3R9XB

Crystal structure of era in complex with mggdpnp, nucleotides 1506-1542 of 16s ribosomal rna, and ksga
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
235
structure length
235
Chain Sequence
LVSEGVLKKIAEELNIEEGNTVVEVGGGTGNLTKVLLQHPLKKLYVIELDREMVENLKSIGDERLEVINEDASKFPFCSLGKELKVVGNLPYNVASLIIENTVYNKDCVPLAVFMVQKEVAEKLQGKKDTGWLSVFVRTFYDVNYVMTVPPRFFVPPPKVQSAVIKLVKNEKFPVKDLKNYKKFLTKIFQNRRKVLRKKIPEELLKEAGINPDARVEQLSLEDFFKLYRLIEDSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase Era
publication title The Era GTPase recognizes the GAUCACCUCC sequence and binds helix 45 near the 3' end of 16S rRNA.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/transferase/rna
total genus 65
structure length 235
sequence length 235
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2011-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3r9xB02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3r9xB01
3LKDA 1OR8A 3UA4A 3NVKI 2PGXA 3HM2A 3O31A 2XYQA 3HCFA 4Z2YA 3EEOA 1L9KA 1HNNA 2B9EA 4YV1A 3A4TA 3LECA 1H1DA 1DUSA 3R6TA 3SSMA 1XTPA 5U4XA 3ER8A 1SUIA 3BXOA 1G8AA 3DMGA 1L1EA 2PVCA 3GRUA 2ZW9A 1NV9A 2B3TA 2FHPA 3C3PA 1PJZA 4FZVA 1NBHA 2FK8A 3GRZA 4X1OA 3EMBA 5E1BA 2VP3A 1RJEA 2AVDA 4QDJA 5FULA 3Q7EA 5K0LA 1KYWA 1F38A 2PJDA 3ANXA 2VDVE 3FZGA 4PYMA 3HA3A 3C0KA 4QDKA 2PKWA 2A14A 2JHAA 2ZTHA 5EG5A 2BH2A 3L8DA 1D2GA 3HA5A 1JQDA 3BKXA 2UYQA 5T6BA 3ELWA 2O05A 3I53A 2H11A 4M37A 1QANA 3TR6A 1X1CA 2AOXA 3LPMA 3RODA 3M6UA 3NTVA 4GBED 2NNWB 1BKYA 4FP9A 1VBFA 2PLWA 2ZVJA 1NW7A 2P7HA 2ZBQA 3CCFA 3PB3A 4DM3A 4E32A 2AN5A 4DF3A 2IH5A 5K0EA 1KYZA 4IKPA 4P7KA 3GJYA 2GS9A 2NXNA 5EEHA 4CKCA 4DCMA 2AR0A 4PYIA 4CXMA 4RTJA 2FK7A 1XCJA 2AN4A 5LQUA 2JHCA 2P8JA 5GM1A 2G71A 3B89A 1VP3A 3KKZA 3LDFA 5DXJA 4EVIA 4FR0A 3G2PA 4RYLA 1DL5A 3KPJA 1D2CA 4RVFA 1X1DA 4A6EA 2C7PA 2ZBPA 3DH0A 5F2OA 4XUCA 4DZRA 3TFWA 4PYJA 3LBYA 3PLAE 3X0DA 4RVDA 4OX9Y 4PYOA 4L7VA 1RI2A 1O9GA 3G8AA 3AXSA 5GIPE 2CMGA 4YUZA 2FPOA 4OQEA 3M6WA 3P9NA 3DTNA 3MERA 3TRKA 5EKUA 4PONA 5E1MA 2PV0A 3AY0A 3G5TA 4QVKA 3GWZA 3VSEA 5K01A 4G56A 3FUUA 3BT7A 1XJ5A 3P8ZA 4U7PB 2O06A 5FCDA 2KW5A 5BW5A 4E2YA 4X60A 5K0FA 1JQEA 1T43A 4HTFA 4ER3A 2YVLA 2QY6A 3JWIA 4GOMD 4RTSA 1FP1D 5E1DA 4PGHA 3ID6C 3B3FA 2AOTA 3HEMA 5CD1A 3BZBA 5FA8A 3FPHA 5GP1A 3DR5A 5EZQA 2AOUB 2G8NA 3GRVA 3B5IA 2CL5A 2NXJA 2ZIGA 3K6RA 4HGYA 4ATNA 1XCLA 4C4AA 3CKKA 1SKMA 3NWBA 2C7RA 4RTOA 3OZTA 5T64A 3MAGA 3G88A 2ESRA 3OU2A 9MHTA 2IBTA 3KR2A 4HTFB 2YQZA 3OE4A 3PS9A 3LCCA 3UJDA 2EJTA 4BP3A 5K0JA 2IIPA 2ZZKA 3R0QA 3OU6A 1JQ3A 1MJFA 3NDIA 3M4XA 3AXTA 3LCUA 3ME5A 3RIEA 5EMLA 3FYDA 3BUSA 1YUBA 3FTFA 2P41A 2BR5A 5DTRA 4AZTA 5LQCA 2IH4A 5ERGB 1IM8A 3Q87B 2NYUA 5FWAA 5M5BA 2VDWA 1JTEA 2ONZA 3HCBA 5FWDA 5E2AA 5T67A 4PNEA 4X63A 3LX6A 3GU3A 3EGEA 4RX1A 3KPYA 2QE6A 3MB5A 2PSSA 3P2KA 3LL7A 5LQKA 5FHQA 1RJFA 5EMJA 5LQAA 5CCXA 4YUVA 1NE2A 5EPEA 3FRIA 1JSXA 2JH8A 5E9WA 3UJ7A 3KQTA 2IH2A 3B3JA 4YV2A 2XBMA 1WXWA 2FYTA 4YUXA 2DPMA 3GXOA 1ZHFA 4E2WA 2WK1A 3HVHA 2I6GA 2YR0A 4HC4A 1XDZA 4CWAA 3D2LA 4P7FA 2AVNA 1EIZA 3DLIA 4EKIA 8MHTA 5FA5A 5K05A 3DXXA 10MHA 4KIGA 4FT4A 3DXZA 5DX0A 1ZKDA 4GOLD 1ORIA 3KPWA 3QV2A 4E2XA 3FPJA 5EOVA 5DX1A 3PTAA 2R6ZA 5C1IA 4PCAA 5BW4A 1JG1A 3OFJA 1NT2A 2JJQA 4PYNA 3KQWA 3OU7A 4PYLA 2AS0A 5ICFA 3KQPA 5K09A 5EEGA 1NBIA 1WY7A 3LGAA 2PWYA 2OZVA 5E8JA 3FUXA 2ORED 1R74A 2VDUE 3B3GA 3JWGA 4FSXA 1QZZA 2AOVA 4E30A 5LQNA 5D1NA 1X19A 4MIKA 2OY0A 1AQJA 1R8XA 4KIFA 1R18A 3TMAA 4ER7A 3NMUF 3MCZA 4POOA 2QM3A 4V0RA 4HGZA 2ZSUA 5DTQA 2FRXA 4E33A 3I5UA 2ONYA 1FPQA 4DMGA 1FBNA 2E5WA 1KXZA 3ELYA 1WZNA 4ER5A 1VLMA 3R9XB 3PX3A 1VQ1A 4CKBA 3KPUA 3GNLA 1Q0SA 1ZQ9A 3FUVA 4MWZA 5EIFA 2PT6A 3E23A 4QTUB 3FUWA 1NV8A 5GM2A 2AOWA 3HA7A 3BGDA 3ERCA 2XYVA 1SUSA 1VL5A 2I7CA 3ORHA 4YV0A 5HIKA 1KHHA 3PT9A 1M6YA 4C06A 3B7PA 4YMGA 4UOEA 3GRRA 4M36A 4PWYA 4QVGA 2XVMA 1KIAA 5K0BA 5CVEA 2QYOA 3SMQA 2ZWVA 1VP9A 3MTIA 4K6MA 4RTQA 3HCCA 2OB1A 4RTPA 3TKAA 3GCZA 4WXHA 3SX0A 4AZVA 4MQ4A 4IV8A 5E9JA 2HWKA 5ICEA 3NJRA 3EPPA 3THRA 2R3SA 4C04A 3I58A 3QOXA 4RWZA 5EZSA 2ERCA 2DULA 4DQ0A 2PXCA 2GB4A 2YXLA 3M6VA 2ZWAA 3DUWA 2Z6AA 4PYKA 3BGVA 5EKXA 2ZLBA 1JG4A 1SG9A 2OKCA 3G2QA 4X41A 3UJAA 3UA3A 1G38A 2B78A 2UYOA 3OCJA 4EK9A 5BP7A 2IBSA 2G1PA 2OPBA 5LSAA 4R8RA 2AZTA 5ICCA 1VE3A 4DKJA 4GC5A 2AOUA 3ELUA 3MCTA 3UZUA 5KQRA 3GGDA 3UJCA 4RVGA 2IFTA 2P1DA 4PCLA 3SR4A 3KHKA 4BLVA 1SQFA 3E8SA 1X1BA 5K0GA 1VPTA 5JUWA 3TM4A 3GIWA 3FUTA 2BR3A 3P97A 4FSDA 2ZZMA 3OE5A 2IP2A 4RSRA 4OBXA 4AZWA 3AJDA 3LBFA 4P58A 5E1OA 1U2ZA 2Y1XA 2I9KA 3IYLW 2VZ9A 3G2OA 1NW3A 4B17A 3EVGA 3JWJA 5K8VA 1KR5A 2G70A 5FUBA 3HVKA 4YUWA 3FPGA 4EQZA 4PGGA 1RI3A 3EVAA 1TPYA 4EMSA 4XUDA 2B25A 3QOWA 3EGVA 5F2KA 5DWQA 3C3YA 2ZIFA 2B2CA 2EJUA 2PX2A 3PVCA 2F8LA 4O29A 5HEKA 5HFJA 3C6MA 5E8RA 1XDSA 1P91A 2EFJA 3KQMA 2QRVA 3G5LA 2PT9A 3A7EA 5DM4A 1P39A 4RTNA 3A7DA 1SQGA 3A26A 1N7IA 4M7RA 5DXAA 4P7GA 1IXKA 3EVDA 1G60A 2YUIA 3P9KA 1I4WA 4KW7A 3FRHA 4PIPA 5FHRA 4KRGA 1FJXA 1JSZA 3G8BA 3KQQA 4QPPA 1BHJA 2BM8A 1HMYA 3MTEA 1XVAA 4GF5A 4GOND 3LHDA 4RVHA 5G02A 2NP6A 2UYCA 1XDUA 4FS8A 4QQNA 1Z3CA 1KPHA 2V74B 3KQOA 2QRVB 3ELDA 5DT2A 4EKGA 2NP7A 5E9QA 1L3BA 1NW8A 2NXCA 2EX4A 3KU1A 3KR9A 4LWOA 3OZRA 5DRTA 5E2BA 5HILA 3REOA 2Q41A 3CC8A 5ICGA 1QAOA 1JG3A 4OA5A 1WXXA 5CVDA 1P1BA 3FPEA 3M6XA 2ZZNA 1QAMA 3LKZA 2ZBRA 4P7JA 2OXTA 3PX2A 5EIWA 4R6XA 1O54A 5EMMA 2GPYA 2C7OA 1Q0TA 1WG8A 3DXYA 5KVAA 3A27A 1TW2A 3TQSA 3UJBA 5DM2A 4BP1A 2AN3A 4E70A 3HCEA 2HV9A 2OO3A 3OPNA 3OZSA 4ER6A 5K0NA 4C05A 2GLUA 2OBFA 3MGGA 2P3OA 2H00A 1L3CA 3BWBA 5DSXA 3VYWA 3KQVA 1B42A 3DOUA 4M38A 5DRYA 5EVJA 3IEIA 2K4MA 1EJ6A 3UBTA 1YFLA 3GO4A 4JXJA 2PBFA 3EVBA 2BR4A 3AWIA 2WA1A 1KPGA 2ZULA 1RI1A 3KPVA 4R05A 5D1HA 3T0IA 4V0QA 2HR1A 3H2BA 3FTDA 3HCDA 4RTRA 1R00A 2JH9A 4YMHA 5C0OE 3NWEA 2CKDA 5P8WA 5GINE 1MHTA 2CWWA 3NDJA 2O07A 3P71T 4KWCA 2YTZA 2YX1A 2G72A 2XYRA 3EVEA 3FPFA 3G2MA 1NW6A 1JTFA 3VC1A 5HZMA 3SVZA 3FTEA 5K0CA 4IV0A 2IDKA 1AV6A 1ZGJA 3KQYA 4LWPA 2ZCJA 2OYRA 2OB2A 3E05A 3V97A 3RW9A 3UJ9A 2JG3A 4HRAA 1Y8CA 5DM1A 1EAMA 2PXXA 3EMDA 2ZFUA 3IV6A 1L3IA 4F85A 1KP9A 1N2XA 5K03A 4GOOD 1SVUA 4H0NA 4RTLA 1FP2A 1RI4A 4Y30A 4C03A 1UWVA 4Y2HA 1BOOA 2IPXA 1N7JA 3EEYA 2PY6A 5DSTA 3BWCA 3T7SA 5DX8A 1AF7A 2P7IA 3JWHA 2H1RA 5GIOE 4CTKA 3BGIA 3HNRA 3TLJA 3PFGA 5KQSA 5B1SA 2PX8A 5DPMA 5HIJA 1NW5A 1JG2A 3CVOA 1ZG3A 3LDGA 3LSTA 5EQJB 2N47A 1UFKA 3SXJA 3UJ8A 4AX8A 1F3LA 3G89A 1M0EA 3HVIA 3CJQA 3SM3A 2UZ4A 3FYCA 3EVFA 5HIMA 3P9CA 5HIIA 5IKMA 1TW3A 5C9ZA 1RJGA 2BM9A 3DP7A 5FQOA 2O0LA 4F84A 2HMYB 4CTJA 5H02A 4KDCA 2XVAA 3BWYA 4XCXA 4PIMA 1G6Q1 1P1CA 3CJTA 5EHGA 2HTEA 5DM0A 1ZGAA 2LD4A 1NKVA 3EVCA 3U81A 3V8VA 4C07A 5EMKA 2C7QA 3MHTA 4ZTBA 2PWPA 1WS6A 2GA9A 2GAFA 1O9HA 1G8SA 4MHTA 4GC9A 3K0BA 4R6WA 2Z6QA 1QYRA 3WSTA 4OBWA 3HP7A 5FTWA 2ADMA 2FCAA 3NVMB 4U7TB 2P35A 3M70A 4X61A 4RTKA 5MHTA 1INLA 3P2EA 1G55A 3GDHA 1JR4A 5CUQA 3R24A 2JHPA 4AZSA 4DA4A 4KDRA 3FTCA 1IY9A 2PXAA 3A25A 4GEKA 4WVLA 5CVVA 2PX4A 3SSOA 4BLWA 3UWPA 2V7EA 4NECA 1EQAA 2BZGA 4QPNA 4GQBA 3UFBA 3CGGA 5CVJA 4OQDA 2P3LA 1ORHA 4ER0A 3P9IA 3OFKA 1I9GA 3DMFA 3TM5A 2CMHA 3DMHA 3HCAA 3G7UA 1M6EX 5DLYA 5GOZA 1R8YA 5KS2A 1RJDA 4E2ZA 4BY9E 5FQNA 2IGTA 5EC8A 3F4KA 2VS1A 2EG5A 1V39A 3MQ2A 5GWXA 4BLUA 5F2NA 5LQJA 3O7WA 1KPIA 2P40A 3E7PA 1R6AA 4LG1A 5EHIA 5IH3A 3CJRA 3M33A 4PINA 4IWNA 3T7TA 5LR6A 4PYQA 5LQRA 1I1NA 1YZHA 3KQSA 3TPZA 4FT2A 3EGIA 4HG2A 2AOTB 2YXDA 4DCGA 4R8SA 3HTXA 2HNKA 3PFHA 3UJ6A 5CVUA 4MTLA 2IDJA 3CBGA 3LDUA 3R3HA 3LCVB 5CIYA 4HSGA 3ER9A 1AQIA 4GUAA 4CKEA 1BC5A 1D2HA 3S68A 2Z6UA 4F86A 3P2IA 1X1AA 5HOQA 1XXLA 2I62A 3HVJA 3SSNA 3IHTA 5KYGA 3DULA 4QQKA 3THSA 4LECA 4KVZA 4OA8A 4XUEA 2YXEA 3NW9A 2NXEA 4A6DA 5EGSA 1YFJA 1YB2A 4FGZA 4HH4A 1QAQA 4QTTB 1YZ3A 2ZIEA 4C08A 3VC2A 4E31A 5JR3A 1VIDA 3EVZA 2UYHA 7MHTA 1UIRA 1YF3A 1RI5A 5CCBA 3I64A 1DCTA 2GH1A 3BWMA 3T7RA 3TKYA 4RTMA 2O57A 2P3QA 3KR0A 3KR1A 5CM2Z 1EG2A 2PX5A 4AUKA 3BKWA 3C6KA 5BXYA 4RV9A 3TOSA 1EJ0A 3SGLA 4YUYA 3O4FA 2WA2A 1PRYA 2Y1WA 5FADA 5DTMA 3DLCA 3I9FA 3GRYA 4ISCA
chains in the Genus database with same CATH superfamily
1BWQA 3NVKI 4MZDA 2I22A 4FGKA 3ESXA 2X13A 1E32A 4MHOA 2XKAA 2FK8A 5E1BA 1JEOA 4H3VA 3EIUA 5IKPA 2PKWA 4UOZA 3BFVA 1Z07A 1TIPA 3D5EA 1PL0A 3SZMA 1IVNA 1XTKA 2QQGA 1MX1A 1XQXA 4GYWA 3IAM6 4CQMA 2YBDA 3WYFA 4K0KB 1UWCA 2WVAA 3F5DA 3DZGA 5FYDA 3RS3A 3QXHA 5DW0A 1Z5ZA 2WJWA 2II6A 2QPLA 4HDSA 4UE2A 4EARA 2AUTA 4CI9A 2OV4A 2OHFA 4R5MA 4RPKA 3SC2B 4MVWA 5EJ5A 3I2JA 1Z7WA 3U44A 3CLSD 2E3JA 2BFMA 2QCUA 4HGRA 3O8QA 4B3SB 4BEWA 2I87A 1IXZA 1RYBA 1OZAA 5ICSA 2GJ8A 1ADGA 2YQZA 4DUGD 3INTA 4MZXA 1H2AS 3VYRB 2ORYA 1OU4A 2ZI5A 1UFVA 2PAAA 1HMPA 5G40A 2QE6A 5FHQA 4PAGA 5HCIA 4CM8A 3K6JA 2BLLA 1U8ZA 2M6KA 3PD7A 2D2XA 5KHOC 1BA2A 5J2UB 1EUYA 2EL9A 2HHHB 2PHZA 3R75A 3GQ5A 1JKMA 3NOVA 1C5KA 4M9QA 1CIVA 3QVWA 1L7VC 5H37D 1U7OA 1RYFA 4HOYA 1S2NA 3K70C 3KOWA 1HFJA 3SMQA 1AS0A 1N34M 3GQBB 2OO9A 4OSOA 4WCFB 5I9NA 4QGHA 2X0FA 4CCYB 1PEAA 1TT5B 4P0PB 2ZLBA 1JG4A 2W83A 2A1TR 2C94A 4RUKA 1HEIA 1N78A 2AW3A 4Z0PA 4G1UC 5JD5A 3GPIA 1EK0A 2QBYA 2XHEA 4YS6A 3V34A 2XX3A 1F8GA 5LDDC 2PLNA 3Q0EA 4JKYA 1WXDA 3OJFA 4TQAA 3PWTA 2YOFA 2FG5A 3C98A 5FBWB 2IBMA 5C80A 2AIRA 1QF7A 5JECA 3VNAA 4QBHA 3VR5A 4QQNA 1BXGB 4B83A 1VPEA 3O90A 2PMBA 2WQ6A 4HYQA 3OKAA 1JQBA 3DD1A 3UW1A 1KI6B 3K0KA 4E70A 3OX1A 4C3VA 3P4XA 1U28A 3L1UA 2K4MA 5BW8A 1EGAA 3BJIC 1GYQA 2Q1TA 1Y4UA 1O96B 1HORA 4FFRA 4QNNA 1A5BB 3FX2A 3THXA 2QQ8A 3JAWA 1HUQA 3PQ8A 1QNFA 3LVRE 2O8CB 3D8NA 3QE0A 3P1JA 2C59A 4N5LA 4YJ2B 4AS2A 1F6WA 2QMHA 2J3MA 3PEYA 2CLKB 1GNPA 1OQYA 3MHTA 1BHO1 1I5EA 4C3OB 4ARVA 1YC2A 1N34B 4J49A 3GJ5A 3BK2A 1L6IA 3QZUA 4TLLB 5TQ2B 2MYPA 5CUQA 1TF5A 1R0SA 3ZHTA 5CLGA 1PNQA 1R2QA 4KYVA 2EKFA 5J1TB 4JX9A 3MQ2A 2ZRPA 4LG1A 3SIPA 1C7FA 1CJKC 4HDNB 1UBMS 5JAIA 2CFCA 1NDUA 2F5PA 1C8BA 2AHMA 2GVDC 3HX3A 4G5YA 5IHXA 3FHLA 2IF0A 4D0LB 4PHCA 4TV9A 1X86B 3E9EA 4IWYA 3BKWA 2ZS8A 4MX8A 1JHRA 3BQ9A 2J09A 3JYQA 2AQHA 4AZFA 3A3PA 3FFWA 2PGJA 1ZMTA 3NIFB 5FTJA 4DRXB 3K2LA 1YQXA 4B0OA 2X1VA 1NXVA 3JPWA 2DVMA 1CUXA 2PM8A 3E5MA 1PNVA 3K8ZA 1BKYA 2FFBA 1Y6JA 1SFRA 1EVJA 3HLTA 1J99A 1OV4A 4DJFC 3LX8A 3MWDA 4CIAA 3KSXA 4RYLA 2WMOB 1C0KA 1XL1A 4BNYA 3ZTTA 1R1DA 1S5PA 2XZTA 4JFRA 4B4OA 5F9MA 3Q0IA 4EVRA 2WTEA 1QP4A 2P2SA 1XXHE 3BFKA 1ZLXA 1XZEA 2GMWA 4FMBB 4DPLA 3WI7A 4MCHA 5EZQA 3U7IA 3RUHA 2FUCA 2JRCA 1QTRA 2Y2VA 4GHLA 2QOEA 4KPUA 5FPPA 4IHQA 1X7ZB 3H9GA 1Z25A 5M5BA 3QVLA 2R48A 2Q8QA 1FTQA 5B3AA 1H5NA 1B93A 3LL7A 4C14A 4A1FA 1BEZA 4QODA 1UPUA 4FXOA 2JKVA 2SKDA 1EWTA 2GR9A 3ZK9A 1JDBB 2ZATA 2XMZA 3UHPA 1GY8A 2FUEA 4EJ2A 3AB8A 4P3YA 3TTTA 3HDHA 1KJNA 1NBIA 3KYJB 4GM1A 3QHAA 4ID3A 3GC6A 3TJRA 1G2PA 2OY0A 1N7GA 1HLGA 4JA0A 2O4CA 4NYIQ 4QUJA 4ER5A 3KPUA 1M33A 2HU2A 2WB2A 4BX8A 5BYJA 5JDCC 4HDCA 4NDAA 2ZRDA 3H42B 4NENA 1Z0KA 1YRWA 3KZOA 4KWHA 4JR0A 4TKZA 2X40A 1IDOA 3EASA 4C04A 3I58A 4UQPA 3K0FB 1JJFA 4MLZA 3H99A 3TB4A 3BFXA 4DDKA 4TTRA 1L5NA 3NWJA 2VPTA 1EI9A 3SZGA 3K0AA 4KR3A 1DADA 3JAMA 1GARA 5AFSA 2XGJA 4HV4A 3ZE8A 2J3JA 1GL9B 1H9AA 2C42A 1GGHA 3GX1A 1E6CA 2C29D 3GLQA 3H5IA 3K0CA 4CLRA 4WH0A 4OSEA 3EVAA 3DPSA 3I4LA 3ECSA 1NBME 1KI4A 3BCHA 5BOVA 1E4OA 3OT1A 3V6LA 3VJKA 3PNSA 4MR9B 4CDMA 1R4NB 3F3YA 1BXZA 4KXQA 2ZUTA 1TO6A 4BAZA 1A2BA 3C8ZA 3QMWA 2NXCA 4ZI3A 3TYXA 1W4CA 3K8QA 4AX4A 3CNBA 3E61A 1UFZA 2QXUA 5AXDA 1GAWA 3ZWAA 4EAAA 2I7TA 3IEIA 3QW2A 1J21A 3IUMA 5D1HA 3STVA 1AHHA 2P9JA 4ENSA 2P0YA 2HQOA 3W8NA 4Q3OA 1FDUA 1I3LA 1TQDA 4RF4A 3PNVA 2GBLC 1KDPA 3VDRA 3U16A 4Y0AA 1F8YA 4PHFA 2DUJA 2H18A 2YXPX 4KK3A 3LT1A 4D02A 3WLPA 4TPKA 1ZG3A 1N9KA 4IFTA 4LZPA 4JEHA 4WTOA 2BKVA 1KMHB 4YRIA 4X1YA 2RAVA 1AKMA 4YJKA 1GA4A 1OGIA 1PR9A 2RHGB 5AVXA 4MS1B 1G8SA 2QVXX 3OFSA 3RCBA 2G3QA 2YASA 3KT6A 2H1LA 4Q1CA 4OQ4A 4KDRA 1JLMA 1YKGA 3SSOA 1DJMA 3ZGZA 2GXQA 4OQDA 2KW0A 3AEYA 3NDBB 5DNEA 2UXCM 1VIAA 3UXMA 1X3SA 1VFNA 3ZV7A 2GBGA 1SXJD 3OWHA 2VAWA 4DDHA 4B4DA 4F06A 2AEFA 2ZTUA 2I67A 3N59A 3AONB 4DDUA 3ETLA 2DKFA 5SYAA 4ZC1A 5JR3A 1NVMA 3T3HA 3U3OA 4RVNA 4EEZA 3JY6A 2LIPA 4YJHA 5C3MA 4DLVA 4FFBA 3RVPA 4NI5A 1W0JA 4RVCA 3NBIA 3DV0A 2VP9A 3ZPXA 4C88A 4DSOA 1L9KA 2FFHA 2B1JA 1EFPA 3UFXA 2ZU6A 2V0NA 1A0OA 2REBA 1L5MA 3URKA 5F64A 2ZIZA 3NTVA 3RRXA 5FFNA 3FSGA 4C1NA 4WJZA 3FBWA 2QROA 4TKMA 4HEJA 4H7FA 1D1SA 1O94C 5A3QA 2F43A 5A5FA 2OKGA 4PR3A 2D6FA 3ROEA 4EQ6B 4PS1A 1YLAA 2BDUA 3ZXSA 4N41A 3GT0A 1WZCA 2Z98A 2Q8NA 2JI8A 3OX2A 1NUQA 3WGQA 4JHXA 3Q7SA 3L2OB 1YIDA 3H0KA 1V1MA 3VBCA 1DJOA 1YUBA 2BR5A 2W22A 1Q6YA 1E58A 4KDEA 4QFBA 4PLFA 2BGRA 1EHYA 1U3FA 4N5DA 2QSYA 2O2JA 3QYPA 3MB5A 1GPLA 3GDWA 1Q1AA 4YP5A 2J3IA 5FPHA 1NXXA 1NASA 5A71A 4UEJA 2XE8A 5T4BA 4P3NA 2PKYX 2A88A 3PICA 2UXCB 3X1MA 3ZNNA 1IQPA 1AQLA 4D4IA 2EOAA 4JJ8A 4E22A 1M2VB 4I1OA 1L8XA 1CZHA 4RGVA 1MB9A 3ZV6A 2J0EA 2FF7A 2E4UA 1FSFA 5C4MA 1LDMA 3JRNA 4HPXB 4QU8A 3D7LA 3EYWA 2OCKA 5LQMA 4RH1A 4FZ3A 4JYBA 5LZ4A 1KMQA 4CKBA 1CFJA 2PFSA 4BPBA 4Z3DA 3TS1A 1HGXA 3UCEA 3ZE9A 4DVGA 4YCBA 3PL5A 4P7BA 3ZEIA 4ED9A 1K7EB 3TKAA 4RAOA 2EJSA 4DV0B 3W1VA 1OIWA 1CETA 4HFMA 1D7OA 5LYYA 4M22A 2XLJA 5EE9A 2OILA 4TLMB 2BTEA 5AW8A 3GOQA 1NYTA 4P36A 1AJEA 5JS1A 2OV8A 4LNAA 3GFOA 4LOLA 3SLGA 4L5AA 4II3A 1TF7A 2OHOA 5DCLA 1OAIA 2WEKA 4OMCA 1OX6A 3P20A 5ESDA 1Y1PA 3VR4A 5JWRA 4HP8A 3L0ZA 3E18A 2FZ4A 1EXWA 4IILA 1IEQA 4IDDA 1SPBS 1R5JA 5FKJA 1DBSA 5EL0A 2ZYRA 1R3DA 4I6JA 4IO1A 3S2FA 4LF8M 4IJQA 1ZQ1A 1N9ZA 1FMJA 3OLYA 4BXOB 4FLMA 4L02A 5L4SA 5I8ZA 3K9BA 2LXNA 2E2WA 1DRJA 5KTPA 2B34A 2ATCA 1GRRA 1JTFA 1J8MF 4Z3OA 3MN1A 2OCYC 4B34A 2C7GA 4P08A 2QVBA 4Y9SA 4H08A 4NYJR 1PZHA 2YIVX 1FNMA 2WPDD 2R1VA 4CV1A 4WKCA 4URUR 1YCDA 3TD9A 4ITUA 4G0XA 1PL6A 4RD6A 1NJ8A 4XCQA 1K3UB 3SFZA 5DNYB 2YNMD 4B8WA 2BM9A 5D8DA 3BZUA 3GFBA 3KS9A 3CJTA 1A8SA 3LW5F 3QLUA 3ZWYA 2C7QA 1MV5A 5KTMA 4M7OA 4K9KA 4DSZA 3AEKB 1ZX1A 2C9BA 2DWMA 3NTOA 4O8CA 3RKUA 1AF4A 4P17A 4QLOA 2VJBA 3GPBA 1XO1A 4LRWA 1CQXA 2C3OA 5A6SA 2VHUA 5CYPA 2EFHB 2EVWX 1RWNA 2IS2A 4EJFA 4I66A 5CCEA 5DGIA 2CHUA 4CN8A 4PAOA 3TXYA 2E4WA 4YUYA 3N39C 5HBRA 4L4YA 1NP3A 4C2BA 3ESYA 5EWJB 4BB0A 1KDOA 2GAIA 5H3LA 2QTZA 1GHTA 1MOPA 1LF0A 3Q4GA 1LXCA 1W25A 1ZL0A 4LF8B 1PFWA 2GWRA 3M34A 1D0IA 1HL7A 1P17A 5F4BA 3OQIB 1W36D 1LQ2A 1S01A 4DA6A 2EKDA 3RHFA 2VVTA 1JHXA 4KPGA 5KEIA 2IEBA 5FB3A 3TFWA 5K8CA 3VAAA 1KAHA 3VSBA 3FYTA 1KQPA 4K40A 4UUOA 3QYFA 2PV0A 4DRYA 2H65A 1UAYA 2JVIA 4X60A 1DOHA 1DWQA 4RY9A 2C99A 1H1LB 4Z53A 4C4AA 4HYYA 3WWCA 4XWTA 3VR0A 3PRJA 2FFRA 2AG1A 2R6FA 3LCCA 2PMDA 3N9IA 1GKIA 1K3XA 3PI6A 3M4JA 2ZAOA 1PR6A 5D7NA 5LBTA 1FDVA 3WMRA 3VVBA 1GTG1 3FCOA 1L5KA 3WLNA 3QYJA 3UUGA 2ZK7A 2IODA 1SVOA 5K4AA 3TIXB 2X42A 3TDNA 1QFJA 1ZK3A 1U5BB 3I9KA 3NHMA 1E59A 4XIFA 1U63A 3NRCA 4GITA 1RWMA 2YFYA 2EA0A 3F74A 2UVPA 1F0YA 3SE7A 4IXDA 3DB2A 3IERA 2VC2B 2PKQP 3BMOB 4K88A 2DJIA 3KLMX 4ZHQA 1MX3A 1Y9ZA 3NUGA 3QPAA 4KE7A 2CBGA 4QBKA 4R2HA 2R8EA 3LCJA 4LYYA 4ZEWA 3HSKA 4GRAA 4TGLA 2Y1FA 2XYHA 1CJCA 2AOUA 3T0FA 3ANSA 3F6PA 5DM70 5HHTA 1ISIA 3JQAB 3R40A 1B3BA 3HYTA 3KFVA 1PDVA 3QVUA 5LN1A 1DIHA 1KEEA 3EHDA 3WFIA 2JZCA 2B4KA 5HCNA 2P5TA 4FFMA 2P2DA 2HOQA 5G53C 3T52A 3KXKA 1TVMA 2R7NA 3T9AA 3L4SO 4IBFA 4HYEA 4L9WA 3RV4A 5J4VA 1EGHA 2XKJE 4JXZA 2OESA 3AFMA 4MVXA 2FMKA 2C4WA 1PBNA 3T8YA 1GIAA 2F5SA 1UBEA 4WLOA 2HI0A 1SIUA 4X92A 1OT3A 2IUYA 2ZBRA 3JSAA 2F55A 4BKQA 5KVAA 3ZDDA 2ERYA 5CXXA 5EWMA 3NHBA 1NF2A 3S4YA 1PS0A 1ZD4A 3KYCB 2K47A 4M1ZA 5JV5A 2F4NA 2EJBA 5A3RA 3PNBA 1JR6A 2I55A 4YACA 3W6NA 4EF6A 5CTAA 1M83A 3NIWA 2V1UA 5FTKA 3T6KA 3KKNA 2XYGA 1Q11A 4I81A 3KOYE 3DHVA 1E9BA 2NVBA 2JDID 4ZODA 1E3WB 3WQSB 2EFEB 4B7UA 1FXWF 2O5CA 3BWCA 2OD9A 2IHTA 3JWHA 2AG6A 4CTKA 1SU7A 3X2SA 4KUEA 4MWSA 4FEGA 4GE3A 3KT8A 5D3KA 3TI7A 2EW2A 1UDCA 3N2GB 2B5WA 3LC0A 4P53A 2G83A 2J0UB 3PGA1 1G18A 5JQWA 3PJRA 3RBZA 5T4FA 3K0BA 4RIEA 5L9AA 2Z2ZA 4Y2UA 3DXFA 2C77A 1CRQA 2HMUA 2BP7B 3ZW8A 4L3WA 4M55A 3S3TA 1OU0A 3H9QA 5GOZA 1IYZA 4EPTA 1BKSB 3F6RA 3NLLA 4RHXA 4O2AA 3SAJA 5L40A 4F2PA 5K8LA 3FSRA 2YXDA 3VYVA 5JH7A 1PJRA 2XXAA 2V5UA 3TWKA 2DAGA 3AVPA 1VL2A 3IULA 4YIHA 3DEHA 4MGEA 1F06A 4CRWB 2ZRCA 3FYUA 5BOSB 3C6BA 1V71A 2YH2A 2C2XA 1E2NA 3JVEA 1I4LD 3OZBA 3QEOA 4LF9M 4PDIA 1HNZM 3G9QA 3Q72A 4RLFA 1MIOB 4HEOA 3DAPA 4M9CA 5IVHA 2MMGA 2HF8A 4L57A 2B4YA 2C5EA 5L51A 4N6GA 1US8B 3CG4A 4OIFA 5H4HA 1ARZA 5IVKA 3OQ1A 1T91A 2IZOA 3HZOA 5C8YB 4O4HF 3B6ZA 4RZHA 4AJEA 5D5HA 2GFQA 3I1FA 4P3OA 3CRMA 3QU7A 4GT1A 4Q1DA 4WOJA 4CM1A 1MX0A 4BQOA 1GSHA 3Q9SA 1CY8A 3LRPA 4K9OA 4M8NE 2FV8A 2FMFA 1I51A 3OZDA 4F92B 1ZOSA 3BPSA 1R8SA 1TMGE 2H54A 4WDRA 4TWJA 4AQ7A 2Z58A 5DIZA 1UR5A 3PE6A 4RDHA 4LJ8A 1H9CA 5I48A 2CZCA 3ME5A 2HHCA 4PGMA 3CUWA 1BCRB 1IY1A 5JXGA 3W9YA 3SAWA 2Z2XA 4N3AA 2ZR0A 3P2KA 1RJFA 3J81A 3SE0A 2JH8A 3KQTA 1F8FA 3TQQA 1HT0A 1P0IA 3QPDA 2FZKA 5JSKA 2PGIA 1L7NA 1V5EA 1PR2A 5EJ2A 5A7FA 5LOVA 1RAHA 1EE2A 4FSXA 1L5HB 4CV0A 5C7LO 1Y6FA 1OYVA 3TG8A 4WXPA 2G9RA 1NX6A 4QUHA 4B7XA 3RRZA 3OO1A 2C3PA 3IBCA 2FMXA 4MWEA 1RXUA 4L15A 5DNAA 3Q5GA 3QWBA 3B5JA 1GT6A 1UXKA 4P2GA 4LF9B 3Q7RA 2Q7DA 1HNZB 4HB0A 4CPDA 1DO8A 4RF3A 4GICA 4AUEA 4KO3S 3TE7A 5EZSA 5B7QA 4JLJA 5LXTA 4YYZA 4V2UA 3FW1A 4AO7A 4PFJA 4NY1A 3O3MB 3EWAA 4HAVA 1IN6A 4MINA 4CFSA 4TLCA 2QTAA 3T1TA 2BEUB 1O0CA 4Q93A 4DILA 1RXSA 4I9HA 1G7SA 4GX5A 3KDSE 5IDQA 3IYLW 3GJTA 3CH5A 3WIEA 3CONA 4LN1A 2PFKA 2VPYA 3SG0A 3QITA 1QS0A 3BMQB 4JP2A 1P39A 2H92A 5BSWA 1U7HA 2IXGA 3WNDA 1ZEJA 4Y2PA 5DK6A 3REOA 1S0UA 2NYVA 4DCVA 1JX6A 5JTUA 4P81A 1MG5A 3SJUA 3KS8A 4ZC8A 2W58A 4EENA 5DXFA 3PQDA 5TT0A 3OEYA 5EHQA 2L17A 2EEZA 2FQQA 1G98A 1M67A 3B48A 3CY6A 1MR3F 4JYMA 4ARZA 3DQPA 1M6WA 4M1QA 4P4SA 5HZMA 4K86A 1QE5A 4BFCA 2JG3A 4M6WB 2W90A 4W8HA 1RVV1 1Z7GA 2PKCA 4EI8A 4BC1A 4PPFA 4WFIA 2VWQA 5CCDA 3HU3A 3BD8A 4IDAA 3MAJA 5F2EA 2B0CA 3T5CA 1A1VA 3KE8A 2P7IA 3L6OO 1F60A 4N48A 1OMOA 2AFVA 2Z2IA 1KOFA 3L5OA 1BS1A 3HDVA 5FNZA 1HZZA 3KM0A 1BNCA 4GLOA 4I14A 2GRUA 5I01A 1IB0A 4PC2A 1Z5UA 3H5LA 3USES 1C4KA 3F6YA 3IALA 3RU9A 1I36A 1YQUA 2CUTA 1WF6A 5LP6F 3ZE1B 5CVJA 2GASA 1DIRA 4PX3A 5AM3A 4ENVA 2ATEA 3GZNB 1WU8A 2H2FA 1WKBA 4ENQA 4RJ2A 1E5VA 1XP8A 1CR2A 3HLYA 2JAHA 4FQ5A 2IDJA 3BRWA 4PQEA 2LVPC 1POXA 4TYMA 2FH0A 4IXTA 4OQXA 1N6OA 3OM0A 2YWCA 1QH1B 1T8SA 1DLJA 3PNQA 4HVAA 3DEAA 2VNIA 4Y6LA 1IXSB 3DT9A 2OBBA 4KI0A 2PGDA 1Z47A 4GI2A 1L1ZA 1IBCA 1JL3A 4FKBA 4TXMA 2F4VM 4RF1A 4DV7M 2QX6A 4QWMA 3ZXXA 3GUCA 1HWYA 3B7ZA 4R7GA 3FBTA 3BXXA 1XZIA 3FTPA 2CUZA 4W6QA 1L8AA 1JJVA 4FN5A 3VO2A 1M1YB 1W5EA 4YREA 3HI6A 4B6GA 2JUJA 2PRYA 4EW1A 1WOMA 5TMDA 3UH1A 3BCSA 4WNAB 3BCUA 3C5VA 1PFQA 4B84A 5FI1B 2HIMA 2DCMA 1N8TA 3EDQA 2YDYA 1TKAA 1G19A 2N9UA 2OYSA 1PT5A 3U4AA 2GJAA 1NVEA 1IONA 3KR2A 4G4OA 3WLAA 3QP9A 4JJAA 4AQDA 5LU8A 1JSRA 2HRBA 5AVZA 4Z7OB 4D45A 2IP4A 4F1IA 4I3FA 1MTOA 1SIWA 4B6PA 2BD0A 4NL4H 2RFLA 4IIBA 2QXYA 5KYYB 10MHA 3H04A 3V9AA 4AI6A 2V98A 1QQTA 3QUCA 1KTIA 3CUSA 3PNYA 3S2GA 2PU7A 5HA5A 3W04A 5HRCA 4PN7A 3X1JA 1E1KA 2RB5A 3GP3A 3TZEA 3K09C 4NOMA 4PLCA 4C6SA 1Z12A 4QUEA 4S35A 1ADJA 3FZQA 3L8HA 5GM2A 4MVJP 3DMYA 2F4VB 5KBYA 1CULC 3GT4A 4DV7B 5KYUA 3BF8A 2XUGA 1DKLA 2QM8A 4JLOA 3NORA 4R2JA 2GZMA 1ZGGA 1O3YA 1SC1A 1PSZA 3OC6A 4WX2B 3K1AB 4BLVA 3I1JA 2D3TA 1U8TA 2WYIA 3EIEA 4QD3A 2W2QA 3IQDB 1GZ4A 2XMSA 4Q82A 4N65A 1JMKC 4J76A 2EFCB 3JW8A 3IQZA 2C04A 2F3TA 4RA9A 3LJKA 3QOWA 4HNUA 1ZBDA 3KSDO 5CA1A 1Q1NA 4XPZA 5ADHA 1IHUA 3AESA 3VGJA 5DXAA 3D6HA 4BBPA 2CCGA 1ZD3A 5AXCA 1DBQA 3QBEA 2VCHA 3W8EA 4IXMA 3GPPA 1E0SA 3GFRA 3DC2A 2G1JA 1VMIA 4JHLA 2XNSA 2Z56A 1CUIA 3OCCA 2CJFA 4MWOA 1Z59A 4B7GA 2B8TA 3IX7A 3HCEA 2J0SA 3MGGA 3KB1A 1ZK2A 3GCGA 4Q19A 3B6EA 1RQRA 4ODIA 3H2BA 3O93A 4ZPJA 1S7CA 1UJBA 1SCQA 5KTRA 2V97A 2CDNA 3KDPA 3OEED 4MRVA 5JBQA 1OX4A 2BFCB 4YRKA 4IMJB 3D43A 4C5CA 4QAQA 3EGDA 2EBWA 4R2KA 2O8EA 2IPXA 1VYTA 2R1TA 1V2HE 2R79A 2LE0A 4BLOA 4TMYA 2EBFX 4KN5A 4EPWA 1ZC4A 1XNJA 4W1QA 1V96A 4PO3X 4ZKDA 2XQVA 1RJGA 2QB5A 2CKMA 1FFBA 1LNQA 3UV6A 1ODCA 1NLYA 2D2VA 3N6VA 3A8TA 2FWAA 3ESQA 1G16A 4EF5A 4PANA 2DFNA 3HJHA 1G8FA 3AP3A 4XQEA 5HE8A 2MSEB 1ORHA 4MLDA 3TVYA 4TMXA 1L7MA 3M2PA 5J4HA 4D0GA 4GLFA 4BNDB 1MH9A 3DVAB 3RAFC 1V37A 4LVNA 1NLFA 3GLVA 4IHJB 2L42A 3LGXA 3ZV4A 2OD2A 3CCBA 5BPFA 1Q57A 2J9ZB 3UYKA 4FFOA 3PIRA 4UNIA 2Y1OA 3LTNC 4OSPA 4EA6A 3TINA 3FZEA 1T4CB 3L6CA 4ZYTA 1NFQA 2FSHA 3NX4A 1JQLB 1OFGA 3QBDA 1M6VB 1L6RA 4GBMA 2AGVA 1P29A 3QFCA 2GCOA 5DSZA 4MI9A 1LTHR 4H6PA 4XPIB 1OIVA 3IV7A 1XCPA 4B6EA 3EFBA 2J7PD 3U6BA 3LVQE 2GZ2A 1CZKA 1KEPA 1QV7A 4G09A 2ZSDA 3LXMA 3L6EA 3MT7A 4IXWA 4W1SA 4F71A 2R8BA 2WV7A 3P8ZA 3QE2A 3WIBA 4V38A 1YS6A 1G66A 4PR0A 5HE9A 3LOQA 3GUVA 3LIPA 3ORFA 3EIFA 3RT1A 4MYDA 4R51A 5J4YA 3NC0C 3AETA 2Z1NA 4RNAA 4RFSA 5C81A 5KHAA 3B7GA 3RAPR 1DMSA 1RNLA 2AMVA 4KQXA 4UEWA 1YQWA 4RQBA 3VU9B 3QPVA 2JLSA 1EE8A 2F59A 3ASVA 5JS8A 1IOVA 5H80A 4GNKA 1NY5A 4GAEA 4F7WA 1I13A 4R1OA 4A91A 3OP1A 3KXDA 2HSGA 4REQA 1QOQB 2QZJA 4K0KM 4DB2A 1V8FA 4RACA 5A9SA 4XJSA 1IEXA 2IXDA 4YRRA 2G1UA 3I2KA 3UTDA 1UWLA 3LQ4A 3WDKA 2IYYA 3ORHA 2OMKA 2CVOA 2XVMA 2AE1A 5DTJA 3ADDA 1EZZA 1WNFA 4BNMA 2R3SA 4TKUA 4LXHA 4IWXA 4W8OA 4PYKA 1BJRE 2J5XA 1Z18A 1GGJA 3F6BX 4UQOA 4QARA 5TF4A 1VE3A 3WWOA 2YUTA 2BFPA 1K89A 2AXNA 1GA1A 2CCJA 3ROTA 5E1OA 2RI0A 2VZ9A 1QU2A 5K0SA 1R8QA 3DGEC 3GFSA 2P4HX 2YMPA 2FE4A 2NU7A 1FUKA 4AURA 2NM0A 2RIRA 4B6FA 4YRJA 3OQ6A 4M7RA 4XM0A 1IXKA 4RA6B 1J8QA 3KL4A 1JSZA 3DEKA 3KB8A 4I99A 4YQFA 4ZO7A 1F48A 1XX6A 4CEIA 4R9UC 3VO8A 2GLTA 5KNBH 1RPTA 3L6UA 4I1UA 2WM2A 4MWBA 1P2BA 5NULA 1I6MA 5ERYA 2QMYA 2PK3A 2WRZA 4FHGA 3EFOB 3HBJA 2WUGA 4F1KA 1KH3A 2DWZB 2F5OA 3BFJA 4F3RA 4FMCF 4HSEA 3KJQA 2VTEA 4DNQA 4GR9A 3UMJA 3GVPA 3U1VA 1Y8CA 3ZLTA 4MW5A 1JV2B 1RI4A 3VHLB 2ZROA 2A5FA 1N0UA 4YRGA 5JD4A 4TV8A 1U1FA 4E5UA 1MHPA 3W2GA 4BNVA 4LDPA 3G89A 4AKEA 4ZJUA 2CDRA 4UKDA 1F8XA 4BQRA 5DT9A 1L5LA 3GZ4A 1U1GA 1ZU5A 1TCBA 3PGLA 2YJ4A 4Q00A 2GAFA 2JRLA 5EZYA 4QGBA 3AC0A 1Z0FA 3SYTA 4X9XA 2QUKA 4X44A 3ANLA 5TB5A 2C9MA 3G59A 4YBZA 3I8XA 3BDAA 4FYHA 4KLZA 4ER0A 2POCA 3DMHA 4EH1A 3HKCB 4KFUA 4MIYA 5ISMA 5K4GA 2BGNA 3CBGA 5L7TA 3VUEA 2Z6UA 2FMIA 2OV6A 1SKYB 3V7FA 1V34A 3RF7A 5JOQA 2M6RA 2LDXA 2GYYA 2E87A 2R68A 2X9QA 2B1GA 4UEQA 2AJDA 3A4LA 5DCUA 4Q9KA 2FP4A 1AMNA 4D96A 1HBJA 4V3BA 3NXKA 3G2NA 2EQAA 1BXRA 3QI2A 2BEVB 1D03A 1PFGA 1OY1A 3W2HA 3GRUA 1XFDA 2QR3A 2OCIA 4INPA 1WPXA 4RQAA 4UULA 1M1XB 4PYMA 2AX4A 2EJCA 4GRIA 2Y71A 2IITA 3VI4B 5HJEA 3PPWA 1X8KA 3TIGA 4O4IF 2OTCA 1CY7A 2O3UA 3QI7A 5U9CA 3KPJA 3TK1A 3ETJA 1LK0A 4CQMB 621PA 2F1HA 1DARA 3C3MA 4HDSB 4E3WA 2Q3EA 2VHVA 3LDAA 5JSFA 3UAZA 3QVTA 1AS2A 4HQOA 3IDFA 2ZUBA 1SZCA 5T57A 1G291 3C8HA 3HEMA 3U44B 1QDTA 3LUHA 1QG4A 2CN1A 3OJOA 1IAQA 3UJDA 3T9EA 3AR5A 4EBFA 2IC5A 3B12A 3UK1A 4Z7NB 3BJEA 3LY5A 4UBIA 1AN0A 1Y4AE 4YUXA 2XOXA 4E15A 1EDOA 3MINB 4HC4A 2QG6A 1X8LA 3SS9X 3DXXA 4UUBA 3AVYA 4FT4A 5KVVA 1RW4A 4DR2M 3QU4A 3TDKA 2GEKA 3ZHSA 4NCIA 3V9PA 3IUBA 2ZIWB 3IR7A 2QTNA 3T3GA 4QGSA 5KSOA 1KNQA 1XQ9A 3EIQA 1E3SA 1RBQA 4IX9A 2G5GX 5G2OA 2V7BA 4JBLA 3O2JA 2C2HA 2A9PA 3I73A 1CEXA 3THGA 1E9EA 4RTQA 2H1WA 2DULA 4DMFA 1VTKA 4PC1A 4MGIE 1B6SA 5G0WA 1C3EA 1RZ3A 1RHJA 5B7GA 5KZMB 1GFSA 1CUEA 4F4IA 4D0SA 3Q6IA 1SVLA 3MGBA 4NHEA 3WAGA 1XHBA 1O95D 3AQ4A 1QQ5A 4OYHA 4YRPA 1UMCA 4B3MM 1G9TA 5CYFA 4KR9A 4B87A 4E11A 4HK4A 4ZT7A 1QIDA 4QHSA 3VR6H 3SJAA 4BP9A 5E7MA 1IIRA 3Q11A 1RMTA 4KSYA 1Y3AA 2AEJA 3TCXB 4KEAA 4EMBA 3L27A 1YK1A 4UBMA 3P26A 3OEWA 4EW3A 2L0XA 2Z2JA 4HQKA 2PS0A 5AD1A 1WZ2A 3GJ3A 1H5UA 5TX7A 3GPXA 3EPKA 4D9GA 1SO8A 4XSVA 1VL6A 2BISA 2VAVA 1XEFA 2AC2A 1Y5IA 3IMFA 5BVHB 2SICE 3FROA 5A5DA 1UBRS 3RKSA 4BV3A 5JPIA 4OJKA 4DR2B 3MZ0A 3PIDA 3JRXA 4IOJA 1YL5A 1LD3A 2C5FA 5JDCA 2C3MA 4XR4A 2OG2A 1AS3A 1ZVVA 1GPH1 3AHJA 3RTGA 5B55A 4ZDWA 3D8SA 3RTEA 2H9AA 1R15A 9ATCA 1NBAA 2JFXA 4Q18A 2P4UA 4IIGA 3TL6A 1EGVB 1G63A 1OFUA 2FR1A 2JA2A 3HB4X 2LD4A 1QOPB 4U2BA 3CR8A 2ZPTX 1OOEA 1TLLA 4R9RA 1KJQA 2JW5A 1LLQA 2PBRA 4N3BA 1ESDA 4TSKA 3PC2A 1GU0A 4N49A 2NN3C 3LKBA 1AE1A 4Q66C 3CMMA 4F5WA 3BIFA 4IWNA 4IGFA 4IVRA 1YR8A 3DMTC 4ALKA 4B3MB 4I8XA 1XD9A 1BFUA 2N46A 4G1MB 3M6LA 3TWLA 2VNSA 2W8ZA 3QEMA 1V6SA 2BHSA 3A9TA 1Z5GA 2YMMA 1D6MA 3ZHQA 3EXIB 4TUYF 2A2ZA 5BV0A 1OX5A 4K9SA 3SCZA 3HJNA 1E2MA 2HMAA 3NKVA 1KEKA 5DTMA 1DAHA 1T8PA 4PG4A 4TV9B 1FLDA 2LKCA 3O8OB 3BIWA 3RS7A 3HWRA 5B6PA 4I2NA 5K0LA 3KEQA 4P80A 2YV5A 3QELA 1W4BA 2GBLA 1C9NA 2QRUA 3TR6A 1A7KA 5EIOA 2ZJ6A 3Q3EA 3GH1A 3IAS6 2R46A 2GWHA 4ZOLB 2X9VA 3DGFC 1EVIA 1AU9A 1N0VC 4ARIA 2H2GA 1GNQA 3FF4A 4YRZA 3WL6A 4KWEA 5L8VA 2RGNC 2Z5VA 2Q5FA 3CX7A 3H84A 1XJ5A 4DYDA 1EU1A 3ZR4B 4N7MA 3QE3A 2WMDA 3AW9A 5IJZA 4FDUA 4M9XA 5AM1A 3GT3A 1NVXQ 2Q9UA 4OHYA 3AMVA 4R81A 1DC7A 5ERGB 3DZ8A 1CERA 4XEUA 2NTNA 3RSGA 3A3KA 3TD2A 4A7PA 1DV2A 3L7LA 2JBAA 2KDLA 4KPUB 4IICA 4H4EA 1R0KA 2XBMA 2VQEM 2J5QA 4TMTA 1SHLA 5GY7A 1P2UA 4ZVMA 1OBCA 1Q50A 2QRPA 3AIIA 4OB8A 4YPFA 3X44A 5ICFA 5KINB 4TVOA 1Q17A 2X4GA 3LBHA 1P3QQ 2OSVA 3UICA 3L4KA 3R7AA 3CO5A 3GMDA 3ZWVA 4MPPA 3FCCA 4F9TA 3QVMA 4ZZ3A 3E2PA 2BJVA 5AW7A 1COZA 3L4JA 3BE4A 5KX5A 3H4MA 1C2YA 2IYXA 3M8KA 3RIXA 3ZGNA 3ZLBA 2JBWA 3URMA 3DKVA 4NENB 2B78A 2XCLA 3T5BA 2EZ4A 9LDBA 4ZANA 1O94A 2P5SA 2CB0A 5EUCA 1ECBA 2X3FA 2P1DA 4UM8B 3HKBB 5CBKA 4GG1A 3N3AC 3U61B 1N2SA 4LHZA 2AR9A 3ETHA 1EE1A 3K0AB 1XLUA 5LVAA 3NAGA 5M3BA 5AKXA 2YZKA 5HEKA 3CKLA 4OU4A 4OU7A 1SBQA 4Z8YA 1NLMA 4KXYA 1QF6A 2FOIC 3FOFC 4HQFA 2FSPA 4BTLA 4OFBA 3OT1B 2L2QA 3P96A 2B69A 3EXG2 2C7BA 2G9QA 1AT1A 3RC9A 3A2LA 3WGKA 1TC2A 3NDPA 1AXGA 3IUNA 1EEXB 3VA7A 1ZR2A 4YT8A 1K4MA 3OF2A 3S70A 3UBMA 4JBNA 2VQEB 1LB1B 1P1RA 5IDWA 4DV0M 4G4RA 1F3OA 4FSHA 1E9RA 2W48A 2EXXA 1ZIXA 2C2MA 2IKQA 5IM4F 3K0SA 3TN7A 1B8NA 1TZJA 2QQ5A 3EQ8A 3WO0A 1UFKA 3AVQA 4NBSA 4ES6A 2B30A 2V96A 1XDWA 1UZNA 2VHJA 4YAEA 4K6FA 3CX3A 1R6DA 1V3VA 2P62A 4FYKA 1XZPA 5GQSA 4DTCA 4YJGB 5CH3A 4AZSA 2DKLA 5JD3A 1L5OA 1KMIY 2PN1A 4NJMA 2XUPA 3LT0A 4NH4A 3RUDA 4HGNA 5EHIA 1S8OA 2ECFA 4F72A 2QF7A 4FYPA 1AXRA 2EYUA 4EZBA 2JJMA 3VH1A 2JAUA 3FY4A 3WGNA 3PUJA 4HFJA 1S3GA 2IS6A 1QFYA 4NV1A 1Y5RA 4U7FA 3DFIA 4H6VA 1U0BB 3WLQA 5A4FS 1TJYA 5TPZA 2PLFA 2VO1A 4BB5A 1NVMB 2WIGA 3GEEA 2M98A 4YJHB 4GSLA 5H83A 2C5HA 3GV0A 2IYVA 3OWXA 4IF6A 1X94A 3UKJA 3RE1A 5DBOA 3DV0B 2ORIA 2J85A 4AJ9A 3EEFA 2C2YA 3ZHCA 2PWBA 3BRQA 3FDIA 1M7GA 1E1RA 1EFPB 3H2IA 2WJ4A 2FZCA 4HAUA 2JGFA 4F21A 2AR0A 3NU1A 1V1JA 3IVGA 3DZCA 3HHWA 3IODA 1XIVA 3W3ZB 3ZK8A 3G13A 3X0DA 3VK8A 1J97A 1LS1A 3DDZX 4BC0A 1AB6A 4I1YA 2E7ZA 4F5YA 5EQFA 1T9BA 3FUUA 1YS4A 4NK4A 4OB7A 3LDHA 3PF9A 2XWBF 5E0KB 5FR2A 4NEQA 1I4EB 3NDRA 5EJFA 5A3VA 2F43B 5MGNA 5ESXA 1LQTA 3MRSA 2HK7A 5HMMA 4BP3A 4J4HA 1JILA 1S2OA 2ETVA 2P41A 4MGYE 4ZCRA 3ONNA 4NRWA 3RHTA 3RU3A 4W9NC 2B2XA 2HA2A 2DNAA 1V1MB 3B3JA 2ORWA 3KDAA 1SOVA 2P2CA 5K05A 2IHKA 3SSAA 1SU8A 4R1QA 5TARA 1K8XB 1KFVA 3HR4A 2JJQA 4BECA 1QONA 4JSYA 1AKYA 4JI3M 1Y5MA 1WW3A 5JHGB 1DBVO 1E1NA 1GZ7A 4YAGA 3EQ7A 2H2AA 1ZUWA 3WB9A 3GNSA 3CWQA 4WKNA 3WWDA 3E58A 2F64A 3CN9A 4J6FA 1I30A 3T3NA 2A30A 3QGMA 5EPOA 4Q9DA 5AW9A 1KSJA 5FLKA 4KH1A 1CX9B 4FSDA 4OFZA 3LI2A 4HLQB 2I9KA 2NUTB 1JA1A 1J2UA 1M2WA 4ZVSA 5IARA 3DWIA 3ZZUA 3L43A 5A4DA 3Q12A 2QD5A 3IIMA 1SHZA 1XDSA 1P91A 3I30X 3QNUA 1FQKA 4UBLA 1YB5A 3WBJA 3JZMA 2QVGA 4BNTA 3BDVA 2NPOA 1J5EB 3BE5A 3J7AC 1PJJA 1C3LA 1L1FA 4DUZM 3AL3A 3IA7A 2WW8A 3DEYX 3A6FA 1RE0A 3O1JC 1K6IA 3ZY3A 5LC1A 4C7VA 3U60B 2D4HA 3KU4A 2ZULA 1RI1A 4DV2M 2C9YA 3C15C 4TM7A 1JEAA 5D51S 4FNAA 2AI2A 1M8JA 4NYJQ 2FVXA 2GN9A 3KEMA 1EFLA 1Z6XA 5LP6C 3ZE0B 3QF4A 4MWDA 4MJ3A 3FB1A 2QUHA 2AUMA 4JI3B 3D59A 4R1MA 4DPKA 2GF9A 1XZDA 5HW0A 1JIIA 1OXXK 2PKEA 3HY3A 4WOBA 2QSFX 1FRQA 3HXMA 2WF9A 4OJMX 1CYEA 2B6NA 4I1VA 1CF2O 3OOJA 1M6NA 3HJAA 5ITUA 2OXEA 3EOZA 2HPZA 2ZXUA 4WWHA 3JASB 3B6IA 4L1KA 1TCVA 1Q7BA 2JD0A 4C21A 1EZ1A 2RGOA 3NI2A 3J2PB 3LVWA 3IR5A 5KAMA 3IMEA 3OCXA 2GEJA 3LDUA 5TIIA 4ZP1A 1D2HA 4EJ0A 1D1QA 2A4MA 5KYGA 4QQKA 4WKBA 2VNHA 5KPTA 4B44A 1KC3A 4KRXA 1VIDA 3TXAA 5A6SB 1PG2A 7GPBA 3TKYA 5I7SA 3GJRA 4LS3A 3SAUA 2XGNA 2VKQA 2EC5A 4CMCA 2Y1WA 2A9OA 1ZO8A 2QSUA 5IC4A 3FJ1A 4B35A 1W76A 2X14A 5SICE 3EC1A 3TO5A 3ER8A 1H6DA 4DUZB 3MT8A 4LUCA 5D3ZA 1NQ5A 5EMHA 2XWQA 1DWPA 4EI2A 1TCAA 3WLRA 2GZ3A 4L4SA 1G8GA 3UYLA 3E6AA 1M9NA 1X7WA 4DV2B 3WRXA 2WICA 1FP4A 3LY8A 1L2CA 2C1ZA 4RZIA 4R3UC 3KUUA 2XB8A 2HD4A 4AS3A 2Q4DA 5JMTA 3S1AA 1IWPB 2YVQA 4MRMA 3ZY6A 2ANCA 1D2MA 5DOZA 2ZCUA 4XM2A 1RWKA 1ZA1A 3S7ZA 2Q3LA 2ESRA 3G3EA 2GZRA 4BIIA 1Z5CA 3JX9A 1XRPA 1JFSA 3DOAA 2QRLA 1V95A 4DV6M 1U0OC 2ZE6A 4PSCA 1A4RA 4Q4HB 4BCCA 3FCUB 2DR0A 2ZBGA 5A2QS 1AUPA 1PO7A 3N05A 3RGGA 3GXOA 4S05A 1XA4A 1EUDB 3D64A 1UADA 1RKQA 2C92A 2ACVA 2PIAA 4EZIA 2XMDA 3MVEA 3H13A 4PYRA 4PYLA 3ZDXB 4Q34A 4CV2A 1MZPA 2IF2A 3MOGA 4AF6A 4GMFA 5LQDA 5CT9A 3I4FA 3ETNA 4IUYA 1T34A 3GG2A 3VGPA 1Q0QA 3PX3A 4L5YA 2YYZA 4MGHA 4GQAA 1M2EA 1CS0A 5IUJC 3E0XA 3AM4A 2OB1A 5CM8B 1XWWA 4NZZA 4CM3A 2GPSA 3I8OA 1ZJJA 4ZHQB 4I50A 3V8EA 4AU1A 4C2UA 5KKCA 2RHMA 4I5EA 3OJLA 3I2IA 2BMVA 3NETA 4KSBA 3QPUA 2R62A 2Y1XA 5G3YA 1TM7E 2V55B 4BVAA 1JJ7A 1KVRA 1CB7A 2DERA 5BSHA 1NR5A 2B2CA 3C6MA 1OPRA 3VHXA 3V3TA 2P5TB 4FDVA 1P9NA 1MAAA 2NG1A 3N2ZB 1LRJA 3RQSA 4HHEA 1C8VB 4DVJA 3IPCA 3ZD6A 3TWMA 2RKOA 1UCFA 2C5BA 4GXNA 3EDYA 3I62A 3H1GA 3KVWA 1Q0TA 5EIEA 4DV6B 2ZAIA 3TZBA 5EWMB 1XHFA 1NW6A 1DMRA 5A0VA 3T3IA 2JVKA 2RDMA 2COUA 1CP3A 3IVAA 2RAFA 1OIXA 3QWFA 3UWKA 5ITYA 4KMRA 1EVYA 3Q2KA 2O8FA 1XOIA 4PZEA 4DMUB 5HJ7A 2POQX 4TTVA 2G9NA 2WYHA 3LZCA 3DEZA 3B60A 3GJ0A 1YU9A 2XB6A 3U4QA 5CB4A 5AI8A 1OJLA 3IAFA 2L2DA 4ZOCA 3H6KA 5B7PA 3SQLA 4K3UA 4G1CA 2WIAA 5FOUA 1L4MA 4NHOA 4C9BA 4X0EA 5L45A 1QFSA 3BULA 2Y0BA 3LRTA 1XTZA 2VCEA 1NO1A 3O4JA 4QICA 3JAKB 4O2AB 4MS4A 1RLIA 4G65A 4PF1A 5FNVA 2I29A 4YAOA 4URFA 2G76A 2Q3FA 1OBOA 3PC8C 1V45E 3KR0A 4TSFA 4W5WA 5LFAA 2EG9A 2Y21A 1ADFA 2VHZA 3FYUB 3KXIA 1NHGC 3O31A 1TLFA 1DFIA 1E63A 1H1DA 2OQ4A 3NASA 2VDVE 1H2HA 5JZMA 3VDQA 3LSYA 4WXEA 1OBFO 4K1XA 5DHTA 2J0QA 5IUNC 1QH8A 4E32A 2GPTA 2FK7A 4GMHA 4IG9A 3E4RA 5B4TA 5AVUA 4KQ1A 3QU5A 2OO5C 4PGFA 5IEJA 2OGSA 4JLSA 2H08A 4EECA 4MUFA 3RVNA 4MNTA 1PE0A 1QGUA 1V8OA 1NURA 2O5RA 4MDFA 4WXRA 3UK0A 1VHLA 3OZTA 2W2PA 2IBTA 1Z5OA 3WXBA 1M0TA 3NV9A 4G36A 2G8LA 5KVQA 1B7GO 4MV5A 1M2HA 3IKVA 3UN1A 4JEIA 3F73A 2IUFA 2WWHA 1N7HA 5A0FA 4YC7A 1HT2E 2XNKA 3QM1A 1RJWA 2O1EA 1BDHA 3VKFA 4KRYA 2ZJOA 1NMZA 2HC9A 2XB4A 2PMCA 2V45A 4KZKA 2H3EA 4AMGA 4WBNA 1XHEA 3U31A 3BEDA 4BWGA 4BO3A 3G2KA 3GPUA 3DMNA 4ZAGA 4MR7A 4UFOA 3MWGA 1GG5A 3JQ7A 2IL1A 4I46A 3E23A 1WF3A 5F5NA 1NBWB 4LCEA 3THWA 1T1RA 4JLUA 4FWGA 2EDAA 4RS3A 3NJRA 4A73A 4G01B 3RVLA 1NLUA 1HE8B 3SVTA 3RQIA 4JB2A 3ZLUA 3Q1LA 3F1KA 2W6ZA 5KQRA 4IHAA 4PCLA 5EKSA 4RWEA 1E7WA 3FDFA 4HCJA 1FQOA 2PLAA 3I23A 3SZUA 2HSJA 2QZ9A 4AT1A 4LF7M 5IUKC 1QIJA 1KORA 3JALB 4MGZE 1OKKD 3E9RA 5A5EA 4AN0A 1W4RA 3EG5A 2EFJA 5K8TA 3ZQ4A 3W7BA 2FU5C 1JSCA 2ISQA 5BNTA 3C7DB 4CLHA 2PRZA 2PJRA 1S2MA 4R7ZA 1QU3A 4X6YA 5BSMA 1QS0B 3T7EA 1TH2A 3NATA 4M1OA 3S7TA 4M0DA 1VIVA 1CDOA 1K6EA 4U9IS 4I5GA 3HU2A 1SHUX 4ZK2A 3CXRA 4RK0A 1GPMA 2ZIUB 3T0IA 2KZUA 2JEYA 4KWCA 4RMNA 3AIOA 3SVZA 3K09A 3N3BC 3KAQA 4BO8A 3DAOA 4ARZB 4P4SB 3W2TA 1YVEI 1GCAA 2HLDD 1TT7A 3ESAA 2OXRA 4DQXA 4D3ZA 5TMEA 3KJNA 4H7JA 3WDMA 1TF0B 2AYYA 5D00A 1AMOA 3QLEA 3CGWA 4BE7B 4ON9A 2HTEA 3A58B 1JEQA 1Q2UA 3KOUA 1J07A 2GYVA 2H1CA 4F3YA 5CIQA 3HLKA 1QSGA 3TZQA 1HQDA 2P65A 1CUWA 4MRSA 4QFDA 2O2EA 4UM5A 4GQBA 2F6RA 4C43A 1EFTA 3H75A 1YOVA 3VPSA 2W93A 3RABA 4HLNA 4OJYA 1U0LA 3DL2A 5TJ9A 4KO4S 1JFRA 2BFFA 3I1IA 3I9JA 4DBGB 1F7UA 2DF8A 1KERA 3FVWA 4LF7B 1KXJA 4AFNA 5HOQA 2XBUA 3IHTA 4GFDA 4GM0A 4OYLA 3AHGA 1XTTA 2WA2A 1FFCA 3EEOA 2XYQA 3PZBA 3HRHA 3LD9A 1I10A 4LV6A 4XQGA 13PKA 3HA3A 1P7YA 4E4TA 1ATIA 3OIGA 4CG1A 4LJSA 4M37A 1ZSNA 1MRNA 3H2SA 4DLPA 4OKNA 1XPRA 4GBED 3JD3A 2PLWA 2CP8A 4JLNA 2R11A 5B1IA 1KMNA 3L2AA 1KBOA 1H0HA 4TTPA 3SZ3A 3N70A 3SDSA 4YGXB 1MJGA 1U3CA 4IIEA 5J43A 4YRTA 2BOVA 1QYXA 2ZXFA 3B3AA 2VH1A 3R7SA 3VRHA 4O1MA 4MVJG 4FGWA 2D13A 2QRHA 4E4RA 1CVIA 1H23A 5AKEA 4LMBA 5CXUA 5JCPA 4GXTA 3K5IA 1YDHA 1P3Y1 2ST1A 4NZNA 3ZLJA 1S2IA 4EJSB 1M1YE 3FTFA 2HQRA 2WU3A 3BC1A 4KHPM 4D81A 2Q7OE 2VJQA 2BKLA 1WETA 3HMQA 1J39A 3UGTA 3MGKA 4YDQA 2QTTA 1GNRA 2AVNA 2OWEA 1TYDE 1V1RB 4AJNA 4ZQIA 2ZG6A 4ZAVA 1M8FA 3C24A 1RQNA 4C78A 4ND8A 1NJ6A 2GT1A 1XMJA 1DKPA 1IFYA 4AO6A 1J42A 1EBFA 4EVSA 1SRQA 1VYHA 2FQXA 2WSBA 1JN0A 3FUWA 5K6AC 4WESB 2DSTA 3WJ1A 2A3RA 3TR5A 1EHIA 5I7RA 1Z15A 1NPDA 5CJJA 2XB9A 1EFRA 2JZ1A 1PZEA 3C1TA 3IB6A 4JP5A 2IK8A 3GGJA 4D92A 3I04A 1QPBA 3PRHA 1LDYA 4K9QA 3AKYA 5K0GA 3C1OA 1R6XA 4QJIA 3A6DA 3FPBA 3D7SA 4L0QA 3HSSA 5CA0F 4PG5A 3WLOA 1FQWA 4FK8A 1NW9B 2DPYA 3G2LA 4FKMA 1GNTA 2BWEA 2P9EA 5CA1B 1YE9A 4WCVA 1F4LA 3PQ6A 5IBQA 3QUAA 2O8DA 4MQBA 5LLSA 4S0ZA 4RD2A 4PNPA 3TQSA 4AS1A 5KO3A 4N47A 1ZIPA 5I7UA 4KHPB 2RI1A 5I4KA 4Z1OA 4G5GA 1EFHA 2VJMA 1ORVA 1RWVA 3L8GA 1EK2A 1YDEA 1MRZA 1FSZA 3ILKA 4HO1X 3V7NA 1LJ8A 3TJMA 1VBMA 1YQEA 4LGCA 1FTWA 2BDTA 1RWWA 4J0JA 5CMLA 1UKEA 5IJ0A 4TT8A 2FJPA 3U3XA 2JCSA 2FLVA 1U6JA 3ADOA 1VCOA 5DISB 4UQLA 1FUUA 5E0OA 3UV3A 3RV3A 1EM8A 2A5YB 2ZWPA 3RK4A 1R6BX 2O8EB 1E4EA 4KPYA 3FMVA 1TO1E 3D8LA 4AYXA 5E7JA 2I5PO 3A9UA 1G4HA 4MHTA 2IUEA 3WK6A 3L8EA 3HP7A 3IEMA 3VZSA 1BE8A 1IXYA 3A4VA 3CNQS 5K3SA 4L4ZA 1W0KA 2CXSA 3GPDG 2VYVD 3P9IA 5IT4A 4LDRA 3HZZA 3P0EA 1B2RA 4TT3D 3V4RA 2B20A 3C41J 2VXBA 4NS4A 4FQ7A 4Z7QB 2QN6A 3R3HA 4GPBA 3UT0A 2FLWA 2NUPA 3HA2A 3H83A 2PGOA 3A6JA 3DCJA 1TB4A 3N28A 1UANA 3DLBA 1UT6A 4QL3A 4J1TA 1DCTA 2KNVA 2CXRA 3K73O 4ARBA 1NUHA 1H2RS 1I2AA 1FLAA 2PVPA 3UA4A 2F5QA 3DBLB 1E2BA 2XV1A 4L95C 1N5RA 3WLLA 5U4XA 2OORC 1NUAA 2GCGA 4OHKA 3EMBA 4WASA 2Q6VA 1D6SA 1FFXA 4HDRB 4TL8A 1ADBA 3DFZA 4XB6B 3KFUG 2NQ2C 4BV9A 4EL5A 3NBMA 4EGJA 4AIIA 3FOAA 4F97A 4W9RA 3ZTYA 2GCOB 2PH3A 4JK3A 3MJFA 1JI0A 1PVDA 2EF1A 1Q5PA 2EZ8A 5EKUA 2KMLA 4DA9A 1IE3A 1ZBQA 4GOMD 1UAAA 5F98A 5T3YA 1WIWA 3TLMA 4CIBA 2CHVA 2VNJA 5B53A 4CL2A 3I52A 2N35A 2PEZA 4J2HA 2HQ1A 1X1SA 2IH4A 4PN3A 4CGZA 3TSCA 1NFFA 2ZAGA 4FWBA 3AETB 3ZVRA 3KG2A 4BNHA 4C7OB 4QUBA 1P62B 3L8MA 3WWEA 3L5KA 1M72A 1B0ZA 4QDUA 4QZVA 2X6RA 5BNZA 5D7BA 1NU6A 2NAPA 4LC0A 1FVHA 1I8TA 1U7TA 3NEYA 1PR4A 3NYRA 5KPRA 3L8CA 3I61A 1VDDA 1OFIA 3OZGA 5IM5A 2QKYA 3PNMA 2EKBA 2W2NA 5A9SB 4GH5A 3ZW7A 4MJXA 1U0HC 3GCZA 4GWKA 1OFTA 4L07A 2C8KA 5KREA 4KKXB 2YXLA 1DO2A 1Q7EA 1Z33A 1HNXM 4XTCS 4EYEA 4YJ3A 3E8SA 1CUSA 4WZBA 4ENRA 5FBLB 2HCJB 1A2OA 1RYDA 1A8IA 3TOZA 5BSEA 3FTNA 1WB6A 4IGKA 3SQDA 4YUWA 1QHNA 4GHAA 2FPUA 2IHBA 1SVIA 4WERA 3AI2A 1E3JA 3ROQA 3RTAA 3PVCA 1KSFX 2OHXA 1DRKA 3IQGX 3FG9A 4NFLA 3IUQA 1YZNA 3IEXA 1KWKA 3MPUA 2PS3A 1G7RA 4ZYXA 3G8YA 4A3VB 4DQUA 5P21A 1JBQA 1JQAA 1Z2OX 2PXHA 3V1YA 5B36A 3CHYA 2WTXA 5TQJA 3B53X 4KX3A 1MA0A 1G6KA 1ODLA 3IE0A 1IG0A 3Q9NA 1JDVA 1CP2A 3VNQA 5ADVA 4ZT3A 5IAKA 2FWIA 2DZOB 1SCAA 4YDSA 4LBWA 2P6PA 4RXUA 3VU0A 4TRJA 1P8JA 3ND9A 1SVUA 4PLWA 5EA2A 3ZX5A 4ERXA 4N7RA 1QGDA 4ZRNA 4A6PA 1O2DA 2QVLA 3U48A 1V33A 1RE1A 2ZGVA 1YL6A 3UO8B 4Q3CA 3ETEA 3EH1A 4H18A 5JEEA 3EVFA 4C6TA 5C34B 3DDWA 2BGKA 2J41A 5C9ZA 4U39A 3IBFA 5AVQA 3IFSA 4KIUA 3WMGA 4YT5A 2VJNA 4TV8B 1PW5A 3QTTA 1E62A 3LYHA 3FAKA 2PYDA 1WS6A 4U6SA 3VSAA 3CLVA 4IIJF 4DCJA 5B2EA 3GCWA 3I76A 3GDHA 1Y9DA 1T3SA 5B12A 2JLQA 2RH4A 2J0VA 3D0QA 1JFTA 1HNXB 4Q1VA 1HV8A 2P40A 5IU6A 3O8QB 4NEGA 1QYIA 2OCPA 2R6HA 3VX3A 5HZHA 4HSGA 2Q0XA 4MEAA 2OPFA 2PZBA 1TRHA 3GEPA 1W5TA 1X14A 3MJSA 1IHOA 2H17A 4DYVA 3KR1A 5BXYA 1W34A 2WVJA 3CEPB 3T7CA 1S2DA 1J70A 3K6KA 4CM8B 4H77A 4Z2YA 2FP4B 1G8AA 1KR2A 5K3FA 3WA7A 5CFQA 4G9EA 3VZPA 1CF4A 2MYTA 1N9GA 2CWDA 3R09A 4QEKA 4XFDA 1SKYE 5DVZA 3GJYA 5EJMA 3KJXA 1B1AA 3A31A 3GT7A 1T9DA 4ADSG 4ZCTA 1O9GA 2FAXA 2A67A 2AEEA 3S81A 1EJ2A 5J58A 4CE6A 3K30A 7ADHA 1VGVA 5E7IA 4E51A 5I3ZA 5AO9A 3BHIA 4YFVA 5FO0A 1DINA 4UZFA 2QDKA 4HWKA 2AX3A 3ZWMA 5K0TA 1XCLA 3D3KA 3VDUA 1YU6A 2QBYB 3A98B 2Z43A 3THYA 3A1NA 4BCDA 3SKYA 3H5WA 1X0XA 1L4FA 1NQAO 1N5IA 3E9NA 2WUWE 2CSUA 3L40A 2NSJA 2ZB2A 2Z30A 2B4QA 1QHHA 3DMTA 3M3DA 3QEAZ 1SUBA 4P33A 1QLWA 2WU8A 4O2LA 2O7VA 3W77A 1T24A 1ZKDA 3O8DA 2ZRIA 2FPIA 2ID7A 1SH7A 2B8NA 2WOOA 4XASA 1FU7A 3C3AA 1OH5A 3EMKA 2XMPA 3BORA 4HNHA 1NPYA 1PLJA 1XVLA 3MCZA 5TR9A 4X71A 3BERA 3I5UA 3LHKA 1OHHD 4Q7EA 1QPGA 2YV4A 1KJZA 3RAEC 4KWTA 5I4IA 3FWPA 1T5HX 2PFGA 1MQ9A 2GPJA 3T3PB 4GMGA 5HIKA 1KHHA 4S1WA 2BKUA 3M2TA 1AUAA 3NC1C 4HF7A 2X86A 4WY2A 1D2NA 5LM3A 2B8EA 2HWKA 5TSDA 4MVJD 5FRDA 4U2KA 3THXB 3V2IA 3JAWB 1JYFA 4A26A 1R5BA 3HJTA 4FB5A 3DVSX 3DL4A 3M1LA 2RGNA 4BBJA 1NMSA 2NPFA 3LMKA 4XD7D 1WPQA 4EGQA 1NW3A 1KHTA 3W05A 2EJUA 4UXIA 3QXCA 3BBLA 1NNUC 3G5LA 4KFTA 4C0XA 1BO6A 1UMCB 4BVEA 3OVMA 3W8RA 2D7CA 2O23A 4JYZA 3KOWE 4NR0A 3UAVA 3SIRA 3LY9A 1RPZA 5HMLA 3IECA 2G0NA 1GQQA 1MH1A 1XJCA 3WLMA 4NU5A 1WMAA 3RRNA 4QEDA 1GTL1 1E6MA 3SZOA 2HR1A 1IQRA 3NWEA 3SBOA 5GINE 4NCBA 4DG8A 1U1DA 3FPFA 2X1MA 2PUEA 5GADl 2L09A 3X1DA 5IVIA 4DADA 2VOEA 3U3DA 4B3JA 1UMBA 5J40A 3PDJA 3NJ8A 3SDBA 1JQ5A 2I91A 2Q0SA 2J6CA 4G5QA 4PV7A 1RP7A 1WGLA 5CG2A 2UZ4A 3GP8A 3K9LA 5FQOA 1ZJ5A 3U62A 4B2LA 3ST7A 3FUCA 4MH0R 3GF4A 3CCCA 5EMNA 1G71A 3N0RA 3MWDB 3ES9A 2CD7A 1N1MA 1K68A 4TQ9A 3RVMA 3PGJA 3IEUA 4BFTA 2ZTMA 3SNHA 1KZHA 4CQLA 4TL9A 1IUPA 2JLYA 1BWSA 3L8YA 1KQNA 5LR6A 1I1NA 3VPBA 3TPZA 3LM8A 4DCTA 1TK2A 3HTXA 4XCVA 3VM6A 4CF3A 1CR6A 1ABBA 3R6GA 3OOSA 4MAFA 1FUIA 2VQSA 2VWGA 1Q19A 4X7RA 3HNPA 4J90A 4AP5A 4NMHA 2I2CA 4M83A 1UEJA 4FCTA 4CM6A 4LDAA 3AU8A 5I47A 2O7QA 3TBHA 1PRYA 2CMKA 4ND6A 4GEWA 1T8UA 4RETA 1P73A 3R6TA 3SSMA 1GNLA 4X1OA 4MW4A 2A3NA 2Y6VA 4EHIA 5FL3A 2DPXA 1ZA2A 3LYAA 3CNOA 2N0SA 3RK0A 2O8NA 2W00A 1VBFA 1CLUA 3BTSA 4HDMA 1M1ZA 4DF3A 2ZAMA 1KZ4A 1XI2A 3QELB 2Q3DA 1XCJA 1A96A 1GFZA 2YN0A 2P1RA 3HFSA 4R16A 2LBPA 4CLXA 1Z36A 4PYJA 1EP1B 1JHYA 2C2KA 2CFIA 2P9CA 1UJNA 5AKZA 5AOVA 1FFAA 1VB5A 2IPOA 3FDJA 5ECDA 1P4SA 4ITRC 1S4QA 5BW6B 3KFLA 2WJGA 1B26A 3MJHA 5F52A 4IINA 3U4CA 3RKRA 1G2OA 3NHAA 1GRVA 3ZDAA 2HYDA 3ECCA 1GSOA 4NARA 4G84A 1C9YA 2PZAA 3BICA 4MYSA 4CLRB 2VDWA 4DCNA 1O9BA 3SQMA 4GD3Q 1Z08A 1DXYA 2HA0A 4I8DA 2JNWA 5BQ3A 4Y6SA 1HC7A 4BCBA 4X66B 4IKOA 2JBAB 2J6HA 3G5AA 1Y1SA 4TKVA 4EI9A 4P1ZA 2IS1A 4O4HA 2HF9A 1WY5A 3F97A 5EXEA 3RGPA 5JBIA 1UJMA 1W2GA 3VNVA 2E4VA 1DTEA 4HGZA 5LNK6 2REOA 1N0IA 2GM9A 2JPDA 1DKMA 3BGOS 3H0EA 4JI4M 4C20A 2XECA 1ZCFA 3JWPA 2CK3A 2AFIA 3REQA 2IV3A 3U5TA 5L8RF 4X45A 5KX5B 5T6MA 1G38A 1RABA 3R74A 1YBHA 4RVGA 3P27A 4ZGBA 4PIVA 4PW0A 1PFYA 2QX4A 2VF5X 4G0MA 5JCOC 3EXHC 1HTTA 2VPIA 4EHFA 5DHAA 1FTSA 3BK7A 5AXAA 4TS3A 1VG8A 2HLHA 3N8DA 4GUDA 2CF5A 1JJAA 4X1YB 4NDZA 4ZQHA 3IB3A 1R9NA 5CB0A 1FMCA 5C7OO 2I6UA 2OGWA 4LSWA 2FWNA 4RTNA 1KDYA 3OIUA 4QASA 3UPTA 4Z6KA 1WUYA 3WICA 2QUAA 4KUGA 4LRTA 4I5IA 1QNLA 5IX8A 2J7KA 4UE3S 1V5WA 1Z3CA 2FPXA 4W9NA 2IU3A 2QLNA 4GGPA 4AMUA 5K51A 3JVDA 1SU6A 2PDAA 3QBTA 4W5NA 1O89A 1XROA 4MICA 1RHMA 4O4JF 1I3CA 4BVHA 3D0OA 2JFFA 2LUOA 3G7NA 3AWIA 4O5AA 2I2XB 3AIKA 3K15A 3S2UA 2CKDA 4KVGA 1VE1A 3STUA 2O2YA 3VMMA 1XRQA 5JEDA 5GPBA 1H94A 2CSXA 4FFBB 4KP7A 4IEFB 1LPPA 1N2GA 1FP2A 3M4NA 3H1TA 1BVSA 5KYVA 6CHYA 2BMAA 3P9SA 4KPEC 4A8TA 3UFXB 2JIOA 1R5LA 3BA1A 2V3WA 2GN2A 3DP7A 3DW3X 4JI4B 4XB1A 3GAFA 1J2YA 3CUYA 2ZYGA 1ZGAA 1DLIA 3MJTA 4Z86A 1U3WA 4RMHA 2HYIC 3R3XA 2PX4A 2DENA 5AJVB 1NVBA 2CB9A 4Y8VA 3GJXC 1J5EM 1Z0SA 3F5FA 3J7TA 2M2IA 3Q8WA 4RLQA 3QENA 1FK8A 2FMHA 1K63A 1R37A 3IJRA 1C9EA 2WJVA 4FDTA 1DJQA 1U3GA 1VEJA 4NJMB 1GR0A 3AEQA 4TTJA 1W88A 2VRWA 4ZEVA 1C1DA 2D54A 4HH4A 3VH4A 2JGAA 3TR0A 1SCKA 4QG3A 4E88A 3ZVKA 2LIVA 5DYYA 4KR7A 1JKXA 3OFVA 4R1NA 3VNUA 3L18A 2Y67A 1MC8A 2JZNA 2V9CA 4OLHA 3ABRB 3AG6A 3LZ6A 1O8BA 4FZVA 3WOVA 4EG4A 2V7QA 1BDMA 4UUQA 4WUVA 1G2QA 2KRKA 4I9FA 4INAA 4M9RA 1S8FA 2YJ6A 4NP6A 3L0PA 1YBMA 5CXSA 1AKTA 1VB3A 2YWJA 2VT6A 1L4UA 1VP3A 4CKBB 3RFWA 4YASA 3D6UA 1G4UR 4EFLA 2AK2A 3HYNA 1NJ2A 1C8KA 3AXSA 2FMUA 1DOAA 5A62A 1D6JA 4NCAA 1M73E 1OLOA 1OFVA 2X0RA 2BM1A 3M4YA 2N3ZA 2M9MA 3IILA 4G67A 1MO5A 1U0EA 1PGNA 2ONKA 3QKWA 1HDXA 4ALNA 2YY6A 3CKKA 1A95A 1UBJS 1CZUA 2NYAA 5JS2A 2XLBA 3LU1A 5BYKA 4UVHA 5ALLA 2JIZA 4HL4A 1TKBA 3GJ7A 1NVDA 2OV3A 3KPYA 1EBBA 3T5DA 3D2LA 2I80A 2J32A 2ZSEA 4PCUA 1EE9A 4KIGA 4LXIA 3HL4A 2PYZA 4D97A 3PC4A 1ZJYA 1Z0AA 5IEBA 1XPUA 1QZZA 4FX5A 1OYWA 3R3JA 5BV7A 2PL3A 5HK8A 3CLRD 3V8MA 3ZCXA 1RCFA 3DC7A 5GJCA 2VQFB 5EIFA 4X64M 3IT2A 2V58A 2P90A 1NZFA 4N39A 1CVLA 2IEIA 2GLXA 3MGCA 4AW9A 1HOXA 2H2DA 2P3SA 2QZPA 2GNPA 1SQ6A 4PAQA 2ZQZA 1E1LA 3GPLA 3L77A 2QTRA 3GVHA 5LCXA 2DEUA 2R1VB 3DLPX 4QU9A 1U1EA 1ORWA 1X13A 3T7JA 4TZTA 1QP0A 1JAZA 4K6OA 2NVUA 4KITB 1KOGA 2KSQA 3P0JA 1JKIA 1YRLA 4AG6A 3E53A 5HKKD 1AH2A 2B4RO 2AYZA 1W30A 4AMYA 1KR5A 4NBUA 4BX3A 4Q4LA 2RG1A 3ZZNA 2ZIAA 3I6YA 3OJCA 3G5UA 4MGKE 2HA4A 1GTMA 3V1TC 5CBPA 2P2ZA 1SVKA 1EIWA 4BLRA 3LHDA 4LGVA 2FWJA 5E3JA 4OGFA 2CC2A 1PJLA 2ZBUA 1IPFA 4QXAA 3FZYA 4A5OA 1JS1X 1P0QA 4Q48A 2NU9A 4RELA 2EHDA 3DWEX 2WP8J 2D5AA 3H5AA 2GK7A 4YBRA 3H1AA 1QR2A 3KEOA 3EVBA 1I2DA 1SOAA 3V7YA 1RMQA 4RD1A 3JWEA 3WIUA 2CWWA 4ZTZB 4BBZA 4Z1MA 3H8WA 4QQRA 2RHWA 3WRYC 2VAXA 3PE4A 3EMDA 4PAWA 4C2TA 1S2GA 4G2TA 1I5OA 4Y9UA 1K2WA 2REQA 5EJAA 3LPLA 2DMRA 4PQFA 3ZDZB 4B6RA 4HMOA 4L22A 2ZJ1A 1BE0A 2W6CX 1EFVA 1M5UA 3QF4B 4UDXX 5FWNA