3RADC

Quinolone(clinafloxacin)-dna cleavage complex of type iv topoisomerase from s. pneumoniae
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
227
structure length
209
Chain Sequence
GKLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKAYAWTDGELEELRKLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Exploring the active site of the Streptococcus pneumoniae topoisomerase IV-DNA cleavage complex with novel 7,8-bridged fluoroquinolones.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Isomerase/dna/antibiotic
molecule keywords DNA topoisomerase 4 subunit A
total genus 45
structure length 209
sequence length 227
chains with identical sequence D
ec nomenclature ec 5.99.1.-:
pdb deposition date 2011-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
C PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3radC00
2XKJE 3L4KA 4I3HA 2XCRB 3LTNC 3RAEC 4G0WA 4FM9A 1BJTA 3FOEC 4G0VA 2RGRA 4Z53A 3QX3A 3KSAC 3FOFC 3RAFC 4KPEC 1BGWA 3K9FC 4Z3OA 2XCSB 2XKKA 4J3NA 2XCOA 3L4JA 3RADC 2XCTB 4KOEC 4G0UA 5EIXA 4Z4QA 3KSBC 2XCQA 4KPFC
chains in the Genus database with same CATH superfamily
1KJZA 2YASA 1B3RA 1E5VA 1MO4A 4P82A 3K6SB 4EX6A 4B17A 4UJ5A 2HSDA 1CS0A 1AHHA 2I4NA 4V1CI 4Y2JA 2ZSBA 4DAOA 2E87A 2NVOA 2GBLC 1KEEB 1ORRA 4Y2PA 1YAJA 2NVUA 2B25A 3AU9A 3KCQA 1VCIA 1RWKA 3VC1A 4CLEA 1EBUA 3A25A 4BMPB 4RK4A 1G4HA 4MITA 5DV9A 3V7YA 1AKTA 4TYNA 1I2CA 4BNKA 2PKQP 5KC9A 3B7GA 1QE3A 1WZUA 3BEDA 4PN7A 4CN9A 5DGXA 4WJKB 3BMOB 4H7DA 1D2CA 1Q21A 2RH9B 2F9MA 1R4NB 2PKXA 3UAOA 1ZVQA 3OOJA 2FMKA 4GRIA 1T13A 1IHOA 4ALMA 2WTEA 3JQ8B 2OSBA 3QE4A 3S1AA 4DMCA 2H4YA 3SR3A 4OB6A 3E5HA 4NRDA 2B36A 4NMWA 1I2MA 2MSNA 1EXNA 3TVTA 4X1KA 4BEVA 3LA8A 4HYQA 2AZDA 1OZHA 3BWXA 4GYYA 4LDJA 5A4MS 4ZIRB 2YV2A 3M9LA 5JHHB 4GDMA 1JHRA 2ERYA 3LVFO 3ASZA 4M55A 2A9JA 2YWGA 1QF7A 1QM5A 4XWYA 3QNMA 4YB8A 3VPFA 2QLJA 1P17A 1OF1A 1VDMA 3R76A 1T35A 4NE7A 1DIAA 2HNKA 5JCJA 1ZBDA 4ZODA 3WLJA 1CWUA 4OJMX 3OQJA 5ICCA 3T4PA 1TQHA 4LNAA 3RSSA 2IOQA 3MCZA 2Y99A 2AG8A 6ADHA 2QQFA 2VATA 3EX7C 3JTMA 1ZR2A 2BMEA 4HVLA 3OZBA 5JARA 3DHWC 3WZMA 1DX4A 2I4TA 3GROA 3OX4A 4DILA 4AS1A 5DCUA 1J9GA 1VHTA 1UP6A 3KHTA 3KKMA 3ROGA 4A0QA 3U44A 2QHXA 5BV0A 1H42A 4B4WA 3AQ4A 3O91A 3QBJA 2ZATA 3E27A 1E7WA 4J29A 2WTAA 3C5VA 4QD3A 2NV2B 4ND3A 3SS8A 1K2VN 2B4RO 3GC6A 4RHXA 1Z2CA 5JI2E 2FB9A 4V03A 2X4IA 2HJSA 3PHLA 3S55A 3AR9A 1T1JA 4R8KA 3V80A 2IZ7A 3BMQA 2PE5A 1C5KA 3PLNA 3LZDA 4HX5A 2BM0A 3ECSA 4K8RB 5AQEA 2GSDA 5DLDA 3K0AB 3FOWA 3M1AA 1JHAA 2ODTX 2WU4A 3E22A 1GTZA 2IIBA 3H0KA 4FLEA 3NBKA 4EB3A 1OBCA 1Z68A 3BMCA 2A0KA 3TTUA 5B64A 1P0PA 4FJ0A 3ZHRA 5JASA 2AOWA 4A23A 4YPFA 2HOQA 4LWOA 4R9UC 3BH0A 3UXYA 1JU4A 4UMVA 4EFNA 4RV5A 5EIHA 5K8UA 2Q9AA 5DX8A 3WAGA 2F1RA 2R4UA 3TJMA 4C7XA 3A31A 3A32A 3LIPA 3G5TA 2R3SA 1K8YB 1V25A 2JIPA 2YCLA 4I6GA 4OIFA 1V3QE 5LQNA 3M34A 1WMSA 4WJLA 1VL0A 1PNRA 4X1KB 2H5JA 4IOKA 4IWYA 4RABA 3UF0A 3GNTA 3T9DA 3D4PA 2FN3A 3PNPA 5FLEX 3JR7A 1CS4C 1FUEA 5J4KA 5BSFA 3FKSA 2D54A 2DYKA 3W6PA 1LRJA 2NT3A 1OFTA 4P4SB 1Q0QA 1AO3A 1R12A 1AM4D 4EY5A 5AUQA 4U7TB 1CP3A 1ABFA 2YJZA 3PQ8A 4P4UA 1NXSA 1WKVA 3EXG1 1UIRA 3FOAA 4JEMA 4YY3B 1N6PA 1JG7A 1CUFA 3OZGA 4MQBA 1AY0A 3TLAA 2AMJA 2I3DA 3UHOA 3CUEF 5BUZA 5FDFA 3DMGA 5D00A 3RV3A 5L9AA 3V8PA 3IAS6 4XIFA 4D98A 5FKJA 4PYJA 2QLLA 3V4OA 2CNWD 5JNLA 4BYGA 1T2EA 4UTZA 5EP3A 1B2LA 1U9CA 1NSFA 2JAQA 1VSTA 2ZCVA 1EH5A 4XDGA 4XCQA 5GVRA 2FPXA 3P0JA 2FSVA 2PRKA 4WXPA 5KQRA 3ZJTA 4K6OA 5BMVA 4HQ6A 4W5OA 1J6UA 1WMFA 5K4HA 3PX7A 2OTCA 4FYJA 1BEZA 4TRJA 1YZLA 1PIWA 1ESEA 4IGAA 1DB3A 1S6YA 3H75A 4WSOA 4CZ2A 1TTQB 1Z9BA 1YCFA 3FETA 4KBFA 4P93A 4UASA 3LUBA 3HXTA 4JT9A 3ZKAA 3VOBA 1OZ0A 3N3BC 3H3FA 5A3JA 4BS9A 1AHNA 3OLZA 1O5OA 4XPIB 3BSWA 2W6CX 3FTDA 2R1ZA 2YZ2A 4BE7B 3U60B 5MHTA 5D3MA 2RHCA 1KH3A 3AW8A 3TW6A 1LI5A 3U7IA 1QYWA 3CA8A 1X1EA 3MW8A 1MP0A 4Q9AA 4F2WA 3MCUA 2DFDA 2XA2A 3S81A 2CCKA 3A9UA 3IQGX 4EIWA 3RAEC 1X9HA 3GRPA 3Q0EA 3RPEA 3RT9A 4EVIA 3R9XB 2X8WA 3CG4A 4XARA 5KWSA 4QDXA 4TXMA 3P4XA 3WYCA 1Y8AA 1FUIA 1OGJA 4B3JA 4GOKA 3DZCA 2CNWA 1AUQA 1P7PA 4LHZA 2JAWA 3U16A 1V8ZA 3CEMA 1S1CA 4GYKA 4XUEA 4EF4A 3I73A 5FQNA 2HXGA 2PT5A 1VG0B 4J4HA 4AU1A 2R44A 2M2IA 3G49A 4MV9A 1JIIA 4QE3A 4V2UA 2AX3A 4PYMA 5JAUA 2XZLA 3VMMA 2OHOA 3LM8A 5E0OA 5F5NA 1I2BA 3KQVA 1I9CA 2F9LA 3HWWA 1Q19A 2GARA 3OI7A 3FB4A 4FMBB 4J7UA 5J40A 1X77A 4LCBA 3FUTA 3G9TA 4M99A 3DZDA 3LQ4A 2ISQA 4MLCA 3RG2A 1T5OA 5JROA 2PXHA 2NWQA 2PGXA 1CUUA 3ZWCA 4TYYA 3L5OA 2H1RA 2N46A 5E1MA 2QUHA 2BR3A 4AWXA 5ILOA 4Y2XA 1GSAA 1JPVA 4E5MA 2ET6A 1NX6A 2QN2A 4HUQB 2AOXA 3F3MA 1R74A 3FVTA 3GPDG 1Q50A 5LOVB 2O2SA 1SD2A 1NNEA 2AF4C 3UG7A 1MEJA 1CQJB 1JNYA 3AZPA 5KTSA 2C1XA 4XAQA 2WU1A 2I6TA 2W4IA 3GCXA 2WJ6A 3LUAA 3AERB 4I5DA 5FAKA 3L6RA 4J0CA 5B4TA 2C7QA 1QV7A 1RXCA 3DLIA 3A1CA 3OQIA 4WDRA 6REQB 3L4EA 3EUAA 4OLBA 3SIWA 5D01A 5EHNA 3VTKA 1ZGAA 4QFMA 3SKVA 4YX9A 5C7IO 4NFHA 4EG8A 2A57A 3BBLA 3AR2A 4JOBA 3FTNA 1I33A 3VKGA 2JDID 3JASB 3T7AA 4ED9A 1YCDA 1CY7A 2EFEB 1DX6A 2ACWA 3FUUA 3M89A 4RH1A 2B34A 3QELB 4YQZA 2PUDA 1Q7GA 1BXRA 1MKYA 1NRWA 5I5EA 2RGYA 2WU0A 3G7UA 3DEJA 2IPNA 1TADA 4I5EA 3CSSA 4URXR 4C01A 1WPQA 3N39C 4F8JA 5K51A 3KKPA 5EZYF 3T8YA 2XGGA 5K0SA 4J91A 3LVRE 3BSFA 1LPNA 1SIUA 3DDUA 2AS0A 3FGZA 4O2RA 4FCCA 4F56A 3EQ6A 4MWDA 2AMLA 2PD6A 1M8PA 3N0RA 3OM8A 1HWYA 3MWFA 4KK4A 4NYJQ 3VM6A 2EZ8A 1RRCA 2ZU6A 1TD1A 2Q1WA 5J3JA 1UOQA 2HZ7A 4ZCSA 1N6NA 1EK2A 1E61A 1G2IA 1NN1A 2DHCA 2I3AA 2YN2A 3I2JA 3ICWA 4V0NA 3STUA 2OG2A 3OTHA 3F5QA 4AZVA 4YASA 1T3LA 4TL7A 3LOUA 5ANRB 2H1OA 3FBTA 2XQFA 1HEYA 3HP4A 3NHMA 5DM1A 3VYRB 1R37A 2JI9A 2A78A 4ZU6X 2KBFA 2KX7A 3DDHA 4MJXA 4ND2A 5COBA 4DQUA 1CR4A 1G8AA 3JRNA 3EUEA 3K1TA 4D0NA 3PK0A 2PKWA 4KE9A 3RJ9A 4II2A 5LQKA 1GGKA 3U62A 1D1SA 3BXFA 3W8RA 1DO0A 4HLUA 1XD8A 4R01A 5ERXA 2VT6A 4O5OA 4EKYA 2F1KA 4OI1A 4H60A 3ZYCA 4AVYA 1C9MA 1RWWA 1UC8A 2JGNA 1P4HA 5ALHA 4K9RA 4NV3A 3MILA 1RPZA 1HNNA 1NVEA 4DLKA 1U2RA 2CXXA 2VLBA 2ZVPX 3TAUA 3VVCA 4L8WB 4JI4B 1DTSA 2PEYA 2YWDA 3GGPA 2F1HA 2C9MA 1P8JA 2F43B 2IZ6A 4AY3A 1A1VA 4MYTA 2R6ZA 4EJSB 1I6WA 2EERA 4RJKA 2NUTB 4AM8A 4EY6A 3NBQA 2DB3A 1ULHA 2W2NA 4PHTA 5EYPB 2AEMA 3B1WA 1Z82A 4A5OA 4QYWA 4RMGA 4ZICA 4FCTA 3EA0A 3INTA 4AKEA 4LC1A 5EMJA 3OH8A 3SD7A 2ZRJA 1Y5NA 5AKIA 2CVPA 1UFVA 1YFLA 4OK3A 1H2RS 3GWGA 2RCYA 1TCVA 4JBXA 3VSAA 2CMGA 3KP1A 2HM7A 1Q1AA 3OEYA 4WVFA 1U4SA 1BRTA 3K6JA 5TRTA 1O7JA 1O94C 1TOAA 1N2OA 2GRUA 1JR3A 4IJVA 4UE2A 3TL2A 4ZJPA 1DAHA 2MCFA 3M4JA 4HPJB 3W8DA 1ULZA 2W2MA 1QZZA 3PDCA 5ALVA 5M3BA 1P18A 3CCFA 2D5LA 5CFQA 4OK6A 5FBKA 4DSOA 3I1JA 4RKRA 4G5RA 3PNLA 2JCSA 3E18A 1H0HA 4KQFA 2ZYVX 3BA1A 2OM6A 3I52A 4E5YA 2A35A 2B7LA 1TGVA 1EBBA 2ILVA 2Q6TA 4YQFA 1M0EA 3NALA 4FZ3A 3MQFA 3WMWA 3HR7A 1KWGA 3ESRA 3T9AA 5A06A 3L2OB 4KIGA 3R3SA 4NAHA 5EZ5A 3SX0A 2WWIA 4IMPA 3RKSA 3UJNA 4ND8A 2PQ0A 1R10A 3FTFA 2YY7A 5DT2A 3S5JA 4N3AA 3OQNA 3L4JA 2A0UA 3HPRA 4YMLA 2QR5A 1E6MA 1FPMA 4YFVA 3K6RA 3BA6A 1B0UA 4HQFA 4B6SA 4XRGA 3GYGA 4TXHA 4BOYA 3U4IA 1QTQA 1Y3DE 4RFSB 1P1BA 3I5MA 4XIIA 2JVJA 2HMWA 3IMKA 3P2JA 4Z1MD 8OHMA 3E4CA 5FWYB 4A26A 4MVJA 2PUJA 4LEIA 3WLRA 3IV9A 1VHWA 1NMQA 3P7MA 1Z0FA 4K0KB 2SKDA 2EFYA 1V4NA 2ATCA 1YL5A 2BEWB 2C88A 3KZKA 4HWSA 2OXCA 2XGSA 1KVQA 1BU8A 1SZDA 2QRLA 4MS4A 3ZX5A 1G2PA 1P3DA 1E7YA 1G5HA 1U7UA 1CNEA 2CKMA 1EUDA 4A73A 4DC0A 5ICMA 4D4IA 1KKMA 3BPSA 5GZ1A 2B21A 1RHKA 3O9ZA 2QRJA 2X15A 3CLUD 3EXHA 3EEQA 3FFXA 3I72A 4MPRA 2W2XA 3KVVA 4HB0A 4S1NA 5BVGB 3D8BA 2ZM6B 1RZUA 4GKAA 5JZMA 1OI4A 3B9QA 5C53B 1J7KA 4RTJA 3GLFE 1P6XA 3VH4A 2EJTA 1QQ6A 4HAYA 4PHHA 2NNWB 1J1IA 1SHZA 2WSSD 2MR5A 1I4WA 3CNEA 3OOWA 4W9RA 2C04A 2R7AA 3N8NA 4QC2A 4ETNA 4UMEA 4YJHB 1SIWA 2QRNA 4PS0A 2EC5A 2BFBA 3FM9A 3PF8A 5ADWA 1N75A 4OU4A 4EY3A 1U3CA 1H1TA 2O3JA 4DLUA 2Q2WA 2OUIA 2BBTA 2XAAA 3BJIC 5L51A 1M6NA 2PX0A 5ITWA 2XT0A 1R6AA 3MGGA 3RTBA 2FUEA 1EFRA 3WL6A 4M22A 4O4JF 1Y9JA 3ROKA 3TSOA 4Y6PA 4E70A 2HJ9A 4KFTA 2CXPA 2YNMC 1T1SA 4R8SA 1OB2A 5K09A 3E2MA 3QY9A 1ISHA 1ZD1A 4EQZA 1X6VA 1SC1A 5KAMA 1OPRA 4WCFC 3PDHA 5IBQA 1YC2A 3FRJA 1M5RA 1URPA 4B81A 2P5UA 1YQGA 3EXEA 1ISFA 1GUAA 1PZXA 3D7SA 2DXIA 2JGAA 5J2UF 1J8YF 2ATVA 5GM2A 2K87A 2X1HA 2DX7A 3D8SA 4GHWA 3Q98A 2PS0A 4M37A 3SQOA 1BGWA 2EKBA 1ODIA 2AN5A 3C98A 1YWGO 4H0FA 3K9HA 1VCNA 3WIBA 1IONA 3CPJB 3KAQA 1BDBA 2QTVA 4ZVKA 5CD9A 3ECCA 2VPZA 3PKZA 3DEZA 3TTTA 3R7DA 3KEMA 1N2SA 1NTRA 5BNFA 3ZNPA 4WECA 3OURA 1V5GA 2V7TA 1XZJA 4YJFA 5IAKA 3STXA 1I6MA 4HLDA 4ZI7B 1O5TA 3UYLA 1BXKA 3HJCA 4FHCA 4CUZA 1VIVA 4ZCLA 3VDRA 3M4NA 2WWRA 3D0RA 5CXUA 1E1NA 2QN6A 2RHJA 1PR4A 4D0SA 3KQNA 1SXPA 3INYA 1LF5A 3TBFA 4K40A 1QYCA 5EIFA 4FMCB 4RD6A 2PZJA 2N75A 5EWMB 2EKQA 3L8MA 3H13A 1WXIA 2Z30A 2JK1A 3E3AA 3I6IA 1QTIA 1G21A 3F6EX 3JS5A 1PG0A 3WKEA 5IKPA 4P5EA 5AVZA 2Y1EA 2I22A 2PUBA 4JOCA 3IXQA 1VXRA 2I3GA 2O8DA 4LDNA 3VR6H 5FL7D 1EHCA 5LR6A 5AUPB 5CT5A 4A4DA 2VEDA 1A8SA 2VJBA 2CCGA 2R7KA 2JAHA 2YJ4A 2R6JA 4AO7A 5BV8A 1JJVA 3OJOA 1HLGA 2QD5A 4KVZA 4TV8F 3HXMA 2V65A 1SUAA 1T9GR 2ZUSA 4MLPA 2RG7A 4PIMA 4UHFA 5IW8A 3RS4A 1ENZA 1OE0A 2Z6VA 3FNEA 1GEEA 4Z2YA 1UJ6A 2R7NA 2HCRA 1GUZA 2PR2A 3D0KA 3HJNA 4CF7A 5GGYA 2Q4DA 2CNBA 4TWIA 5CXSA 1N2BA 4ZVRA 1RE1A 2XWPA 4JI1B 4A1FA 1U7XA 2Q41A 1C2YA 1L3IA 4D8UA 4F6RB 3LYAA 3VSEA 4HWPA 4TWZA 1K92A 4BNZA 5I7FA 2ZJ3A 2WWVD 5MN6A 3OZCA 1Y3CE 3N8KA 4BNXA 5CJ2A 3SEZA 5LVAA 3PLAE 3L5KA 4AN1A 2YS7A 5FEUA 5JDIA 1RRKA 2DOKA 3GJRA 1LSOA 3T7EA 3RVRA 1GPH1 3KETA 3BRSA 4FYMA 3GFTA 1G5IA 1UK8A 2ZP1A 3M6AA 3OIGA 2NZ8A 3HR8A 1Z3IX 2CF5A 1N1DA 2H0QA 2W2LA 3DWIA 1RRMA 3ZHVA 1JAXA 4B7AA 1LA2A 4IIDA 4TTAA 4D6YA 4KL8S 1SXJB 3AFIA 2JFYA 1OYOA 3DL2A 5ULLA 3SJZA 4DBLE 3DCIA 3IAS1 3HB5X 5C8DA 4MB2A 4C6HA 4LBYA 4GO1A 5CPBA 5C7OO 1CUEA 4RK0A 3TGWA 2WVHA 5BNIA 5LSAA 3R7WA 2EGGA 5JZBA 1MIOA 1R50A 2BE9A 3KPWA 2HHAA 2VTKA 4U63A 4YCDA 4RL6A 1IK6A 3E58A 3CZ5A 2BTOA 1QNLA 3GLHB 5EWMA 3V6LA 5FUMA 3SHFA 1CUHA 2QLMA 3JYLA 1ZD5A 4UUMA 1J2JA 2WJGA 1EVLA 2EKPA 1EB9A 1PFGA 1RAIA 3AJRA 3UW1A 3VO8A 1CNMA 4RZSA 4X1YA 4Z7JA 4YCMA 4Q3EA 1GU7A 3CZAA 3THOA 3H6KA 4CNBA 1RTKA 5AKYA 5EUCA 1BQ4A 2ZRHA 1A3CA 4BMNA 3QMMA 2AR9A 2FEAA 2JI8A 4P58A 3H4VA 3SNHA 3I9KA 3MXTA 3GFQA 4MIYA 2QVXX 5L7WA 2L19A 5AIAA 1P6QA 2O3UA 3KVYA 4YV2A 5HJEA 3R7AA 5FWAA 4YT8A 1HA3A 2CLFB 2R97A 2Z8YA 3HBFA 4G81A 1HC7A 2YHIB 4L51A 3W79A 3OU2A 1KEKA 5A03A 2VDUE 3IC5A 1CLEA 2RC5A 1SBZA 3TW8B 2XEDA 3TD6A 1PX0A 3GP3A 3PXXA 1CVIA 3GMTA 3HBMA 2X1VA 3W4IA 4AWAA 4LXGA 3FTQA 5I8WA 3M6VA 2Y2UA 2O2CA 2XBLA 3GLFB 4EATA 4R3NA 4Z99A 3QNUA 4O3FA 3U4CA 4GOOD 1WHSA 3H3XA 4ZU3A 3QA3E 3AB7A 4K9OA 4PG5A 2FP4B 3RIEA 4XGKA 1DL5A 3NHRA 3GJSA 3FNBA 4FR2A 4JJKA 2CJWA 2BMVA 1VP9A 2VZLA 1T6NA 3BQMB 4MR9B 4PZCA 1PK8A 1RYEA 2JBAB 2PYZA 4YHBA 3NX4A 1RRFA 4WAUA 4NU0A 3WY9A 5K6AA 1LI4A 2G5TA 2A94A 2ZR0A 3FDIA 4Q39A 1Z2AA 5F3RA 1O89A 3D64A 3S7ZA 4LF8B 3NOQA 4X45A 1NQVA 1V48A 1HSOA 3MXOA 3PR1A 4I3FA 5DHFA 5LIPA 1KO4A 1PHRA 2CLKB 3BDAA 4KWTA 3DTVB 2VNIA 4EFLA 3C85A 4GD3Q 2RAUA 3N5CA 2FPGB 4LJLA 5HP4A 2R751 1H2AS 1WXDA 3CLRD 3CLUC 3V32A 1PN3A 1XBTA 2O3SA 4A91A 4PQEA 4AO8A 5IUJC 4GM0A 4CLRB 2XXAB 4B9AA 1WUJS 3RVLA 1T5HX 2PFSA 5CVJA 4GGOA 4F5WA 2ZI7A 5TPZD 3T5TA 4B3DA 5DWDA 5H7XA 3HU3A 2VP4A 3AVUA 4QUAA 3B38A 3PEYA 1LLDA 4CXMA 4MRAA 4CF3A 2ZRIA 2I71A 4ZP1A 2HHCA 2I99A 2RH5A 1CR2A 2Z2ZA 4XFJA 5K3FB 3N6XA 3VYUB 3SZUA 1W6UA 1NASA 5F1YA 1J00A 1P2GA 3WLAA 3PQ3A 3T7IA 4BN4A 2OKGA 4ASUA 1RTTA 2EYUA 4I55A 1GFZA 5F5XA 3AHFA 1KNXA 1VI5A 3QYPA 4O4HA 4BEJA 3TX2A 4D26A 2ZWVA 4JSTA 1X7WB 4LI0A 5ES3A 1L7RA 1P0IA 2C96A 3SOPA 5A5EA 5JC1A 3HXOA 1JAYA 1UBKS 2B83A 2J59A 3K6KA 3I4FA 3NIDB 4CTJA 1RIFA 3BXHA 1UBUS 3R8CA 5DMXA 4CM4A 4DB2A 3HCBA 1B3BA 4PXAA 1I6LA 2RKBA 2B5OA 4DA6A 1CERA 3DPIA 4FSDA 2IV2X 2XYQA 3IAFA 5JYEA 3CKYA 2ZYHA 1JRLA 1ST2A 2PK3A 1U31A 1Y6JA 3AXSA 1XOIA 2ZWPA 3FSGD 3EISA 3T35A 1LSJA 2PVPA 3QITA 4WNIA 5TEWA 1SO8A 1RRVA 4HXEB 3C3KA 3EY4A 5FBHA 1RYFA 3ZHCA 4BO2A 1OBOA 2FX2A 3ACCA 4FFPA 1ZH4A 1IVYA 3K2IA 4BQSA 3AF0A 1GV0A 2ZSJA 5F51A 1EP9A 1QGZA 2R8RA 2Z5GA 3HU2A 4GFDA 5JU6A 1WF6A 2FSPA 2I0FA 1N8KA 4QU0A 4X8MA 2H31A 2FWIA 1ZJ6A 3C87A 4H7KA 5BR1A 4C0QC 2ZTHA 5CA1B 3OA2A 4MHOA 5I47A 3SOZA 3RC3A 2DWUA 2P77A 5CXXA 2FPGA 4MQFA 5KPDA 3R7WB 3WGKA 1A2BA 1IY0A 1QLWA 5IJ0B 3UH0A 2C2BA 3UHAA 2OYRA 1CR1A 3L7LA 3LPDA 1QGOA 1KEWA 3L7IA 2AFHE 2C4UA 1JG3A 3AG6A 4QRDA 2GH1A 3ZCUA 1GPWB 2KLBA 3PSAA 3DLBA 4OFBA 5DISB 3R09A 4TLMB 5FI0B 1KHTA 4UMFA 5IEJA 2QD4A 3FSGA 3KSMA 4ALJA 2ZKIA 4ENVA 4H7PA 2WIDA 5HDBB 3A2KA 3KB8A 3WGJA 2XB8A 3ENQA 4DHEA 2WFMA 4DQ0A 1ADFA 5B6PA 5JQGF 4NCKA 2GDZA 4TLCA 2QJTA 4QWWA 4WBXC 1SUBA 3M5DA 2IIVA 3K8QA 3O0TA 2TMYA 4IIUA 3W78A 4MR7A 3ZCQA 1NUAA 2DETA 3UC9A 3ZVKA 1E1QA 3QLJA 3PWZA 3DKKA 3FTPA 1U8XX 1XKTA 2XTZA 2FRVA 3TCXB 3AHIA 1IN7A 1AQYA 4BNLA 3H19A 1T1IA 1UQTA 2L69A 4JGGA 2Y1CA 1LC3A 3WSTA 4Q4LA 3WZLA 2J5RA 1UWLA 4HKTA 2I7VA 3LT5A 4RQUA 1JLMA 1U2GA 1R0LA 4JT4A 5SZKB 4K7JA 3KB6A 2BAGA 4X20A 2NQ2C 3M6MD 4R7GA 1PT5A 2F2TA 4QOHA 4ZU1X 4DG9A 1C30B 1KK0A 1AB5A 2NYVA 4DA0A 1T6ZA 2DTDA 1QH1B 2J5BA 4JGIA 4AJ9A 2RKWA 1HTTA 1G3RA 2OC4A 3UXMA 2DUNA 4R8VA 5H3LA 3QQPA 4FB4A 3Q4GA 3GFSA 1MBZA 1Q77A 4BRWA 1E96A 3MGKA 1YFZA 4UM9B 2FYTA 4R84A 4BX2A 2PLAA 3N2KB 4JB0A 5ESRA 4R2JA 1ADYA 1UH5A 1C4OA 2CUKA 3IE2A 4R83A 4ZV4A 2X6RA 3VUFA 3DAYA 3OIYA 4HBGA 4J1SA 5BQXA 1I7LA 3AM4A 3TGPA 2X58A 2WA2A 1X9IA 1H69A 1QZTA 1RVDA 3QOYA 3TLGB 4MQUA 3KZ1E 1XJQA 3N53A 2DQZA 5EFOA 4E46A 4KXMA 2ZJ0A 3MOGA 1S1MA 4RACA 3G2KA 5CA1A 1IOVA 1L5FA 4PO3X 3DUFB 1G8SA 1L2TA 4JYBA 5E6RB 4OHXA 1Q20A 1NWCA 1QPZA 2VG8A 2NZJA 1SFRA 1JEAA 2EX4A 2AW3A 2XNDD 4FBLA 3U9TA 1U1CA 3RD5A 1C50A 4NNPA 2A67A 3FNHA 1C14A 2O6LA 4CCYB 2JB9A 4NOKA 2IEZA 1G6HA 1RYBA 3GZNA 4X64B 3IL2A 1QFJA 3EQ8A 3H2IA 4BZZA 4HFRA 5F2KA 4GVLA 4F9GA 5J2TF 1D0IA 3AOEC 2CFOA 1ZJ4A 1ONNA 1NVMB 4PAWA 2FW6A 3E3NA 3LL7A 1E6UA 3OU7A 4JP2A 3VYWA 1KYIA 3SHQA 1VPEA 4HAOA 3SJCA 3TJZA 1WG8A 4FLMA 1UBOS 1PL7A 4B3MB 4CM5A 1Z6GA 3A9SA 1T4CA 3PUHA 1ABBA 2GXQA 4FE3A 2B8JA 2JLRA 1BN6A 1BX3A 1SUWA 2QRVA 3EA4A 3H16A 3QVKA 4MGKR 5T3UA 1W47A 2QDXA 3KYCA 1F6DA 5LC1A 3VU9B 1JMVA 1SUSA 1V9CA 2ZT5A 4NNOA 2IZZA 4OF4A 4LQDA 2OGTA 3NDBB 1LK7A 3U7EB 2WRZA 1B0ZA 5T8KA 4LMAA 5HTKA 1CJVC 4RVFA 2IYZA 3RRXA 3KQPA 1CDOA 5LBUA 1JS1X 1Z83A 3QKRB 5AMXA 1R0YA 2GEVA 5HUHA 4FDMA 1WEKA 4K6FA 1JVBA 1UKEA 5DASA 4ZO4A 1MAVA 5IH7A 2JJ8A 2QAGB 1FNNA 1GSHA 2ZPAA 3Q2OA 4MQLA 3K2QA 3CRZA 1AUPA 3FF4A 4YT2A 5L6LB 4HNUA 1YDGA 2P3LA 4GEGA 3A11A 5BSVA 3KK0A 5SICE 1ZJ5A 2BGLA 4B7UA 3KHSA 1E94E 1ZWKA 2WSMA 4G5FA 1JWLA 5LD2C 1A77A 5AOAA 3UTDA 2PGDA 2VS1A 3SI7A 4MNTA 3ND6A 1KA9H 2PVSA 1N5RA 3AEUB 3OY2A 3PENA 4ZKEA 4M6WA 4RESA 2PIAA 3UWDA 3ADCA 2X5XA 1GRQA 3JAKB 3HBJA 2C9DA 3E6AA 3CUKA 1V8BA 3K20A 1MA0A 1JKMA 2DHEA 4RTPA 1GGVA 1NP3A 2WKPA 3LWBA 3HCRA 4LYHA 5A7GA 2JLAA 1TQ2A 3SJ7A 3WGZA 2OV2A 5LQUA 3TYXA 2H52A 3GEEA 1PD1A 3QELA 5BWLA 3R6LA 1EE9A 2FV8A 2VUHB 3AY3A 1VB5A 1VA5A 2BL4A 4ISBA 1D5CA 1VYHA 3VFDA 4EMUA 2Q3FA 1ZUNB 3GB9A 3X1JA 5EMKA 3FF1A 1A9SA 3GNQA 3HGTA 3LCCA 3H5TA 5CW1A 3A05A 4CHTA 4EMBA 3LHDA 1YAHA 1WRBA 3ISJA 2G9QA 4X61A 5IBPA 3VO2A 2ZYRA 4DSNA 7MHTA 4JC0A 1E1LA 2CW5A 3LXXA 3K92A 1CRLA 2YFQA 3UJDA 3PTAA 1YXMA 3IALA 3ZE8A 4YUZA 2PRIA 4P92A 1NVAA 2CHVA 4LE0A 2C58A 1AVTA 1H0RA 1TK2A 2CHFA 2II6A 4UAUA 1HDZA 1N3IA 1L7XA 1M2NA 3W06A 4JDUA 2XTJA 3JARA 1S4MA 4NXNB 1DQZA 3CN7A 4YTEA 2GJ8A 3KJNA 4ZAFA 5EJ6A 2FPRA 2IYSA 4G0NA 3PTLA 1P0FA 3K1AB 4CEHB 1O6CA 1I3OA 3WKDA 2C7RA 3GEHA 2MYPA 1RJ9A 2V5VA 2LW7A 3NVAA 2V55B 3DCNA 3SZGA 2IELA 4ZAZA 2PD3A 1GT91 4FQ5A 3WIOA 2CKDA 4HEJA 2J87A 4UHCA 4TT3A 4LQCA 5HKAA 3WJ7A 1F5NA 2Q46A 3LQKA 4HDRB 4QVKA 1LX7A 4WKGA 2YNMA 3CMMA 3EY9A 4BNHA 2RCNA 2NZWA 2X9LA 2VZEA 4FOOA 1Y48E 4HLCA 3HJRA 1G7SA 3CIOA 2I34A 3C3AA 3ROXA 1UFRA 1I2DA 1Y5LA 2FHPA 3ICCA 4A5SA 1AKEA 4V0RA 2H2FA 4U7FA 3OFVA 4K6HA 1TT7A 2J45A 1XRRA 1VGQA 1RWOA 2HF7A 4H16A 1WF3A 4I6JA 1G8YA 1X2EA 3EXIA 3CONA 3RHZA 3CW2A 4KVFA 1FDVA 4NZYA 4ZT4A 3RUIA 4DWWA 2OV4A 2A9KA 1QDUA 2IFTA 2RI1A 2WJ4A 2J7PD 4ZOEA 1XKQA 5EXPA 5I9LA 2OZLB 2H08A 1G7TA 4TKMA 4ZI2A 1PQPA 3FPJA 3R5KA 4IV0A 4TN5A 1BEEA 2WWHA 2V3CC 4CU5A 2X0JA 3LG2A 5IZCC 3FMIA 4Y7DA 1FVHA 1TIBA 2YOHA 4WGGA 4FDVA 3FLMA 4QYSA 3JZDA 4UD6A 3VR1A 2I3ZA 3EVFA 5LQAA 2KS6A 2R68A 3KT6A 1GFWA 1T15A 4BASA 3CVXA 4YI5A 2BTQB 2OILA 2PX3A 2SNIE 1NA5A 5LP1A 1MLDA 2WUVA 5DULA 1M8FA 2QTCA 2BFMA 1N33B 1HX7A 5ICGA 2IOHA 1A4IA 3L9WA 3BD8A 3FIJA 4HOYA 1PZHA 2XKAA 2HPZA 2O7NA 2P4HX 4C2AA 4V0QA 3FCEA 1AKUA 1O6GA 3QLUA 3TTYA 3GNLA 4MKXA 4G0VA 2HEGA 4FGZA 2QY9A 3VC7A 1NIPA 2JAUA 4COOA 3QEBZ 1IAQA 4YJ3A 1QLHA 3AJAA 2XDAA 4MPDA 3SEFA 1V4VA 2LKCA 4Y9DA 1ETUA 1RYZA 4P5DA 2QSYA 4WL0A 2I4MA 1JEQB 1Y89A 2QG6A 1QZ3A 4IIXA 4KPGA 1CUIA 4U6NA 3W5IA 2VP0A 3WADA 4KUEA 3CKLA 4AJPA 3E1GA 2Z9CA 5F9HA 4GOLD 5G1OA 1P0CA 4FIZA 2FPPB 4KN9S 1RQ2A 5G4KB 4AYTA 3QHAA 3O75A 3TQSA 4F4HA 3G8YA 1VLJA 4O3MA 2HDWA 4DZZA 5KNCA 3IODA 4KIWA 1LK0A 4UDYX 2N1BA 2YR0A 3ONFA 1GRVA 1LV8A 4YAIA 4OI0A 5J9FA 4EKNB 2QTHA 2UYYA 3W5BA 2EQBA 3O4IA 1GN8A 3KD3A 4LY3A 2OXRA 2I1LA 3Q7EA 2C31A 1XQ1A 3KUXA 4MQEB 4XVHA 4X0EA 5F2OA 2QL6A 1SPBS 1SKYB 2EX0A 4NNJA 3V1YA 4MUKA 4AP6A 5M7EA 2ZRBA 3GG9A 3CF6R 3QPCA 4DUGA 5AJWA 4AYWA 1E3DA 2Q9UA 4G56A 1XCMA 3WJ2A 5B3JC 4BNMA 4RJLA 3R0JA 4ENQA 3ZH2A 2D2IA 4ZZ0A 2QBYB 3P96A 3R23A 4U2DA 2CWWA 4KK3A 1PLJA 2I78A 3T3EA 2F8TA 2J9ZB 1BXRB 1YTLA 3T0GA 1F17A 3RSOA 1LZKA 1BWPA 1DIHA 3QXXA 2HIGA 4WCFA 2JCVA 4LVCA 3SFZA 4DR2B 1VG1A 4EOGA 5BV7A 1NC1A 4RE6A 3W9SA 1KIMA 5CBKA 1BKSB 3QIVA 3VR4H 5JRJA 2XUAA 2C9OA 2XUPA 5B5SA 1LRKA 4OL9A 4FGKA 2M6LA 2WTBA 3CEHA 1XF1A 4MEJA 3RIMA 3VOSA 3F9IA 1GTRA 4EHNA 3AVQA 3ZVMA 3O2NA 4EYKA 4V0MA 1DAGA 2O7RA 4PG4A 3RNOA 4HNAB 2NZXA 3AM1A 4AULA 3HYTA 3AL2A 4DPLA 1UOOA 2GAFA 4L6IA 5AI6A 2FX5A 3BHMA 2Q8QA 4Q82A 5D8DA 4ZAVA 2XZTA 1XXLA 1YR1A 3T3HA 4GE0A 1RI2A 3GY0A 3H8SA 1ZZEA 4MKRA 4QU5A 4PNHA 4U8GA 4W7HA 1KI9A 3IT0A 4IL5A 1U8FO 1QGUB 4IFTA 3RF6A 5K3EA 2XNHA 1ZD8A 4JL8A 1G64A 3VHXB 1M6VA 1FTGA 1W1WA 4UKDA 2FSVC 5B6IA 5L53A 2VYQA 1O4VA 2BMAA 1YR7A 3KEQA 1S2OA 2VRBA 1BVHA 1L9KA 3ONWA 4YC7A 1IG3A 4QGGA 3AY7A 3H5OA 2N0SA 4DJTA 4O4LA 2IF0A 3NUQA 2NTJA 1U02A 3GMSA 2QF7A 3QJYA 3GK3A 1ADJA 4IVPA 1BC5A 4RANA 4AKSA 5B12A 1G7RA 3F9CA 3MWDA 4G1BA 4LS3A 2EYQA 3W3ZB 3DB1A 4H4EA 2BM9A 1B8NA 4FEYA 2PWZA 3LC1O 3W90A 1GILA 2J08A 3IT2A 5E6SB 3I9OA 5JG7A 4D56A 3CE6A 3DBHB 1EZZA 1KGDA 1ZLYA 4U4AA 2Q4TA 3FUVA 4OQYA 2GPAA 1JIKA 1P4RA 1UEJA 1ZM3A 2H3HA 3UBTA 3TRHA 3SZOA 4XCVA 1K7SN 1QIJA 3O8LA 3IHKA 4EJMA 1P5RA 3EDQA 1B16A 3JWHA 5KVCA 2I2DA 4BVJA 4RTQA 1M2HA 1Z6XA 2NV0A 3DOCA 4FT2A 1C4KA 1QB7A 1NQXA 2HREA 4IDFA 2GERA 5D7BA 5E8JA 1KWKA 2WABA 3I64A 4NECA 1Z3CA 2FGKA 2Q1UA 4IEEA 3H1PA 4I55B 1E1RD 3IBYA 2RK4A 3BOSA 2QP9X 5JSFA 4Z0TA 2XVXA 3IP7A 4GEKA 1XTBA 4BJ3A 1GTJ1 1XZHA 4MPJA 1K6MA 3ESXA 1ZIDA 1NI5A 3Q8KA 1TYEB 3GOQA 3GLUA 1P1CA 2I2XB 2Q2VA 2KQUA 3G59A 4LKOA 4QDJA 2IITA 1VLQA 2OO5A 3NVMB 3O7WA 3TZLA 4DSTA 1E9EA 2IX9A 1PJ3A 2AFIA 1XEFA 1R5JA 2AQ8A 3JYHA 4DL9A 3W4KA 2QLFA 3LUPA 1DJOA 2FRDC 3Q3IA 2I1QA 3HFRA 4BQFA 3IE0A 1VL2A 2ZFUA 4ZFNA 2EP7A 5BSWA 2PMWB 4ML3A 1UZUA 2R8YA 5IJWA 1JL3A 2P78A 4RK5A 3OCVA 2J6BA 2ORIA 3AFMA 1NF3A 4BMVA 4H35A 1PK9A 4P0QB 3KUCA 4QELA 3G1TA 1E3IA 3A1NA 4AMYA 3SDZA 4Y6OA 1T1GA 2ENWA 3PHIA 4BFTA 4KQXA 2HWWA 4O4IF 1EVJA 1X80A 2EGUA 1L7QA 3TCKA 4M36A 4RTRA 2PZMA 2D5AA 1EDEA 1S8AA 2IDMA 3MM4A 4XYMA 3GQBA 2CDRA 4EI7A 2P3OA 3C3BA 3CUVA 1R27A 2GESA 5JCPA 4O4IA 5KTTA 1S2IA 2GBCA 4BCDA 2WUGA 2ANCA 3KOUA 4BB5A 1ZKMA 4C4YA 3UOWA 5BURA 5FPTA 3AJ8A 1C9NA 3G17A 4LXXA 3IJ5A 2A8YA 4IQ4A 4YCBA 3RARA 5K0EA 4B3GA 3PT5A 4I1UA 3I6YA 3I9JA 2OXIA 1FQKA 3IPAA 4MHSA 1TVMA 2OQVA 2H1CA 4DPKA 3ASUA 3IP8A 4IKPA 2F48A 4HXGA 1M72A 3PIIA 3FB1A 3KSUA 1X7ZB 4XWAA 2AC4A 2GFQA 2YZNA 2J09A 1GNVA 1YE3A 1DBWA 1R8SA 1YZHA 4V2IA 3ZEAA 3JYQA 3ZHXA 5IDQA 5K20A 4MJ7A 2JIZD 1T9DA 4BX8A 1Q1GA 1WSAA 4I19A 3RU7A 4BFVA 4Y9SA 3CE9A 3NBFA 1A76A 2GM3A 1IOZA 2XRMA 2UZ1B 3KZCA 1AHIA 1BD3A 3LH5A 2HF9A 1CSEE 3F7NA 1M2WA 5K99A 3ZU2A 4D9FA 5BUCA 2GYWA 1FVOA 5COQA 4ZGBA 1FYEA 1MRZA 5HVNA 3A1UA 4LF9B 4EWLA 4KRFA 2ZJ4A 1E2QA 1DDIA 3WYGA 3IXLA 5GINE 2GHQA 2XMGA 1P5HA 5BV1A 5BQFA 5EJ4A 5AP9A 4JR2A 5F1PA 5CH3A 4OB8A 5H4GA 3DTVD 3M5WA 3AVPA 4HX9A 1ECBA 4XTRA 1OI7A 3JSAA 2KJQA 2NXNA 4LXUA 3RRJA 4AUMA 2SICE 2VDMB 3I92A 1JHDA 5FADA 4UPVA 1RC0A 4OXXA 5AUOB 1PZEA 4F96A 5KTYA 6ABPA 2PSFA 1N6KA 2F90A 3AYZB 4JJ7A 5BPHA 2IPMA 1KVRA 1UDRA 3FDFA 4A0HA 2VNHA 5JANA 1PUXA 2DPGA 4PZYA 1R9MA 1M7GA 4MGHA 5HKLA 2C4TA 1WDKA 2JA1A 1Y5IA 2RI6A 3QVTA 1OKKA 1R6XA 3OQIB 1U2GC 5KYNA 3CVYA 4ZEOA 3HVRA 1I1NA 2H92A 2R00C 4KQJA 2DKNA 3BQ9A 4GLFA 3L1VA 5JCOC 3LVBA 1AK1A 3QOXA 1MA3A 1UFOA 4O08A 3WP1B 3Q6NA 1W1UA 1XC7A 4XEUA 4QUDA 4LRXA 5C32A 3HHEA 4YVFA 3UJBA 3ORRA 2NU7A 3NDJA 4HDNA 4PSDA 2WY2D 3E53A 3RAPR 2JCBA 5BRJA 1KEZA 3ZWNA 2F1OA 2YDYA 1P2BA 3NTVA 3V8EA 4ZVTA 3HL0A 3O93A 4ETIA 3OCZA 3ZDAA 3EMVA 1SUDA 3FPGA 3ZW9A 2VJOA 4XCXA 5ILQA 2CLDX 4R1UA 1DOHA 4BJ6A 1HNXB 5C1OA 2VDKB 3HM2A 3T3PB 1Y1TA 2WICA 5LMCA 2RGBA 4LISA 3QHPA 3GX1A 1ISGA 2YJTD 2I7TA 1LXCA 1XN4A 3OX3A 4EGJA 3R6TA 4RWZA 4WESB 5EHGA 4EHKA 2BH2A 1XFAA 2OGUA 1GZVA 2BDUA 2YRWA 2EQ5A 3HDVA 2Y8EA 3MRTA 1WUHS 1DUIA 3OJEA 1ILWA 4HB3A 5I9TA 4XSHA 2EF1A 3U4GA 3E15A 1JJAA 3EBOA 1E3WB 3QVMA 2CXRA 1AKVA 1JX6A 1E4OA 3F71A 3QQ5A 1SHTX 4XTCS 3EPLA 3OWHA 3QVGA 1YK0A 1W85A 2HQ1A 1T34A 3C6QA 5LQMA 1X7WA 1RR6A 1WDLA 2CJYA 2Q7XA 1GA1A 2QTFA 4RD4A 3TI7A 3ZGNA 4FWTA 4CWAA 5CDHA 3NPAA 4N0MA 2DC1A 2J30A 4BBJA 2D3WA 4MUGA 1ABEA 5IBRA 1XZLA 1ECCA 4KNWA 1IPFA 3O1IC 5JSUA 3A58B 3ZD8A 1QH8A 4NONA 1GQRA 5ALOA 2R48A 2FQ1A 4LFBB 3HDJA 1MB2A 1Z2DA 2XQVA 4Q1CA 4RXUA 2YXNA 4MDHA 2Q0QA 2XCLA 3N0TA 2ZUCA 3O8DA 3PUIA 4R1QA 4DZRA 1KK2A 3ZD6A 2WUDA 4A2CA 4K87A 2FQYA 1GYPA 3RQSA 5IT4A 3NEAA 2A9VA 1KYWA 4YAOA 4UUQA 3UV6A 4O8ZA 5EJ8A 2W6QA 3WK5A 4XFKA 3QY0A 4YUWA 2FVXA 1RXEA 4GL2A 2JZOA 1TM4E 3PZBA 3K0HA 1YF3A 4LOAA 1SUIA 3ER6A 3HRHA 3WL7A 1TJ5A 4E1AA 1E3SA 4DV2B 4DY4A 3OE5A 4R2HA 1L5LA 1YMVA 2NV6A 2NUTA 4G0XA 3TRJA 3DTYA 4G0YA 3VBEA 2NQTA 3DCYA 4B84A 4V02A 1WZEA 4Q4HA 4LSZA 3V2GA 3N5KA 3QBVA 3O03A 4U9IS 3ZX4A 4WBNB 4I1RA 4CM3A 4CNQA 4BNWA 4CQLB 4BXOA 4QIHA 1GRRA 4DAEA 3B9RA 1UPUA 2OQ2A 1CF9A 2XLCA 4LJKA 5KOJA 4JLNA 1CLUA 4PG8A 4YV7A 1MDFA 4UTNA 4H1WA 4KRXA 3AO0B 2ZJZA 3H2BA 1WO8A 3IA7A 4MIKA 5GZ6A 4X3OA 3UCEA 4ENPA 2H2HA 2BI4A 2WAOA 3RSZA 4RJTA 1DP4A 2CB0A 3MJTA 2CFSA 3K5WA 2ID9A 1YE8A 3HB1A 3S8YA 3U3JA 5IVPA 1CDEA 1SEPA 4O2LA 4UOQA 4ZQHA 3NHWA 4TKVA 4F7WA 5IT0A 5HQTA 4BJ1A 3NM6B 5IJ9B 1ORIA 4OH7A 1DAFA 3DW3X 1KI3A 1GGMA 4FINA 4FOTA 4WFIA 1L5HA 1C7QA 2IOYA 5ALNA 2W4MA 3IDQA 1Y7IA 1GCOA 2F3TA 1M76A 4MJLA 4YV0A 1PF7E 2FK7A 3RVOA 3WMFA 2FUCA 4LZJA 4HQKA 4X1YB 3WYFA 1DCKA 3HKCA 4CMIB 5IXJA 1JJIA 3LC2O 3P9PA 4UFOA 4X65B 1E3WA 1KAEA 3GJQA 1BS9A 2LCIA 1GTG1 1OXMA 2VTDA 3FWYA 3O3MB 1ZCAA 2O6HA 4PPNA 2O8VA 3PQFA 2X9VA 3M49A 5EGSA 1VKRA 1TUBA 2V45A 2XOXA 3P9QA 3ESZA 2ZBRA 3QXGA 3OUZA 3VR0A 2WSIA 1CY1A 2P4QA 4X6XA 4FNOA 3LF2A 4LFCB 1NW5A 1O95A 1W4RA 2X8JB 3WGQA 5HUQA 4M53A 1AQLA 4XQEA 3HA2A 4D3DA 1VKHA 2ONYA 3PFIA 2PPVA 3UAVA 4CFYA 4Z51A 3R4VA 3NIWA 1J1ZA 4G25A 1JLHA 2QVCA 3FUWA 3GEGA 1PL0A 4N3CA 5AOBA 1BJTA 1QIKA 1HY3A 2BFEA 1S0UA 5JISA 5A9RA 3QKUA 1O6FA 4G01B 3FVRA 3L6BA 2ERCA 4E08A 4UHHA 2P30A 1LLUA 5EEGA 5CA0F 2IJGX 4WN9A 2FP4A 3OWOA 4IICA 1M1UA 1XZCA 2CVHA 2REQB 5CBPB 3FTEA 1SC4A 3MLBA 1QV6A 3O8OB 5A3SA 3NORA 5ALSA 2QRGA 4PPGA 3TZCA 5IT5A 3FIUA 2BGUA 4CEIB 5KEIA 1SA0B 4EY7A 4MV6A 2GZSA 3VYSB 5KYVA 1CUZA 3RJTA 3TEFA 4C29A 4W7IA 4EBBA 2HH9A 2FZ4A 4W6QA 1PJZA 1N0HA 3OHPA 3W5HA 1CUDA 4K9KA 4U7JA 3KSBC 3LGXA 1NAHA 2O7SA 4M7WA 3ZZ0A 4ZCMA 4WCDA 4ND4A 2LGJA 4U7HA 2DWPA 3F6CA 2P7IA 1U3UA 4GQAA 5BSUA 3JQ6A 4WBNA 1MU0A 4XX0A 1OZGA 2AD1A 5F64A 3UAYA 3F6SA 2P4EA 3QJGA 1J4AA 3X43A 3ITKA 2A59A 1CEQA 2OCYC 1UJMA 5TEVA 1I3CA 2O8NA 2QEQA 5HMMA 2PRYA 4P3OA 1VPVA 4KODA 1PTKA 2WHRA 4MJ3A 1ZS9A 3PYXA 3C16C 2WF8A 1RXVA 5AR1A 5KU1A 3ZGOA 3CW9A 3K1JA 3R3HA 3K0BA 3P19A 4JEHA 1THMA 4ND1A 4RHFA 5AJXA 2HL6A 3EVNA 1QK5A 3VHLB 4CL2A 5A62A 5IX8A 2BKXA 1LCIA 1E6EA 3JQ9C 1YS4A 1VQ1A 1XQXA 3BCSA 1NUSA 3VKVA 1ZM9A 2C3YA 2EKLA 2LZ0A 3HP1A 1D6SA 1QRDA 3IEXA 4M4SA 2G80A 1NBIA 5CIYA 1FSSA 1JA9A 1E2GA 3STVA 3BERA 3ZXXA 4GZ3A 5IF9A 3G3EA 1KP2A 1QRSA 3OLYA 1P2SA 3T9BA 3KUUA 4OJQA 2BUBA 3CBGA 1NOJA 1VIDA 3WLMA 4TVBA 2GPBA 2EX1A 2QUJA 3BAZA 5BQOA 5L95A 1PJBA 4C3ZA 4LRSB 1XD9A 1VL1A 5C5EA 4F7DA 3QLUC 1SWVA 2D7CA 5AO9A 4EG1A 4DA4A 3C3JA 5I51A 1QOQB 2DTXA 2FK8A 2PPLA 1O9HA 3QF7A 4JJZA 1FLAA 4WZ6A 3MRXA 2ZI4A 3QPBA 1R15A 4IX9A 2FPIA 2L0XA 3CIFA 4ZZ2A 2HDNB 4L74A 3U2QA 1C3VA 3IJPA 3FR7A 3UMSA 4EO4A 4AKHA 4F85A 2SBTA 5BQ5A 3U09A 3LQFA 1PLLA 1UZNA 4YECA 4XE5A 3MUFA 3SKYA 1PGJA 3DXZA 4GOJA 1LTQA 3ET5A 4I50B 4ADSG 4IZ6A 4R1SA 4XSVA 3RAFC 4IQ0A 3ZUPA 1EP3B 2W6JD 1SU8A 3I2HA 3ZKWB 1E3EA 1YZKA 1F4PA 4J0QA 4NMLA 4RF5A 1MQAA 4KMRA 4NX2A 2V3VA 3Q0IA 2G67A 3T4EA 1PI3A 2IYRA 2SCUA 1PFVA 1FFYA 4CM9A 1KBOA 3IYLW 2BM8A 4KX5A 3I76A 4DEXA 3OQ6A 2W9XA 3WOVA 3VPXA 3TG8A 4PYKA 4QDZA 2QZ9A 4QOGA 3WSVA 1AQ6A 1RYHA 5M34A 2NZYA 1P19A 3HCNA 5LCXA 3TFOA 1A8QA 1YHNA 2HA3A 1J70A 1H2BA 1WB6A 2ZBGA 4BB9A 1JIXA 2FSSA 4ITRC 4HRXA 4OQ4A 5ALRA 1QX4A 5ER6A 1EM8A 1JYFA 2HLNA 1VSUA 3VGJA 4RM2A 5BVHA 1YL7A 3BORA 1W4LA 3OPQA 4KAFA 4ABYA 1JAZA 3P0EA 4Z9FA 4BKRA 5C52B 2C5HA 1VLHA 2HWKA 2JIQA 2C2HA 2WF6A 3PL1A 3CNQS 4Q3OA 3SJBA 2R2AA 3TW4A 2H4XA 3MIZA 1KR5A 2G71A 4ZI5A 1W2HA 4IJ5A 3ZXSA 5BT8A 3FW1A 3I04M 1SXJE 3IIEA 2XCIA 1K9VF 3COSA 4LWQA 4JSYA 5FFMA 3ZK8A 1Y7TA 2G09A 2F8SA 4AQ7A 2YW9A 2YOFA 5DCWA 4UW9A 1D03A 1RYYA 3AW9A 5AVXA 3I6MA 2OB1A 4TRRA 5DDIP 1IZZA 5L6MB 5IWCA 2RGRA 3I0NA 1V71A 3O5AA 1A9QA 3QVVA 4NZPA 4PBRA 1MORA 2J6HA 3LPAA 3UM9A 1R5OA 4N12A 1XAHA 1SVKA 1T1RA 4G1VA 4YO8A 3I01M 3RCBA 3JQPA 1ZIYA 1D0VA 1KKLA 4QJ5A 3C5HA 4DIMA 3HN7A 5EPUA 8ADHA 2AKAB 3LK7A 4HGZA 3ZI0A 2ZANA 4O4LB 2QP4A 3LBNA 2I2WA 2Z0MA 1JVNA 1U1DA 3OF3A 3MWDB 1GDTA 3X1DA 3BD9A 1N7IA 2IEBA 1RQNA 4C78A 4MRRA 5D51S 2ZE5A 4X91A 3FAKA 4XM2A 1IWPB 3KZXA 4L5IA 5H68A 5EERA 1VYUA 1YJQA 3HNOA 4L27A 3T9EA 1JE1A 4NJMB 3ZGLA 4YMGA 1OASA 4IH4A 1U3VA 1BDHA 1A7KA 1O1YA 3VNVA 1Z5GA 4NXMB 2XDQA 2XCSB 4ZWNA 1P0QA 4X1IB 1J2YA 4MB0A 5AVWA 4UHBA 4B2PA 1ZVJA 5JMOA 2WOJA 3IQWA 1LNQA 1XTSA 2UZ3A 4B43A 3K16A 4F21A 2GEFA 1SVSA 5CM8B 1MF7A 1UANA 2FZGA 5JVDB 1T3TA 3IE1A 1EFPA 4AMGA 4QM7A 3OIUA 1O95D 3GZNB 1S3SA 1J8MF 3DEKA 1Y4UA 4DSZA 2FFJA 2GS9A 2VP9A 1TAUA 5KO2A 3WWCA 5A3QA 2CNOA 1KQNA 1SD1A 3SKXA 4TV9F 4FT4A 1JFFB 3VPBA 2BVNA 1KO7A 3CWQA 2P1DA 4NDAA 4BNUA 1M83A 2H5IA 2WYVA 1GJRA 4EI8A 1P6UA 2JD2A 3OFKA 5EEHA 2ZUWA 3EZ7A 4ENSA 3LYHA 3NPMA 3D7KA 4AMBA 1QAMA 1X1QA 3QMPA 1WBJB 5C4GB 4V0SA 3HMQA 3D1JA 4UC0A 5A5DA 5BN4B 4KGZA 4RKQA 2P7HA 4IHJF 2KLHA 3RASA 2VHZA 3TQCA 2B1JA 1S2GA 2BGRA 3LK6A 5LWHA 1TZJA 1P7VA 3JZMA 2W48A 3LJKA 2GYYA 3MS7A 4DR5B 1EXDA 4QREA 4R54A 2HK7A 4W9MC 1HG0A 3B1KA 1NBME 4IXWA 2NSDA 5BOVA 3FOEC 5FT9A 1YZFA 3L1HA 1KOLA 2C8KA 3FYHA 3WJAA 4LTNA 1UMCA 1XXHE 3R9KA 4X5OA 3WA7A 1YH3A 1KKUA 2ZZNA 5CLQA 3MTEA 3W1VA 5K4GA 4MEBA 1U7PA 1GU1A 4MRVA 1KFBB 5AHOA 5JSQA 2WHXA 4BUCA 4Y1RB 2J31A 3GELA 2OMEA 3V8MA 3AV0B 4PLPA 5IPFA 3TD9A 4BN0A 2Z83A 2ZJAA 4WOKA 5EP1A 4FR5A 3QPWA 2GK3A 4FYKA 3MWLA 1E58A 4I66A 4LJRA 1H9AA 2O2GA 3QPUA 3TI9A 2R8PA 3TM5A 4I6EA 1LS6A 3QIAA 1B6RA 3UXHA 1HE4A 2VF8A 2ZYDA 3IVGA 1JKFA 1ZSVA 2V59A 3LDFA 5JLJA 3BMXA 2G72A 1XJWA 2PX8A 4DLPA 3GAMA 4UZFA 3KEOA 4WKPA 4KR7A 1Z7WA 1YA4A 3A4LA 4RJ2A 4D25A 5HM6A 2JGMA 4NENB 1IJEA 2IU6A 1GP2A 3VR5D 5LJLA 3THXB 3E3LA 4DLYA 1LKZA 1RVV1 1I0LA 5C5DA 1CF2O 1GXSB 5HZGA 2ZWMA 5F2EA 5DBHX 3D8RA 1WB4A 2DR3A 4KVGA 4O4HB 5EP2A 3NMUF 1U63A 2ZE8A 2ETXA 2MR6A 3PBKA 4CE6A 1Z4IA 2MSEB 4GSLA 4C3VA 4EVQA 3UJHA 3GVPA 1LLQA 2P69A 3E0QA 2YV5A 1R2QA 4RIFA 2C54A 4E5SA 1YRLA 1FFWA 1KMHA 2ERXA 3F5SA 3ILSA 3JQ7B 3MJ4A 3F1KA 3MOSA 4LRTB 3W1WA 1CF4A 4ME6A 1XWWA 3K0FB 4RDHA 4XA8A 4EYOA 1Y7HA 4IM7A 3ZJ5A 4YRIA 1Y63A 1P9WA 1S4QA 5JW6A 5D3KA 3PEVA 5G0UA 1RPNA 1I80A 1UCFA 3UKDA 2YWCA 5IK2D 3A6PC 3NBYC 3W5UA 4L8YA 2VTEA 3IVMA 4HLUC 1DI0A 5IS2A 5HNKA 4KQ6A 1M6VB 4F84A 1V3VA 5TMDA 4P4NA 3CEJA 1Q7EA 1UBHS 3PJRA 3WRWA 1A9XB 1PNVA 1OBVA 2Q6VA 1SJ9A 1UODA 1V3UA 5IMSA 3HVKA 2JJYA 5ALMA 1UMCB 3FGOA 3IGFA 1XNGA 5CT4A 3O3OB 4IIBA 1TEXA 4BU1A 4XWWA 1N0WA 4MUBA 3ORQA 5BR7A 4LSWA 1FBNA 1UZLA 3GARA 3S6JA 2F3PA 4GPAA 4KSBA 4EY4A 4LHXA 1J21A 5LP6C 1XP5A 4FC7A 4W6ZA 5E4TA 2Q4OA 4YRTA 2A1UA 2H57A 3A37A 5EJAA 4PIPA 1PJQA 4KGXA 1JXOA 2DUMA 4D0LB 1VBKA 3RODA 4AJJA 4EI9A 1FRZA 3AGQA 4L02A 1Z25A 4Q18A 2ZUDA 1DFHA 4D6PA 4NH0A 4PYRA 1BROA 1K5DA 2M32A 4D80A 4E0BA 2I4RA 4LFAB 5CA0A 1FNDA 3TVDA 3NYRA 4L4ZA 5DGCA 2I7DA 2RHRA 4KFRA 1XP8A 5MF6A 1KEVA 4QGHA 4MS3B 3TUZC 3N05A 2H63A 1YA8A 4S24A 4NI5A 4QUBA 2H7VA 1NMYA 5GOTA 5G1PA 3BMNA 3H8JA 3SYRA 3VQTA 2UXBB 1EVIA 3TSAA 4PONA 3LP5A 4M89A 2A5JA 3JYNA 1PU2A 2Z56A 4YO7A 4YYEA 4A27A 3GLKA 4KPEC 2BFWA 1T3SA 1ZGBA 1KTVA 4I5GA 5GJWC 4DLSA 1WMBA 1YQXA 3BULA 5AW4A 2ZIXB 1O0CA 3ROPA 2C00A 4Q1EA 2JFNA 2B92A 2Y0EA 3QKIA 4IV8A 4XJVA 1SRQA 1A69A 1MJFA 1A7UA 3NKLA 3NXKA 3ZBQA 2H2IA 2P9BA 4PY2A 4RW0A 3KQUA 1G20B 1J22A 2C07A 2FDRA 3Q15C 1KQPA 5AHRA 3R7BA 1JBQA 2DFPA 3D6MA 4GPEA 4ZRMA 3TLEA 1MN6A 3K53A 5AICA 2HV8A 4R9SA 1XTTA 1ATIA 1T9ZA 3INNA 4OBXA 3PNBA 1JHPA 3EB9A 3P9SA 3GVHA 1ETHA 2ZPTX 3KV3O 2PFKA 1KGSA 4KAAA 4PO1A 4W7SA 3ROFA 1RI4A 3P27A 4M7OA 3SYNA 4IPTA 3CZ9A 3R1IA 3PUZA 1HT2E 1QH0A 1E3TA 3AETA 3EZ6A 3L92A 4IIGA 1EFRD 3UJ3X 3CU5A 3I83A 2CNNA 3JSXA 4D3FA 5KSYA 3KIPA 3SZMA 2PR7A 3UC5A 3M1LA 1G4AE 2I7XA 4RQAA 4Q24A 3OE1A 4CMGA 2GBPA 4RH0A 5KJEA 1IUOA 1YKGA 4RPIA 4UM5A 3ID6C 2BD0A 3I9V6 4NMHA 5ERYA 5LNK6 3SVTA 4R0NA 1JI3A 1RPTA 1NVVR 4YP5A 5FJJA 5LP6A 3DOUA 2IHJA 4C22A 5KVVA 2XECA 3CURA 1IEQA 4MCAA 3L8CA 3A6EA 2ZWIA 4BAZA 3A3OA 1OFUX 2NO5A 1WQ3A 4OO3A 3N2EA 4M1MA 4RGYA 4ZTUB 4ALLA 3MYRA 3M70A 2LPMA 2WM8A 3L8FA 5YASA 1R6TA 4AXXA 2X76A 1D04A 1XIVA 1JEJA 3TRIA 4C14A 1FTNA 2P0EA 3RSGA 3VU1A 1ARZA 2JFVA 2ZUFA 1ZICA 1RBZA 4XR9A 4MPPA 2C42A 4N5IX 5F21A 3L0IB 1QFSA 1C81A 4OI2A 1E9FA 2CXQA 4YUAA 1C0EA 4X6UA 2FWMX 5DGIA 3TUJC 3N3AC 1NMEA 2X14A 4H1UA 4ND5A 8AT1A 1ZVKA 2H7XA 1VYVA 3DXYA 4NBLA 4JI2B 5E6UA 2W11A 3OZDA 3I42A 4RQBA 2ZRNA 4UU8A 3KT0A 5SY4A 4EB6B 5JD5A 1XMOB 4G6ZA 4GX0A 2HA2A 2Q4RA 1QHYA 4L9SA 1NVUQ 4EVSA 1ONPA 2HPAA 1L4LA 1XZEA 2X3UA 3C6XA 1RM0A 1M7HA 1I4TD 2D7JA 1Y6RA 2RHWA 4ZN6A 1ODLA 1ZN2A 2P68A 2ZJFA 4NAVA 5GAJA 2LVBA 3QG5A 1SXJD 1TA9A 2EZ4A 4N5NA 1OVMA 4TPKA 4TMVA 1SHJA 2Q4BA 2ID7A 4UJ3A 1V3TA 4YJ2F 4UBMA 3RIHA 1QUFA 2FWAA 2CJXA 3DZHA 2DZDA 4CKBB 1TPYA 4KV9A 3H4MA 4MRMA 4TSRA 1EDDA 2XOKD 4B6OA 2I4LA 4EG3A 4HMOA 1CUYA 1MO3A 1XWIA 1U7TA 1V16B 2ZIGA 3FYUC 3IVAA 4AW9A 1YRBA 1YVUA 1X94A 3ZE7A 1RBMA 3KAPA 4KN6A 5LP6B 4YRJA 3U61B 3K73O 4LF6B 1UZMA 1XLVA 2M6KA 1EZ4A 5CCXA 4OPMA 1O95C 1S9DA 1ZQ9A 1K5HA 3DBRA 4NBUA 1D2EA 3VU8A 1JDTA 3TECE 2WVJA 5FI3A 4OGGA 1QRTA 2XYHA 3PQCA 5SYAA 4G4JA 3O9VA 3NAZA 4QXAA 1R9NA 1J5PA 3IQHX 5I6DA 5JQGB 1IZ9A 3EFHA 2I55A 4KXVA 3KT3A 4XGQA 2DECA 3RRFA 2OV8A 1MHPA 4KVAA 4ZT6A 2K2WA 2DSTA 2NYUA 2RDMA 3TD2A 1SRRA 4TM8A 4YMSA 1Y8QB 1FX0B 1XCJA 3ZCXA 2GAJA 2RONA 2WYIA 5LXTB 2BJWA 5DW3A 1L8OA 1G3MA 4JVOA 4EHIA 5CB4F 4QA9A 1C1XA 1LVGA 1E9SA 2DWOA 3W0LB 1BE1A 2GEKA 1E0DA 2ZDGA 3DO8A 1R5NA 4AMVA 3RRNA 2PU7A 4X41A 5FFNA 1D9XA 1L8LA 4O4JA 5ED4A 3HCCA 1GO2A 4WESA 3DJYA 1T5TA 1W88B 2P2SA 3AWDA 2EQAA 2EVWX 1QVWA 1TM7E 4ND6A 1W5EA 2VT2A 1N1MA 3A1TA 4QATA 4U6QA 3SBDA 4E7OA 3PDWA 4J4TA 3SM9A 1PRYA 3BREA 3FROA 5FO1A 2CUNA 1VZ3A 3URKA 4BNDA 4CDNA 5HWSA 3IMCA 4LC0A 1B93A 3KHKA 5JDCA 4MA4A 4D97A 1PHPA 2XPCA 4IYJA 4TV8A 4Z4GA 4OP1A 4P0PB 5HS4A 4N40A 2VJMA 1I9GA 1IDOA 4YIKA 1PV4A 4GI7A 1D6JA 4PLZA 1YHYA 5IUKC 4JQCA 3L77A 1Q84A 1ZONA 5CXQA 5JYCA 1J2RA 1RJDA 1X1RA 2OOKA 4G4IA 1KE1A 1SD5A 4EMTA 2BGGA 1F3OA 1MJNA 3ZPXA 3TNLA 1PCXA 1TCBA 4EB0A 1Q7CA 2YYAA 2G1JA 2FZCA 3D8NA 5DX0A 1USUA 4ILKA 2QDKA 2RBGA 4BB0A 1DINA 2GRAA 2RIPA 2JK0A 2ZVJA 4PGMA 1Q6ZA 1AF4A 1K5PA 3CX7A 4RY2A 5BNWA 1ID1A 2BHLA 4A0RA 4F3CA 1SEVA 3C8HA 1Z8HA 3U9LA 4B4OA 5HF9A 5L3ZA 4CM8B 1NP7A 5L3SA 3OZVA 4FPXA 1P4AA 2FPLA 4XX1A 4EHDA 2DQSA 2XYVA 5AJUA 1KJIA 2Z6QA 2GPYA 1AZWA 3FJYA 3GT0A 3LHKA 4WQMA 2O0MA 4I4LA 1GPAA 3CJRA 3COWA 4JBIA 5A9TA 4YXFA 1IZ7A 2H1IA 4AJIA 2CE7A 3KV1A 4QG7A 1RC1A 3VVMA 2SCUB 4B40A 2BM1A 3TTVA 3AFNA 1KYVA 2YJGA 1RQRA 3A1FA 2DFTA 2JFWA 4UTRA 4P3NA 2IDZA 5SYMA 1C7IA 1RACA 1SOAA 3LFTA 4X1OA 1Y8CA 3VR4A 4MQ5A 4HS9A 3MLEA 1M34A 2QZ4A 1CYEA 3FZYA 2D1QA 2H2GA 1GTSA 2VP5A 1GPYA 3OBIA 4RF4A 3DTNA 1NQUA 5HCIA 3UT5A 3VISA 1G2QA 3DBOB 4YCJA 1PUJA 1X7ZA 3W05A 3THYB 2YUIA 4ZVLA 2PGAA 2V6GA 3S4YA 3WGLA 2ADFA 2BFCA 2IXTA 2P90A 3NHSA 2Q3EA 3D0QA 1BFDA 4G8DA 1A4RA 2ODBA 2H7CA 4EG7A 1KIAA 3PQ7A 4G1EB 2AR0A 4CL8A 1RBQA 2Y27A 3UFXA 3OZAA 3G6KA 3K9CA 3KTAB 2AXEA 2X0IA 4N03A 4ZPXA 4ZVPA 5AM1A 4B09A 3W6NA 3OFJA 3LAWA 3H4IA 3STWA 1J42A 2GXSA 4B31A 4JBWA 4EL5A 5IU6A 5KU7A 1IQRA 3GCWA 3V6MA 3Q9SA 1EVQA 1N6HA 2VRWA 3KFVA 4UNQA 5DYTA 2FG5A 1CB0A 3KKZA 5JWOA 4FX5A 3KXIA 3RBXA 1SZPA 4ZRNA 5KYUB 5DHRA 2JS7A 1RXYA 3L7MA 1F48A 4F8EA 4RYLA 4DCNA 1XNQB 1MG0A 4AX8A 4KLCA 3Q9LA 3U44B 5LMNB 1UEIA 4FOSA 1MVOA 3U6BA 3PFCA 4OQEA 3MAGA 1GNPA 1WNTA 3ONNA 4DMFA 2NAPA 1FU7A 2B5VA 4BMXA 4YT4A 3QNWA 4RD0A 2WEKA 4GX2A 4R98A 3MJVA 3WA6A 1G9SA 5E4JA 2W83A 1YACA 1KJ8A 2D5IA 2E21A 3OD5A 2GFIA 3WNVA 5C8XA 2J9XB 4I1IA 3JAWB 3GEIA 5FPHA 2UYHA 3DMTA 4G23A 4GC5A 1D2RA 4Q05A 1W93A 3E1SA 5CJJA 3GLQA 1V8FA 2WDPA 5EMNA 2W6PA 3UT0A 4C7BA 4ZMRA 1XNRB 1QHXA 2O3TA 2XUFA 2EDCA 2OGZA 1DIRA 1VG8A 1BH6A 3MINB 2C2KA 4O4LF 1HDCA 2GCPA 4Z8YA 4DABA 3Q5GA 4LZAA 2J0UB 2ZJBA 3DAHA 3H84A 1DPGA 1SVLA 3GUCA 4MV1A 3UPUA 5IJ0A 4AY5A 4CQMA 4L8FA 5B7QA 1XVAA 4KN5A 1U0RA 4TS1A 5DLYA 2ODPA 1NW6A 2ORED 2HSGA 2YDXA 1DU4A 4GXTA 4L95C 1ANKA 2ID8A 1IFXA 1T5BA 3JQFC 4NEHB 1TJNA 4HDCA 4ERXA 1T0JB 3Q3EA 5F35A 1Z5VA 4K6MA 6CHYA 1JALA 4B5LA 3F3SA 2BSAA 3H7IA 2ZVQX 4J9UE 1NZDA 2AG1A 4W1QA 4LRQA 4YN3A 5A5GA 4RKFA 1KIFA 5CEJA 2GHIA 2XZOA 2EKZA 3MCTA 4XWOA 3MD9A 3SK0A 1O6BA 3IO5A 2OZVA 1T5DX 3EC7A 4INPA 4TYPA 1CRPA 4FDAA 1RWNA 4ER5A 2BGMA 2FMTA 2QUZA 4MR7B 3QEJA 3K09C 3SEQA 1ZUWA 2A86A 2RGUA 4YCAA 5JFOA 2JIMA 1US8A 1O0SA 4KQEA 1K9SA 5LU8A 4M2LA 4M1QA 5C31A 1YBAA 5DTJA 4WMLA 1FMFA 1QF9A 3SBEA 1FMJA 2FR8C 2CVZA 2Y1DA 2X9NA 4PNPA 2PL3A 4ZREA 2VXCA 4Y2UA 2O52A 3FKSD 3CH4B 3U1VA 5F4ZA 3RK0A 1K68A 2BLLA 1ULAA 3HVIA 3JWIA 1U9IC 4OTZA 4AI6A 2WWTA 2OZEA 5ARCA 5GWXA 4BNJA 4DY6A 4LMBA 5B3KA 1M1NA 3A8TA 3BK1A 2RGCA 3OT5A 2E0IA 4LXIA 3UJ6A 1WY7A 3CH6A 3HLTA 4PZAA 1OA1A 4TKUA 2F67A 3HUEA 1JIQA 9ABPA 2F4NA 3A70A 3EFEA 1OJLA 3R0IA 1GG5A 1R00A 1PTJA 4J0KA 4XSGA 5BYBA 1U5AA 3HWX1 5KWJA 3GLHE 3EGXA 4OG2A 1C8BA 5HILA 3WHKA 4GLLA 4A3SA 1TVCA 4IILA 2DPLA 4GC9A 2B3DA 4IIFA 3X1YA 3BS4A 1JKJA 1LJ8A 3CUWA 3RYFA 1SCUA 5FHQA 3ZXUB 2NPIA 5C81A 4YJGB 4NESA 4UTPA 4M8KA 3SQLA 5EE5B 2IXEA 3CUUA 3UK0A 4CQLA 4BXOB 4UNRA 3H97A 4AY4A 4PZ0A 1M8GA 2J3EA 2O1XA 5DM0A 1ND6A 3GAAA 4MUIA 3M1IA 3S29A 1KI4A 2CFRA 2IU4A 3NOXA 4ZYYA 2BP7B 3IKJA 1MD9A 1ZGJA 2PSSA 3EDRA 4QARA 3SZRA 3RABA 3T5PA 1QYVA 2WWXA 2PYDA 4JJ4A 4O2AA 4PX5A 2RHOA 1FSGA 4WKNA 3AUXA 3UV7A 3NOVA 5FF9A 4B4VA 5ITZA 3IQDB 4EK9A 2FMXA 4BNGA 3G88A 1Z63A 1TLTA 5DBOA 2FZVA 1K3UB 1OC4A 2VP3A 2XJ4A 5AVJA 1CIJA 5FR2A 3RV4A 3TOVA 4BC1A 1ULUA 4DV7B 5DLPA 4CG0A 3O21A 5KYYA 3CXUA 1JT9A 2CBGA 4M9UA 4R1TA 1YR3A 3T9FA 4FZJA 5AM2A 4WA8A 5EJ2A 3DQZA 4FW8A 4ZQFA 1AU9A 4P6VF 4R9RA 1ZHFA 3AUJB 2PXAA 5HQJA 3ZJ4A 2D59A 3KXKA 4FVTA 2GCOB 4P81A 2CLHB 4J16A 5K8IA 2VDJA 4H59A 1ENOA 1KZYC 4B0OA 4ZDIA 3QTTA 3ZJYA 3OD1A 1MENA 3VBCA 4ILEA 2HHLA 1CNFA 4UE6A 3AP3A 4OOFA 5IKOA 4DLBA 2QYHA 3AHCA 5E1DA 2VSQA 1ZD9A 3OUTA 2V7WA 2GKOA 1YB6A 3NNNA 3PUWA 3GP8A 4QYIA 4BV9A 1L7MA 3AESA 1Z0ZA 2CT8A 1W87A 2GF0A 1NR5A 3ADBA 1AGYA 1RW4A 3MVEA 2Y1GA 1LPPA 1DEXA 2R66A 3N8GA 1SOVA 5HF5A 2XT9A 4EQ6A 3ORYA 2ZYUX 3KYJB 3JY6A 4ANFA 4W63A 5CA0B 4AZ3B 1XMQB 4RIEA 5DM60 3ED1A 1JZTA 4MUMA 5INTA 5EKXA 2JNWA 3CRQA 3VZQA 2PT6A 3ZDZB 4MYCA 1PJSA 1M2VA 1FOEB 4MWBA 4Y0VA 2CDBA 4ZAGA 2M98A 4E13A 2PA3A 1OX5A 1EFPB 3RIXA 3M33A 1AE1A 2ADOA 3ASVA 3LPMA 2EFJA 2KBEA 3N0WA 4LTDA 4G24A 3GUYA 4Z0HO 2EW1A 4Y30A 2X2PA 4LA4A 2P1RA 5FNZA 1IATA 1QHNA 4UEOA 2CBXA 4GX1A 4FOLA 3ZYZA 1GGJA 1F8FA 2ORWA 3MBKA 4QQ8A 1RXSA 4TVKA 1GCUA 1U0EA 4GGPA 2JFBA 3IUEA 4LGMA 1POWA 1C3LA 3RT1A 3W77A 4YLYA 2ZBQA 1KC3A 2JHPA 3CH7A 1NW8A 1H2YA 2D3TA 2IE8A 2Q07A 2R86A 2ST1A 4GKVA 4JUCA 2AE2A 2O48X 3G5MA 4M8SA 4TLBA 2EP8A 3PGMA 3EH2A 2P9GA 1VBMA 2PWAA 3AEQB 3QLVA 3AU8A 2HTEA 4J0HA 4WZAE 1XJ0A 5K7SA 2EP5A 4CKCA 1GLNA 3KJQA 3IUMA 1UK9A 2F3SA 1QGAA 2QX8A 3NIFB 3ULKA 4LK2A 4UEJA 1SKUA 5JS2A 4UNNA 1Z37A 1E2UA 4RK6A 4IS2A 4KLAA 4XWKA 3INRA 3CVOA 4M1OA 5THQA 4IHJB 2JF0A 3G9XA 3MC1A 4PSUA 1EWTA 4IJ6A 2OYSA 4LZOA 4L72A 4XJSA 4TTSA 5CNJA 4AG3A 3NHPA 5HK8A 3JQDA 4QUKA 5C7LO 1KDTA 3CZQA 3FPHA 4G2TA 3PGXA 4QOIA 4WLUA 4K2AA 2OSVA 1P2DA 3IUBA 3GFFA 3QWIA 5JT1A 4REQB 1DQPA 2ZDHA 5KQPA 4HNRA 1KL7A 2GCGA 2MMCA 2O05A 5LBTA 1U7ZA 3OVMA 4IXTA 4L4XA 2H29A 4O2BA 4R8LA 5BN3B 2K5UA 1YT5A 3O1LA 1XEXA 5HJ5A 4I2VA 1Y8ZA 1U99A 2FLKA 1D3AA 4R4JA 5BR4A 5JMWA 1OR8A 3MSXA 3ZG6A 3WLHA 3UGJA 2ZT6A 1SXIA 4KGDA 3AJDA 4OUDB 3IVRA 1NJGA 1UBLS 1Y4ZA 3PE4A 4NCAA 1HDRA 3UCXA 3AUUA 5EY5B 4F6CA 3O3NB 2AC7A 1YS7A 2ZBEA 3D3WA 4GG1A 3UTCA 1E63A 4YRAA 3D5QA 1BEUB 4TYWA 1ORTA 4HAZA 1ZJJA 2G9VA 4ZOLA 3G0BA 5F3DA 1BMFA 2Y6VA 1SH7A 1A4UA 2YCBA 4QXQA 4BLWA 2JH9A 5U9CA 1HEIA 3IUQA 5ESXA 1ELOA 1U11A 3DE2X 4U7WA 5H3CA 3ITDA 1VBNA 2R1VB 1KY2A 7AT1A 4DCTA 1Z34A 3BMCB 4YJHA 1M8JA 3HLKA 1FTSA 1VIMA 4ALIA 5CFRA 2CV0A 1XZ8A 3WK4A 4E22A 1J0DA 3NLLA 2ZYWX 4TXLA 4JHLA 4EPXA 4R8RA 2WAXA 4XDYA 5FA8A 3AFHA 1FLDA 4LN1A 4WNYA 3TSYA 4DSAA 1CU1A 4N5DA 1V11B 4H3VA 3UKOA 3URMA 3W9BA 5DB4A 4BQOA 1EWQA 1FDRA 2HNBA 1DG1G 5AKKA 4A8TA 2C7VA 3RTEA 3BWCA 4L5JA 4FHZA 2Z4SA 5A5FA 1OXBB 1WCWA 1XCBA 1HQKA 1IBKB 3GN1A 1V43A 4PTZA 5CDTA 1VSVA 4JBGA 2E89A 1PW7A 2HQRA 1OGYA 3LBHA 2H8GA 4MUEA 4PLVA 3N8DA 4UUOA 3BCRA 3TNDA 3T5AA 3N2GB 1HYGA 4FW9A 5A4JA 3K1YA 1QHGA 4QYTA 3MT0A 1F7UA 4PLGA 1HM5A 2OPBA 3JVIA 4JFAA 5E2BA 1IYZA 4LSGA 3N7AA 3IDOA 1U8AA 1OV4A 1X19A 1FA9A 3NT4A 4MV4A 1XLTC 1C9DB 3O38A 1C8VB 4K03A 4JMPA 5ARBA 4F0JA 1TZBA 2BN4A 4RDXA 1CXZA 4L9AA 3CKKA 4ZCRA 4KZPA 1EVYA 2Q3LA 4OXRA 1Q1ZA 4FCVA 4DRZA 3NCTA 4KRGA 1UK7A 1DXHA 3MHPA 2AQHA 3RS7A 1RAFA 1XUOA 3E03A 3AUYA 1AKQA 3C97A 4TV9A 1GA6A 4QJ4A 1QHHA 1BG6A 1LU9A 4BVKA 9GPBA 1J0XO 3SIPA 1B7GO 3F49S 5HE9A 1A71A 2QW8A 5DHSA 3KKEA 3RREA 5HZHA 1ZK4A 3IBTA 5IXYA 5JTUA 3L7BA 1UBJS 4D9BA 4MUYA 3WLOA 2IV7A 3DV0A 3STTA 3V4PB 3L41A 3V2IA 1KH2A 1SULA 4UCXA 1EESA 5EVCA 3ZOKA 3ZQ6A 4Y8VA 4PYNA 1WDTA 1LFDB 3PR2B 3NW9A 4RZXA 4C0SA 1PL8A 1R0XA 2QZSA 1CRZA 4TTJA 1VRCA 1FJGB 5HM8A 1XZGA 1GCAA 3HXPA 4WK6A 5KJ1A 1UAAA 2YICA 3HKCB 2R1VA 3M9WA 4J2TA 4N41A 1W9HA 3DH0A 2PRSA 3UK1A 4HFJA 3GH1A 1M2KA 1XAIA 3O4GA 3NGLA 2RGDA 2W0MA 4ZPJA 4MO9A 3GJ3A 3HUFA 4I14A 3OPVA 1N2HA 1CD5A 2MDTA 5LYYA 4ALNA 1GITA 2JATA 1KMMA 1D2AA 2HCJB 1CUXA 2VNKA 2VSFA 3AT1A 4HDMB 4N3BA 5DK4A 3S3TA 5CFNA 1FW8A 4QU9A 3BSSA 2C7GA 2XQIA 3C4VA 4O33A 5B1SA 1NGSA 4MUAA 5DCLA 3TJRA 4F5ZA 3WRYA 1CJKC 1FNCA 1NVBA 1Q1BA 4TZ0A 1CJTC 4NCHA 1TT5B 3T34A 2NZVG 3RKRA 2JLBA 3KVNA 3BL8A 2P4SA 1E5XA 4B83A 3IAUA 4YAWA 1G291 4PWZA 3QV1A 4B8WA 3LCVB 1FP7A 1MB0A 3BB3A 3PZRA 3O8OA 4JCOA 1MX1A 3EMKA 1PJCA 4PU0A 5CP8A 2ZRLA 5A71A 3MWGA 2NXEA 1DKQA 1MR3F 1N5KA 4IDEA 1SKBA 2INGX 5AKJA 4B85A 4H31A 2EJWA 4UREA 3KPJA 2JRCA 5JI3E 5DNDA 2E5FA 4IRMA 5DNCA 1TA0A 4YT5A 2NU8B 4GOXA 4CTOA 2BEJA 1LS1A 4AN4A 3OU6A 2A14A 2C94A 1L5QA 2ZE7A 2IW1A 1BXGB 1JHZA 1HYBA 1MABB 1P4GA 3IUYA 4K81B 5AW6A 1ZRSA 2W2LD 3EDOA 4LHVA 3NS7A 4C0HA 3IP6A 1IUKA 1TXGA 4CW7A 3VDQA 3J7TA 4NE2A 1Z6YA 1RWVA 5EUBA 4XI9A 4TWRA 1Y3FE 2WD8A 5DKFA 3F4LA 3IEUA 2FGJA 5F4BA 4HAWA 5FPQA 1ODFA 2CEKA 3DAPA 4XXHA 5H4HA 3R0XA 3U7HB 3QEMB 1HE8B 2OK7A 2V58A 2PCLA 1XK7A 1YJXA 1EDOA 2RGAA 3FKJA 3K15A 4H08A 5GONA 4M9CA 1DTEA 5EQDA 4ZV9A 3W7VA 3GRYA 4UM9D 1IM8A 3LY8A 3Q3GE 1YU9A 4BRSA 1PV1A 2UUOA 2EARA 4G9GA 2IXFA 3RKUA 3U7FB 3H11A 3A1WA 3B1YA 2XQKA 3L43A 1B15A 5ISMA 4C7VA 1JG1A 2Q7DA 1CHDA 3GL9A 1USVA 4BWFB 1ZK1A 2EFGA 2YVUA 1T10A 5HBRA 3ZWBA 1ZOPA 2VF2A 3AKCA 1TCUA 4MGYR 4QUEA 1OC2A 2X9QA 3SXJA 1YU6A 1J8DA 2WKQA 3FVVA 1BX1A 3UUFA 3MNFA 4BMOB 3OZSA 7GPBA 4G3XA 4O63O 1RFGE 2X40A 3AVOA 5DCYA 5IM5A 3ZCSA 3R3YA 4G8BA 2FF5A 4MVJM 3IEVA 2E1PA 4N6GA 2HMAA 4OGFA 4URZR 1Y8RB 2QLBA 4MMYB 2F1IA 4O8CA 1H9CA 1TO6A 5JSZB 1ZI8A 2HRBA 1UKYA 2GVNA 4JBHA 1A04A 1E1MA 2QROA 3WZ2A 3AIIA 3EG5A 3R77A 5GVSA 4XRRA 2AXQA 2CJWB 4AJ4A 4R5HA 4P54A 1CR6A 2VH5R 1U0SY 4RXMA 1ZW6A 4U0JA 4BVHA 5ALYA 1UBNA 1CY2A 2GXUA 4I50A 4KQKA 1EGAA 5EHIA 2VJPA 1NUPA 2RBEA 2OCLA 1LLFA 4MMXB 4C0WA 5KREA 3FZQA 2OAEA 3ZKWA 1XCGB 4PZEA 3YASA 1VDZA 5FWNA 3OG9A 4LX8A 5KYXA 1I8TA 5GJCA 2H06A 5JYDA 1CUCA 5KS2A 2QM3A 3S2SA 1A1SA 1C1DA 1XDUA 4DNFA 2PH1A 1IXZA 3V9AA 3X0DA 1FQJA 4PC3A 4ARAA 2AVNA 4OKSA 4YREA 3TX6A 3WBBA 3IQIX 1Y7PA 3SYKA 2V6JA 3ZQUA 3DP7A 1MABA 4JU8A 2GZ2A 3M8KA 1ZZGA 3HABA 2QVYX 1TJ4A 3LLCA 3MFQA 3OMLA 3SMVA 3OC6A 5HG0A 2A1UB 3OBBA 1V26A 5CNKA 1GKIA 3S40A 1A9PA