A 3HXTA 3S6JA 4YFYA 4OGWA 1S2IA 2K6GA 3O83A 1KMHA 1XMJA 3WNDA 2H9YA 3T4EA 2O3SA 5A5GA 4TQAA 1N5KA 3TCNA 3MF4A 3UMRA 4ZCRA 3FI0A 3IUSA 1DVRA 4CCAA 3CEAA 1KMQA 5FSWA 1CQZA 4JV5M 3WGTA 2OG1A 2G25A 3CVXA 3I5MA 4CF3A 5DASA 2XAAA 5JISA 3OMLA 4DRXB 1WUTA 4YHHB 1HLDA 3AB7A 4B3RB 2ZBRA 2BGTA 3L0ZA 3HL4A 2Z5FA 4C7OB 4JBIA 3VDPA 2HIGA 1WJGA 3LCUA 2LBCA 2EFDB 1ZRHA 1VEKA 4BMOB 4DM4A 3WV4A 3GQ5A 1G9SA 4MVCA 3TG8A 5EG5A 3EBPA 1DKPA 2IE8A 2WSMA 3IVCA 1OBOA 2BYTA 1E2MA 2Q8QA 2X9LA 1DJQA 1Z6AA 4KH0A 2YY5A 3U62A 4X71A 2A2ZA 1JW9B 3L6EA 2K7ZA 3LUPA 1ZOIA 5JAOA 2N46A 1FRZA 1Z45A 2H1HA 4LVCA 3L0DA 1X7YB 3NVKI 4L07A 2GAJA 3TEJA 1MNAA 5CLFA 3GLTA 1P6XA 2OB1A 4IBGA 1UJ5A 1J42A 3LK6A 3GGPA 2BHRA 5CA0F 2G1AA 4MKRA 4YMTA 3R44A 1BVYF 2JGNA 1XO1A 4NU6A 2G9NA 3AHGA 2XWPA 4H9GA 1J90A 3RU9A 2H06A 3K5IA 3FVQA 4C6SA 1JKJB 2YHBA 3KUXA 4I2VA 1SXHA 4IDQA 1B0AA 3MG9A 2L42A 3ZK9A 1UXOA 2QMUA 1JSRA 2IW1A 1EUDB 1I94B 1SA0A 5JECA 1IYZA 2PZAA 4EMUA 2G3QA 1UBRS 3Q3JB 4MKFA 2MT9A 2W2TA 1X74A 3V7NA 4YCMA 5HRCA 1HQCA 4YS6A 3ESBA 3RUPA 2UZ1B 2JCSA 4I9GA 3AFGA 1DPGA 4J76A 4LQDA 1X19A 4XWGA 4EJSC 3LX4A 4XYBA 4B8YA 3N53A 3S7TA 2JRLA 1IZ7A 1FCJA 2ZU6A 1VYTA 5JS1A 3RUCA 3CF2A 2R5WA 5T4BA 4YRTA 3VOAA 3HL0A 2NVOA 2EIXA 1A9SA 3TPZA 4KVAA 1DC7A 1P1HA 3ICVA 3MMZA 4XOUA 2FSSA 3EXHB 1SXGA 2BBOA 2RARA 3EEIA 4RV4A 3BFKA 3I5XA 4YJHA 4LOIA 3ZE9A 1GPH1 4URFA 4MR9B 2QV0A 3W67A 5IXJA 4I5GA 1PQWA 1E6EA 1FLVA 3WHPA 3L82B 4CMBA 1XEXA 4IOKA 2VYNA 1V5GA 2X41A 4CI9A 4ZQIA 4FILA 3AEQA 4XI9A 3EAFA 1CB0A 4BNMA 5DI3A 3VH4A 2O8BA 3IQWA 4C4AA 3ZD7A 3DMFA 1DGBA 1O6ZA 1HDOA 3INRA 3AI2A 4ER5A 2EFGA 2Z30A 2JFXA 2PSHA 3DAFA 3DNFA 4FEEA 3DO5A 5EPOA 1BE0A 4Y18A 3LGAA 4NQZA 1B73A 2WHXA 2DQKA 2FN4A 4TLAA 2BELA 1K0FA 3DEKA 3OIYA 3VDQA 1GUZA 5JNTA 1LCIA 4HDOB 2F8TA 2NTYC 1X1EA 2XTJA 1GU7A 3OEYA 1NR1A 3B1ZA 4A23A 1FTQA 1G8PA 3GT4A 4HOYA 4PNPA 2I2BA 3GLHE 2CJWA 2GRJA 4E51A 1ULZA 3UJPA 4Y2QA 3IAS6 4XM1A 3FR7A 5GINE 4YJ2A 1JT9A 1XTZA 4PS0A 2GSDA 1T4GA 3EEQA 4RABA 4IGFA 4RFSB 4URXR 1QPBA 3NDRA 3K3PA 3EWSA 4W5TA 1O95C 3PJEA 1C0LA 4HWPA 4RKFA 5CFOA 1KMHB 2C98A 1RLIA 4R16A 2ZS7A 4TL9A 3H4MA 1VG5A 5LU8A 1PNTA 5T6MA 5J40A 4CE6A 3GLFB 3KKEA 1YQXA 3R5XA 4IXDA 2GAFA 6GPBA 2ANCA 2Z6VA 4R1QA 4F84A 3UO8B 4XUEA 2PX3A 4FDAA 3FLEA 4MUMA 4AXXA 4FOSA 3IVRA 4EEZA 2EG5A 1L6IA 4MO9A 3ZWVA 4B48A 5F3RA 3FDJA 4OV6B 3P4UA 5ITXA 4AMYA 3ISTA 1Y9EA 3F2IA 2UZ4A 4KXNA 4YJ3F 4OQLA 3LS2A 2Y99A 5IVKA 4DA8A 3WDKA 4IPTA 4XH9B 5ADHA 2XIJA 3FB4A 4YAUA 2JFPA 3WMXA 4XWYA 4Q39A 121PA 3DPUA 1PDVA 1DADA 2QTWB 3HEMA 4O2RA 1QWSA 1D0KA 2LP4Y 3PPXA 4M53A 4BUCA 3L1KA 5JI3E 1RM4A 1PFVA 5IDVA 1YBFA 3L9WA 4PLVA 3U6CA 3UG7A 5F23A 1F6BA 3O2NA 4R40A 1WY7A 2HSZA 1LB1B 5KEIA 5HF6A 4L8FA 3V8QA 1RP1A 5EZSA 4OQZA 4Q3CA 1V2HE 4W1PA 4RTQA 1QH9A 4WERA 2AKEA 3H5WA 5AR1A 3WP1B 1U7OA 3CO0S 2ICAA 1Q17A 5EJMA 5T5QA 1OIXA 1YB6A 1RXVA 3G68A 3I42A 3HA7A 3WGUA 3A7EA 4OHPA 2PZKA 4WE3A 1AM4D 1QIFA 5DX8A 4BLSA 4Q1BA 1Z26A 4YMWA 4REMA 1QV9A 3NIGB 4YWJA 4P35A 1S8FA 2EHDA 3P52A 1DTWA 4HDRA 3REQA 1W4AA 3NPMA 2ST1A 4FHEA 3K5PA 4ZZ1A 1OCEA 3A98B 1RS0A 5ES3A 3I83A 4EPTA 4C01A 3PUWA 3O8NA 1TM4E 2HXGA 1P74A 5FI3A 1X8LA 2ZXEA 1VE3A 4QUEA 3QWBA 5CFQA 5L6LB 3RE8A 2ZPAA 5CGZA 3PYLA 4JQSA 5FOSA 3G6WA 2RHHA 3ZVRA 4TZKA 1D4FA 1N6IA 2X58A 1QQAA 4AULA 5JCZA 1XPRA 3D6UA 1X80B 2PT6A 3M33A 4YJHB 1JQJC 3Q2IA 4NK4A 1BIFA 5HYVA 2OHXA 2ZB3A 4UMEA 2G9UA 3MTDA 1XEXB 3QMWA 4G0UA 4HEA1 3JZDA 3AEQB 1U7WA 4CIZA 2GZHA 4BMSA 5JDIC 3BHIA 5DI3B 4MUGA 2O8BB 3O82A 4IBBA 2FZLA 4XM2A 3DC7A 2OQRA 3UAZA 2FG6C 3KT8A 3BJZA 2XKJE 5AM2A 4QPZA 4UAJA 1T9KA 3HDQA 1CUDA 1GA4A 2G72A 5KX5F 1YCDA 2OVFA 3LUFA 5ELLA 1QF6A 5E7QA 3VJKA 1GL7A 2GCOA 4LSMA 3U0BA 2IYFA 3CWQA 4QT4A 4TSFA 2X22A 3DOJA 2VH5R 2LIPA 3I6IA 4OXRA 4BLUA 2CE7A 1AU9A 3WTCA 3MK31 1XF9A 2KRUA 2CJWB 2WQ7A 1L1QA 1ZXBA 5C46F 1T1RA 1Z12A 1WHTA 4MGHA 2I6XA 3AEYA 4YJ2B 4ZIRA 2VXBA 3QEBZ 3ZE1B 1K6JA 3A70A 3IBTA 4YDSA 3I2YX 3FJ1A 3WL7A 1M66A 1G9XA 3QHPA 1JDPA 2AXEA 1SGWA 1J24A 4I1YA 5K01A 3D0RA 1CUKA 4QDOA 3SD7A 3KKLA 5FBVB 2NIPA 4JCCA 2O0KA 2GM3A 3H5TA 4E2ZA 1P1BA 3WYFA 1K3FA 1VA5A 4DWOA 4R2HA 5IEJA 4BNKA 4WD3A 4IY1A 4LBZA 4ZHSA 5K7SA 4RJJA 3AGQA 1ZC4A 3OFJA 2J46A 2JDID 2VT7A 1RXUA 3F4BA 4NCNA 2NAFA 4P7BA 2AQKA 1MDFA 4HGPA 3THOA 3CKMA 2P6PA 3I0NA 1UM9A 2VP3A 3NZEA 2RJOA 1I3CA 4PYJA 4NAHA 1YJAA 1KHTA 4JOCA 3K9NA 3OKCA 4RL6A 1WHSA 1IJFA 2IF0A 1TKCA 1HSZA 5BXQC 5K8JB 1J0EA 2J6HA 5AW9A 3K1YA 4RELA 3TSCA 3E46A 3TBKA 3ZCBB 4D8VA 4IUYA 3LZ6A 4FSDA 3TZCA 3N1UA 3T1NA 5H0IA 2YQ5A 2IYXA 1DV2A 1CUGA 1QCCA 5LQNA 3EQ7A 5AHWA 2HRDA 3OSZA 4TGLA 2Q1UA 1SHUX 1UMKA 4LVUA 4I2NA 2H92A 4WH0A 4JA0A 2NZVG 2QD4A 3WFJA 4MB7A 2JFFA 3C3EA 4MR7A 2DECA 4QULA 1PE0A 2QL9A 3SC2A 1JPVA 3X0DA 2HJSA 3A4LA 4LC1A 2ZB2A 1RWQA 4ZAWA 4BX9A 1D2AA 4LZZA 5TDHA 4FCCA 1NSYA 3T6KA 1H22A 3OZXA 5F76A 1Z4OA 3HFSA 5C52B 3IX7A 1DX9A 3HDHA 1K5PA 3BGSA 4NZYA 3H6KA 4NJMA 1DTWB 3BFXA 4HDRB 3REQB 3CVJA 3DBHB 1TF2A 4OAPA 2C9ZA 3KYCA 3RV3A 1OOEA 3TX2A 4DUZM 2V97A 1QZZA 4W8GA 4JI0B 1C7EA 2C4VA 3AHIA 5K3BA 3P2IA 5JMOA 1EX6A 3CBQA 3HBLA 3A42A 5D51S 4RKWA 5IAOA 1SBCA 3SE7A 1QYVA 3AU8A 1JB0F 5EIBC 3DB1A 4XIYA 2PD6A 3AIIA 3OSUA 1USIA 4F04A 3ET5A 2K5UA 1P3QQ 1TT5A 5BNWA 1N6HA 2XT6A 2WQZA 5H9WA 2B7LA 2HA7A 1I13A 3G5AA 4CN8A 4HLNA 4O08A 2E5WA 2HSDA 1DIGA 1RRPA 4RJLA 4KWCA 3FYUA 1ABBA 1JPUA 3LUDA 3AR2A 1LRKA 4RE6A 4U2DA 3PJDA 3GI1A 3F4KA 1JEDA 5BMVA 3DXFA 1EFRA 5F2OA 4RS4A 4BMDA 2YWCA 1T3TA 3DLTA 2XDAA 2CDAA 3GC6A 1K1EA 4M8IA 2GCOB 3GELA 3RS4A 1QOZA 1ZN2A 4EAQA 3IO3A 4D0GA 4ZEMA 3WRXA 1BWPA 3OCUA 4YJGA 3WGQA 1LJ8A 4AG3A 4JN6A 1JWAB 3QKSA 2C3PA 2NM0A 3BMXA 2BKUA 2LRHA 1QZMA 3CJTA 4JLWA 3D4LA 1CHNA 1WHTB 4IFEA 4ZIRB 3GJ5A 3WA6A 2PANA 5I4IA 2OD2A 5SICE 3JQFA 2PKWA 2VF8A 1PK7A 2F62A 3F67A 3U1VA 2CXQA 3JVIA 4CNBA 1NQWA 2V3WA 3MJSA 1NXQA 1MJNA 1EUYA 1OLSA 4FMPA 1DXOA 5AW0A 2GMWA 3CF6E 2ZR9A 5JQWA 1CQWA 1E69A 4BE9A 4XPZA 1MOSA 1WZEA 3GGOA 3O47A 2BM0A 2F3UA 1IEWA 3HGQA 5DCWA 4ZOCA 3HO1A 1UM8A 4LAFA 4OFXA 3E5HA 3DMTC 2VDQB 1GZ3A 4U7WA 5KTTA 1VBFA 3G8AA 2A4MA 5ENVA 1BDIA 2LVPC 2R62A 4FC7A 1WXIA 4LZJA 5LSAA 5CDFE 3V2GA 4LTNA 1VIAA 2LTUA 3U7JA 3GZ4A 1EE1A 2FMFA 3AQ4A 4M0LA 4Q1DA 3HTXA 3TIIA 5J5AA 1UM9B 3WWCA 1TQ4A 2J5XA 3L84A 1E0KA 4UC0A 3C97A 1CRWG 5CR9A 3RUEA 4TXHA 4J0KA 2ZDHA 1OI3A 3IAM1 4LN1A 3II6X 1SBIA 1JV2B 2VK4A 2EFEB 2O7RA 4GZLA 4P53A 4MARA 1WMFA 2KQUA 4ZDIA 1KAQA 4OQPA 1KIMA 1USVA 2JA2A 1P0QA 1U31A 3U7QA 3RK1A 1W0KD 2GPWA 1P29A 1F51E 4ARZA 2O0LA 1RXSA 3A14A 2CNLA 1JECA 4BNHA 3ZY3A 3WB2A 1YKSA 4Q7QA 2GILA 2X8JA 2VNJA 4K0RA 5TX7A 2QTLA 1X87A 4XQ9A 4HGQA 2DTDA 3WQQA 2O59A 5DXAA 3WB1A 4J2OA 2JP7A 2AEFA 2LZ0A 1NMSA 4W4TA 2JI7A 1A2KC 4PEVA 3SNHA 4GBJA 4GSLA 2EDAA 3NFRA 4R6WA 3DDSA 3RYIA 1APBA 2FEAA 3NT4A 1YR1A 1E5TA 4LRYA 2RGRA 4MR7B 2ZYGA 3SC2B 2A4KA 3AF4A 3JQAD 1T15A 3OOEA 5KSZA 2QX4A 1ESCA 1VP3A 1NLFA 4R98A 5TPZD 4TROA 4Q47A 2HMSA 1YR7A 3A2NA 1YMQA 1CR0A 4D4GA 3V7YA 2IF2A 4LKRA 4NJMB 2IYNA 4NFSA 4DKXA 2QXUA 5IU6A 3LWBA 5MGNA 1QZUA 3KYCB 1W85A 3TBHA 4ODIA 2VPTA 1ZQ9A 3RSSA 4O1MA 1GZDA 5JMWA 4KMMA 2VOEA 5BPVA 5JSZB 5DYWA 1LUAA 2P5SA 4G9GA 4RZHA 3JR7A 3WWDA 1KFCB 2CNWA 2XUKA 3RSCA 3LHFA 3QVLA 2DAGA 1PNRA 3QJYA 4U02A 2XGOA 4GQAA 5EHXA 4Q82A 3WOVA 1KETA 2P90A 3FPBA 1EKXA 1Y1KE 2GYWA 1YR9A 4C14A 4OB6A 3MBOA 3N8HA 3OJOA 2GWHA 5T7BA 4NNJA 1D0VA 1ZM4A 2ISQA 1JIQA 1TT5B 5L4NA 4ALJA 2ZPUA 4EATA 1KF0A 4QJ5A 3R4VA 3KKMA 4C3ZA 3QVWA 1ISIA 1ZGJA 3FZNA 4L85A 4D56A 3AVTA 4NCXA 5J63A 1Q1AA 4YAFA 1N2CA 1Z34A 4BC1A 3ZD9A 1OKSA 1TGYA 4MQ4A 3ZBUA 3QKRB 2CSXA 1QIHA 3FYUB 2QX9A 4ZI5A 3B6IA 1H94A 3AILA 1SCBA 5H83A 1UFVA 5BMVB 3MINA 2KI5A 3RSFA 3SZLA 1HEYA 1NKSA 3MMNA 5B37A 5JNUA 1OILA 4KDRA 3KSDO 5MF6A 5ITSA 4GKKB 4PT5A 4HLDA 4IBJA 3LSYA 1U8XX 5JS6A 4YJGB 1J8YF 4F4HA 3UJ8A 3I4FA 4R7TA 3HEBA 3W5DA 2ZUEA 1XQVA 4R9NA 4JN6B 4AMUA 4ENUA 3QKSB 2BBTA 3W2IA 1V8FA 2EKPA 4F9GA 5AD1A 2IQIA 2X4IA 2QDXA 2XE6A 2H18A 1DX6A 1R0KA 2XVZA 5HFNA 4BNLA 4M4SA 1EVIA 1E6MA 3TYXA 1PWYE 1KSJA 4ZYVA 2GBCA 2D1TA 1CDEA 1LPOA 4DV1M 3TGPA 4RPHA 4P0TA 2B8NA 3MJ4A 1WVGA 1WD5A 4N8EA 3ED5A 1OLSB 4EJSA 4O4JB 1UPTA 1G8JA 3F8TA 2PA3A 1RVDA 1E89A 4M0WA 3FAKA 3ILYA 2EKLA 4IBDA 4Q6WA 4KR0A 4DCMA 3AR8A 3NJ4A 1QC5A 2JH8A 2KJQA 2Q7XA 2YW2A 2V7VA 5AJVB 1TJYA 1JU9A 3VU0A 3VZRA 4Z4QA 4XGKA 4OKNA 4ZCTA 5ICGA 2A9JA 2GRAA 4ISBA 1ZH4A 3LP5A 1VRWA 1VL2A 1L2TA 2C9YA 1UBEA 4OW0A 2K2WA 3TL3A 3NH9A 4EHAA 3ZXSA 2GN0A 2OG2A 1KBQA 3VQTA 5IDQA 1YR6A 3KCQA 2VAXA 4ER7A 3C8MA 2O54A 4MQFA 3FBGA 2BKXA 3D8BA 4YMGA 3WKEA 1R88A 5CT9A 1P77A 3AHFA 5E3IA 1VM6A 3V4ZA 1UQUA 3TI7A 2NNWB 3ZU4A 2M6SA 1Z88A 2ZBFA 1KS2A 3P9XA 1KJQA 1ADCA 1KSGA 3I04M 3S40A 1KDOA 1B15A 2DZDA 1Q39A 3U7QB 1CT9A 3B53X 1O6CA 2H6EA 4MGIE 3HCRA 1QO9A 4ARZB 1EPUA 1AHNA 5E95A 3NOXA 2QRKA 2X8JB 3I73A 4IDHA 5C4MA 3VLFB 2HC9A 3GJ4A 1S2DA 5EIBD 1JDJA 1QP4A 4TKVA 1ZESA 1JVNA 2APLA 521PA 4XB2A 1F20A 3RO7A 1HEIA 3ZZTA 2FLVA 1AUOA 2J3JA 2YIDA 2INGX 4K9LA 3STYA 3VSCA 2J48A 1KK3A 2WINI 2OV6A 4MYUA 5F5NA 2XXAA 4KVFA 2JZ1A 4UZFA 3BRQA 2B1RA 1CUWA 2BE9A 2DTXA 4XLZA 3ZWPA 3MELA 1YL6A 5KKCA 1UJ4A 1I3NA 1P33A 1QTRA 1XCOA 2Q8NA 1OIWA 1L5FA 1KWKA 1Z18A 3F3MA 1K3XA 1O95A 5EWJA 4XYEA 3AVXA 4JB0A 1YE3A 4FGZA 1JFVA 3LLVA 3EISA 1W85B 2E55A 3UEOA 4FMCF 3KOYE 2YJ3A 3QHQA 1WZUA 4UOZA 4UD6A 1KI8A 3T5MA 2B20A 3ITKA 5NULA 1KYWA 4QOFA 3BS4A 4EECA 1C1DB 3RB8A 4XBOA 4FFBA 1T29A 1OT3A 2G1KA 2WTBA 1W1IA 1BQEA 1D7AA 3E82A 3ZWCA 4RK6A 3IHKA 2QS9A 4ZJPA 3L41A 3N6XA 3DE1X 5DK6A 3HY3A 4W7HA 4CMHA 2QHOB 4WLUA 3U40A 1U11A 2P11A 2BM9A 2HF8A 3ZCUA 3T1QA 1ONPA 1OTXA 1M83A 2O2EA 3VAAA 4BYMA 2VJLA 4BQQA 4RF3A 2B1JA 2CF5A 2C84A 1N2CB 4OQXA 5JE8A 1BMDA 1EE8A 1ZH0A 1A4UA 1VKNA 4FCVA 5B1SA 1BJKA 5ECWA 4WBNA 2G9VA 1SHLA 1W4BA 5F2EA 4MW9A 5H68A 5LOVF 1SG0A 3MINB 1FLDA 3JQDA 4LMRA 1P19A 1COWD 1UBLS 2M98A 1U8CB 2B5WA 1RYFA 2PXHA 3BN3A 1EJ2A 3ZCTA 4G5SA 3CTWB 1T5IA 4ZXPA 2ZIGA 4X54A 1YFZA 3ZE8A 1NVMA 2UYCA 1Q74A 2ZBPA 2DJIA 1WW3A 4QRIA 3IP5A 1QGYA 2YYYA 2WLSA 3JRXA 1NP6A 2J3HA 1GGKA 4WA7A 1JSCA 2WE8A 1EFKA 1GPWB 5A1TA 3C4JA 5KTKA 4BNJA 1Y3DE 4H31A 1ABEA 2DKFA 5DM4A 4MCJA 4XDGA 4BGEA 4JIGA 4DHWA 3HHEA 4K88A 1P3JA 5D3MA 1CUVA 1U0EA 2D59A 4GD3Q 5H80A 2P0AA 4TS9A 1FP1D 1A3CA 4BV9A 4RLFA 1C3XA 3PPVA 3EB9A 3AKDA 2LNDA 3G88A 2Z3XA 1U2DC 4OLJA 2HA5A 4QUIA 3TNJA 4EJSB 3TLYA 4BVAA 1XK7A 2BPOA 4Z2AA 2BGRA 1RACA 4IYJA 3I1FA 4B40A 3R9WA 5AIBA 1NBEA 5T67A 2Z98A 4G4RA 3HXOA 5A3RA 4HLQB 4OYLA 1QC5B 5FPHA 1QG0A 3S1LA 4MEAA 4U7PB 2I34A 1E5DA 4JEMA 4W5JA 3TH5A 3OU2A 3EA5A 4E5NA 4KLCA 5HIKA 4LWPA 1H93A 1XP8A 2NOAA 1DEXA 3QKTA 1WP9A 1SKMA 3H3JA 3CKYA 2C82A 1P6QA 2GNAA 3DWFA 1LV7A 3E18A 3U39A 1LFAA 2YCBA 1T2DA 2DZOB 1FVOA 4I9HA 4MQFB 3VISA 4R7ZA 4TZ6A 3GP5A 5AJHA 4CLRA 3KOOA 4INAA 1NSTA 5GZ3A 3COWA 2P67A 4J0CA 2VTBB 2GJ4A 3IL2A 4LOLA 1JDZA 1G2PA 5KNCH 3PGXA 5JDIA 2ERXA 1VDZA 5ADUS 4KUGA 4CISA 4XWAA 4X92A 4NPAA 3A6KA 3JQAA 1CUIA 3FNGA 3O4GA 2B2NA 5E6SA 2YHSA 4I1RA 3U6KA 4TUWA 1G18A 1DKRA 1B14A 2IHKA 2VNIA 2P4QA 5TPZA 4B6FA 1KDTA 1GAJA 1IK4A 4TKVB 1DG3A 3MB5A 3V5NA 1PGNA 2I22A 2X4LA 3TFWA 2ZBEA 4LHEA 2NW6A 1AHIA 1E9DA 3ADPA 3W1EA 3FWNA 2EKZA 4RM3A 4LFBM 3F49S 2OQIA 5AJUA 1IQUA 3OIDA 1XNHA 4QYXA 1LBIA 2PWAA 5D1NA 2D0PB 2XXAB 1JAZA 1ISJA 3TB4A 4Z3DA 4X66B 3QX8A 2LXEA 1HYGA 1GA6A 1ZSVA 3OI7A 2ZZNA 2ONKA 3JSXA 2C59A 1NUSA 3JTEA 1BOFA 1U04A 2AYZA 1DP4A 1KBZA 4AG6A 2XNDA 2ZSDA 4JB3A 2OO5C 3FSEA 5K20A 4JYBA 3VBCA 2VYND 2IDJA 4OP3A 4CMJA 3A2MA 4RMGA 1IRXA 5AVRA 1XBTA 1QE0A 3A10A 1XMSA 4G89A 4ME6A 2KRKA 3SVLA 2RONA 5K8VA 4F4DA 4F4CA 2X2OA 3KTDA 1UF9A 2OCPA 4BE4A 1ZMRA 3V4RA 2Y9PB 2NADA 4CLXA 4AT1A 2C9MA 4FFBB 3DL0A 1B26A 2WUGA 2OE2A 1V3UA 1QLWA 2HWUA 1VZ2A 3K31A 5AVUA 2QTHA 3DA1A 4BAZA 5SYAA 4K87A 3ZZMA 1CHDA 4HFJA 4O1HA 4U5QA 4HQ6A 4LOHA 3RGGA 1SCIA 1WV1A 1V4BA 1NTRA 4TMTA 3QNMA 1UCFA 2WFAA 3PRYA 2B2CA 1VHJA 2R4UA 2P2LA 2QVXX 2YFKA 1VECA 1NR5A 4ZTBA 4W1RA 4UQLA 4M9CA 1U98A 1D6NA 5CDTA 3GLGE 5LCXA 1T8RA 3T7TA 5HQ3A 1L2CA 5E9QA 1XA3A 4GBED 4I5SA 2WHRA 4WBNB 4FYWA 5TB5A 3ZCQA 2YOHA 1D0IA 4C7OA 4TTAA 1L8XA 5U4QA 4UBOA 1M1YA 1PR3A 2UV8A