3RAJL

Crystal structure of human cd38 in complex with the fab fragment of antibody hb7
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
208
structure length
208
Chain Sequence
b'IQMTQSSSSFSVSLGDRVTITCKASEDIYNRLAWYQQKPGNAPRLLISGATSLETGVPSRFSGSGSGKDYTLSITSLQTEDVATYYCQQYWSTPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosyl cyclase 1
publication title Engineering a novel cytosolic form of CD38 for cyclic ADP-ribose dependent signaling
rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 36
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2011-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rajL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rajL01
2DKSA 4I2XA 1K5NA 5F1OB 3U0WH 4HUXA 5EZIL 1Z9OA 1G1YA 1PGRB 3NZHL 3GUTB 2VDLH 3T2PA 2C3VB 2EE9A 1JTOA 3TFKD 1Z3GL 2X5PA 1MFBH 3FT3A 4LGRB 5DK2B 1JFQL 5IQ7L 4R2GD 3KPQB 4ZUVA 3VGAB 3MGOB 1NAMB 4UQ3A 3ROOB 4UQ2B 3UPAA 5GGTA 2NY4B 4YWGL 4J1UB 1GYAA 3HMWH 3S97C 1MCQA 4QRTA 3THML 2QHLA 1B0GB 3V6FB 3EYQD 2BY3A 3FT4A 5DEZA 2P46B 4O2FB 3SCMD 4BM7A 3GK8L 3TO2B 1TVDA 4NQCD 2P8MB 1FYTA 1RZGB 2F54A 4I0PA 4RWYL 3VXOA 1U3HB 1V3JA 2EDXA 1BGXL 2Q87A 4P9HL 3MOBL 3W2DH 5IB3A 4Z7WA 1X5IA 3JTTB 4ZUUA 1JGVH 1KPVB 4J6RL 2OTUA 2XXCB 4Q9QL 2DM7A 2WUBH 3IDMB 2E9JA 4H88L 4MCZA 5KJRH 3BT2H 4KKLD 1F45A 3TGXA 1QR4A 2J5LB 4Z7VA 5F8RC 3SHSA 5D6CB 3VGGA 1QZ1A 2FSEB 4PJDA 4HWEH 3FO1A 3EDDA 4XP6H 1OWRM 3U48A 3OHXA 5F89B 4N8VG 1FZKA 2W0FA 3EFFB 4RDQG 3C60B 5E2VH 4N1EA 4PJEA 5E94A 3N85L 2QSVA 5BS0D 3WHXB 2BNRD 4G8EB 3WMSA 3QEGH 1A1OA 5E70A 2RBLA 1XR8A 4RQQA 4GW5A 3SE4C 3ULVC 1NH6A 3BSZL 4ZOAA 1ZLVK 3UTTE 4G8IB 2IG2L 3LPFA 2Y07L 1MCKA 3B5TA 4LF3A 4PP2B 1JI1A 1IC4L 2ZKHH 3BN9D 2VLJD 3KDMA 3H3KA 2M26A 1Z9LA 5KVFH 2A2QT 1CDBA 3FO2B 3O3DB 4LCCA 1FQ9C 1KLGA 3HFML 5AZ2H 1WFUA 1T7XA 2NPLX 5C07D 1LO5A 3ILQD 1K6QL 4I0CC 5CIPH 4NWUL 1H3UA 2HYMA 4YGVB 2UWEB 2C1OB 2FX9H 4QHKJ 2FATL 2VDKH 2AV7A 5I1EH 2A1WH 1WSST 2YPVH 3REWA 1N0XL 4NFBA 1A6AB 3BH8A 3HC3H 1KV3A 4GW1A 3AS0A 1UFUA 3LKQB 1TIUA 5JZ7D 3U6RB 4XBGB 4Y16C 3V0WL 3AREC 5CILL 4N0CC 4NJAH 5CZVL 1KB9K 1CIDA 3P9LA 5DO2C 4J3VA 1MHPL 5T1KB 2CDFB 5EU4B 1LO4H 2Y5EA 4K71B 5IFJA 1I1CA 3D0VA 4PJAA 5DQ9A 4NQDD 4OZHF 4U6VL 4YHOH 5H35B 2YKLH 3KYKL 4HUWB 2EDJA 3TC9A 4Z0BL 2FR4A 1I7RA 3FRUA 4LNVA 1ZLSL 1P9MA 8CGTA 4OZFB 2ICWJ 5FB8B 2APBA 4XHQA 3RWCA 4NZUH 5IGXL 1A02N 3QUMB 1D5BB 1JRHL 3QJFA 4XI5C 4L8SC 4HSQA 3BO8A 4Y4KB 3ZDZE 5D9SB 3S35H 3IAPA 3LV3B 2F54E 1WQVT 3L3DA 1QRNB 3MRJB 3QIWD 5K9OA 4EOWH 4JRXD 2OXGA 1GGCL 2P48B 3PIQA 3EGSA 3GHBH 3SDCB 3LS4H 2R69H 2E9IA 2Q86A 3D3VE 2JJUA 5HYQB 1K4CB 3QDGE 1TJHH 4NIKB 4QHUB 5BW7C 4XPFH 1R3JB 1BVKB 1C12B 1XGYL 1EJOL 3MFFB 1PKOA 4JANB 1H3VA 3N1GC 5EC1A 4YHYC 3MRRB 4Z6AT 1IM9A 1TNNA 3RNKB 3H9HA 3MCLH 2XN9B 2DQIL 3GM0A 2WK2A 3QQ4B 1OT1A 1KJ3L 3KXFB 4P4KA 4QHLA 4ZUTA 2HFFB 4JM2C 1ZT1A 1R3LA 4HMDA 3FQRA 4GLRH 4PJEE 5JNYA 4DZBA 1CICC 1YUHB 1OD9A 3NMEA 3QH3A 3BP5B 2VLLA 5DQDH 2QADC 1MY7A 3EYSL 3OG4B 1CVRA 4KXZI 2BVOB 1DDHB 3FB5A 1KCSL 2PYFA 1AGFA 5CMAB 3SKOB 1NQBA 4OM0H 5DMKA 2FGWL 4JZJA 3NTCH 1G0YR 5FXCH 4E5XA 2CDGB 1T03H 4L4TA 1JWSA 4UNTA 2ADFH 5D1ZA 3AXLB 3LN5B 3FCTB 3IDJB 3GEWB 4L3CA 2FJFB 5IB2A 1XGQB 1VA9A 2DQCL 3OKMA 4TRPH 3U30C 1MHCA 1WITA 2C4XA 4QWWC 4F33A 4A6YH 2E7LA 4M1CD 4RMVA 2CLRA 3CSYA 1MRCH 2H3NB 1MCIA 1T1ZB 2D03H 2OP4H 3LKRB 2JKXA 3UTQA 1T20A 1IL1B 3UTTD 4H8WL 1ZT7B 4IIQB 1VADA 2WBKA 3OKNB 3QUKB 4YX2L 3E6HB 1QNZH 4GH7B 2ZPKH 2QKIB 4BH8A 4QXWA 5GRVL 3RGVD 3U7WH 4QKXB 5IHBA 2PR4H 4OSUL 5CEXA 5GZNC 4YO0B 3D9AL 4TNWF 3BH9A 3KR3L 5GIRB 4U1MA 4D2NA 4MWFA 2ADGB 3ZSSA 3UJTL 1BAFL 4Y5VA 4Z7VF 2PYEB 4PJDF 5K33A 4LASH 3I3DA 3N9GL 3JV6A 2XWJA 4P4RB 2HLFD 5JIKA 4KQ3L 1YECH 4PJEF 3BWAB 3QRGH 4FFYL 3RWHA 4IRJA 3V4VH 1BBDH 1GOHA 3I3BA 1P1ZB 1KELL 4N9GA 4HWBA 4G42A 4XPBH 5KANI 3TM6A 1JUFB 4R7DA 5DHVB 5DJXB 4NM8L 5I1IL 3I75A 2DLFH 4PJ7A 4FXGA 3MV8A 3N0PB 1QFWL 2PO6D 2HH0L 3DGGB 3TPKA 1PG7W 2GCYB 5F7HA 4YBQC 4NN7C 1I8LA 5B8CC 3Q6FA 4NUGH 2G2RA 4YJZL 2R8SL 3WJLC 2KL6A 3QXTA 3VD7A 3CU7A 1UT9A 1W8OA 4NRXB 3NOIA 3V5HA 1CD0A 5HXMA 5CJOH 1BQLH 2OJEA 3MXVH 4P5KB 2VE6A 5HI4C 1KN4L 4XMLL 2C1PB 1MJUL 2COQA 3MCKB 1WK0A 4KMLB 4G6AC 1NSNL 1G6RH 3FMGH 4X4ME 5EIVA 3QIUA 5DFWH 3CPLA 1I7ZA 5ACZB 3D3VD 5HGAA 3QDGD 1E4WH 1ZS8A 3OKLB 3GSWA 4Y8AA 4JFHE 3D0LB 3CDFA 3KPRB 1QEWA 3FQUB 4R6UA 4XH2A 4GW4B 3BZFA 4L4TE 3V52H 4NFCA 4UB0L 4YDVB 4L3EA 2EYRB 3PL6B 2DJSA 4G9FA 4ZUWA 4M1DL 2WWMD 2GQHA 4LHUA 5DC9B 1EGJH 1U41A 3MA9L 3WXVH 1CK0L 4C56B 4NKMB 2D7PA 4E9LA 4MXVE 3VXSB 1CGSH 1NGWA 5I1CL 4JFFE 3AFLA 1R3IL 4NQTA 3T65A 3DECA 2EKJA 3OF6D 1JYNA 3O0RL 3MBXH 2PXYC 4YDKL 1J05B 5ANMB 4D0DA 3CDGA 3C6SB 1RIUH 1RD6A 3SY0B 5KAQG 5L7XH 4YDJA 3E2HC 4I18A 4L8CA 5DEFB 2IPKA 4MXQC 4HH9B 2DI7A 2IALA 4LEOA 4PJ5D 4NO5B 4P2RE 3GMMA 4U1IB 5DR5H 1KN2H 4PLKC 5JHLL 5J1AB 4B7IA 4JM4H 1U8IB 2OXHA 1HDMA 2R1WA 1C5CL 1BMGA 3EJZD 1ZE3C 2EXWD 4DWHA 4Q6YA 5DD6A 5KN5A 3VXRA 2NY2B 4LVNB 1FO0A 1IVLA 1RJYA 1ZA3B 2CSPA 1IGMH 1QQDB 4DZ8A 1A5FH 4OFYD 1GRWA 4RZCB 4WDIA 3WN5A 4X6FB 3CLEH 1EV2E 1IC7L 3IJHB 4LSTH 8FABA 4TTGA 2BJMH 4KI5E 4R0LB 2QV2A 5ICXB 3X3FH 3EO9H 2GJ6E 2DLHA 2HFGL 1FC2D 2BNQA 2H2SC 4XNUL 4PJ7E 3BP4A 1EO5A 3MV8E 2OJZH 4MB3A 3TBVA 4XVUC 4E0RA 3RVWD 5BJTA 5GGRB 1MJ7H 4OFPA 4AY0A 5KSAC 5HI3C 4XGZB 3O3BA 1FVEA 5A3ID 4AMKL 2RQ8A 4FQIH 3BD3A 4N8VB 1DUZA 3BDYH 3RDTA 3WCYA 3BEWB 4MAYD 4NYLB 5GSRA 1FJ1A 4I77H 1CBVL 2HN7B 4ZFGH 3U2SB 4NKOB 5IEKB 4MXVF 3VWJA 1FIGH 5FK9B 1WBYB 3RL2A 2YSSA 1X5AA 4MA1C 4NZTL 4LBEB 4Z95L 2GT9B 3WSQL 1YN7A 3LEYH 4LKXB 2VZSA 1NKOA 1CXKA 3JWDH 3UYPA 1BFVH 5GQBA 1MCWW 1XT5A 4M6OL 3STLB 4ORGA 4OCLC 3GMPA 4PV8B 2YD9A 3AC0A 1T21A 1KF9B 2YPLB 1IGYB 2WIMA 1NBYA 4MQ7B 4PUBL 2WINA 3T77A 4L3EE 1H0DB 1HIML 3PHSA 4M5ZL 2GAZA 3MV9A 3PUCA 4OLVH 2LU3A 5AYUL 3TA3D 1V05A 4U1GB 1MJJB 4LGPB 3ULVL 3PGFL 2ICEB 4BA8A 1BFOB 4HS8L 2VXQL 1ZGLA 3QWQB 1OLZA 2EH7H 4PJGA 4M7ZB 2MSPA 2YPKB 5DA4A 1OM3L 1NGYA 1AE6H 3F7VB 1EUTA 2MHAA 1KJ2B 4YXKL 2VITA 1QSEE 3NCYS 1H3XA 1YEDB 3VWKD 5IESH 4Q6IA 4KI5F 5EZLA 4QYOB 3H0TA 4JFHD 1BX2A 1INQA 5DT1L 1PEZA 5F70A 2W92A 1HNGA 4L4TD 5KSUB 4ZFOA 5SWZB 1X4ZA 4MA3A 3TN0C 1B6UA 4PJ7F 5C0RH 3CUPB 4PJCB 1FZOA 2C5DC 4P3CL 1P9MC 2G60L 2HJLA 1MRDL 1ZWIA 3RZCB 5DTFA 3L1OH 2X2YA 5B39A 2CRYA 4JDVA 5C7XH 4JFFD 5EU6E 3X14A 3GGWA 1HEZB 5C0CE 2D0GA 4R7NB 1A6TB 3AAZB 4GSDL 5CP7B 2X9WA 4PJ8A 3GB7A 1PBYA 5BO1L 3OXRB 1HYRC 2Y36L 3K8KA 1O7SA 4P2RD 2EYTB 4OLYL 2ZUQB 1UM4L 4ZOBA 1QBAA 1I8IB 1S9XB 2BNQE 2GI7A 4KRPD 3B2UC 4WJ5B 4R97C 2AEPH 2Z35B 2FJGB 3KYMA 3CFEB 1KLUA 5JW3L 1NFDE 3VMPA 4Y5YB 3L3OB 2ARWA 3NGBC 2X4QB 5F6IC 4V1DA 2W9DL 4GAFB 1QSZA 5TDOA 5GRVK 3IDGA 3O3AA 4V2BA 3U9UB 4U2ZA 2ILLA 4XXDB 3SPVB 2O61A 3PWVA 5DJCB 3MUHL 4X9HA 3DRQA 4U1SB 3HE7C 4C57C 4NQXB 3SQOH 3KG5A 4HKXA 1NMAH 1U2CA 4JPWL 4K94H 2FX8H 3HB3D 1JMZA 5DVMA 5I66B 2GJ6D 2AQ1A 2DD8L 1ZK9A 3O4OC 4WO4A 4QTHA 5IBLC 2BVPA 3TO4A 1NAKL 2G9HA 5ISZA 5TQ0H 2BXYA 3OTTA 4U0RB 1EVTC 1CF8L 1P4BH 3MRIB 2D7TH 4WW2A 1IGIH 5DRWB 1FORH 3QEHA 3F6IA 3MZGB 4KK5C 1Q72L 4LDOB 2E7LC 1A14L 1GXEA 1NBZB 2QQKH 3RWIB 1ADQA 3BKJL 5DZOA 2IANE 1KYOJ 1MCEA 4H1LH 1K4DB 1XGPB 4OFVA 3O9WC 1IAII 2BSTB 4NQCB 3JTSA 1FFOB 4K8RD 4C83B 2AJYL 5BXFB 1P84K 5C6TH 3PP4L 2XZQH 3P0YH 2NY5C 4LCIL 1E28B 4LOUC 3OX8A 1JZ7A 1YY8A 3IF1B 3N1FC 1G7QB 3FOMB 5HSFA 3EBAA 5TDPA 1BQHG 3NCEB 4MD0A 4XC1H 1CD8A 3MFGB 1RMFH 1DBAL 4FZ8H 4L5FH 5I9QC 2GFBB 1CD1B 3MYJB 1EEYB 1OP5H 1DR9A 4Z7UB 5I76A 4HUVA 2JTDA 3U0PA 5GRJL 4Y5VC 3CSBA 2OI9B 2MQCA 2NY0C 3FN0L 4R8WL 5JIPA 1NLBH 3MV7A 1RUKL 3P4NB 4HS6A 1UWEH 1CL7L 5CJQH 5D1XC 3B9KA 3M8OH 1NFDF 4Q2ZA 1NCDL 1II4E 1ODAA 4IRJC 3ARGD 5F1IA 3U7YH 1OCWL 1P7HL 1HILB 1NUNB 3VXUA 5L2JB 3WUWA 3C5JA 4OFKA 2CIIB 2XWTB 3S96B 4HG4K 2V17L 1QSED 5FHBH 1DBKH 1VEPA 1LNUA 5EIIA 1JPFB 2H41A 2VLJB 1IT9L 5GZOD 1DBML 1M7IB 3MLXH 4K9EH 1KIUA 5CEYA 4NPYA 3ET9F 4K7FA 2DMKA 4P99A 3EZJB 4S1DC 5C07B 4Y19A 2Q3ZA 1WVZA 2IADB 2A74B 4JFDE 1SJEA 3PWLB 4FFVD 4OTXH 5F1KC 2CLZB 4L4VA 2SEBB 1JJUA 3CVHA 1PY4A 2VISB 3B4NA 1E27A 4PJIE 5EU6D 3RBGA 2A9NL 3MMEB 1F02I 5E8OB 5A2KH 4IOIA 5C0CD 1E4KC 5DUBB 5C9JB 4C55A 4D0BA 2DLEA 1M6OB 3S3PA 1A3QA 4EI6B 2XWBB 5ID0A 3ES6A 1SBSH 4BH7B 4ODTL 1Q1JH 4ONHA 4CMMB 3QDMA 3HI6H 4NJ9H 4PJFA 4TUKH 4PJGF 3VGHA 2ICWI 4BFIB 4TSAL 3RWEB 2Z4QA 3DURA 3H3PL 3KLHD 4KTEL 4PBWD 4QF1A 2BNQD 3GSRB 4IMKA 5E8DL 5I1JL 2NY3D 5I75C 1MFAH 2Y1VA 1L9MA 5IMOB 3ZTNL 4HXBH 4G6JH 4PJBE 4X0KB 4EI5D 5CEZH 3QULA 5FUZL 3B3IA 4LLVA 4ORZC 5DZNA 1RJZB 3LKSA 4JFXA 3RDTD 2B1HH 4DGVH 5D4QA 1G7HB 1MIEH 1OGAA 3W11C 1C5DB 4G8FA 3B6SB 1F90L 1D5MB 2X09A 3ZL4L 5A2LH 1HH6B 1VGKA 5C3TA 4LAQL 3VFTA 2X9YA 5FA4A 3BX7C 2IH3A 1J1OH 3QIWB 5T5NF 1X7QA 5I1GL 4X99B 3MREB 3I9GH 1CQYA 3UC0H 2NX5A 1T7VA 2QBWA 1JHKH 2B39A 3LKPB 4X6EB 1A8JH 5GS0D 1XFPA 5A2IH 1UQSA 5MERB 2OQJA 4FQ1L 3TIDA 4YK4C 4U3XA 2Z8SA 2ZOKB 3F5WA 5E00B 3OKEA 1V3MA 2E7BA 4WHDA 5FO9A 3KPLA 1MCRA 1F2QA 2EDNA 3V7MA 3PQYB 4PREA 5EOQH 2IAND 3MV7E 4YHPB 1OF2A 1MHHB 1AKJD 2P24A 3R06B 2CRIA 1RZJC 3WN5C 5FYKU 2JJSC 2AVGA 4X4XB 1CFVL 3H9SA 3KNBA 3NFSL 4M02A 2CKBA 4OZGA 5HYJA 3QA3B 3I3EA 2VMFA 4M9OA 4YC2B 4ZQKB 5HHVH 4ZG1A 1UM5H 2F15A 2YBRA 3U0TA 1KEML 5FHAL 4FZEL 4XCCL 3UYRH 4ODWB 1RUML 3MBEA 4WHTB 3PV6B 3X17A 3IDXH 4MD5A 5B3NA 4JVUA 1TQBB 2R0LL 4OZHB 3VH8B 1DBBH 1NAMH 4ODHH 1AP2B 3QDJE 1YNLH 1QLEH 5I1LB 2ZG3A 5GS2H 1I1YB 1M71A 2Y4SA 5FDWB 4L8BA 3EDKA 5B3JE 4KMQA 4WW2F 2NTFA 5EBLB 4L9DA 3RIFK 4Y4FA 5CAYB 2OL3B 2XFXB 3G04A 3VWJC 3E8UH 3T1FA 1MCOH 2OTWB 4KRNA 5TQ2L 1OAYL 4PJHA 5EPMB 3ARPA 3UTTB 4HJ0C 1FFQA 5CIPA 3VFOA 4JRYB 1A2YB 4PY7B 1G9EA 1EAPB 4P23B 3D18A 4XCFH 4XCNB 1NANI 1MH5B 2VZTA 2D9CA 3MRPA 1IZJA 2XT1B 1AJ7L 3GNML 4NP4L 3ZT6A 1UACL 4JFDD 1TXKA 1CLZL 2DDQL 2E27L 3DI3B 3TBSB 2EC8A 4LHUG 2BHYA 4DOHE 3GMQB 5IB5B 4PB9L 4JE4B 2DKUA 4XMPH 3P30L 2GUOA 3HLAB 4QHNA 1HOCA 3R1GL 1FZJA 3O4LB 4LIQH 4Y4HA 1KIRB 3AB0C 3BAEH 4XCYB 5C92A 4RBPH 4UOJA 3B9EA 1PX3A 4I2XB 4XAWH 1K5NB 3L9RA 4WWKA 1EK3A 2HVJA 2CLVA 4KV5E 3RIFF 1QP1A 1QFUH 3HC4H 3RTQA 3MGTA 1JV5B 1ZHKA 4LP5A 3DYMA 4Q9RL 2D9QB 3T2NH 3RFZC 1CFTA 1T89C 1ZHBB 4MYWB 2JELL 4UQ3B 1J0ZA 2W0PA 2YMXH 4WHYG 3O2WL 5EFIA 1EZVY 4QRTB 3I6GA 2MKLC 4AT6B 4HULB 4FQLH 3BIKA 5B3JF 3TWCH 1WEJL 5J1SC 2DM4A 5EZJA 5CZXD 5DUPL 2F54B 4I0PB 1ZGLM 3SEPA 3WXWH 5HYJE 5FDYA 5IB3B 4UIKL 4C58B 1FVCB 3D3VB 5IJKC 1IC5L 3L5JA 4X8JA 2E8ZA 3QIBA 4ZUUB 2OTUB 3WJJA 4X5XA 1SEQH 4PJFF 3P3YA 4LSDA 4MA8L 3WLBA 3QXAA 3OAYK 1QBLL 4PJDB 3QCUH 2BCKA 2NZ9D 5GRUL 3ULUE 1FAKT 1QOKA 2J88L 4CL7A 3OHXB 4UINH 1U6AH 4KVNL 1UZ8B 1FZKB 2W0FB 3IT8D 4OZFH 2VZ3A 4LSRL 3RKPA 3WNNA 4PJEB 2NCMA 3QUMH 3MLUH 1JZ5A 1NCBL 5HVHC 4WI7A 1H3PH 2F5AH 4ZXBA 3GRWA 5HHQB 1XF3A 4BZ1L 5EUOE 1A1OB 3KYOA 3K2MC 5IWLA 1XR8B 4NFDA 1PFCA 2Z92A 3NACH 4PJHE 3QNYA 1JWUA 5FO8A 4QXUL 5L6YL 3WFHA 5FECB 2P5WA 1RHHA 2R29L 3TO4C 1JWMA 2I5YL 2NW3B 4OB5H 5FYLH 3QG7L 2PKDA 4LF3B 1TJIH 3NA9H 1A6VH 4OF3A 3KDMB 3TV3L 1EBAA 4NC1E 4KV5F 4LCCB 1KLGB 3TBTA 4XMKL 5D93B 3QDJD 3NZ8A 5E99H 3DJ9A 2JIXD 3DSNA 3DX6A 2YWZA 1LO5B 2IF7A 4AENA 2VKXA 5FYJH 1KPUA 2AJSH 4ZD3L 2XNAB 3BE1H 1EX0A 3HPJB 2AV7B 4Y16D 4QRPE 4N0CD 4N8CH 1LE9A 3Q2CA 4CU6A 3MLSH 5DO2D 5FEBA 5F3HA 3D69A 4G7YH 3IGAA 1W72A 6FABH 5JDJA 4NKIL 2AQ2A 4PRIA 4B41A 5FKPB 5ITFA 4TQEH 4GFTB 1BQHB 2Y6SD 4JZOB 3P9LB 1AFVH 12E8H 1CGTA 2JK5A 3MV11 5IFJB 3D0VB 4ODXA 4OCNC 3ZKXB 2I60H 2VABA 5DQ9B 3VXME 4ONGL 2X4SA 3UBXG 4IHOA 1GGYA 3BJ91 2A0LC 4FQ2H 3ULUF 2V2WB 5DJ8A 5B39G 2QQNH 1KXTB 1IGFH 3B2VH 5T5NG 4M43H 1FAIH 3K74B 2WIIB 1Y18A 2NY5L 1I7UB 4FFZL 1KG0A 3BISA 2Q8AL 5JPNB 2VJXA 5EUOF 3TNNA 3L3DB 1UWXH 1QR1B 5FGSA 5INCA 1YEFH 1WFNA 3PIQB 1FGVL 3EGSB 4PJHF 4HF5H 3RA7L 5L88L 5DURD 1JYWA 1WIPA 2OBGA 5J1TC 4MJ2A 4Z0XA 5E8PA 1G6RA 3MLWH 5KZCD 3TVMA 5E6YA 2QEJA 1RZ7H 5F3BB 4JM2D 2ZJSH 2CRZA 3LS5H 3MACH 4OJFH 4O4YH 1QYGH 2CMRL 2E6JA 3OMZA 2CQVA 1U0QA 3HZMA 1HZHL 5J12C 4P4KB 1T2XA 2C7UA 5MENA 2F58L 1PG7X 4R4FL 1ZT1B 1YMHB 5I19H 3OJMB 5JNYB 4DZBB 2VOTA 3UMTA 1UH2A 1B2WH 3TA3B 3SDYH 1MAML 1CG9B 3DUUB 1RUQL 4NZRL 4N90E 4XPGL 2VZUA 1F5WA 4PGCB 3FB5B 1A6ZA 5HYJD 2PYFB 1AGFB 5E9DA 4AIXA 5DHVH 1P6FA 2I26N 1S7RA 1BEYH 4J3UA 5DMKB 1UENA 1LK3L 4X9FA 1IQWH 4ZS6C 4IMKC 2R4RL 3AMKA 4JZJB 1YNKL 5DUML 2QSCH 3WLWC 4B5EA 2OR9L 4E5XB 5A1AA 5DC0A 4L4TB 1JWSB 5D1ZB 4P2QA 1Q9OA 3ULUD 5IB2B 1ZOXA 3MRQA 3OKMB 1MHCB 2B4CH 5E2UH 5CINH 4F33B 2C4FU 2CD0A 3C5SA 4U7SA 1HHJA 2WWKT 2CLRB 2AJ3A 4C54A 1AO7E 4JFFB 3CSYB 1RZFH 1YQ2A 1CLOH 3BWUC 1SJHA 3RZWA 2AQ3A 3OZ9L 4BUHA 5GS1B 3QHFH 1UJ3C 3UTQB 1T20B 4MVBC 3Q48A 3UXFA 1I1AA 5DD5L 2ENYA 4OGXL 4XP5H 4LLYA 4NWTH 1JYVA 4OBSA 1I7TB 5GZND 2VTFA 4PRIE 4PTTA 2EDWA 1GZQA 4FQXD 4YDLC 5IB1A 2YD4A 2HAZA 3FT2A 4P2RB 5E24E 2I07B 1MFEL 1D9KC 3KLDA 2ZCHH 2ARJQ 4HD9A 5H37H 4PR5A 1FN4B 1YN6A 5D71H 1JZ8A 5CEXB 3GI8L 2I9TB 3GSNL 4MS8C 1Z2KA 2GSGA 4R3SA 4MQSB 4IOFC 3BH9B 5DJ6A 3PF2A 3BGFC 4U1MB 3NCYP 2GKIA 5DVNA 5E4EC 1KC5L 2RJMA 5I0DA 2QSQA 1NKRA 3GIVB 4JHAL 4G9DA 1WJ3A 2J4WL 5HGHA 5ACMA 3JV6B 1QKZL 2EO1A 3QNZA 3IU4L 2L7JA 4RMRA 4QRPD 3TBYA 4MA7L 4ZTOH 4KAQL 3CK0H 3D25A 1N8ZA 2NW2A 3RWHB 3JBG7 4JQVA 1JPST 1FL3A 3WUWG 5FUOL 1IEBB 5F71A 5FM5M 4G42B 4YBQD 4J2XA 1Q0XH 4UTBH 2DL2A 4R7DB 2GJ6B 4TNVF 2WAHA 2GW5A 3I75B 4FP8L 2NY1D 4FXGB 2VLRE 4PJ7B 3MV8B 5HDQH 3WFCL 3RTQD 3ARFC 3KPSD 2C9AA 3SO3B 1JVKA 3VE0A 4K3EH 5D7JD 2O5YL 3HZYB 3Q6FB 3VXMD 1BD2A 2G2RB 3AS3A 4X7EC 2LVEA 5IM7A 4PGDA 3TESA 4G6AD 2ITDA 2Z31A 1D7FA 3BRDA 1GSMA 4FQCH 1YMME 2ICCA 3V5HB 1RZJL 5MENE 3WFBL 2ZNXA 1GCFA 1J11A 2OJEB 4OZIA 1SY6H 2VE6B 2V9QA 5T33L 5DFTA 2FB4H 2VDOL 3EOAA 4WI9A 3C9NA 4RA0C 4XXCA 1A1MB 4HJJL 5D2LA 1FL5A 3QIUB 2VAAA 4Z18A 4ZDHA 3CPLB 4OD2B 1IQDA 1U8QA 5E9DE 2ESVE 3S37L 1I7ZB 4JO2L 4HLJA 4WY7H 2YA1A 3HG1A 1ZS8B 2WZPD 4S0SD 4YHLL 5FYKE 4K7PL 3C8HA 3GSWB 4QRUA 5BQ7A 1QEWB 4PG2A 4XH2B 1NCWL 5D2NA 3BZFB 3CFJA 3M17A 1MLBA 2AXFA 2V2TA 4P2QE 4KHTL 1D6VH 2FD6H 5CBEA 3RWGA 4L3EB 2DMCA 3AROA 3MOAH 4UV7H 2DQHH 4ZUWB 1JTTA 2CIKA 4DCQA 1L0YA 4LHUB 4RMUA 1UA6H 2V6HA 4MHHG 3ARGB 4Y4HC 5D7LA 2X7LA 1NGWB 5DJYA 3QEUA 2V2XB 4B53A 2CKNA 4N90D 5E7BA 1NJ9A 4MXQD 4APQC 1WFOA 2E3VA 2ZG1A 3K4DA 2Q8BH 5ILTL 4CMHC 2X4UA 5JDSA 1KUMA 4G8GA 3CDGB 3HTLX 1QSEB 4RFEA 4ENED 4PLKD 4PP1D 3BESR 4YDJB 1R5IA 3BVNA 4I18B 5LBSH 3V95A 4L8CB 5C9KA 2IPKB 2X44D 1UCBH 3TT1L 2HVKB 4LEOB 5EC2B 5T1MA 3LOWA 5F9OH 3GMMB 5ID1B 4I3RH 4NO3A 1G9MH 3RPIA 4F9PA 1XMWA 4KUZH 2FRGP 5I73C 3X13A 2R1WB 4DKDC 4J4PA 4HCRH 4O5LH 4ZPVA 5DD6B 5KN5B 5KBNC 3H3BC 1AO7D 3DUSA 1FO0B 5EU6B 5J6GA 3MGAA 1RJYB 3LQAH 1A7RH 5BV7B 4GT7A 4WW1A 1FPTH 3FB8A 5I17B 5GRZA 2H2SD 4KPHL 5HJ3A 3SDAA 4AIOA 1KB5L 4CN1A 8FABB 1MCPL 3P11H 3QIBC 5AZEH 4YHIA 4CBPA 3WJJC 4ZFOL 4XVUD 3C2AL 4QCIB 1FSKC 1JN6A 2EO9A 1TJGH 3K2UL 2VUOA 2XTJB 5DJDB 5HI3D 1AD9B 2YHGA 1HWGB 2BNQB 3T3PE 4RMWA 1F42A 3G5YA 3BP4B 2MNUA 2R2CA 3TBVB 2AK1L 4E0RB 5BJTB 1NFDB 1KSRA 4S1SL 1GAFL 1BD2E 1TZHB 5I71B 4HMCA 4OLXL 4DKAA 2AJZB 4ZXBC 3RDTB 1JHLL 3SDDA 4WVRA 3BKCH 5K59E 1UM6L 3HRZB 4GQPH 3ORJA 3MJ9A 3P4OA 2APXA 4AEEA 4XBPA 1VERA 1NGQH 1UWGH 3VRJB 5TJWK 3VFUB 2I24N 3RL2B 4R90L 1LP9A 4JFQB 2YSSB 1NPUA 2BY1A 5D1QC 3SE9L 4JG1H 1XIWD 4YXHH 1JK8A 2DIAA 5IEHB 1NGXA 5I1KH 5JR1H 2VLRD 1YN7B 3KWWA 1RZIA 2XZAH 4UDUA 3HPLA 4M6MH 2XIDA 3HG1E 1UVQB 1WAAA 4U0QB 5JW4N 5D70L 4GXVH 4LU5H 3S36H 2HTKC 5IBTL 4XNXL 4R9HA 3HS0A 5GGQH 3ARBC 4QRRE 3QEQE 5ESQB 5JXEC 2WINB 1YMMD 4MXWL 3T77B 1PD6A 2IANB 5MEND 1QLFA 2GAZB 2ID5A 1T1WB 1LEGB 2JCCE 4HUUA 3OR7B 5LGHL 4KRMB 4U6XB 4MJIA 5LCVL 1S7WA 1ZGLB 4MB4A 1D3CA 1U8LA 1SMAA 4PJGB 1PKQA 1NGYB 3MNWB 1XGTA 1WZLA 2ESVD 2MHAB 3V5KA 5L8LB 4Z78A 3TN0D 2DTSA 1MCWM 3A6BH 1JRHI 5F7YC 1PSKH 4Q6IB 5FYKD 5MEOA 32C2A 1UGNA 2R0ZH 3H0TB 5J13B 2O5ZL 1L7TH 1INQB 2OSLA 3RAJH 5TE6H 1KGCE 1NMCB 3VI4E 3PWJA 5IROA 4XRCB 4XHJC 1N4XH 5DD0H 5IFHL 4X7SL 1FE8H 4QHMB 3STZA 3RWDA 4JPKL 5LXGL 1QFHA 2RR3A 4RAVA 1ZWIB 2XA8H 5C0JA 2CR3A 5B39B 3U4BH 2DQJL 1AGCA 3H8NA 5CGYC 3GGWB 3LY6A 3OAUH 1M7DA 4LNRA 5IT2L 4M7JL 2VDQL 3MZTA 1I1AD 2PW2B 4YXLH 2DQEL 3HE6A 4JREC 4PJ8B 4CVUA 4DUXA 4Z8FH 2BC4A 3GB7B 2WBJD 3B2UD 5I8EB 2DRUA 3TVMC 5D2LF 3D2UA 3G6DL 4YHKL 4HGMA 3VGBA 4ZFFB 4S1QH 3BQUC 3PWPA 2H9GB 5IVXE 5TE7L 3HCVA 4KHXL 1WT5C 1C5BL 3MODH 3LKOB 3SJVE 2HG5A 1U36A 1BQSA 3GZKA 4BZYA 3V79C 4KZEH 1BJ1J 4PJIB 2D7NA 3HE7D 4NN6C 3LRGA 5TDOB 2APTA 3GMLB 3IDGB 3O3AB 4CU8A 2O61B 4HIEA 2ADJA 3PWVB 4JO3H 5DWUL 1TITA 3ZSTA 1JGLL 4GAJL 3DRQB 3N1MC 3SKUD 3VI3E 2JCCF 1ZV5A 4PRAA 5SX5H 4HKXB 4YE4H 3TJHC 1FH5L 1J86A 1ZGLP 1AC0A 1R24A 4KK5D 3HR5B 1SJXA 5M95B 1U8NA 3TPUA 4WO4B 4QTHB 2BVPB 2LVCA 4IRSA 1WIOA 4OD3L 5ISZB 1MWAL 2JJTA 4E41A 1FVDA 3MLZL 3UAJC 3CVHL 3B5HA 4GUPB 1PLGH 3OBAA 3JZ7A 4WW2B 5D7IA 1WC7A 3QEHB 3S4SA 4W4OA 4PJBB 3OGOE 3O9WD 3S5LA 1DN2A 3MLTB 3PNWA 5JXAH 2DQFA 4LEXH 3SDXE 1CGVA 4G43A 4LOUD 4NT6A 4XNMB 4X80L 2ZP0T 5KW9H 3NPSC 3JTSB 3UJJL 1KJMA 3QISA 1ONQB 1OAKH 3FFCA 1L7IH 4TVPH 2O26U 1CLYL 1UKQA 3UPRA 4I5BA 4NCC2 1YY8B 3L5WA 3QG6A 3EJYC 5TDPB 1LEKA 4KK8D 3U0WL 2FO4B 1L4IA 3HG1D 4ISVA 1YEHH 4M61A 3RPKA 1HH9A 2VDLL 4RX4A 5D1XD 3SGKA 5I76B 4HUVB 1MFBL 4QRRD 2X1QA 1F4WH 2H1PH 3QEQD 2MOVA 1EFXD 2X9XA 3MV7B 5L2KA 4HS6B 1Q94A 1IKFH 3IFLH 3B9KB 3MGOA 4XC3H 3ARQA 4DQOH 4Q2ZB 3HMWL 5B21A 5GSVA 5F1IB 3ROOA 1DE4B 4UQ2A 4UIMB 4BQ8A 1DQJA 4TSBH 3V4UL 1XF1A 2CK0L 2XPGB 3GIZH 3O41A 1MQ8A 1B0GA 1EEUA 4OLWH 3V6FA 1CXEA 3WUWB 3C5JB 1IZKA 1AXTH 3VI3F 4UU9A 4BFEA 4X7FC 1RZGA 3W2DL 1LNUB 4ACPA 4YFLF 2IFFH 3QSKB 1U3HA 4TSCL 5JA8B 5HD8C 1JGVL 2WUBL 3OXSA 4NPYB 3JTTA 5KJRL 2XKNA 2JIXB 4M4PA 1BVZA 1N7MH 1WISA 3HMXL 3JWDC 4Y19B 1WAAF 1SJEB 4XP1H 3QWRD 4L4VB 3W0WD 2AW2A 1EO8H 2VB5A 4XP6L 3CFBB 2FSEA 1E27B 1MREL 4OLEA 4RGMC 5E2VL 1P4IH 3BP6B 3V6OA 3EFFA 5SWQA 3KS0J 1T7ZA 1KLFA 4D0BB 3QEGL 4CNIB 4FTVE 1H8SA 5C2UB 3QJHA 3ES6B 3WHXA 3KAAA 5JIIA 4ONHB 2UUDK 4XNQB 4OT1H 2XACC 5JO5A 1A7BA 4PJFB 3T2QA 4K3JH 1BHGA 2Z4QB 3DURB 5D2NC 4HBCH 3ZMRA 3GSXA 2ZKHL 5DMIH 2P4AB 4HBQA 5KVFL 2Y72A 4PP2A 4FQJH 4P2CG 2DTML 3DVIA 4KJQD 5AZ2L 4WI8A 3QCTH 3SJVD 1S9YA 3O3DA 1BZ7B 4AYFA 4GBXC 3OJDB 1N6QL 3LKSB 4JFXB 1V7MH 1DQTA 1OGAB 1JNNL 2FX9L 1X5HA 3ZZ1A 2VDKL 1HK6A 1VGKB 4YGVA 4OM1L 2UWEA 5I1EL 3VFTB 4M3JA 1F4XH 1NC2A 2A1WL 2AK4A 2C1OA 2YPVL 3QQ3A 2CJUH 3HC3L 1E0OB 3LSOA 2NX5B 3LN4A 5EZOL 3ARDA 1VB9A 3LN9A 4YUEH 5DURB 2HLAA 1A6AA 3UJIH 1BWWA 3EDEA 4F9PC 5KZCB 2A77H 4NJAL 4Y88A 3TIDB 4XBGA 4NO2B 5EULV 5TFSL 1T22A 4HIHA 2FBJH 5E03A 3RJDA 3OKEB 1X5YA 1EEZA 1LO4L 4N68A 3UYOD 5FO9B 3KPLB 3VG0H 1NLDH 3U1SH 1OTTC 4N1CA 4P2OD 5EU4A 3V6ZA 4F8QA 2BY2A 4CVXA 2YKLL 1J8HA 3BUYA 2P24B 5H8DA 3RKDD 4OGYH 5DF0A 5DYOB 4HUWA 4ELKA 1YEGH 4NZUL 3H9SB 3JV0A 3KNBB 1PW3A 2CKBB 5EO1B 5I8CA 4OZFA 5HYJB 2ERJB 1QVOA 3S35L 3U0TB 5T1LA 4Q9CA 3BPOB 3MBEB 2F9BT 4EOWL 2H26A 1YC7A 1NDMA 3GHBL 3MRJA 1F13A 3VG9C 3LS4L 5IW1B 1J0IA 3RVTD 4MNHA 3CH8A 4K94C 2XZCH 3BZDA 3SDCA 1TJHL 4AJ0A 2YUXA 1E6JH 1I85A 1FLRH 4XPFL 5GGTH 5HYQA 1K4CA 2OZ4L 3S3JA 2VDPL 3SDDC 1R3JA 1HE7A 1C12A 3MCLL 4L8BB 5D7IF 2NTFB 4HJ0D 1FGNH 4Y4FB 4JFEA 4Q0XH 2BERA 3RNKA 1HHGA 3G04B 5EUOB 4LRNH 3T1FB 1LO3H 4LLDB 3V6OE 2NY6C 4PRPA 3BIBX 4PJHB 2J8OA 4HIIA 4Y7MA 4E42A 1I1FA 5DQDL 4WFFE 5CIPB 3IFOB 3NBNA 1HHHB 4KKNA 2BHUA 4ZO6A 3WD5H 2BVOA 4OM0L 5CMAA 4AL8H 3MRPB 2X89D 3NTCL 1V3KA 2ZUYA 1T03L 4OKVA 2ADFL 3IAQA 3BRGC 1U3YA 3K46A 1UZ6E 2CDGA 3BKYH 3W9DA 3LN5A 3IDJA 3DWTA 4TRPL 2UY6A 2GUOB 4A6YL 4QRPB 3T0XA 4LLMA 4QHNB 2D7QA 3Q6GH 1MRCL 4G3YH 4A2LA 4FTVD 3ARZA 2D03L 2OP4L 1FNFA 2YK1H 2V5MA 2FO1A 2K7QA 3L9RB 1NUDA 4WWKB 3EFDH 1MPAH 2V9RA 3DRTA 2Z8VC 2CLVB 4ZYKB 1OOAA 2NY1B 5LWYH 4Y5XA 1QNZL 2ZPKL 3RTQB 1RHFA 2HT2C 3QUKA 4RFOH 5IHLB 1ZLUK 4ZNEA 3U7WL 1ZHKB 3DTXA 3NA4A 1KJVA 2QKIA 4IM8A 4MNGA 1G0DA 5D7JB 3VXMB 3LEVH 2PR4L 1CFTB 3NCJH 4K9EC 4NGHH 5F72S 2JF1A 1A9EA 5JTWA 3QXUA 4HDIB 4U1LA 1LO2H 4F7CA 3I6GB 4ZS7H 2FWOB 4CADB 3BIKB 2R2BA 1J8HE 2YC1B 2NNAB 4KROD 3TZVD 1T3FA 3HE6C 5T3ZE 3JVGA 4KDWA 2BRQA 3QRGL 3D5OF 4P4RA 3V4VL 4MLIA 4ELME 1BBDL 5L0QB 4X8XA 1WZ1H 4WI3A 3BWAA 5C0GA 3ROLA 1A7NH 2DQUH 3O8XA 4X8JB 4XPBL 1KXQE 1S78C 4ZSOA 1HXYA 4X5XB 2AERT 3MRCB 4M03A 2DLFL 4O58L 3TCLB 1NC4D 2BCKB 3FB7B 4LSUH 2K1MA 3NAAH 2EEDA 4NUGL 3L3GA 5KVEH 2X4NB 2GCYA 1B0RA 5MI0C 4UV4H 2Z9TA 1ZMYA 3F8UB 3W5MA 4JFEE 3OSKA 4J3XA 1NUGA 5CJOL 1XF3B 5I8OH 1BQLL 3MXVL 5C1MB 3KYOB 4TYUA 4WCYH 4FMKA 4PRPE 2Z92B 5EOCH 3QNYB 4P5KA 1G6RL 3LEXA 3FMGL 3IXAA 1WCBB 1RHHB 3MCKA 4AQOA 3INUH 2EDDA 4GRWE 1JWMB 1U8JB 4IRSC 5E2TH 1E4WL 4W4OC 3TBTB 3FAWA 5ACZA 3NZ8B 1EVUA 3DX6B 2QTEA 2OM5A 3V52L 1YZZA 3D0LA 5HYEA 3KPRA 4AENB 1JNLH 3MJ7A 4PYGA 4GW4A 3QUXD 5SX4H 3CXHK 2FJHA 2EDLA 4KU1A 4DKEH 5J0BA 2EYRA 3PL6A 3DXAE 1EGJL 3WXVL 1MI5A 4KVCH 1TZGH 1CGSL 3B43A 2GK2A 4WFFD 1LE9B 1CL7I 1UC6A 4H88H 5DRNB 5F3HB 3D69B 3VXSA 3MBXL 1T83A 5DD1H 1W72B 4PRIB 4PRHA 2F8VA 3ZDYE 3PGDA 1RIUL 5ITFB 4UT6H 5I1AB 1J05A 5BMFH 3SGKC 5ANMA 5L7XL 3CZJA 1A4JA 2Z91B 1OPGH 1DFBH 5INDA 1OP3K 2A0LD 3DYPA 1UADC 2JK5B 1VFBB 4PY8J 1DJSA 5DR5L 3PGCA 1KN2L 1HKLH 3EYOA 1FDLH 4ODXB 2Z8RA 5DJ2A 2VABB 3VGAC 1XZ0B 4U1IA 4JM4L 5C09A 3L7FB 1S7SB 4IHOB 1YYLH 4XVSH 1FBIH 2X1XR 5DJ8B 1KCVH 2NY4C 4L29A 3RWJB 1A47A 3GDBA 1HWHB 2FEEI 1JL8A 5CBAA 3HNVH 1HCVA 1IGML 1PY9A 3QQ9C 3TNNB 1A5FL 1MCJA 4JJ5B 1J7VR 1XGUA 1U3HC 5INCB 3CLEL 2FCBA 4LSTL 1BVLA 1XIWB 2J8UA 1SY6A 2R23A 2VLRB 2BJML 4FOMA 4GRWF 2Y06H 5E8PB 1IILE 1LE5A 3O6MH 3X3FL 4ETQB 3TCXA 3EO9L 3TVMB 4R0LA 5E4IA 3BEVB 2MPAH 1BECA 4LQFL 1JNJA 3BZEB 2OJZL 2J5LC 3CU1A 3LH2H 3TEUA 3HZMB 1MJ7L 5I74B 4FQQA 2EE6A 3RL1B 4MQXD 2C7UB 5MENB 4ODUA 2W38A 1J8HD 3C60C 4G6FD 3T0VA 1IRAY 3BDYL 3PXHA 1DTUA 3ESVF 5HHPA 3DHMA 1HKFA 2OMBA 4KY1H 4N8VA 5HDLA 4I77L 4HGKC 4NQSA 4ZS6D 3RVUC 3FQTA 4HWBH 4ZFGL 1U91B 1A6ZB 5E9DB 4Y2DA 2ESVB 1FIGL 2HN7A 1V8HA 3U2SA 5T1LD 4NKOA 1S7RB 4NM4H 4DFHA 2M2DA 3Q1SH 1ETZA 5FK9A 3ZDYF 3U4AA 1G7MA 3OAZK 7FABH 1OW0A 1ZLSH 1UKTA 2W91A 3JWDL 4P2QB 1BFVL 1MAJA 5IGXH 4H20H 4LKXA 4MVBD 5IV2B 1QSFE 1G9NH 1HHJB 2YPLA 1A6UH 2AJ3B 4K8RH 4GAYB 4DN3L 4EN3A 4D9QD 1K3IA 1SJHB 4OLVL 2X4OA 4EXKA 1AH1A 4BK4A 1D9KD 1I1AB 3AMLA 2EH7L 4LLYB 2WBJB 1N64H 3VFPA 1AE6L 5IJVB 2EDQA 4PRHE 5HHNA 5EBMA 1GZQB 5IB1B 1UKSA 3FT2B 4NHUB 2YPKA 5BZWA 1KJ3H 5IESL 5HY9B 1QBBA 1YN6B 3Q3GA 4GG6E 3MJ6A 2D3VA 4MCYA 1INDH 1YEDA 2DB8A 2R9HC 4JCMA 2GSGB 3B9VA 4K71C 3OL2A 4R3SB 4I4WA 1TVHA 5DJ6B 1FIEA 5C0RL 1OP9A 1IEAB 1A7QH 3RWFA 3BRFA 3OKKA 4M4RA 4O02L 5KSUA 5C09E 4JN1H 3IKKA 2NXZB 1NGZA 5HGHB 4WUUA 3U46A 3DXAD 2N7BA 4BSWB 3QNZB 3NFNB 3E3QC 3GMOB 5DRZA 3L1OL 3TBYB 3O11A 5C7XL 3GBMH 3D25B 3DHJA 2NW2B 4D9LH 5D8JH 3DX9B 4Y4KC 1K8DB 3ARFD 5F97E 1G1CA 4MD4A 4URTB 2VN7A 3DVNB 3AAZA 4XNYH 3T0EA 1KIPA 3SDCC 5IP4A 2J8UE 3T04D 1JYXA 1I85C 1D6EA 4DVBA 5KSBE 5TPWL 3OXRA 3Q0HA 5HYIA 3IRZA 5J3HC 5FGCE 4OV6F 2EYTA 1BD2B 4WHYH 3U7AA 5IM7B 2FNBA 1FO0H 1S9XA 3HKFA 5DQJA 2W1NA 4WJ5A 2Z31B 5BV7H 2WWKO 2Z35A 2FJGA 3K8LA 4M8QA 2CGRH 2PETA 4XT1C 4EQ2A 1T1XB 4KUCD 1A21A 4JZNB 3C9NB 2ZCLH 4XXDA 5D2LB 1DUYA 4ZDHB 1A7PH 5J11B 3SQOL 1U8QB 3WNOA 1NMAL 1BZQK 4K94L 2FX8L 3HG1B 1BAFH 1YDPB 1CD9B 5CD3B 4QRUB 5BQ7B 1JPSH 5TQ0L 3EUUA 5I66A 3CFJB 2AXFB 2V2TB 4GG6F 1P4BL 2D7TL 4KQ3H 5CBEB 1MF2L 3RWGB 1CDYA 1IGIL 1FORL 1EFXB 4DGYH 3FO0H 4RGNC 1PZ5B 5JHDD 2CIKB 3OKOB 2AJXH 4JO1L 4APQD 4K55A 1S5HB 2KH2B 1RIVH 2E9WA 2DYPD 1X5GA 2X7LB 2JCCB 5EU7E 5KANG 1NBZA 3RWIA 1D5IL 1SM3H 3QEUB 5IG7B 2I9LB 1NJ9B 4L1HA 1R3HB 2X4UB 4WFGE 5GS0H 5JDSB 5C6TL 3SCMA 3S6CA 1O7VA 1URLA 2XZQL 4NQCA 1LEIB 4ALAH 3P0YL 1FFOA 4IIQC 3C08H 1OHQA 1R5IB 3VW3L 3WBDA 5C2BH 1E28A 5GGSY 5T1MB 3P4MA 3B9DA 3CDCA 4XC1L 1G7QA 1WV7T 2J8UF 5FCSH 1RMFL 4PTUA 4FZ8L 4L5FL 5JUEL 2ZWLT 2IH1A 3RPIB 3C6LD 2C4FT 1YEKH 1KN4H 1MJUH 1CD1A 4LDEB 4C59B 4NNYB 5EB9A 1QSFD 1WF5A 3S88H 4XPHH 1NLBL 3W5NA 5CJQL 2VXVH 3DUSB 5J6GB 3JVGC 3M8OL 5HI5C 3P4NA 5GGVH 5ERWA 2V5RA 4KKCC 3U7YL 2VR4A 3FB8B 5H2BA 3MROA 5BS0A 2AV1A 5HJ3B 3WFEH 2BNRA 2X1WL 3SDAB 1S7XA 1R0AL 1HILA 4YHIB 3SGEH 3QUZD 1F11A 2UZYB 1XH3A 5C3LD 1JN6B 4PGEA 5FHBL 2DM2A 3ZYOA 5JMOC 4X5WA 5HGGS 2XWTA 4DJMA 3G5YB 3MLXL 4K9EL 1CK0H 4HZAA 4YEFA 1OTUD 3ZYIA 4KDTA 4NC0B 2ORBH 4PD4J 4HC1A 4GKNB 2HKHH 2YZ1A 1XCTA 3EO1B 3GSUA 3FHAA 1VHPA 3WKNA 3TT3H 5C07A 1OB1B 5GRWA 3PWLA 3P4OB 2B4CC 4XBPB 2XG4A 1EDQA 2VISA 3RY5A 2A9MH 4DKFH 5T3XE 4JQIH 1SBSL 2X4PB 2HTKD 5EUKB 1Q1JL 1M6OA 1C5CH 5HHOE 1JK8B 4R4NC 4F7TA 3HI6L 4NJ9L 1RJLB 5BRZE 3KWWB 1RZIB 4TUKL 4UDUB 5JXED 3HPLB 2Q76B 4PG9B 5DJ0B 4CMMA 2CK2A 1MFNA 4NRZB 3NIGE 4BFIA 3NABH 4JPVH 3RWEA 1PYWA 1MFAL 4P2OB 1U95B 4HXBL 2ZSWB 3PL6C 4BYHA 4DW2L 3CDYA 1UH3A 3OJ2C 1I9JH 4G6JL 1ZHLB 1LWRA 1QLFB 2YD1A 4LCWD 1TCRA 4JO4H 4NQDA 2J1KA 4U1KA 4DEPB 3GSVA 4YZFE 4TULH 1MIEL 4HUUB 4J3WA 1TVBA 4MJIB 4AM0A 1BM3H 1J87A 4MZ3A 1B0WA 1XGTB 4UNVA 1P7KB 3ARWA 1J1OL 3FJTA 4Z78B 3VFRA 3I9GL 3UC0L 1CI5A 5LQBH 4QXGH 5HGBA 1JHKL 5MEOB 4JRXA 1HXMA 2EDRA 1I1RA 3F6LA 3QDAA 1K3ZA 5F88A 3LKPA 5C08E 3PWJB 4L4JA 1ADQH 3LIZH 5MERA 2ZOKA 5I18H 4OQ1A 3STZB 3RWDB 5CLWA 3DOSA 4LSVH 5EOQL 4EJ1C 1XF2B 3QYCA 1AGCB 1DEDA 2NY2C 4S11A 3RX7A 4LVNC 3MRFB 4EN3D 4POUB 4Z95H 3WSQH 1S9KC 5IBUB 1M7DB 4LNRB 4WFGD 1MHHA 4NC2B 1EIBA 3BQUD 4NDMA 1X5KA 2BC4B 5HHVL 4X4XA 2BNRE 1UM5L 3GI9L 5EN2A 4POYA 4TUOA 3FO9A 4R0LC 3UYRL 3UTSE 3SE3A 3O3EA 1WBXA 3IDXL 5IUSA 2VWEE 2VZOA 4OF7A 1LO0H 3HCVB 3LB6C 4MX7A 1NAML 1F58H 3NIGF 1YNLL 1QLEL 1CZ8H 2HG5B 2VXQH 4TTDC 2JB6B 1TTGA 3FKUS 1GC1H 3DETD 1AIFA 1F97A 5I1LA 1GZPB 1RU9H 5HDBE 5J6HA 1IFHH 4HIEB 3TJHD 1SMOA 2ADJB 1A7OH 1C08A 3FQXB 3E8UL 4FTVB 5DD3L 1QG3A 3CLFH 3HI1A 4PRAB 4OCYH 4RGOH 4N0YL 2OTWA 4JR9H 3UAJD 3MXWH 4AH2A 3PDDA 3GJEB 3KPNA 3UTTA 1R24B 3WNLA 1U8NB 5SV3A 4KMTH 5IIEA 4N0FB 5IW6B 4XCFL 1FVDB 4PY7A 1EAPA 1BFSA 3RGVA 1MNUH 5D7IB 1WC7B 3S4SB 5JQ6H 1MH5A 1IAIM 1G9MC 5D6DC 3VJ6B 3ZKNC 1CVSC 1D5XA 5KOVC 1KCRH 3RUGE 4G43B 2ZG2A 1FZMB 1XAUA 5IMKA 5ADPL 2MCG1 4XMPL 3TBSA 4KROB 3TZVB 3EJYD 3S3SA 3GMQA 4GKSB 3OPZH 2W07A 1KJMB 4U1GC 5JW5B 1UM4H 2NY7H 1YEJH 5T3XD 3LQAC 4LIQL 3IETB 3HLAA 1KPRB 2IQ9H 5C0BE 3BAEL 4M7ZC 3UPRB 4I5BB 1G7PA 2H2PC 3QUYD 3QG6B 3CFDA 5JOFA 1KIRA 4XAWL 5HHOD 4XCYA 5BRZD 4TUJA 1LMKA 4ISVB 4M61B 1HH9B 5DMGD 5E0QA 1QFUL 3D39E 4JRXE 5DVKA 3HC4L 1ZANL 1U58B 3CGTA 5CCKH 1E4XH 2UVEA 2PO6A 1W2KT 4F9LC 3T2NL 3MJGX 1JV5A 5L2KB 3ZKSD 1Q94B 2G5RA 2YMXL 1ZHBA 1B6DA 4PPTA 3RZCC 3OJVC 5GSVB 3RVVD 3CXDH 4HMEA 3AY4A 3FQWB 5BVPH 3LPWA 4FQLL 4WI2A 3O45A 3TWCL 1DQJB 2HTLC 2DD8H 1Q9LB 4BSVB 3VXTB 3O41B 4AT6A 3OKYA 4N0RA 1CF8H 1MVFA 4U3HA 2YUWA 5JQHC 5IQ9B 4UU9B 2VERN 3WXWL 3VCLA 4BFGA 4FN0A 1Q72H 2VXTH 3F58H 3S8WA 2EZ0D 2V9TA 1IBGH 5ICYB 3RNQB 3F7RA 3BPLB 5C08D 2ZUQC 1FVCA 1T4KA 3D3VA 3OXSB 4XCEA 5EA0H 1SEQL 3QDGA 2XKNB 5JOPE 5FM5O 3PP3K 3PE9A 1QPXA 2XKSA 3QZWG 5B38A 3QCUL 1OSPH 3QUXB 3PP4H 4KDVA 3MLVH 4Y5YC 3OAYH 1U6AL 1MUJA 2VDNH 5SWSE 1OTSC 2YEZB 1X3DA 3K4AA 3QUML 3MLUL 2CKBH 1UZ8A 4PY8I 1H3PL 5SWQB 1ZVYA 2F5AL 2YS4A 4K07A 3DLQR 2XKUA 2GSIA 5DJAA 3QJHB 4U7KA 1JCKA 3LHPH 4LCUB 1PG7H 5HHQA 3NACL 4ODSH 3OF6A 5EO9B 1KENH 5GRJH 2OR7A 5JO5B 2XZZA 4R8WH 4N5ED 3UTSD 5FYLL 4OB5L 3C8KA 1SBBA 2BZDA 5FECA 1TJIL 3NA9L 5M7QA 3ULUH 3GSXB 1A6VL 4Y1AE 4NO0D 4W68A 3VU2A 3GKWH 2NW3A 1Q9WA 3TFKC 4U0RC 5FCUH 2NLJA 1HQ4A 1QFPA 4PJ5A 1QUNA 2I27N 4M3KB 3MOQA 2E6QA 3WL9A 5C0NC 5EU3B 1BOYA 2XRAH 1S9YB 3GBNH 5KAQF 1EHNA 1HCFX 5I2IA 5BVJA 5CD5D 5FYJL 5HVFB 2AJSL 5GGUB 1Z0MA 5E8EA 1VESA 3EYQC 2RIKA 5MEPA 2XNAA 4PBVC 2JB5H 1NC2B 2AK4B 3HPJA 3QQ3B 4N8CL 3UO1H 2VXSH 3LSOB 3LN4B 3ARDB 4OFYA 2Q6WA 4G7YL 1I75A 2HLAB 3MLYH 1DBJH 6FABL 3ZTJH 5A43C 1C1EH 1OTTD 3L7EA 1I3RA 4LARH 4ONFH 4UOW0 4TQEL 1FG2A 5FKPA 1T22B 4HIHB 4YHZH 1DQLL 1EEZB 2A9NH 1AFVL 2AKRB 12E8L 1BQHA 4JZOA 5LAXA 1LILA 1QHPA 4UILH 5FGRA 2YD7A 2OI9C 1DVFD 3V6ZB 3RJQB 4QLRA 4CVXB 1TPXB 1J8HB 3MRDA 4FQ2L 3BUYB 3QXWA 2QQNL 1P6AB 3QR2A 1IGFL 4ELKB 3B2VL 1CDCA 2P8PA 2D4FA 2V2WA 4M43L 2E9BA 1FAIL 3JV4B 4MAYA 3J8F7 2AJUH 4ELMB 5I8CB 2M8XA 5C0BD 1JGUH 1QVOB 4ZFZB 1DL7L 2HRPH 5HVWA 2WIIA 3ALXA 2F19H 3KPTA 3NN8B 5T1LB 5HYSG 1I7UA 5JPNA 4GKOA 4Q9BA 2H26B 1YEFL 1M1SA 1NDMB 4HF5L 1QR1A 1J9CT 2CH8A 1H8OA 3BN9C 5FUZH 3D39D 4KDTC 4MNHB 3ZKMD 4NQEE 3VFVA 5F7MC 3MLWL 4YNYB 1RZ7L 1HQRA 2A6IB 4NCC1 5KTEH 4Z7QE 2ZJSL 4OJFL 3LS5L 4O4YL 2Q7YB 1QYGL 2X4RA 1YJDH 5F3BA 4JFEB 2W65B 1HHGB 4HX1B 4YGAB 5I19L 3DI2B 4PRNB 1B2WL 3SDYL 4PRPB 4K3HA 4JVWA 1YMHA 4HIIB 1FG9C 1EBPA 4FS0A 4E42B 1I1FB 3TA3A 4GRWB 1CDGA 1IGTB 1CG9A 3DUUA 4OI9A 4X4MA 1REIA 3OB0H 4PGCA 1BEYL 1JF5A 2ZUVA 5DZLA 1KTLA 5C0AE 5DDHB 1NMBH 1IQWL 3IFPB 3ALPA 3O6LL 3GO1H 3T3ME 2FGZA 1S9VA 2QSCL 5CGTA 2EXYC 3VWKA 5JOPD 4AZ8A 4M7LT 1F3JA 1CU4L 1N0LA 4OKVB 1QBMH 4HKBB 4WTZG 4PJ5E 1T0NA 5EWIH 2CUIA 3W9DB 4AIZA 3GRWH 5HTSA 3AM8A 5IW3A 5SWSD 3UDWC 4P49A 2B4CL 5E2UL 5CINL 4RGNB 4OV5A 2HKFH 1ACYH 1VPOH 4LLMB 5AAMA 3WS6A 3V4PH 1RZFL 1I8KB 1ZVSB 1MCFA 1CLOL 2BHZA 3CVIH 4JFFA 4JQXC 3EYUH 3VRIA 4DGIL 4CW1A 2HT2D 1PZUB 1Q9KA 3QIWC 2DLGA 2PUQT 5GS1A 4XP5L 3DRTB 4NWTL 2BMKA 5DLML 5KVGH 5DGRA 4Y5XB 4Y1AD 3ZDZF 3HR6A 1VACA 1ZKAA 2RCSH 2XV6B 1I7TA 3DTXB 1KJVB 4MNGB 4P2RA 2I07A 5D71L 1KYOK 5I6XB 1T1YA 1FN4A 1YY9C 5TQ2H 1A9EB 4X98B 4Z7QF 2JE8A 1RK1B 4U1LB 2I9TA 4F7CB 4HUKB 5F7LB 2R2BB 4JKPH 1WLHA 3B9AA 4G80B 3IJYA 3GIVA 1T3FB 1A4KB 5FOBA 4ZTOL 1W72H 1UB6A 3A6OA 4P5TD 3CK0L 1S78D 4O2CA 1AD0A 4R4BA 1CGUA 2YXFA 4YC2C 1UEMA 3ROLB 5C0GB 5IMMA 3O8XB 3P0VH 4JDTH 1IEBA 1Q0XL 4UTBL 4ZSOB 3MRLA 1A6WH 5CHNA 1HXYB 3VMOA 4DN4H 1NDGA 2DJ4A 1FNGA 4B7LA 5HDQL 4EEEA 1N59B 3QO0A 1TQBC 2GJ6A 4NUJA 3T3MF 4P46D 3FRPG 4LFHD 1F6FB 1JPTH 3L3GB 2YD8A 1B0RB 2DYPB 3HZYA 5CLTA 4M1CC 4FQCL 1FFPB 2BVYA 5FUCC 4A2MA 2FDBP 4HIJB 4U6TA 1F3DH 2PTVA 2FB4L 5ECJE 3LEXB 3IXAB 1H3TA 2IAMD 3KJ6H 1BIIB 4QY8A 3WHE1 3K81A 3S34H 3MRKA 4U4BA 4HKJA 4OIBA 4D94A 2VL5B 1A1MA 2BVUA 1IAKA 4PJXE 4P23C 3Q5TA 4NQED 4WY7L 4OD2A 2J3SA 3C6LB 5J89A 3E3QE 4M6NH 1D6VL 1QSFB 3MJ7B 3MOAL 1DQDH 2UVFA 4HS3A 2DQHL 4MDIA 4UV7L 3IJSB 4MJ6A 2CPCA 5DA0B 1K2DA 2FJHB 4RCAA 1UA6L 2HLFC 1QRNE 1MI5B 2IMMA 3OGCA 2YUZA 3ARGA 1NL0H 2X4TA 2Q8BL 5FYKH 4NNXB 3QUZB 1P4LB 3ZE2E 2V2XA 4PRHB 4W6XB 3PGDB 4WFEE 5C0AD 3B8YA 2J88H 2BOBA 5LBSL 4GG6B 1A4JB 4HKZA 1QSEA 3VGFA 1UCBL 5INDB 3L5XL 3VXNA 1RY7B 2XN9E 2NY4D 5F9OL 3KXFE 4JG0H 4I3RL 3A67H 3PGCB 4O2EB 5GS2D 3EYOB 1G9ML 1ZEAH 2CUHA 2HVKA 5EC2A 5DJ2B 4YHMH 5C70A 1T5XA 4I9WE 4KUZL 1OQOA 3KPOA 5ID1A 4WI6A 5C09B 2P1YA 4H1LG 1UXWA 4NKQB 5ALCL 4HCRL 3AY4C 1V5JA 3QQ9D 2VDRH 4L29B 4O5LL 4QTIH 3DV6B 4Q74A 3WIFB 4JHWH 4CRPA 2BRRH 5CBAB 3LQAL 1A7RL 4R26H 2VRAA 2IWGA 5EU6A 1FPTL 1MJ8H 2FLRT 5DVOA 2R56H 4I0PC 5C0CA 1KJ2L 1XGUB 5I8KH 4TOYH 2EYSA 4GS7B 1BVLB 1EH9A 2PTTA 3P11L 2J8UB 4HHAA 5AZEL 1JNHA 2R23B 4BZ2H 4G5ZH 5KG9B 4IDJH 3X3GH 5I17A 3CIQA 1LE5B 5KSBB 4OIAA 4DK3A 1G7JA 5F9WB 1TJGL 3OG6B 4ZD3H 2VN4A 1A1NA 4QCIA 4LPWA 1AY1H 3C60D 1A3LH 5DJDA 2CR6A 1AD9A 4GMTH 3CMGA 3MSPA 4FQQB 4FFWC 4PRDA 3RVUD 1O5DT 4GXUM 4ODUB 1NFDA 2APWA 1TZHA 4EI5A 5GPRA 3BKCL 5HHPB 2AJZA 4HH8A 2K7PA 4NQSB 3FQTB 5DMYA 1ED3A 3HRZA 1NGQL 1UWGL 4Y2DB 5C6PB 5CZKA 3ARRA 2AEQH 1Y0LA 1W0VB 1RSFA 1R5VA 3VRJA 1J88A 1ETZB 2GIYA 3VFUA 3ZE2F 1G7MB 4WGWB 4YXHL 2FYYB 4JFQA 5I1KL 5JR1L 5IMLA 4PJ9D 4M6ML 2NYYC 4LCCC 5IEHA 3DGCR 2L4OA 3EIFA 2PYEE 4GXVL 4LU5L 5D93C 3DMMD 5HDOA 6CGTA 1UVQA 3BPNB 3DVGB 5GGQL 1F8TH 4FFZH 4PV9A 1CIUA 3QFJE 4RMSA 5ESQA 4EN3B 2IANA 5IF0A 2X4OB 3O6FD 1MCHA 1AKJA 2VLME 1T1WA 2CXKA 3HC0B 4R96B 4YEEA 2WLZA 4JY6A 1LEGA 3OR7A 5T1KD 1IGCH 4U6XA 3VFPB 4ERSH 2VDML 3O6KH 5HHNB 3HA0A 5EBMB 3T4YA 5DEGA 5BZWB 3MNWA 1LDSA 3A6BL 1KACB 1PSKL 5L9DL 3V8CA 3RRQA 3GM8A 3Q3GB 4HK0A 5I1DB 2YA2A 2R0ZL 2C3WA 4FMFA 5D7SH 2EICA 4MCYB 1RVFH 3RAJL 2V5SA 5TE6L 4S1RH 5CSGA 5MEQA 4FG6C 2DQDH 4I4WB 1TVHB 3MUGB 3ZKXC 5E6ID 5EBWA 3G6AB 1N4XL 5DD0L 4WU5A 3RWFB 3OKKB 5A3IC 1FE8L 1H3WM 4LVOB 1NGZB 4XRCA 4LGSB 4Y4KD 4OLZH 4WUUB 3U46B 43CAA 2F74A 2XA8L 5DRZB 1DSFL 4QHMA 1QRND 2N56A 3U4BL 3O11B 5I15H 2BFVH 2ICWB 3UBXA 5TF1H 1IJ9A 1AGDB 2IBBA 3IFNH 3OAUL 1OT2A 2IPTH 1GHFH 1MIMH 4YFEA 4YXLL 2CO7B 2VLKE 5J3HD 4WFED 4MD4B 4PS4H 2AXHA 4GLRI 4Z7NE 5HYSB 3T0EB 4RNRB 1F6AB 1KIPB 2PW2A 3C2SA 1D6EB 2XN9D 4DVBB 4YR6B 2DWEA 3KXFD 5I8EA 4MAUH 4S1QL 3W39B 2ITCA 4I9WD 5B38G 5C6WH 5FYJD 2QQQA 4ZFFA 3BOVA 2X1PA 4C56E 4OGAC 5E8NB 5DQJB 2H9GA 4JDZA 4F37K 4U31A 1YA5A 4JFDA 4P4KC 3SE8H 4M8QB 4KZEL 1T5WA 3LKOA 3ME0A 2R0WH 4GRLD 2VYRE 4OCXH 4PB0H 3ZT7A 1CFSB 4PJIA 3TA3C 2ZCKH 4S10A 4JO3L 3AU1A 3M45A 3GMLA 2BNUB 15C8H 4P3DA 3C5ZD 3NCFB 2FH8A 1DUYB 3IDYB 1UCTA 5D5ME 3QUYB 3GI8H 3MCG1 5HHOB 2NXYB 4LLWA 1UG9A 5HVGB 3SQBA 5GJSL 1XR9B 2X1OA 4WFHE 1OWWA 2AI0L 2J6EH 1T2QH 1N5YH 3V7AE 1L0QA 4LL9A 4JZJC 1GJIA 1RZKH 4HPYH 1V7NH 2XY2A 3HR5A 2P5EE 2ENSA 5D1ZC 1PLGL 2BDNL 3R8BB 5IOPB 4IRZH 1WZKA 4R2GB 2VQUA 1MFDH 4GUPA 2FEDD 1I4FB 3MJ9H 5JXAL 4PJBA 3GJFA 4LEXL 3K4ZA 4JAMA 3MLTA 3G08A 2FIRT 5KW9L 5EG6C 1OVZA 5GS1C 3QI9D 4G6KH 4XNMA 3SCMB 1OAKL 1L7IL 1WIUA 4TVPL 3P9MB 2APFA 4F37F 4XWOC 1ONQA 3VD5A 5GHWH 3P4MB 1AI1H 3MR9A 5C08B 4Z7NF 3VDCA 2F5BH 1YEHL 1YPZE 4PTUB 2N1KA 1FYHB 5GJTH 3WFBH 2IH1B 2HRLA 3GKZA 2PYED 2FL5A 2FO4A 4EUPG 1H15B 3D85D 4OCMC 3RU8H 4XNZB 4KKCD 1F4WL 4U6HA 2H1PL 1MOEA 3QCVL 1MCBA 1CQKA 1I8MA 2DJUA 1EAJA 3QFJD 1RULH 4OCRH 1IKFL 3IFLL 1MFCH 5ACLA 4P5MB 1RAMA 4XC3L 4DQOL 4OGZA 5ERWB 4M62H 3U36A 3SE4A 3LKNA 1VSCA 3LRSB 4JB9L 2VLMD 2VL4A 5H2BB 3MROB 5BS0B 4WWID 2AV1B 4TSBL 1DE4A 4UDTA 3GIZL 2BNRB 2Y25A 1S7XB 4UIMA 1NCWH 3LPGA 4OLWL 1NEZA 2B0SH 4KI5C 1F11B 1XH3B 1AXTL 2XPGA 3K8MA 4KHTH 5D5MF 2IEPA 4PGEB 2ADIA 4CU7A 4X5WB 4OCSH 1X5FA 1RQ5A 2IFFL 1B4RA 3SO3C 1CXHA 3WYRA 3P4LA 2MQ0A 4YHNB 1I8LC 2W9LA 5IB4B 5JIHA 3SKMA 1N7ML 3W9EB 4NQVB 1BJ8A 2R0KH 1NGPH 3QDJA 5LG1A 4XP1L 3VFSA 4L8DB 2JIXA 1XCTB 3C8DA 3GSUB 4X6CA 1EO8L 2FEEL 3MRNA 3WO4B 3F12B 4K3GA 3CFBA 1P4IL 4OLUL 1G9NC 4R4ND 3IS1X 4J3TA 4K8RC 3BP6A 4Y16A 3NCBB 3GHEL 2GY5A 3BXNA 3FHQA 2VLKD 3QIUC 4CVZB 4OUOA 3HRPA 4NQUA 1A9BB 4CNIA 1DCLA 1CE1H 1JI2A 2QSTA 4K23H 4OT1L 3VD3A 4F7TB 4KZDH 2UUDH 2DQTH 1VFUA 4K3JL 4XNQA 1JZ3A 3LMJL 4U1HB 4HBCL 4I3SH 5DMIL 3RX8A 3PWNB 1YPZF 1PYWB 4FQJL 4C56D 3R4DA 2BX5A 1DVFB 25C8H 2XQBH 3QCTL 4QRQA 1CTNA 4G7VH 1U93A 2OL3L 5KOMC 1TCRB 1KB5H 4NQDB 4U1KB 1U92A 4NRYA 1I3GH 1V7ML 3GSVB 3ARGC 2FECL 1EHLH 1BZ7A 1BPVA 5ITBH 3OJDA 1QFOA 1TVBB 1G7LB 4AM0B 3PHOB 4LDLB 5C0BB 2OR8A 1Q0YH 1YQVH 2LTQB 2V7HA 3CJJA 1BOGA 4JGMA 2CJUL 3VFRB 4WFHD 4F15B 4S1SH 5IK3A 1GAFH 1RZ8A 5HGBB 4YUEL 4I18C 4DAGH 5BW7A 5IFAL 1B88A 2OTPA 1HXMB 4JRXB 1XEDA 1ZVHA 3UJIL 5D7KE 5GZOC 3JWOH 2EIZB 1JHLH 2OLDA 2P5ED 5F88B 2A77L 2IC2A 4ZTPH 4RISH 4NN5B 3JUYA 3GJFK 2NY2D 4UNUA 3JWNC 3VRLE 4POZC 4P9ML 2QHRH 5ESVB 4NO2A 2MMXA 4FFVC 1NLDL 4JM2A 1F6LL 3U1SL 2PW1A 1XF5A 1T04A 1VFAA 1OAZH 5A40E 4H0GA 1X6LA 3EYVB 5BV7C 3N06B 4J8RA 4OGYL 3DUHA 1YEGL 1TMCB 3ULVE 5DYOA 4LSQH 4NDMB 4PJIF 5ICZB 2CUMA 3W82A 5EO1A 4ZPTA 5EN2B 3P73A 3MA7B 3FO9B 4RRPA 4TUOB 5GGSA 3BZ4A 3HAEG 1KFAL 3O3EB 1DQMH 1WBXB 2XTJC 4TTDD 4XPTH 2WV3A 1U8OA 5JMRA 2LABA 3PXJA 2XZCL 3O2DH 4MX7B 4GKZA 3LD8B 5IW1A 1E6JL 4KTYA 1FLRL 2BSSA 5KVDH 5GGTL 5I71C 5SWSB 2VIRA 1AIFB 1N5AB 3RDTC 2YOCA 5J6HB 4X6CE 4KJWD 4Q0XL 2QQLH 3TLRA 1C08B 4JFYA 2DI9A 4LRNL 3WFDH 1LO3L 4PJBF 5D72H 3CX5J 4DUVA 1TQCB 2EDKA 1EERB 3HI1B 5EUOA 4LLDA 3ARTA 1Z0NA 1J12A 4LPXA 1CYGA 2B2XH 4PGZA 4AH2B 4UBDC 3KPNB 3ILPA 4XVJH 4Z7UE 5GS0C 3IFOA 2D0FA 3WD5L 5B4MD 5IIEB 2EECA 3KPPB 1B4JL 2GHWB 3IRPX 4AL8L 1HHHA 5EORH 4FQXA 3CNKA 4ZAKD 3RGVB 5E08H 4HZLA 4WI4A 4RIRA 2IQAA 2GITA 2ARJA 1CS6A 3VRLF 4M93B 5E2WH 4YAQA 3BKYL 1D5XB 1S5IH 1S7TB 2H2PD 1WFTA 5IMKB 1K85A 4RFNB 1ERNA 2ZUTA 2DWDB 4H26A 5E95B 2CDEA 4MNQA 3G6DH 5JPMB 3Q6GL 4OI8A 4G3YL 4QRPA 1M7XA 3RGHA 1C7SA 1G7PB 1DANU 2YK1L 5TE7H 3CFDB 5E5RB 5JOFB 4J12A 2KKQA 4X7CC 5SWZD 4TUJB 3EFDL 3WV0A 3LZFH 4Q6IC 4GQ9H 1C7TA 4HXAH 5MP6H 3WIIL 1QFWM 5LWYL 3IXTB 5B8CA 5J13C 1OLLA 3GSOA 4ZYKA 2D4DA 4RFOL 5DWUH 1NMCC 1UB5B 4P46B 1Q8MA 3N1PC 1EEQA 2PO6B 3KPSA 2PF6A 1ZLUH 3LEVL 2HTLD 2OK0H 3R8QA 4QT5A 4NGHL 3NVQA 5D7JA 1H5BB 3VXMA 4EDWH 2DLTA 1JIBA 5DJZB 2DAVA 2H45A 4PBXA 5F7DA 1YNTB 1SQ2N 4ODVH 1LO2L 4LPUA 3CFKA 3O45B 4LMQI 2Q1EA 4HDIA 4X6CF 1RURH 2FWOA 4LCYA 4IBLT 4CADA 1WUNT 1VEMA 4OD3H 4TVPE 4WNQA 1MWAH 2YC1A 3D1MC 2IAMB 4QOKE 2NNAA 4QXTA 4EZMA 4PJ8C 5H37G 3VCLB 1WZ1L 1NBQA 4UT9H 2DQUL 5D7KD 5FOJA 5GISH 1UH4A 1T4KB 3HNTH 4XCEB 2WBWB 4XBEH 3QDGB 1B90A 1J1XH 2VXUH 4C4KT 4QNPE 1OTSD 3NIFE 3UZVB 3MRCA 3L5HA 5B38B 4LSUL 3TCLA 3F7YB 1MUJB 5T3ZH 5HPMA 3IKCA 3FB7A 1R5WA 4UV4L 4P0DA 4OZ4A 3QPQC 2EDYA 1DEEA 2B1AH 2X4NA 2PXYA 1BBJB 2UZIH 4ZO9A 1AHWB 3ARXA 3ULVD 5I8OL 4YLQT 3AUVA 2GSIB 5DJAB 4WCYL 2A6DA 4P57A 5EOCL 4IJ3B 3G9AB 4YFLI 1JP5A 3G6JA 3T1WA 3V7AG 2FZ3A 2B5IC 5C0AB 3INUL 2WQRA 2GYSA 1KCLA 5T1DH 5C0ND 1IE5A 3C8KB 3O2VH 1WCBA 4WO4C 3NH7H 1QHOA 1U8JA 3PQYE 5E2TL 1JBJA 1G7IA 1NBVH 1Q9WB 4BKLA 3LQZA 2NLJB 1HQ4B 4PJ5B 1SYSA 5E5MB 4WW2C 3WL9B 3PABA 4F7EA 3V4UH 2CK0H 1VCAA 1NFIB 5I2IB 4JKMA 5BVJB 1JNLL 2WLYA 3WKMH 2W60B 3QXVA 1FRGH 4JM2F 5E8EB 5ETUA 2EE3A 3I50H 4DKEL 5FA3B 5MEPB 1OL0A 3EJJX 3FTGB 1AO7A 4GRWH 2DBLH 4TSCH 3HI5H 4KJYB 4U05A 5CZXC 4KVCL 1IKNA 2EEBA 1TZGL 4MNQE 5ADOH 1SVCP 3ARED 3BHBB 2Q6WB 3I2CH 5DD1L 4BQ6A 3VA2C 3HMXH 4OZHE 5ABDE 5DRNA 4PLJC 3L7EB 4UT6L 1I3RB 3FZUC 5BMFL 1FG2B 1A6PA 3WDJA 1MREH 3JSSA 5I1AA 1OPGL 1DFBL 5KSAA 3AVEA 5IKCA 1ORSA 2DQGH 5LAXB 1OP3H 2Z91A 4EUPB 2NZ9C 2IBZX 1HKLL 5FUCE 1FDLL 4QNPF 1Q38A 3KPSE 3NIFF 4HFUH 1VFBA 1OD7A 1W0WA 1QD0A 3B9KC 1YYLL 3MRDB 4YDIH 1XZ0A 2O93L 3PDGA 1FBIL 4XVSL 1KCVL 3L7FA 1S7SA 4XI5D 2JJWA 2P8PB 4I48A 1GC1C 4JRYE 1N6VA 2AXJA 4MAYB 3RWJA 1GGBH 4XPAL 3HNVL 1S3KL 4B50A 4FA8A 3STBA 3QAZB 3KGRA 2DTMH 2L0DA 3LVEA 1CDIA 2VQ1A 5T5FH 3CH1A 1WZMA 1AQDB 4JJ5A 4RMTA 1TETH 3VFVB 1HI6A 4PJ9B 4XWGH 1N6QH 2Y06L 3O6ML 1XIWA 2WUCH 1PEWA 5CKAA 2HA1A 2VLRA 1JNNH 4PGBB 3DMMB 1HQRB 2MPAL 3K3QA 4ETQA 5FFLA 1JMXA 4HAGA 4GO6B 4OM1H 2X4RB 3BEVA 4N5UA 3LH2L 5C71A 4LPTA 3O4LE 1CICD 2VSDA 3K1KC 2DBJA 3BZEA 4MGXA 5EZOH 4MB5A 3ARVA 3GFUA 1YMMA 2QADD 1N3NB 5K93A 3RL1A 3O6FB 1ZTXH 4I2XE 4TVPD 1ZHNA 4KY1L 1KBGH 3U79A 1NCCH 4QOKD 5TFSH 1ULVA 4HWBL 4YPGA 2R2HB 1A3RH 2EXYD 1FNSH 2Y5TB 3G6JE 1U91A 4PJXB 1FNEB 4NM4L 5HPOA 1KULA 1KTLB 2ESVA 3Q1SL 3C87A 2Y6SC 4H5SA 3UP1A 5DC4B 3TN0A 3T08A 7FABL 1S9VB 3VWKB 1F3JB 3OAZH 4HJGB 3MV01 3IU3A 2LAGB 1H8NA 5E6IB 4QWWD 1T0NB 4H20L 3G5VA 4AIZB 1GVIA 1AGEB 4WENB 4M5YH 1FNAA 1FYTE 4OV5B 5C0IB 1G9NL 2H8PA 1MRFH 3H9ZA 5F93C 1A6UL 4K8RL 2KZ1B 1RFDH 5EDXA 1INEH 3WO3B 4EBQH 5IV2A 2P42B 4XP4H 4GAYA 4Z7WE 5ELIA 3VRIB 4CW1B 1Q9KB 1P69B 3DV4A 4RMQA 4WEBH 2OZ4H 4LPCA 2BMKB 4HQQH 1N64L 3I6LE 4JKWA 2VDPH 4LSSH 1BLNA 5DGQA 1YY9D 4Z7VE 4DTGL 2WBJA 1UJTA 1GOGA 4PJDE 3PQYD 2AP2A 4OF6A 1VACB 2UV3A 5IJVA 4OF5A 3OWEA 4NHUA 2AGJH 4PGJA 3DBXB 1INDL 1DN0B 3KPMB 1KCUH 5HY9A 1T1YB 1OAXH 4KRPB 5AWNH 3QPXH 5C0DA 1A7QL 1TDQA 4TNWK 4X4YA 4JN1L 3DX8B 4GRLB 4LVHB 3C09B 4WTXA 5EU5B 1IEAA 4NOFA 3HE7A 3IJYB 4M7LH 4KGJA 5FOBB 4MNQD 3C5ZB 1UB6B 4YFDB 3GBML 4ESKA 4BSWA 1F2XK 3NFNA 3GMOA 1AD0B 1M05B 4O2CB 1MEXH 4R4BB 5FAAA 4D9LL 3CCHA 1NFKA 5D8JL 1NEZG 3CZFA 3BKMH 2ERJC 4JLRB 5IMMB 4HV8B 4OQTH 1KXVC 3BPOC 3DX9A 1K8DA 3MBEC 1CFQB 2EH8H 3MRLB 5CHNB 4XNYL 4OD1H 3G6JF 3HAEB 1NDGB 3SKNB 4ONOA 1FNGB 2E5EA 3DVNA 3QO0B 3ECBA 4NUJB 2GJZB 3ULUC 4WTWA 1BFTA 4FNLH 4F57H 1KTDB 4HK3N 1FO0L 5CP3A 1PDKA 3O9WA 2FX7L 5HI4D 5BV7L 1KEGH 1BIHA 4Y4FC 5KSVB 2CGRL 1DLHA 1KCKA 3MRMA 3IDNB 4JRYD 5AUMA 4J3SA 3HZKA 2G5BA 3QI9B 4Y8DC 4P23D 1T1XA 2ZCLL 4QY8B 3MRKB 1YEIH 4WHCA 1S7QA 4Z7WF 5FV1L 4JZNA 4HKJB 1P7QD 4D3CH 1A7PL 3MYZA 1IAKB 4FQXC 3K1DA 3H7BA 4NC1C 1NUFA 4PJAE 2A38A 1IAIH 1AGBA 3BGMB 5ESAB 1JPSL 1EUUA 3D85B 1YDPA 2YD2A 4X4ZA 5D1XA 5CD3A 5HHME 4YQXH 1VFMA 4NZJA 4DGYL 2EDFA 4D0CA 3O4LD 4HS3B 4MDIB 4QRRA 3FO0L 3QFJB 3BW9B 3QEQA 4MJ6B 1K2DB 2AJXL 1EFXA 1RIVL 4I13B 4KGLA 1PZ5A 3OKOA 2HWZH 2PXYD 1S5HA 1LD9A 1SM3L 3OGCB 2EC9U 2JCCA 2X4TB 1KOAA 3H42H 1HSAB 3CMOH 4O58H 3MJ8A 5GS0L 5IG7A 2I9LA 5HHXH 2VH5H 3TBWA 4WWKC 4ALAL 1R3HA 3CFCH 5K9JH 3C08L 2BOBB 2H6PB 4HKZB 5C2BL 1LEIA 2NY1C 3T0AA 3VXNB 4GRMA 3GMRA 3RTQC 1CXFA 2H32B 3U82B 1GPOH 4AEIH 2VZ1A 4XP9L 2VAJA 4HPOH 3NIDE 5D7JC 3KYAA 1T5XB 3KPOB 5C86A 1UXWB 1YEKL 2W9EH 3QNXA 1FYTD 3I6KA 2F54D 4LAJH 1M4KA 5AEAA 3S88L 2XXMB 4I0PD 1GIGH 3QWRA 4XPHL 5DK0A 3U4EA 1E4KA 3W0WA 2VXVL 1YJDC 4NNYA 4D8PA 4WV1B 4KQ4H 3FL7A 5GGVL 1SVZA 4HWZA 2XI9A 7CGTA 5C0CB 2VLKB 3MQIA 5L0QC 3WFEL 2EYSB 5F44A 1DP0A 3I6LD 2PTTB 4RRPG 5F7WC 4HHAB 2M1KA 1JNHB 4PIRF 2YRPA 1Z5LA 1G7JB 3FAXA 3P2TA 4FFWD 1A1NB 5KSAD 4PJAF 4OUUA 3GSNA 2IMNA 5IVXA 1RI8A 2J6EA 5JORA 2IBGA 2NY3B 4JFPB 1ND0A 2ORBL 1E4JA 4PRDB 5B22A 3RY4A 1Y6MR 3F65A 2HKHL 3SJVA 4HFWA 4EI5B 3TT3L 3QRFM 3T0WA 4GKNA 4IOSD 4EIZC 3KJ4B 3MNZA 3EO1A 2C3HA 3REVB 1NCAH 2Z93A 1OB1A 5D5MB 5IWLC 4M9PA 1ED3B 3MLRH 2XG5A 2EE2A 2A9ML 4DKFL 4JQIL 2NYYD 1Y0LB 4ENEC 4PP1C 1JGDA 1R5VB 3P77B 2A83A 4J3OC 2X4PA 1WGOA 2P5EB 3VFNA 5EUKA 3WNPA 1N6UA 5IMLB 1I3UA 4JFOB 1CT8B 35C8H 5F96H 1RJLA 5LGKA 2AABL 2Q76A 4PG9A 5DJ0A 2XQYK 4FQHB 3NABL 4JEGB 4JPVL 5H94