3RAJL

Crystal structure of human cd38 in complex with the fab fragment of antibody hb7
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
208
structure length
208
Chain Sequence
IQMTQSSSSFSVSLGDRVTITCKASEDIYNRLAWYQQKPGNAPRLLISGATSLETGVPSRFSGSGSGKDYTLSITSLQTEDVATYYCQQYWSTPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosyl cyclase 1
publication title Engineering a novel cytosolic form of CD38 for cyclic ADP-ribose dependent signaling
rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 36
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2011-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rajL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rajL01
2VXSL 3IDXL 2FATH 5T1DH 4DW2H 2VDQL 4KQ4L 2BOBB 2M26A 3BXNA 4TUKL 4S11A 1F6AA 4X7SL 3QIWA 2JKXA 3KR3L 8CGTA 2BX5A 4U6XA 4K7PH 3KVQA 5K9JL 5CHNA 2P24B 5D7LB 4NQVB 4OBSA 4ZSOE 4PJDE 4A6YH 1KFAL 5F7DA 1KJ2A 4TULH 4XHQA 3RWIB 2LU4A 4B7LA 1CGXA 5KJRL 5LBSL 5F7NC 1HH9B 3CIQA 3PL6D 1HXMA 1QFWI 1VEOA 4JM4L 4P2QD 4OV5A 3WNNA 1ZXQA 1D9KD 5D1XA 2BVEA 2IQAA 4JY4A 2ARJQ 1G0YR 3MBXH 1EEYA 5IWLC 1FFOB 4FFZH 3U0WL 43C9B 4XPAL 1N59B 2HFGH 2BSTB 2QQKH 3LV3A 3PQYE 3UBXA 3L5JA 1KLUA 5CSGA 4OIBA 2OR8A 3H8NA 3IU4L 5FYJD 4UTBL 1U93A 3EO0B 4K8RH 3UYRL 4X98A 1YUHA 1KEGH 1INDL 4QTHA 2XA3A 4L4TD 4XWOD 4JZNA 1DBKL 1DLHA 1QHOA 1MJ7L 2RBLA 1T7VA 1CFVH 2F74B 3KPRD 3LN4B 4OD1L 4YBLC 5HGDB 3NFPA 4OJFL 3PHQA 3UJIH 2WBJB 4OCYH 4RQQB 1V3MA 3S6CA 3GBNH 2B1HL 3KJ6H 5HYJB 1ZLUH 1DVFA 1FNSH 4H8WH 2VLJE 3TO2B 3D39B 1AGCA 3S3JA 2E8ZA 3WEXA 5DJ2A 3T65A 1Y0LB 3VFOA 1IGCL 3LN5B 4C58B 3TYFB 4LP4A 1CTOA 4H20H 1HSAA 4YX2L 3I9GL 3U46A 2NY7H 4U7MA 1HILA 2B20A 3RWDB 1ZOXA 4LBEB 3NZHL 6CGTA 4OZ4A 1FYTB 4S1RL 3QAZB 5DMKA 5ISZB 1D3CA 1LEKA 3T2NL 1J1OH 3IDJA 5FYJU 2W9EH 4GAJH 3WNMA 1PLGH 3KPMA 2NMSA 3IJSA 1NUGA 2R0KH 1OGTB 3S88L 1U8MA 1HHIA 1QVOA 3WKML 3TT1H 3SDXB 2Z91A 4PJCB 3MR9A 3WMSA 1NMAL 5T1KB 5TJWK 1U3HA 3VXOB 4PJ8D 1CTNA 1VB9A 4O2CA 4OZFH 4EXKA 2ZNXA 3HPLA 3QO0A 5MERA 1FAKT 2FJFA 3HB3C 4LSUL 1ES0A 2E3VA 4RRPG 5EU6D 3P4OB 4PPTA 5I0DA 2EICA 2VL5B 2MWCA 4I3RL 2DB8A 4MNQA 4Z77B 5EBLB 4O4YL 5DRXB 3BMWA 3MYZA 2X1PA 3T0DA 3ZE1F 2JF1A 3U7WH 3VI4F 3GM8A 5CILL 1B0GB 4IDJH 5DA4A 3DO7A 2DQUH 4HK0A 1LO2L 1P7KA 2EEBA 5D7KE 3S7GA 1FFQA 3SKJH 4JFOA 4PJ9A 1NGPL 3V5DA 3LIZH 4LSTL 4WI6A 3WO4B 3FQWB 2B0SL 4FS0A 4GW4A 3HC0A 2WWMD 4OCNC 4Z0BH 3RVTD 3X13A 4FQCL 3MLXH 5GS0D 4G6ML 2LU3A 4YZFE 3V6ZB 1MVUA 2L0DA 3IAPA 2DQTL 4MA1B 4IRSA 3WXWH 4P5TA 1EMTL 1IFHL 3OAYH 4PJIE 4PTUA 4Z95L 5E6ZA 3TBYA 1EO8H 1KENH 4JPKH 1A3LL 1XGQA 3D1MC 1WT5C 1DBAL 3JWDH 2NXZD 1I8KA 2W38A 4JM2F 3L3OB 1C08B 3RTQA 5I66A 2VLKE 4ONFL 2E27H 2WUCL 3X14A 1PYWA 4YUEH 2Q1EA 3BW9B 3EO9L 2Y07H 2Z93B 4P2OC 1HWGB 4ODHH 4PJEB 3U9PH 1DQMH 5ANME 5CJXA 2AGJL 3MRPB 4KK8C 4N0RA 5A2JH 4L3EA 5BV7B 3HLAA 1A7NL 2QHRH 1MFNA 1GZQB 4PJHB 4X4YA 1JV5B 1MWAB 1IKNA 5C0DB 5C0GB 2F8OA 4O51A 2YD9A 2DWEA 2GQHA 3G08B 3C60D 5SX4H 4JB9H 5FYKH 2PF6A 1A0QL 1MPAH 3MREA 5C0BA 4G8GD 1NCAH 4DGIL 1CN4A 4PJHF 4P2RE 4TVPD 5GS1A 1TNNA 1G7JA 4YE4H 2LABA 4PJXE 1A5FH 4OIAA 2XG5A 3CH1A 1F58H 2ADIA 3O6LH 4HHAB 3ZT7A 2PXYC 3FT3A 2CK0L 3BP7B 3NCJL 3L1OH 4WU5A 3UPRA 3VI3F 4QTIH 3LD8B 3LQAC 3VXTB 4Z5RB 5DJZA 1CDGA 5HDLA 4LVHC 4LLWA 3SGEH 5JMOC 4YAQA 5KSUB 3CX5K 3RY6C 1CLOH 5HGBA 3VJ6A 4U05A 4Q9QH 2QJDA 2EE9A 2BOBA 2AK4E 3THMH 3DIFB 3T0EC 2VRAA 1K6QL 4I9WE 1MVFA 5HVHB 3QNYB 1NAKL 4MDIA 2P24A 4NQVA 3W2DL 2NNAB 1P7QD 3JV0A 1A7RH 3C6SB 3RWIA 3CLEL 3CFKA 1HH9A 1WAAF 2YPLB 4ODUB 2PYEB 4JANB 4KK5C 1OD9A 4WGWB 4KKLD 3WUZA 1OTTC 2I07B 1ZVYA 4I0CC 1CXEA 3EDEA 4LVEA 2FBOJ 1FFOA 1H8SA 2XPGB 4YHKL 3MXVL 2W91A 5DD6B 2EE2A 1AR1D 1WLHA 1VSCA 1DQLH 2NY5H 1L0YA 1NCWH 3V5HB 4ZFGL 4N0YH 4MXVF 2IANB 4WI7A 3GKWH 2HRPL 2N7BA 1K8IA 3HCVA 3EO0A 3PV6B 3B43A 4NZRH 2B7DT 3MOAL 3EZ8A 2UUDK 5EU3A 3GI9H 4MQTB 2C1PB 3FO0H 3LHPH 4DGVL 3VA2C 1AE6L 4XPTH 2IBZX 2H32A 1UM5L 3ARWA 5HGDA 3O2VH 3V0AC 5AAWA 4RQQA 3DMMB 3WLWC 3GSVA 3WHE1 1JMXA 1MFAL 5HYJA 2E9JA 1WWWX 2YN5A 3V8OA 2D0HA 4DEPC 3TO2A 3KNBB 3D39A 2EEAA 1A47A 2ZKHH 5ESVB 3HFML 2I26N 3BP5A 4PRPD 4LQFL 3JV5A 1Y0LA 3MV9B 3PWUB 4HGWA 3LN5A 2CDEB 4XC1H 4XCCL 1DUYB 1UYWL 4EKXA 4Q2ZB 3EO1A 3TH3T 3C8KB 1T5XA 4FP8H 3RZWA 2VH5H 3H9ZA 4LAQH 4NJAH 4LBEA 1F3RB 1JHKH 4L3CA 5HJ3B 4V2CB 2DYPB 4O02L 5ISZA 3T4AB 3U30B 4RFOH 2Q7NA 4AEEA 3LKQA 5FDYA 4DKEL 1R5WB 3BIAX 1MJJB 1OAXH 3VCLB 3F8UB 5IMKA 1OGTA 4U0RC 5EWIH 4KFZC 3SDXA 3D85B 5D5ME 4PJCA 2M8XA 2XA8L 4GQ9L 3VXOA 3SCMD 3D25A 3H42H 1KT2A 3BFOA 4TTDC 5HI4D 1K2DB 1FFNB 4L8BB 3P4OA 1X5JA 1HNGA 1EAPB 3BKCL 4N5EC 2FIKB 4JFXA 2ZCKH 1ZHKB 1FVCA 1NEUA 5EBLA 1CI5A 3BZ4A 3V6OC 1P84J 4NZDA 4DKAA 5BMFL 2HLAB 2A77L 3D9AL 4GXVL 4L29A 5ILTH 2LTQB 3QUXD 1U8PB 4LARL 3LB6C 1GPOH 2HKFL 4N0CC 2CMRH 3ZMRA 4I0KA 1B0GA 5GGTH 3TJHC 4HV8B 3R4DA 3N1FC 4W68A 1G7PB 2B5IB 2GSGA 4JG0H 3RVUC 5HHQB 3MUY1 3MNVB 4DGYL 5J6HB 4ZXBC 1DTUA 3I84A 1Z3GH 5I73B 3B8YA 2FCBA 4OLVL 1LE9A 4MQXC 2XTJB 5H37G 3T3MF 3V6ZA 3S36L 3O0RL 3BPNB 5ELIA 3KXFA 5D7IF 1YEHL 5FUCE 1CBVH 1IC5L 4LLQB 2H8PA 4U0QB 4Y4FB 3MJ7B 3N1GC 3Q5OA 4YDKH 3UO1L 3L3OA 4LCIH 1H3XA 4Q97A 1FO0A 1HHHB 5HGHB 5E00A 1QFPA 3BGFB 3RL1B 2FIRT 3BW9A 4UINH 4OLXH 2Z93A 2GY7B 5FK9A 1NC4A 2OK0H 1K3IA 3QEGH 4PJEA 2ZUQC 4AL8L 5DMGC 1AJ7H 2ZCLL 3CD4A 4PJHA 5C07E 5IKCB 1JV5A 1MWAA 4TUJA 4EUPA 5C0DA 4KKCC 5C0GA 4C56E 1HQRB 1CL7H 4ZUVB 3WFZA 3L3GB 2PO6C 5T3ZD 4MXQD 2CO7B 3G08A 4P9HC 2ITCB 2FGWH 3SKMB 2W92A 4FFYL 5GZND 2DQGH 5EB9A 4UUJB 1TQCB 3RKDC 4JR9L 5D2LF 5IROC 4U1JB 4K8RC 3UTSE 2X4QA 5KSVB 3LS5H 4C59B 4IRJD 4NBYB 3BP7A 1AY1L 5BVPH 1OVZA 4K23H 3U9UA 2MCG1 5K9QG 1LK3H 3U4EB 3VXTA 2DKMA 3GO1H 2L7JA 1CGVA 1ERNA 1CLCA 1DZBA 1X5XA 3OV6A 4NQCB 2H1PH 4M4RA 4Q74A 3D2UB 4QXTA 3OGCA 1ZE3C 4Y2DD 3WJLA 2QQQA 1WAAA 3UJTH 3DIFA 1JFQH 2VDNL 2VXSH 1NH6A 3DJ9A 3IDXH 5MI0B 2DI9A 2VDQH 4KRPD 1UH3A 4KQ4H 4Y5VA 2P4AB 4TUKH 1B9ZA 5FGCB 4X7SH 5SX4I 4D9QD 5DZNA 4X5XB 1UGNA 3C6SA 1FP5A 3HG1B 3MV8B 2ZG3A 3KR3H 2Q6WA 2BZDA 4Y4HB 4YIQB 3W81A 3GMNA 4YGVA 5EOCL 2PYEA 4JANA 5K9JH 3TP4A 3GMOB 1KFAH 2I07A 1YYLL 4NQEE 4EN3A 1WK0A 1QFWM 5D1QC 4HKXB 1A1MA 5GRVK 5KJRH 5LBSH 2QV2A 4CVXB 2UWEB 2XPGA 3LPFA 1FLTX 4JM4H 1TCMA 1UG9A 3W0WB 2P5WE 3V5HA 3SGEI 3SJVD 2IANA 3NCYP 4YEEA 1KIUA 3CFJB 4HUNB 3U0WH 2ZSWB 5IESL 4UBDD 4JKPL 4XPAH 4MAYD 3PV6A 2D0GA 4C83B 4P49A 3OX8A 1JTOA 2UWEF 3BZFB 2C1PA 3VWKC 4UTBH 4JO2L 4F33B 1PSKL 5I76A 3PNWA 3UYRH 4PLNC 4PBVC 1L6ZA 4WO4C 1RIUL 1INDH 1UM6L 3LEVL 4KI5D 1JZ4A 1JZ8A 1XGPB 1DBKH 3DMMA 1TQBC 3ARPA 3UTZB 4P9ML 3O9WB 4OD1H 2IGFL 3O3DB 3O8XD 1U95B 5JOFA 4OJFH 5IK3B 1KB5L 4KMLB 2LVCA 3QIUA 4HLZH 4XPBL 2B1HH 2YA1A 3IJYB 3BVNB 2DLEA 3PWUA 4OBRA 3OXSB 1DUYA 4NFDA 4RGMC 5GRUL 4Q2ZA 3VXSB 2BVQB 3C8KA 3LSOA 1CDIA 2Y1VA 4HQQL 3FL7A 1CFBA 2E9WA 2H45A 2O5ZH 4PLKC 4LLAA 3KPRE 3EIFA 1I1AB 1IGCH 4JFFB 5HJ3A 3T4AA 5EUKA 3TBVB 4YX2H 3I9GH 2OL3B 4QWWD 1R5WA 3NZHH 2XQYK 1XF3B 3VCLA 3DX9A 3I75B 4S1RH 3ARGB 3BRFA 1NUDA 3RY5A 4WHTB 5D6DA 3T2NH 3RUGB 4JDVA 3D85A 1MQ8A 3ULVD 3MRBA 1PGRB 3KGRA 5AEAA 4G80B 3C5ZC 3ZHKA 3S88H 5FM5M 3WKMH 3B9KC 3TN0A 4U1IB 1K2DA 3WHXB 4HEPG 3U83A 3B9DA 4XZUB 1NMAH 2FLRT 1QFHA 4L8BA 3VXMD 1EAPA 2FIKA 1V7ML 1NCCL 4GOSA 5F70A 4KU1A 2GW5A 4LSUH 3G6JB 2IADA 3HE7C 4J8RA 4I3RH 4HV8A 3IDNB 1G7PA 5L88L 4CJ0A 3QUYC 1E4KA 5HHQA 1L6XA 2HYMA 4POUB 4AYFA 2A6JA 5CILH 2XWTA 3MNVA 2Z31B 5D7IA 1MHPL 1LO2H 2EDOA 1CVRA 1AXTL 3MNWB 5HBBA 3JWNC 5KS9B 2IFFL 1NGPH 3RWCA 2ADJB 3QDGD 3K46A 1FL3B 4LSTH 5AAMA 1OQXA 4X9GA 4HWNA 2B0SH 2PW1A 4LVOC 3ORJA 4G6KL 5EUOE 5IVZB 4QXGL 5A40E 2EIEA 4RAHA 1XCQA 3D5OF 5MENB 4FQCH 4RZCB 1P9MC 4LLQA 4G6MH 5KS9F 3NCCB 3R0MA 3QDMD 1P4LB 4OF8A 5CLTA 1YC7A 3MJ7A 3S3PA 5KVFH 1SM3L 2DQTH 1JF5A 3AY4A 5I8CA 2GTZB 2OI9B 1EMTH 4JPIB 5HGHA 1IFHH 4Z95H 3MO1B 4JKLA 5MEQB 2A83A 3RL1A 5J1AA 1A3LH 4YXLL 3CFEB 1DBAH 2QSVA 3M07A 4JDZA 3MFFB 2K7QA 4NO2A 3HE6B 5GRZA 5IFJB 1KIRB 4PJDB 4ZSOB 5F1OB 4ONFH 2WUCH 5IKCA 3EO9H 3L3JA 5D2LA 1GSMA 2G5BB 4M48L 1HQRA 4KJWC 3L5HA 5H35B 1VCAA 2AGJH 4ZUVA 3L3GA 2BXYA 2DMKA 5DD1L 1A7NH 2CQVA 1J8HB 4XVTL 2VYRE 3J7HA 3SKMA 2WV3A 5DFVD 3BEVB 1KJMB 5FKPB 2W9LA 3ZTJG 3PQYB 5C2BL 2V5YA 4GBXC 1VEMA 3U82B 4JEGB 4U1JA 1T7ZA 2R2BB 3OBAA 3P9LB 1HQ4B 4J3TA 5EZIL 2FEDD 2HG5B 5KSVA 5I1GL 4XNMB 5MP6H 4L9DA 1EX0A 4F7EB 3U4EA 5EOCJ 1T0MA 4G7YL 3PDOB 1G9ML 1NC2D 3NCJH 2CK0H 1VFUA 4XP9L 3D2UA 2DTSA 1MF2L 4QEGA 1UJ3B 1HOCB 4YQXL 3X12A 1WQVT 1HHJA 3PWJB 2VLJB 3QISA 3ZDXE 4TVPE 5L2KB 1CL7I 1QLFB 4S0SD 5HHOE 4U1LA 2BVOB 5BRZD 4JVPA 1Z9MA 4ELMF 4X5XA 3FN9A 4LVNB 4Y1AE 1K6QH 2ZUSA 3MV8A 2YSSA 3V52L 4YIQA 2K1MA 3HAEH 1NAKH 5A2KH 2B8OT 4PBWD 3W2DH 1RV6X 4J3XA 3CVHB 4HKXA 4NC1C 1T6WA 3CLEH 1KJVB 4XB7A 5J1SC 2DQIH 2UWEA 2UYLA 4CVXA 4ORZC 1UZ6F 4FQ2L 5D93B 5FO9B 3QDJB 2W0PA 1U8OA 3W0WA 1F4XL 4K7FB 2BJML 2Y7QA 2ZSWA 4YHKH 3MXVH 1J9CT 4ISVB 3JBG7 1QEWA 3BKML 4BFEA 2EXWD 4ZFGH 4WWKD 1CDUA 3O3EA 3BZFA 2F58H 5DMIL 2RFXB 1WICA 2HRPH 1FL6B 1CWVA 4FQXD 4CU8A 2Q8AL 4XPGL 2IBZY 2NYYD 3MOAH 5IW3A 3SDDB 4DGVH 3UAJD 2EDTA 3O9WA 1AE6H 5D1ZA 3LKSB 1U95A 1FNLA 1UM5H 1V3KA 3VXQB 1NEZG 4HH8A 5GSVA 5FGBA 4LDOB 4DVRL 3HZKB 1MFAH 3BVNA 4N0UB 4ZOAA 5DD0L 3OXSA 3VXSA 3AMLA 2PW2B 1MJ8H 5SWZA 3DARA 1A9BA 1UVQB 5IMOA 5GJTL 2ATPA 1R3KB 3Q2CA 4LQFH 5I15L 4G8EB 1I1AA 4KI1A 2EKJA 4XCCH 3S35L 1UYWH 1KPRB 4L9LC 5JW4Q 4JFFA 1AGBB 4JFDB 4UDTB 1Q0XL 1WFNA 3TBVA 1ZHLB 1QRNE 1ZSDA 4CVWA 5JZ7C 4KK6C 1A6VL 1I1FB 3MBED 4P5MB 4MWFB 1OTSD 3CX5J 5J06A 3ARGA 2JLLA 4O02H 3G6DL 3QPQC 4KQ3H 4QRPB 4WHTA 2PYFB 3DETD 5D1XC 4DKEH 4X6CE 5KSAB 3CUPB 3I6LE 4PJIB 4OKDA 2P42B 1DDHB 5EIIA 1CD1B 2AVGA 1A8JH 3V5KB 2EXYC 1BBJB 4GAGL 4U1IA 3WHXA 4QRTA 2XA8H 4XZUA 2UVEA 4FXGB 3O6MH 3SE4A 1MLCB 4GQ9H 5E6IA 3RDTD 2VLKB 4J4PD 3WFCL 3C8DA 4ODBD 1YEEL 2HTKD 2DKSA 3WDHA 3BD3A 1FNGB 3TA3D 2OX5A 4NP4H 5ANMB 1S7UB 3HPJB 1JPSL 3BKCH 2CDGB 4X4XB 2GCYB 4OI7A 2WWKT 3IDNA 4PGBB 5BMFH 2A77H 1E6JL 3D9AH 4GXVH 1QUNA 2IPUG 1F90L 4YPGB 2BFVL 5A3IC 3NFSH 5HHME 1RMFH 4LARH 4LNRA 1IM9B 1M7IB 2HKFH 4QHNB 4XP5L 1OWWA 2Z31A 1IRAY 3TBWA 5IB2B 4JO1L 4F57H 4JQVA 5D71L 3MNWA 5BO1L 3NPSC 5EOQL 5KS9A 1IQDA 4P2RB 2ADJA 4PGDA 4PJXB 2XN9A 4LLMB 2CO6B 4Q6IB 1NCDL 1O7VA 3QEHA 1MCEA 3ARFB 4XCYA 3RBGA 4P23B 5IB1A 5IVZA 3RWHB 4OLVH 4HS8L 1MUJB 2NY3C 3H2WA 3PE9A 4HW6A 1AHWB 2CIIB 5GRVL 5MENA 3KPPA 3O2DA 4RZCA 4XAWL 4MD5B 4L5FL 3RZCD 4XVJL 4KC3B 3S36H 1P4LA 4PJXF 4E0RB 1UB6B 1YEHH 2DS4A 3PGDA 5JA9A 1LDSA 3MRMB 3MCLL 4RX4A 1IC5H 3ZZ1A 1P7HL 2AK4B 1LO0L 3A67L 4JPIA 3QNXA 5B39G 4YBQD 5MEQA 4EI6B 1OSZB 3MJ6A 5DA0B 3CFEA 3IFPB 3PABB 2NCMA 3BI9X 4MNGA 1DP0A 3OKLA 3UO1H 5IFJA 1U3HC 4YFDB 3V4VL 3DXAA 2X89D 1KIRA 4PJDA 4ZSOA 4XXDB 1I1YA 4CMHB 2OR7A 5JA8B 4JG1L 7FABL 5FYKD 4L1HA 2IPKB 3V7AE 5H35A 2UZIL 1OPGL 2YPVL 5LCVL 4AL8H 4RWYL 4FZEH 2HFEB 2J8UE 2ZCLH 5C0ND 4HUMB 3WS3B 3BEVA 5I2IB 4JPVL 1KJMA 4X6DF 4JHWH 3QUMA 4YDLB 2GY5A 5ICZB 3L7EB 5FKPA 4OM1L 2JJTA 1L0XA 1PVHA 4I18C 3SGJA 5JNYB 2R2BA 1W72B 2KQNA 3DOSA 3P9LA 1HQ4A 1A9EA 1NPUA 2HG5A 4H1LB 4XNMA 3BISA 1GOGA 4PJ9C 4E42B 2Y6SC 1XR9B 1BD2E 2BNRE 4JR9H 1RUML 2HFTA 1H3TA 3LDBC 4ZOBA 5IEKA 2NLJB 1AY1H 4Y5XA 1EEQA 3C6LB 2Z0BA 4AENA 1HOCA 3QFJD 2VLJA 4HWEL 4M6OL 4OIIL 4LDEB 1QLFA 1AFVH 2Q76B 2V2XB 4P5TC 5J8OA 1EO5A 3C8HA 3E6FA 2VDRL 2VDNH 3D3VD 4UV4H 3RTQC 4KGLA 3QXWA 5DI8B 3BIKB 1BQSA 4Y8AA 5ICXA 3QQ9D 3CVHA 5INCA 2DDQL 4P46C 4QKXB 1H0DB 3ZT5A 3KG5A 5EOCH 5FO9A 1NUNB 4NZUL 4YHYB 2V6HA 1J1XL 1TFHA 1YYLH 2CRYA 4GAYB 2EDNA 4K7FA 5JXEA 4NM4L 1IKNC 1WFOA 2HWZL 1CXIA 5D5MB 2VWEC 3QQNA 4D9QE 4XVUC 4QNPF 3KYKL 3I2CL 3FB7B 5JW3L 2RFXA 4F9LA 2BNQD 1FL6A 2OCFD 5IESH 2VZUA 3BP6B 4JKPH 4R7DA 2EDJA 3AU1B 5GS1C 4D0CA 1ZGLA 1D6VL 3ULSA 3IDYB 2E7HA 4XCEB 3SDDA 3KYMA 4HX1B 3CMOL 3QWRD 4P57A 3H9HA 4JO2H 1EEUA 1PSKH 3VXQA 3L95B 4K7PX 4OCWL 5F1IB 1EZVY 4G6JL 2XACC 1RIUH 2FZ3B 1JWUB 1UM6H 4JZJB 3SJVE 4KDWA 3V6BR 1SEQL 2YRLA 4KROC 1YN6B 5GGUA 4P9MH 2VAAA 2IGFH 2PW2A 1OP3K 2IH1B 1TDQA 4XP1H 3BD5A 1KB5H 3IKCB 4QLRA 1R3KA 2NY1B 4W6WB 4XPBH 2AEPL 2X1OA 1DBJL 1KPRA 5GRUH 1L4IA 1AGBA 3Q3GB 4LHUD 3T0EE 4KI5E 5C70A 1ZHLA 3PHOB 4GJTB 4XXCA 3UMTA 4ZUWB 3OHXB 1WSST 4MDJA 4P5MA 3MLPA 3NIDE 4PV9B 5C6WH 1FPTL 5DVMA 2R4SL 2PTUA 3UP1A 4GS7B 3JV4B 2NX5D 3CUPA 1QD0A 1MFBL 1CD1A 4I77L 3V5KA 4GRWH 1BBJA 5FIEA 3ZDYF 5I1CL 5HYQA 4RDQF 4NGHL 1CGYA 3JUZA 4HSQA 1EEZB 1MLCA 5E2UL 3BESR 2VLKA 3EFFB 2EIDA 3TPUB 4HIEA 1SJXA 5BZWA 5IMLB 3V7MA 1FNGA 1Q9LB 2H2PD 2A1WL 1WV7T 4IJ3C 1QR1A 1S7UA 4ZFZB 1JZ5A 2A74A 1BFVL 2NZ9C 2CDGA 1ACZA 1LE5B 1V7MH 1NCCH 1OD7A 2GCYA 1JPFB 5C07B 1XF4A 3OKDB 1I7UB 3QIBA 2BXZA 4C56B 1LNUB 2ICWB 5JHLL 4YPGA 1MI5B 1J0YA 1IM9A 4QHNA 4F3FA 3UJJL 3WFHB 1E28A 3DI2B 5EO1B 2JJVA 1ZGLP 5L88H 2D7PA 1EPFA 4EI5D 4ZPVB 4P2RA 4PJXA 3KYNB 3EYQC 3UTSB 1VPOL 4GRMB 1QR4A 1IAKA 1MHPH 4Q6IA 1AXTH 4JFHD 1HDMA 3RWHA 2JB6B 1MUJA 2IFFH 3ZKMD 4RGOL 1AHWA 2CIIA 1NFIB 4F7CB 1F11A 4MD5A 4YR6B 2BCKA 5HI5D 2IALB 3IDGB 3A6OA 3QSKB 5D2NA 4XNYL 4E0RA 4QXGH 2P7TB 1UB6A 3HKFA 2AK4A 5C3TA 1S9WB 2XY2A 5I6XB 5DYOB 3WD5H 4EI6A 2A73A 4DCQB 1F3DJ 4WUUB 1QRKA 3IJHA 4K9EH 2R8SH 3EDKA 5C08D 1SJEB 4GSDL 4HWBL 5DJYB 4XXDA 4X6DA 1X5KA 3IETB 1PX3A 3SO5A 1KN4L 4YXLH 3BE1L 3BWAB 1BF8A 2UUDH 3IU3B 1U8HB 3K2UL 3QH3B 1JPGB 3GSWA 1S7VA 1CIUA 3L7FB 5IB4A 4NQEB 2FR4A 4LCWD 1SQ2N 3WS3A 2VSCA 3V6OE 1G7LB 3L7EA 3TGXA 4PRIE 4BH7B 2P5WB 2AK1L 5DD1H 2FBJL 4CVUA 5JNYA 1W72A 2VJXA 4XVTH 4H1LA 4M03A 4E42A 2WK2A 4POZC 1XR9A 4HKBB 3BQUB 5C2BH 1P4BL 1BOGB 1S7RB 2AKRB 3PL6B 5EZIH 1N8ZB 3MYJB 1OOAA 1D9KB 4Y4KB 3VMOA 3WIFB 4S1DC 4WI5A 4X6FA 3PJSA 1CZ8L 4OLZL 2HLFC 4JM2C 2Y06L 3OB0K 4G7YH 2JELL 1G9MH 3F7QA 3TZVD 1G7IA 4HCRA 1MHHB 1EFXA 2Q76A 2V2XA 4XP9H 2RHEA 1MCNA 1MF2H 1RHFA 5F93C 4DKFL 4DFHA 3L5XL 3WN5C 4YQXH 2CKBB 4ZTOL 3ARZA 5E8OA 2J12B 2X10A 4PGZA 5D70L 5CKGA 1II4E 2FX9L 3EYVB 2DQCL 3BUYA 1CGUA 2FHCA 3KPRB 3LQZB 2APFA 1ZLVH 1RK0A 1H0DA 3MXWL 3V52H 1IZJA 3TCXA 1N4XL 4YFLI 1YYML 12E8L 3PWPD 3HRZB 3QEQE 3V7AG 3WYRA 2EYSA 4GAYA 2AV1B 3MGOB 5KVDL 2OJEB 5LVEA 3L3IB 3VXUD 1J5OL 5CD5C 4LAJH 5D5MA 4FQ2H 5B39B 4BK5A 2CSPA 1J86A 4YXHL 3WS6C 1F4XH 1QSFD 3SDAA 3R06B 5B4MD 2BJMH 3SKNA 3AU1A 3BKMH 4M6ML 1X6LA 3QCUL 4HX1A 5GGRY 5DMIH 2D2OA 2Q8AH 5F1IA 4XPGH 3T8XB 3WIIL 2G9HB 2FZ3A 4JZJA 5IR1B 1QBAA 3GKZA 4TQEH 4TSCL 3SDCA 3CU1A 2OSLB 1JWMB 5EU7E 2IH1A 5IBLD 4Z18A 4QF1B 1N26A 1OTUD 2QADD 2X2YA 5HHNB 4DVRH 3WJLC 3IKCA 1HXYB 5DD0H 4YGAB 4OZGE 2J4WL 1OLZA 4HIXL 1FFPB 4JFPB 2ED9A 4Y5VC 1XGUB 5HD8C 5GJTH 2NY4B 4ZUWA 3OKNB 5I15H 4NQXB 3S35H 2DI8A 1QACA 1R3JA 3E2HC 1PY4A 4PV9A 3Q6FA 3GIZL 4XTRD 3REVA 4I2XE 5JW4N 1Q0XH 3GJFA 2D4FA 5EUOB 1X4XA 2FX8L 4M8QA 4HPOL 5IHZB 3JV4A 4EN3C 1RFDH 3FAWA 1A6VH 3O11A 4MLSA 1FG2B 5AWNL 5BV7L 3BZEB 4S1QL 3STLA 4BSJA 4F58H 4ZUTB 3F7YB 4TOYL 5IM7B 5EUOF 3EFFA 2NY0D 3MRNA 1EV2E 1JGDA 5IMLA 2GITA 1FVDB 5CMAB 2EZ0C 3AVEA 4GAGH 5CIPB 3KLHC 3EOYG 1F3JB 3MUZ1 2YS4A 4GKNB 1CICD 4ZFZA 1T83C 2XKNB 3ILPB 3FONA 3WFCH 1LE5A 2UV3A 1YEEH 3OKDA 2VZ1A 1I7UA 1W8OA 3SY0B 4MGXA 4C56A 1LNUA 5AD0A 3FFCD 5C0CD 1L7TL 2PR4L 4MQ7A 5IW1B 3NTCL 2NY6C 1DFBL 1JPSH 1UT9A 4CKVX 3WFHA 4UZGA 3OJ2C 1R3IL 3QUZB 2DLTA 4WW1B 5GIRB 5JORB 1E6JH 2BVUA 3TO4B 3QIUC 2HJFB 2BFVH 2Q87A 3VD5A 4ZPVA 2J5LC 1ADQA 2GJ6A 3HI6H 3VG9B 3TBTB 3KYNA 4XP5H 4NFCA 3UTSA 4N8CL 2EYTB 4GRMA 2FH8A 1P5UA 5D71H 3P4LA 4PJGF 4Z7OF 5BO1H 2F54D 5GZOC 5EOQH 3ALXA 25C8L 1MCWW 3ARED 1JNJA 5E8EB 1NFIA 2VLRD 2IALA 1NCDH 5JDSA 4GXUM 4HS8H 2P7TA 4PG2C 2VZVA 2V2TB 3B2UC 4OD3L 4OM0L 3VFNB 2AJZB 4XAWH 1RVFL 4L5FH 1TLKA 4XVJH 5DYOA 5D6DC 4DCQA 1HKFA 2R2HA 4RMVA 5HHOB 1WIOA 1SJEA 3MCLH 1U2HA 2MQ0A 1LO0H 3A67H 1CVSC 2LU7A 4OF6A 3TN0C 3IFLL 2OP4L 4Y1AB 3IYLW 4RMTA 3BWAA 2DTML 4OI9A 1D7FA 1U8HA 2JJSA 1CFNB 4G43B 3ZYZA 3V4VH 2ZUXA 1JPGA 3L7FA 4NQEA 2J7LA 1A4JB 4K94C 4JG1H 7FABH 4LCCB 1ROWA 2R2EB 1G7LA 3V6FA 2UZIH 5IG7A 1G84A 1KCLA 4BH7A 1WTLA 4LSVH 5LCVH 2P5WA 4FA8A 4RWYH 1RZIB 2N4IA 4R2GD 1CQKA 2VSDA 1S9XB 3S96A 3QB7C 3QZWA 4JPVH 1BJ8A 2WP3T 4XPHL 1E4KC 4HKBA 4LKXB 3O45B 4WHYH 1BOGA 5FYKE 1F3DH 1O5DT 2AKRA 3PL6A 2H6PB 4P2QA 1KCSL 1N8ZA 2EDLA 2R23B 1D9KA 3NA4A 1JGLL 3ZKND 4Y4KA 5KVEL 1BX2B 2ZUTA 3F7PC 3WIFA 4Z7UF 4Y16B 3OF6D 1RUMH 4UT9H 4YDVB 2SEBA 4NKDB 4Y19B 3FB5B 2R9HC 4KDVA 5C92A 3DECA 1VHPA 1U91B 3U6RB 2CKBA 1WUNT 3AY4C 5E5RB 4M6OH 3M8OL 5F89B 4OIIH 3MRDB 4HWEH 3TFKC 4X6BA 3BGFC 3KPRA 2VDRH 3LQZA 2OQJB 4I3GA 3FTGB 4PP2B 4R4ND 4X83A 3T4YA 5CKAA 1QRNB 5ITBL 4YHNB 4KHTL 4WV1A 4IOIB 3MGOA 4FZ8H 3RIFF 2OJEA 2DDQH 4JZOA 3P0YL 3TVMD 3EOTL 4GH7B 5B39A 4X6CB 4NZUH 1J1XH 3R06A 4NM4H 4W4OC 1LO5B 4R96B 4YDIL 2HWZH 5FOJA 5TGBB 5LWYL 2MKWA 3S5LB 1PFCA 2J6EL 4HWZB 3KYKH 3I2CH 5JW3H 3BGMA 4IBLT 5CEXB 1J05B 3T8XA 2IBBA 3T0XA 4BFIB 2G9HA 1JYVA 2O5YH 1D6VH 4K7PY 5IR1A 3RVWC 4I0PD 4YJZL 3V95A 5A43C 3CMOH 1XCTB 3ARBC 1VFBB 4PJBE 4ZAKD 2ID5A 4OCWH 4QF1A 3STBA 2B2XH 4G6JH 4YBLB 2B1AL 5HHNA 1VFMA 4PJ8A 5HHMB 3OKOB 1SEQH 3VFTA 3ULUL 3MA7B 4L4VD 2BNQE 2MQ3A 1FFPA 4JFPA 2LFGA 1QPPA 4N1HB 1KCVL 1KBGH 4PG9B 3OKNA 3HI1B 1ZMYA 2AEPH 4F9PC 4NQXA 1L9MA 5F6IB 1DBJH 5EUOA 3O3UN 3TF7C 3BSZL 4LIQL 5IFHL 3BH9B 4APQD 4NC1E 3LMJL 2X4UB 4H0IA 2R4SH 2RQ8A 1ORQB 4C4KO 3VFPA 3F7YA 5C0FB 4KK9D 1MFBH 3HMXL 1S5IL 4I77H 4UQ2B 5I1CH 3G5XB 3S98A 4PY8J 4GKNA 5E2UH 3ILPA 2XQBL 5J3HC 3W9DA 4UT6L 2EC9U 3GDBA 2NX5E 5AYQA 3SY0A 3TNNA 1RUAL 2HA1A 2OTUA 4HKJB 5IW1A 1JNLL 4PJGA 5D1ZC 4PJ5D 2J8UB 5INDB 4NWTL 3H7LA 4WDIA 4WW1A 5JORA 5JHLH 3LKOB 3P4MA 4NRZA 3UJJH 2EYTA 4AEIL 2VXUL 2J8UF 1NSNL 3FO1A 4M93C 2C3WA 3ARDD 4AIZA 1BD2B 2BNRB 1MCFA 3UTTE 5E8EA 2R39A 1DE4B 3DTXB 5EFIA 5F1SA 3RNQA 1VPOH 1PKQB 1A7BA 3S34L 5HPMB 1BVKB 1VFAB 4G9FD 2HT2D 2BY3A 4Z78B 1WVZA 2IAMD 3NMEA 5DJ0B 1JRHL 4UV7L 4RGOH 3VFNA 4NKIH 4DVBA 3MLWH 1KACB 1E4XL 3VH8G 3O6FC 4XNYH 1V5JA 1AH1A 5KANI 3T08A 1RY7B 4OFKA 3VRLE 5CLWA 4JFHE 3NN8A 3SE3C 1X5AA 1S8DB 5C8JA 2NW3B 4Y1AA 3MROB 4HFUL 3VFUB 3SE4C 1CFNA 4HFWA 5E6IC 4GSDH 4HWBH 4N9GB 2P45B 4M6AA 1A4JA 1ZHBB 4JQXA 1KN4H 3BE1H 3U2SB 2EDBA 4HD9A 1CGSL 4OFPA 5B8CA 2W1NA 4JN2B 4P2OB 4PLJC 3K2UH 4QRUA 4UAOC 1EO7A 2XKSA 5C08E 4M1DL 4F80A 5GGVY 1YQVL 3DBXA 3O4OC 2AK1H 4LKXA 2FBJH 4HS3B 3RRQA 1NGXB 2H6PA 4XWGL 2R23A 4OLEA 2ICCA 5CP3A 4TNVF 1BX2A 1LGVA 2AQ3A 1QSED 2ZG1A 3BN9D 1P4BH 4CW1B 4Y16A 2F5BL 4DJMA 4YDVA 3P4NB 1JYXA 2YUVA 4NKDA 5J13C 1U6AL 2PXYB 3FB5A 3W11C 3ZE2E 5GISL 4WTXA 4RGND 1CZ8H 4OLZH 2Y06H 5K9KB 1YJDC 5IFAL 2JELH 4H5SA 4K3DL 3K2MC 1BAFL 2AEWA 2OL3L 4KTEL 2ZP0T 4P5KB 5F89A 5FEBA 5H94B 3MRDA 4NN7C 3K4AA 1J0HA 2DQDL 4DKFH 3L5XH 4PGCB 1FZJB 4ZTOH 3T0EB 5D70H 5HSFA 2FX9H 1QRNA 1AGEB 2DQCH 2VB5A 2LE9A 2H2SC 3K7UA 3OG4B 4F15C 1IAIL 3MXWH 1N4XH 1VGEL 1WISA 1AD9B 1I9JL 1OAKH 2O5XL 4P4KD 1YYMH 2ZUUA 3IDMB 2C26A 4X6CA 12E8H 1T0PB 1RZKC 4KI5F 5KVDH 1LO5A 2X1QA 1WC7A 4WHCA 3DSNA 5IWLA 1J5OH 2JJTC 3NIDF 4FQQA 1NAMA 3MMEB 5EU4B 4LLDB 3S5LA 4YXHH 2R9HD 4HWZA 3R1GL 3CJJA 1QBBA 4U1GC 1GRWA 5CEXA 1BGXL 1J05A 4K3HA 1YECL 2MTPA 4E41E 3O4LD 4BFIA 4M6MH 5DJAA 3EJYC 4O2FB 3QJHB 3QNZA 5DT1L 3IXAB 1XCTA 4Y5XC 1N6QL 4ZNEE 2WINB 3GMLB 3WIIH 5ACLA 4BQ6A 4GW5B 3SCMA 3OKOA 2DL9A 3X17A 3MA7A 3IB4A 4TSCH 3NA9L 4JFEB 3LKPB 4MS8C 4LPXA 4PY7B 5ERWB 2G2RA 4DWHA 4DAGL 4GRLD 1FNAA 5EOTB 4PG9A 5KTEH 3ULVF 3VMNA 1Q72L 3IFOB 2B4CC 5TFSL 2J4WH 4HIXH 3VDCA 4OZHE 3KS0H 3KWWB 4NN5C 4PJ7E 5DTFA 1A1OB 5FFLA 4FTVD 5EBWB 2EE3A 4MJ6B 2EDXA 4P2YA 3GIZH 2X4UA 1FGNL 4AT6B 2FX8H 1ORQA 4HPOH 1AKJB 2X4PB 1PX4A 4L3EE 1WCBB 4OD2B 5C0FA 4X9BA 3U4AA 3RVXC 5IHBA 2F5AL 1D5XB 4UQ2A 5AWNH 5BV7H 2BVPB 4S1QH 2CLVB 1MWAH 1OGAD 4TOYH 1VENA 4F9LC 4JO3L 4YHPB 1EVUA 2Y25A 4WI9A 1ZT7B 1N7ML 1KCUL 3DO3A 4BH8B 4CDGC 3SDDC 4OSUL 1URLA 3GHEH 5L6YL 2J8UA 3REWB 3G04B 5INDA 3RGVD 2NR6C 3TJEL 1B6DA 4ZO8A 4HXBH 2W9DL 1L7TH 2PR4H 5JIIA 3NTCH 4PRIB 3LKOA 1DFBH 5I75C 1KB9K 5KSBF 4CBPA 2RJMA 1R3IH 3EGSB 5BOZG 1RJZB 5JQ6L 1BD2A 1A7QH 2BNRA 1DE4A 4N8CH 1YN7B 5TDNB 3VU2A 5HPMA 1BVKA 5C0CE 4XXCC 1VFAA 4ZXBB 4Z78A 5HTSA 3JTSB 3EHBC 4ZODA 25C8H 5DMJB 2NZIA 1TPXC 2CIKB 3MV7E 3UROR 3KPOB 4YO0B 5DRZB 2CJUL 1IM3B 1MH5A 2CUMA 5F88B 3CVHL 4OD3H 4OM0H 1NBZB 5T1LB 2DI7A 1BIHA 4WFHD 5E2WH 4IRJA 1A22B 1T04A 1RVFH 1XMWA 1S7XB 5I1EL 2NW3A 1TJHL 2E6QA 3MROA 3QO1B 1K4DB 1WT5A 3LKRB 4LMQI 3QXVA 1YMMD 2VLRE 1AQDA 5I1KL 1NDGB 4YHOL 3RHWF 2GT9B 2VNCA 1WZ1L 3IFLH 2OP4H 1K9TA 5DD5L 2DTMH 4XMPL 3VRJB 1CXKA 4YXKL 4MCYB 1YDPB 4JN2A 3GIVB 4P2OA 4UTAH 1AO7D 3QEQB 5KW9L 4OZIF 4PGEB 5F8QC 2IMMA 1I7ZB 5E94B 2ZUQB 3ZSTA 3DX6A 3QIBC 1KSRA 2PCPB 2Y5TA 2ICEA 2DLGA 3A6BL 4NRYB 4HS3A 3ARXA 3S36X 1NGXA 2ESVD 4G6FD 2NY2D 5T5NG 2NXYD 3DX7A 1G9NC 4XPHH 3LAFA 2VDLL 1Z0MA 4W81A 4CW1A 4Q6IC 3N50A 3P4NA 1MIML 1KCSH 3GEWB 4GKSA 1QBLH 1TTGA 5J11C 1JGLH 5D7JD 3SJVA 1X5GA 5K9KA 4QOKD 4G8FA 4WI2A 3GSNA 4MAYA 5D2NC 5DJXB 1I3GL 4P5KA 3RY6A 3WE6A 4WWKB 1JZ2A 4Z7WB 3L9RB 4KV5F 1KTDB 1XF1A 2F53D 4PGCA 3MLYL 4OZGB 8FABB 2DJUA 4JRXD 3T0EA 3M8OH 1KJ3L 5IUSA 1RULL 5ADPL 1AGEA 5IQ9A 3CK0L 2V2WA 3UBXG 3ZE1E 2VUOA 3MJ9L 4AQ1B 5I1AB 2XWJA 4I2XB 1BZ7B 3VI4E 4KY1L 1MCOL 1VEPA 1AD9A 2AQ1A 1I4FA 5ITBH 3VXPB 5DO2C 4KHTH 1Z9OA 4HKZB 1UCBL 1FORL 5DEFA 5IB3A 5DHYB 4OQTA 5D1QB 1NJ9A 3P0YH 4M62L 3EOTH 2HMID 4HUUB 3MMEA 5KBNC 3BAEL 3D0VB 5DHVB 4RISL 2QSTA 5GPRA 3DNKA 4YDIH 2VABB 5IJVB 3LEXB 1XR8B 4OGAC 5F44A 3GHBL 2J6EH 1PBYA 2MFNA 4MVBC 4OZFB 3QJHA 2DM7A 3HC4L 4NBXB 5FM8A 4JPWL 1QO3A 3VWKB 3GMLA 4ZG1A 1SJHA 4ZS7H 1M7DA 1ZLSL 4GW5A 1HZHH 1OSPL 4KJPD 3QRFM 3VE0B 1KGCE 1UWEL 4GW1B 4EJ1C 1KTRL 5A1AA 4PY7A 2H2SD 4XRCB 1QFUL 3OKKA 3KXFE 5ERWA 3QUKB 2B1AH 2C3VB 2FATL 3CXHK 2P8LA 3OR6B 5EOTA 3ULUH 4XB8A 5IOPB 2DICA 2VLMD 2QSQA 3BO8B 4KVCL 5JXAH 4WWID 2WIIB 3BN3B 4RGMB 4WJ5A 1RZGA 2C3XA 3KWWA 5F7EL 1DBML 5I74C 4K7PL 1KCVH 1A1OA 4U1HB 1XF2A 1GJIA 4D9LL 4MJ6A 5F7HA 3WSQL 2BY1A 5J57B 4HMEA 1S9YA 4B53A 1HHGB 2QR0A 1NGYA 1AKJA 2X4PA 1BJMA 2KKQA 3RVVD 5I71B 4MX7A 3BSZH 4LIQH 3BD4A 3LZFL 4FFZL 3QI9C 3LMJH 1V05A 1JJUA 4BUGA 2CLVA 1QG3A 3LOWA 3WO3B 1JGVL 2X7LB 3SDAC 5E1HB 1JGEB 3VI3E 5J89A 1WEJL 2V5SA 4YHPA 1S5IH 4R0LA 3C5ZB 3FHAA 4BH8A 5IMMB 1W72L 3B9KB 4OF0A 2MJWA 5KSBA 1KEGL 5EIVA 5I1HL 3K1KC 1YY8B 2XQBH 1CFVL 1CGWA 4PRHB 4UT6H 2FWOB 3REWA 2NPLX 4R3SB 5EZLA 4NC2B 3JVGA 5EA0L 4XBEH 2CDFB 4DK6A 1RUAH 2BC4B 4C55A 4CMMB 3SDCC 5K93A 1JNLH 1Z9LA 4Q9RL 1XF5A 3HE7B 4NWTH 5FKAB 2XOTA 3FQTA 3EGSA 4DN4H 3QHFL 5SWSD 5IT2H 3ALWA 3QIWD 3O3AA 3ES6B 1WAAE 1BM3L 4JHZA 3G5VB 2WUBL 1TNMA 1N0XL 4AEIH 2VXUH 3DUHA 1NSNH 4FFWD 5BS0D 5E9DB 4PJ5E 4GG8B 1IGYA 1IGML 3S34H 1GYAA 4R9HA 4EIGB 1FZMB 5DRZA 1JHTA 5FV1L 4OCMC 1BVLB 5IP4A 1JRHH 5F88A 2DAVA 3LH2L 4UV7H 4C54A 5T1LA 3GMRB 1E27B 5ID0A 3MLRH 1E4XH 1S7XA 4I13B 2I9TB 2JCCB 4PR5B 15C8L 2CK2A 4M8VA 2ICES 3WFEL 3SBWC 4YC2C 3P0GB 1NC2A 1CXLA 4IEFB 1T89C 5EN2B 3DUSB 2XXMB 2AJXL 3MRGB 4HFUH 4UDUA 3VRJA 3SGDH 4MCYA 4A6YA 3LRHA 3E8UL 3QEQA 3V4UL 3ZDZE 4PGEA 4YBHA 4MNHB 2YWYA 4PY8I 1KYOK 1SY6L 2VE6B 4FMFA 1CGSH 1W0VB 4PD4J 4ENEC 1P2CA 3AAZB 3VFVA 4NRYA 4XHJD 3EHBD 5IHUL 1UENA 1B0RB 4WENB 4M1DH 3KPLB 5HVGB 3VWJC 1YQVH 1MIEL 1Q94A 4HAGA 4WI3A 1QSZA 4UOW1 5DWUL 4MJIB 2X9XA 4XWGH 5E8PB 5BVJA 5E4EC 3VFMB 3K8KA 5J4MA 1AC6A 1J0IA 2V9QA 1N5YL 1T1WB 3VXRB 2F5BH 1F4YL 4G6AD 1HH6B 3NIGF 3S9DB 1B4RA 1ZGLM 4PJBB 4U6YB 5DJXA 5GISH 5GGVL 4ZMAT 3CX2A 4WWKA 4X5WB 1P4IL 3WXWL 3L9RA 1H3WM 3B6SB 2BNQB 1KTDA 1NANH 5IFAH 4K3DH 4FQXA 3MPCA 1BAFH 4JPKL 2OL3H 3DV4B 1MJUL 4OZGA 4KTEH 4HZAA 4HMDA 3JWDL 1HHKB 5DR5L 5FGSA 5F7LB 3U48A 1UEYA 1I9IL 2DQDH 3V0VB 1XFPA 4ZPTA 5I1AA 2AQ2A 1J7VR 2ZNWA 4ODXB 2HVJB 4I2XA 3PG2A 2J8HA 1JF6A 2JJSC 1PG7L 4M3JA 5MEPB 4BQ9A 3VXPA 1HIML 4BQBA 4HKZA 1MFEL 1AP2B 4IMLB 4BFGA 3JTTA 1J18A 4P3DB 3TT3L 5DHYA 1IAIH 3ETBF 3SE9L 4OCXH 3MRKB 5D1QA 3BUTA 1VGEH 2O5XH 1I9JH 1T03L 4HUUA 5I18L 2VTFA 4PRAB 1HE7A 4OUUB 3D0VA 5DHVA 1KV3A 4LHUB 3TWCL 3P2TA 2VABA 3EFDL 2R1YA 4MZ2A 1MCWM 2FHFA 1XR8A 5JO5B 3T3ME 1K85A 3HRPA 3MBEA 3RGHA 3RWEA 3PL6C 4OZFA 3R1GH 5D7IE 2C3GA 1D9KC 3VWKA 5BJTA 1BGXH 3QQ3A 1YC8A 3OGOE 3FQRB 5TF0A 1MRDL 4ZNCD 5DT1H 3ILQD 1NFDE 3F6IA 3VE0A 3L5WA 1N6QH 4IRSD 1CLOL 4XRCA 5CJBA 3ZYOA 4CL7A 4ORGB 2C3VA 3RDTA 4J4PA 1Z6JT 3OR6A 5IOPA 1YPZE 3BO8A 3NA9H 1G7QB 3CC5B 3BHBB 5MEOB 4XWOC 2WIIA 4M5ZL 3WLBA 1ZWIB 2MHAB 5BQ7A 1BFOB 5FUZL 5D6CB 3BXNB 4U1HA 4EDWL 5HY9A 3UTTB 1F6AB 2FGZA 1Q72H 2DRUA 1OM3L 4M7JL 5GHWL 2X4OA 4L9LB 3STZB 4U6XB 2GK0B 1HHGA 5C0JB 1IEAB 4WV1C 2G60L 4V1DE 1I7TA 4EI5B 1HK6A 5D2LE 1HXMB 1FGNH 4FQHB 4RMSA 2ENSA 5DJCA 5D1XB 1UC6A 2X7LA 2BRQA 1BWWA 5ALBH 1JGEA 1MCPL 4GRWE 4JY4B 5C0BD 3DI3B 1EEYB 2F5AH 3WNOA 5JOEA 3C5ZA 3S37L 4FTVE 5IMMA 3H9SE 2XNAB 3LV3B 3N85L 3W39B 1UXSA 3UBXB 1OCWL 1KLUB 4W70A 3RZCA 3GI9L 4QYOB 1YY8A 5F97E 1H3GA 1XIWD 4JO3H 2FWOA 3U79A 1A6UL 1U93B 3ARVA 4R3SA 5JIKA 1N7MH 1KCUH 4X98B 2IFGA 3GB7A 4QHUB 2BC4A 4OSUH 4CMMA 3WDJA 3HI5L 3S35X 1RK1B 4RMRA 4G42A 1HNFA 5L6YH 5L0QC 1KLGA 3U1SL 5IF0B 1WZKA 5FKAA 3TJEH 2ZKHL 3NFPB 4PJ8C 2W9DH 4OGXL 1CQYA 1T4KA 3ES6A 1Q9KA 1BBDL 1ZHNB 4XC1L 1AGDA 5C09E 5FUOL 2FSEA 3G5VA 1AGCB 5D7LD 3MQIA 4Y5YA 5IV2B 5JQ6H 3WEXB 3NPSB 3T65B 1A7PL 1L9NA 4GG8A 3W5MA 3I6KA 3ET9F 5JDJA 2GFBB 2EDDA 4TTGA 3TCLA 1HSAB 1FZMA 5JW5B 3U46B 4KKBD 3ZHLA 1HILB 3EOAB 2NY3B 4KUZH 3CFBB 4N8PA 3GMRA 4LSSL 4OZ4B 3VA6A 1P9MA 5H37H 4PR5A 5DMKB 3JUYA 4I1NB 5E1AA 2CJUH 1O0VA 4NDMB 1SBSL 2D31A 4EUPG 3CVHH 2EH7L 3HA0A 2FRGP 4HLJA 3T77B 3KPMB 3PUCA 2WWMC 3SN6N 2D7TL 3WXVL 5EBMA 5EN2A 5I1EH 2QHLA 3RVTC 3HTLX 1QVOB 1TJHH 3DUSA 4PP1D 1C16B 3MRGA 1R0AH 2Z91B 5GS0C 1FE8L 5C86A 5I1KH 2KBGA 2OR9H 1U3HB 2C1OB 4YHOH 4O2CB 4PS4L 2OTPA 1WZ1H 2WBJD 2XFXB 3MA9H 4NNXB 2BHUA 2VE6A 5DD5H 4U1NA 4XMPH 1W0VA 5E0QA 4YXKH 5HYJD 2B39A 1MRCL 2H41A 5KW9H 1B90A 3D39D 2NXZC 4MNQB 1B0RA 3RX8A 3U7YL 1YMME 4QHMB 3QR2A 1HN1A 1JRHI 3F7RA 1LO4L 3AB0C 3A6BH 4XT1C 1ONQB 1E4XI 1BEYL 3BKYL 4I18B 1DR9A 1R3LB 1WZLA 1FDLL 1P7KB 4PUBL 4AEHL 5D8JL 2DF3A 4O5LL 3TC9A 1DL7L 4E41B 1EH9A 1NDMB 4PJ9B 2FD6L 1FYTD 2VDLH 5GGSB 1T1WA 5TDPA 2K7PA 1HH6A 5KG9B 2F9BT 1MIMH 1D5ZB 2GI7A 4PJBA 3PGFL 4U6YA 4GW4B 4G7VL 3LDBB 3SGDI 2VXVL 3K1DA 1F02I 3C60C 2YXFA 4X5WA 4I3SL 3T0VA 3L3HB 3IRZA 1KB9J 2BNQA 4M9PA 1H15B 2JJWA 4U2YA 1I3GH 5T1KD 2ICWJ 1GC1H 3G6AB 3QWRA 4P5TB 3V0VA 4RBPK 3MLYH 5CS7A 1KJ3H 4OZHB 4OLXL 2EDKA 1RULH 1N3NB 1I8KB 3K81A 3VG0L 4PJ7B 3RTQB 5ADPH 3WNLA 3CK0H 2RCSL 4JQXC 4IMLA 3VWJD 3MJ9H 1DQTA 5B8CC 4OFYD 4KY1H 1MCOH 4P46B 1RI8A 1LEIA 1MCIA 2F53E 1FBIL 1J1PL 4ODTL 4OTXL 1EXUB 4L3EB 5F9WC 1UCBH 2WWKO 1CDYA 4LHUA 2A9NL 4N1EA 4X4YB 4M62H 2DMBA 5JO5A 4NQUA 2R2CA 4C57C 2AAVA 2Y9RT 1NANI 3BAEH 3NOIA 5TE4L 3KPSD 4RISH 2D7MA 3IFNH 4KKLC 5J56B 3MREB 1CLYL 2NX5A 3R8QA 4K23L 4DN3L 3FQRA 3GHBH 1LK3L 1G7JB 4PTTA 3EKCA 1C7TA 3HC4H 1GGIH 2D03L 4BSWA 3N9GL 3SO3C 4Z0XA 3MJGX 1RZJL 4D9RD 5IQ7L 3HS0A 1U8QA 2IH3B 1OSPH 5GGTA 5GSRA 4TSBH 1IAII 5IW6A 1G7QA 1UWEH 1H3UA 3VJ6B 4NKQB 1QFUH 3UPAA 1ZWIA 2MHAA 1GZPB 1BFOA 1AC0A 5D6CA 3UTTA 4W6XB 2XZCL 4KVCH 5C0CB 2QTEA 4L9LA 3STZA 5F7EH 2GK0A 4MNGE 1DBMH 1BECA 4MDIB 5C0JA 5SWQB 1IEAA 3DXAE 4XCNA 1EUUA 4D9LH 3FZUD 4Z7QF 3MRLA 3MV7B 5J7CC 3CFKB 4EI5A 3WSQH 4FQHA 1QSVA 1OP5K 2EYRB 3ZKQD 3LZFH 4OF7A 4LGRB 5D72H 2XNAA 3W39A 2VLRB 1FIGL 1JGVH 2IC2A 5HHPB 2BY0A 4YEFA 3ARTA 4L8SC 4QYOA 1WEJH 4S0TD 5CCKL 3HCVB 5CGYD 1K8IB 3MTRA 2VDKL 4NNPL 5IVNA 3BKJL 1W72H 4QHUA 2OJZL 5I1HH 1VA9A 5EU3B 4IJ3B 3QCVL 3AFLA 1RK1A 2H32B 5C08A 1FJ1A 5IF0A 2R15A 4KAQL 5EA0H 4ELME 3SCMC 1W0WB 1JHLL 3I3EA 3WFBL 1U8JA 3GSVB 5HI4C 1ZHNA 4Q9RH 1WITA 3HNVL 5F7KC 1X5HA 3V2AR 3VFRB 3BP5B 3QHFH 5IV2A 1C5DA 2X4RB 2O5ZL 5F6IC 4LCWA 4AH2B 4R4FL 4HGWB 1BM3H 3ZL4L 1UZ6E 2YPLD 3EO1B 2PYED 2GFBA 2WUBH 3PHSA 3QUXC 4X8XA 1N0XH 4O2EB 1KPVA 5FECB 1T5XB 2J1KA 5JW5A 5DMYA 4JCMA 2V17L 2Y72A 3EOAA 4ETYA 3CFBA 1B6UA 1IGMH 5DVNA 5F7UA 4L3CB 5EO9A 1G6VK 2I60L 4NDMA 3LKQB 5DHXB 2IAND 3LH2H 3T77A 1G6RB 2YWZA 5B3JE 5IMKB 2DN7A 1IEHA 2HT3D 3DHMA 1PG7W 4BQ8A 5BS0E 15C8H 1C16A 3WFEH 1X5FA 3B2VL 4K2UL 5BOPA 2C1OA 3TZVA 2DJ4A 3D25B 2UZYB 2XFXA 3EDDA 4NNXA 1KT2B 5I17A 2AJXH 3DMMD 1JMZA 4KVNL 4LPWA 3B5HA 3E8UH 3V4UH 4JFXB 2YHGA 2O26U 1FVCB 1IGJB 3DYOA 3BZ4B 4N1CA 1SY6H 4MCZA 3P11L 4QHMA 4L29B 1AGFB 3MV9D 5FF6B 4XMKL 5MHSE 4JDTH 1F5WA 5JR1H 1G7MB 1ONQA 1BJ1J 5IHUH 4I18A 1C5BH 2XICA 1R3LA 2XTLA 4NNYB 1GXEA 1BFSA 3PWPA 4E41A 2GSGB 4WHDA 1NDMA 4CJ1A 1MIEH 5GGSA 1B0WA 2DYPD 3ZTJH 5EH1A 3VXUA 4JRYE 5DWUH 5KG9A 3TVMB 5DQ9B 4GG6E 4JHAL 1D5ZA 3SKUD 2BDNH 4MXQC 3QDAA 4NKOA 4ZNEA 4FABL 1LE9B 5E2TH 4HUXA 4Q58C 1N5YH 3L3HA 3GMMB 3ESUF 4K3EL 5GZNC 1F4YH 4M61B 4JM2B 1H15A 3FJTA 5KVFL 3KXFB 3G6AA 5GGVH 1F8TL 1P4IH 3DHJA 4IRJC 2H8PB 5E2VH 3JWOC 4PFEA 4EXPX 1MJUH 3MLVL 3WN5B 3MODL 1IKFH 4OZHA 2AV7A 4LRIA 1N3NA 1IC4L 5DR5H 4PJ7A 1FO0B 1I9IH 1Y6MR 5E00B 1D5IL 2E9IA 2DM4A 4HULB 4Y2DC 3L3KA 5FK9B 1NL0L 1NC4B 4JAMB 4P46A 1PG7H 5K9OA 1Z9SA 1HIMH 1EXUA 1MFEH 5HDBE 2X4SA 3TT3H 4UT7L 5EG6C 4U1SB 1X3DA 4KRPC 4FQLL 3SE9H 4EUPB 4TUJB 3U4BL 2ILLA 3FT2B 1T03H 1RIHL 5I18H 1LP9F 5GGQL 5K9QI 4J6RL 1CE6A 1TZGL 4HT1L 1Z5LA 5GJSL 4MA8L 2XTJD 3TWCH 3EFDH 5MP6L 2VQUA 4ETQB 4ZFOL 1I3RB 5GS3A 3HZYB 1SEBB 4U3CA 3ULUD 4J3OC 3SEPA 2X4QB 3TIEB 1KYOJ 5I19H 4MMZC 4P2CG 4PV8A 2D0FA 1NQBA 2IH3A 3U9UB 1KPUB 4N8VG 1MRDH 4Y4FD 1S78D 4UBDC 4WFED 4MAYC 1TENA 3RKPA 4IOFD 1A2YA 5D2NE 2OZ4L 1GZPA 3HMWL 4QXTB 3OGCB 4M9OA 4WFGE 1VADB 5JW4M 2H26B 3M17A 3QHTC 4KI5C 5C0CA 4M5ZH 1M6OB 2PTVA 5HGAB 4Y5VB 5IB5B 5SWQA 5FUZH 4PJ5B 1GGUA 4OF5A 3O8XC 5TPWL 4EDWH 4LCUB 4NO5B 4X6DE 1OM3H 4M7JH 5GHWH 5HI3D 3MV7A 1BIIB 2Q6WB 3E2HB 2DQIL 4TPRL 3GMNB 2NQCA 4YGVB 1WIPA 1U8LA 1XGYL 2G60H 3ZSSA 4EN3B 2DQJL 3MCKA 2EYRA 1A1MB 1T3FA 2APXA 3T3PF 2EC8A 2NTFB 5ADOL 3W82A 1FSKC 2VLRA 3FB8A 5HHPA 3U0TB 1IARB 1MCPH 2F58L 3Q48A 1S5HA 4KKAD 4QWWC 5T33L 1JN6B 5T1MA 5J6GB 3S37H 1RUPL 1REIA 3N85H 3OAYK 4K71C 3MLUL 1OCWH 2EEDA 3OX8B 1JZ6A 2X05A 1R5VA 3KPNB 4NQCD 4K3GA 3ULVC 1A6UH 3D2UD 3NH7L 5I76B 3PNWB 3QG6B 2HJKB 4D0DB 4X99A 1H3PL 1W0WA 4ZTPL 1A6AA 3HI5H 1JGUL 2NY6B 3I50L 4TUOA 1F4WL 2DM3A 3U1SH 4QO1A 1MJ8L 3ZDZF 3LQAL 5JOFB 4LMQE 3VFRA 4LSDA 2HT4D 1BQHA 2X4RA 3QIUB 4OGXH 3MV8D 3HG1D 4AH2A 4QRQB 1BBDH 2C7UA 1NKOA 2J5LB 3CCHB 4OAWB 4Y4HD 5FUOH 2FJGA 3LSOB 1JI1A 4O2EA 5FECA 4BM7A 3NAAL 4XAKD 1A7PH 3QHZL 4F7PB 1EGJL 4XH2B 1T1ZB 5F3BA 5EUKB 2Z4QA 4QNPE 4KQ3L 4HZLB 3W0WD 4B7IA 1KC5L 3CAFA 1UWGL 2AJ3B 1QNZL 3FRPA 4F37K 1FQ9C 4LSSH 1G6RA 4YFLF 2PN5A 2VMFA 3DX9B 3MFGB 5F6HJ 2R0ZL 3ZKXC 3WUWB 3MV11 5IBTL 1B2WH 5B21A 4JDVB 1SBSH 3K0WA 3MRBB 3OF6A 1FV1A 2EH7H 4AZ8A 3O6ML 2AERT 5HPOA 2D7TH 4R0LC 3WXVH 5HYIA 3TH2T 5FO8B 4MZ3A 2R1WB 3HAEA 3TN0B 4NP4L 1FE8H 5DJDB 3O9WD 1A4KB 1WJ3A 4PS4H 4UNTA 2VITB 1IGJA 2YOCA 3JVGC 3TESA 3VFWA 3KYOA 1YY9D 1AGFA 3QBTB 5FF6A 1MRCH 3RP1A 2IADB 3NFSL 1Q38A 1RMFL 4J8RB 1G7MA 3RIAK 4F57L 3U7YH 1FNEA 4V2BA 4NNYA 1I1AD 4A2MA 4WIQA 4BFBD 4BUHA 1LO4H 5IHLB 1RIVH 5E99L 3GGWA 2A6JB 2XWTB 1BEYH 3BKYH 5D7IB 3TVMA 5DQ9A 3QA3A 1FDLH 4PUBH 4MHHG 4OCRL 5D8JH 4AEHH 4O5LH 1DL7H 1IQWL 1MNUL 5DS8A 2FD6H 3RWCB 3ARGD 2DIAA 5DFVC 3GMMA 3HHRB 3FMGL 3ZDYE 4Y0GA 4M61A 4JM2A 3PGFH 2PW1B 4G7VH 2VXVH 1FLRL 2FEDC 1XCQB 4I3SH 3DROA 5CUSL 5DK3A 2XG4A 3IRPX 4Q6YA 5SV3A 3WN5A 3UZQA 1KB5B 2ED8A 1NFDF 5I8CB 4GUPA 1BJ1H 3VGFA 3OSKA 2A83B 5J1AB 2GJJA 4JFZL 5L9DL 1LP9A 4AY0A 4JDZB 1DQQA 2H3NB 2DWDB 1YPZF 4JAMA 3VG0H 4L4VA 4NO2B 5K59E 1CFSB 4GKZB 4V1DB 2RCSH 5HDQL 3RNKB 4FZEL 5CIPH 4ZFFA 1RPQA 4U1SA 1RZFL 3L3JB 5D2LB 2ZG2A 3FT2A 3LN9A 4JHWL 4N90E 2Z31D 1T7YA 1DLFL 1FBIH 1J1PH 4PREA 4ODTH 4OTXH 4QCIA 4WW2F 5JOPD 1OAUH 4WEBL 4GRWB 2A9NH 3WS6A 1I8IA 3RQ3A 4Y88A 2FB4L 2CGRH 2KPNA 4HC1L 4ETQA 3OAUL 2A6KB 3H9SB 1I3RA 35C8L 3HZYA 1SEBA 1CDCA 2GJ6E 5TE4H 4APQA 1RUQL 4NC0B 3NABL 2OTWB 4GFTB 3M1BA 3TIEA 4JCLA 2WBWB 4LFHG 4ZD3L 1CLYH 3JV6A 4GRWF 1WWAX 2N7AA 1EJ6A 4DN3H 1X6NA 1KPUA 1KNOA 1T0MB 3GSOA 1NGQL 1AXSB 1FYHB 2D03H 4UNUA 5EU7C 3LRSA 3N9GH 2EXWC 3ARBB 4WWKC 1RZJH 5IQ7H 1DBBL 1FVEA 1AFVL 4X4ME 3KPSE 1FH5L 4MD0B 4WVRA 3FQNA 4H8WC 4FQXC 2X4NB 1VADA 1PAMA 5DFWH 2H26A 2ZPKL 5JHDE 3X12B 1HHJB 2NYYC 5C09B 1C12A 4CNIB 2W0FB 3HE6D 4UV4L 5L7XL 1M6OA 5HGAA 4PJAF 4U1LB 3UAJC 5IB5A 2JE8A 4PJ5A 3UTOA 4LCUA 3E1F1 2ICWI 4NO5A 2XZCH 4HIHA 2YSSB 1BIIA 4F2MB 4AK1A 2YZ8A 3VFSB 5F9JB 4B41A 3CMGA 5T5FL 3DGCR 4PYHA 5CEYA 1J8HD 3Q1SL 4RNRA 3ZTNL 4TRPH 3PQYD 4TYUA 2UYLB 5ESQB 2EIBA 3UYOD 3ARDA 1QQDB 2NTFA 3MGAA 2N1KA 3LPWA 1U8OB 3U0TA 5I1DB 1D6EA 4G9FA 1T1YB 3B9VA 2IAMA 2Y7QB 2WP3O 4M1CD 1JN6A 5J6GA 4NSKB 3MBEC 3VD3A 1QEWB 1OTSC 5F96L 2DBLL 1NLDL 1FIGH 2YD6A 4P9HL 3O3EB 3CDGB 1R24B 3G5ZA 3DETC 1T83A 3KPNA 5CCKH 3Q6GL 4P2QE 4XCFH 5DGQA 1ZA6B 2E6PA 2JIXB 3QG6A 2CPCA 2HJKA 2YUWA 4D0DA 2VDKH 4NNPH 3BKJH 2OJZH 3QCVH 2VLJD 5JTWA 1N6UA 5E95B 5L2KD 3T1WA 1JL8A 1N6VA 4J3WA 5D1ZB 1EZVX 3RPKA 3V9FA 2YPKA 4XP1L 4KAQH 3BPOC 3RDTC 4J4PC 4XI5D 5GSVB 3PV7A 2HTKC 1JHLH 3WFBH 5FYJE 3GRWL 3TA3C 4QRQA 4Q9CA 4OAWA 2DOCA 3CCHA 5I1IL 2P47B 2QBWA 2AXGB 1OW0C 3HNVH 4L4TE 5SWZB 1A9BB 5IMOB 1JNHA 2ATPB 2VOTA 4M93B 4R4FH 4F7PA 2WBKA 3ZL4H 3PIQB 4U3XA 1JF1B 2ARJB 4XH2A 3WL9B 1T1ZA 5JPMB 3QDJD 1T6VN 5C9JB 3EZJB 4HZLA 1UJTA 1YEGL 4PB0L 4N8VB 3RFZC 5JXED 2V17H 1ZSDB 4H26A 2AJ3A 5I71C 4PG2A 4M7ZC 5DK0B 3WUWA 2I60H 3O6FB 3ECBA 1U92B 2UY6A 5KZCB 4NCC1 2A6DA 2YPLE 3FOMB 1FG9C 3JWDC 4UNVA 1EK3A 5EIIB 3I02B 5FO8A 4HIJB 1M71B 1MCKA 2R1WA 1TJGL 4H1LG 5A2LH 3NCMA 4QRTB 3RZCC 2VAJA 5DJDA 3B2VH 2FYYB 4K2UH 2A2QT 1A4KA 4M7KL 3GK8H 5E6IB 3OAZK 3VRIA 2VITA 5KAQF 4YBQC 3DRQB 4KVNH 2F53B 4OV6F 4UAOB 4BZ1L 3QPXL 5D7KD 2FL5A 4W6YB 2Y36L 4XP6L 3T2OA 3NGBC 1GOFA 3P11H 4ZDHB 4XMKH 2YA2A 3PDGA 4JFDD 4LNRB 4NO3B 4HAFA 3O4OB 3TBWB 4KZEL 1KIQB 1Q9OA 3GBLA 4Y5YC 4KDTA 5EU6E 3KAAA 1IQDB 5C0NC 2OMBA 4PGDB 2XN9B 4QRPD 3WJJA 1NFDA 4JHAH 3QEHB 3MV9E 5B22A 2D9CA 3RI5F 1QBML 3NCYS 4XCYB 5FAAA 5KSAD 3VXNB 4FABH 5IB1B 5J13B 3FAXA 5KN5B 3KPPB 4K3EH 1YPZA 1M4KA 2ZOKB 3WD5L 4FQ1L 4LPUA 3MNZA 1MOEA 4OKVA 1KB5A 1KOAA 5ITFB 4K9EL 2IMNA 2R8SL 2VLKD 3PGDB 1F8TH 4NN7B 3QNXB 1N5AA 1ZAGA 3MLVH 3MODH 3CVIL 5JUEL 3P0VL 2H3NA 3SOBL 2DWDA 1IC4H 4MNGB 3OKLB 5D96C 3DXAB 1CFSA 2QKIB 5GRWA 4GKZA 4V1DA 4NO0B 1D5IH 1I1YB 2Z35B 3RNKA 2ZJSL 4NQDD 4ACPA 4F15B 1NL0H 3E3QC 1IM9D 1OB1A 4X7EC 4DZBA 4JFYB 4LRNL 4PJGE 4Z7OE 3D87B 4NQSB 1BLNB 3VW3L 4UOW0 4UT7H 3T2QA 3H0TA 1JK8B 4FQLH 2NY5C 4W4OA 2MMXA 3U4BH 1KLFA 1O7SA 4FTVA 1ZA3A 2FX7L 3QUMB 3FQUA 2A6KA 1RIHH 3H9SA 3QQ9C 1NGWA 3KPQA 3MUHL 4KPHL 5GGQH 5DC9B 3ARFD 4J6RH 4P23D 1TZGH 1A9EB 4HT1H 2OTWA 1CDBA 5GJSH 4MA8H 4U1GB 3PP4L 1NCUA 4ODSL 2Z92B 2GK2A 3QXAA 1ITCA 3GI8L 2GHWB 1AXSA 2R1XB 4NKMB 3DLQR 1KTLB 5IEKB 3ARBA 2AXHA 4RDQG 4Y5XB 4MMXC 2AK4D 4H0HB 1FC2D 4ELMB 1OGAA 2EDYA 4MD0A 4OCLC 4AENB 5EORL 2X4NA 2XTJE 3DX8A 1TTUA 4LQ1A 5DC4B 2YK1L 4R7NB 5C09A 2GTWB 4G8GE 4CNIA 2W0FA 2OZ4H 4YK4C 5DC0A 3ULUE 3HMWH 1OQOA 1U9KA 3E6FB 3MZGB 1UB5B 4MA7L 4F9PA 3F7VB 2EE6A 1T2QL 4F2MA 5F9JA 3VFSA 1YEFL 3MRCA 4WFEE 4NN5B 5TPWH 1U41A 5IVOA 1H9VA 5ICXB 5INCB 5ESQA 5I16B 3BYTA 1QQDA 4TPRH 5C1MB 3LEYL 1XGYH 3FFDB 2EO9A 3QEUA 2EDQA 4LIQE 5I1DA 1OP9A 4NFBA 2DQJH 4AJ0A 2VQ1B 1A6ZA 1T1YA 1ORSB 5CJQL 2X1XR 4Z7UE 4NSKA 2OYPA 5ADOH 5CZXD 1P84K 4LEOB 2VISB 4LHQB 1X7QB 3MZTA 1Q0YL 2V7NB 3CDGA 1R24A 4LOUD 4QXUL 2RR3A 2BOCA 3C6LD 5T33H 1ZA6A 2JIXA 4R7DB 5B3JF 1RUPH 4D0CB 1ZGLB 1NLBL 3ULSB 3MLUH 4XNUL 3KYMB 4TQEL 3U7AA 1T2XA 1UH2A 4P57B 3H9HB 4OFDA 3NH7H 3G5YA 3CFCH 1YMMA 4Y2OA 3OG6B 3S4SB 1H3PH 1G1YA 4N5UA 4UQ3A 4ZTPH 4LLVA 1JGUH 3I50H 5C9KA 1EHNA 5GGUB 5I75B 1F4WH 2H2PC 2VAAB 4X80L 1DEEA 2AXGA 3LQAH 5I8EB 1AO7A 3DSFH 4RBPH 3RU8H 1PQZA 4NQCE 1KIPB 3PIQA 1JF1A 4JRYB 2ARJA 3WL9A 4GG6B 4TN9A 5SV4A 5JPMA 5C9JA 5DFTA 2VZSA 4N8VA 3BDXA 4K3JL 3NAAH 3QHZH 1RFDL 1YNKL 4MDJB 2V7HB 1EGJH 4EI5C 1G1CA 5DK0A 1TPXB 4OB5H 4PRPE 3QULB 1KC5H 2A6IB 3O6FA 1UWXH 1U92A 3X11B 2JB5L 4F58L 4GG6F 1UWGH 4LGSB 1QNZH 1YZZA 3FOMA 1EBAA 1UZ8B 2R0ZH 3I02A 4HIJA 1M71A 3ZKMC 2W07A 5IBTH 3SE3A 5D7JA 4XAKE 5HYQB 5HI5C 5B38A 3QZWG 2FYYA 3P9WB 4FHBD 4M00A 3TIDB 3LKNB 4XX1E 3OJVC 4HIEB 1VACB 5BZWB 5DEZA 2X4TA 3DRQA 2BMKB 4RAUA 2F53A 2Q3AA 3HZMA 1QR1B 2CXGA 2A74B 2P1YA 1XF4B 2NY1D 3QIBB 3MRRB 3OMZA 3QQ4B 3QG7H 4ZDHA 3DVNB 4MJ2A 3HI6L 4NO3A 4F3FB 1E28B 3C09C 2OXGA 5ABDE 1KIQA 4DUXA 4I4WA 5HDBF 1TTFA 5AYUL 2R29L 3BX7C 3TPKA 5E99H 2IQ9H 3AC0A 4ELKB 1I75A 1BF2A 1IAKB 3HNTL 4OCRH 3VXNA 1IQWH 1HDMB 3MRJB 1MNUH 2KL6A 5J11B 1KN2H 2NW2B 5KN5A 3FMGH 4HBCL 1F11B 1EFQA 4XNZC 4E5XA 1U8NB 2ZOKA 2BCKB 2XYCA 4NYLA 3BJ91 5D2NB 5ITFA 4BELD 1G7HB 1OP5H 2VXQL 1KJ2L 1FLRH 3QCTL 2LAAA 3PWLB 5EC1B 4LASL 5DUPH 5CUSH 1JUFA 2WMPA 2A73B 2XV6B 3IJHB 4ZS6D 5F6HI 2DLFL 3TZVC 1S9KC 3RUGE 5C07D 2QKIA 4NO0A 4X6DB 2Z35A 4C56D 3UZEA 1DEDA 4JFZH 3OQ3B 2DIJA 5L9DH 1MI5D 4FXKB 1F4AA 5EZJB 3X3GL 4LSVL 3GSWB 5HDQH 1LDPL 1S7VB 4JFYA 5SX5K 4JJ5A 5IB4B 2Z8VC 1BLNA 3JXAA 4NQSA 2FR4B 1NBVL 1JK8A 1RZFH 1Q1JL 4LLUA 2HTLD 1MSPA 3K3QA 1DLFH 1LK2B 2QQNL 2XZAL 2P46B 4WEBH 1X9QA 4HK3N 1PKOA 2ARWA 2FB4H 3P40A 4KJQD 3EW3B 1JIBA 4HC1H 3UPCA 3OAUH 4GLRH 3DPBA 2BRRL 35C8H 3ARYA 2Z92A 3MRIA 1RUQH 4UT9L 3NABH 2R1XA 4NKMA 4NHUB 1KTLA 1E4JA 2G75B 3CU7A 2XWBA 4ZD3H 5T3ZE 4D2NA 4ELMA 4X5LA 2DBJA 5B4MC 4X6FB 3HN3A 3PJSB 5GRYA 4U3HA 4WUUD 1NGQH 4R7NA 2P43B 3QP3A 2GTWA 1G7IB 1EFXB 1DBBH 4MB4A 1S7TB 1IE5A 1FH5H 4BJLA 1ZANL 1X4ZA 1I8MA 2ZPKH 4AQOA 1UB5A 1NMCC 3F7VA 3L5IA 5E8OB 4LRIC 3CDYA 5TH2B 5L7XH 4Z8FL 4DUVA 4NQED 3LQMA 3BUYB 2PUQT 5I74B 5IBLC 1QOKA 3K4ZA 3RA7L 4AM0A 1OTUC 2QADC 4FZ8L 4P3WA 1TIUA 5D9SB 1RK0B 4RWHA 5SWSA 1JE6A 2P5WD 5I16A 5T5FH 1MHEB 3Q1SH 3FFDA 1BQLL 2EYSB 3ZTNH 1CS6A 3Q5TA 1CG9B 2VQ1A 1ORSA 2APBA 3IVKB 3BQUD 4HUKB 5BS0A 1DQDL 4B50A 3QI9B 5H2BB 1MAML 2HKHL 2XZQL 3EJJX 1RJYA 4MD4B 4LEOA 4XBGB 2VISA 4XTRC 5TQ2L 1X7QA 1G9EA 2V7NA 3SDAB 4Y4KD 1HYSD 1T20A 3SKNB 5DUML 1J8HE 3RWFB 5F96H 1TCRA 2DBLH 1NLDH 2O5YL 2MCPL 4P9HH 3HZVB 3INUL 2C5DC 3Q6GH 4IHOA 3S4SA 2B2XL 1OAQL 5BXFB 2NY0C 5DVLA 4X0KB 4J1UA 2BSRA 3SDCB 5DVOA 4A2LA 2Y23A 1CICC 4KRNA 5FO7A 5I8EA 1RJCA 5GRJL 5CBEB 1KBGL 3AXLB 3GRWH 3SQOL 1KIPA 5F7FA 4FFVD 4FG6D 4JRYA 2BSSB 4GG6A 5I1IH 4WI4A 4HJ0D 3QWOB 5LGHL 3KDMA 4OLWL 3V8CA 5L2KE 2CLZA 1CCZA 2V7HA 1R3JB 43CAB 3Q6FB 3REVB 5JIPA 5L2JB 3BEWA 3GJFB 1Y6NR 2IBGA 1YEGH 3QULA 4PB0H 2A6IA 4M8QB 3X11A 3BOVA 3OZ9L 4K07A 2I9LA 3SGKC 4ZO9A 3NFNB 3O11B 1UZ8A 4GQPH 2A0LD 4NN6C 3AREC 4NT6B 3STLB 3SQBA 4JFQA 5ACZA 3TIDA 2VKWA 3LKNA 3QDJE 4YC2B 4CUCA 3MRNB 1K8DB 1JGDB 1VACA 2GITB 3NVQA 1TJGH 5DHVH 2BMKA 2FEEL 4XNQA 2APVA 4M7KH 3FONB 2KZ1B 5FYLL 3MOQA 1ULVA 3ULVE 3MRRA 4L8DB 3QQ4A 5AD0B 1RU9H 3DVNA 1INEH 1KEML 4MQ7B 2MSPA 3NZ8A 5LAXB 4BZ1H 3QPXH 1RZ8B 4OQ1A 2Y36H 2YXMA 4XP6H 3IGAB 5K59F 5CJ5A 3SDXF 2NY4D 2RAMA 3P30L 4PJCF 2AP2A 3VXME 3VWJB 2GJ6B 3H3BC 2PNDA 4ELKA 1FHGA 2EECA 2P49B 1B4JL 3FKUS 5C3LD 4KZEH 4M5YH 3OB8A 4JO4L 4N0UE 2YD2A 1A3RL 4LCYB 4JREC 3MRJA 5E4EB 3VFGL 4E9LA 4R2GC 3C9NA 2NW2A 4H88H 4NKIL 3RWJB 1U8NA 3MLWL 2VO5A 1IGTA 3BRDA 4XC3L 5JDSB 2DLIA 4LSPL 1QBMH 5CEZL 1G7HA 4JFDE 5DVKA 4MXWL 3KPSB 3PWLA 5EC1A 4IMKC 3GM0A 3OPZL 1ZTXL 3UC0L 3ZKNC 2HJLB 4FQ1H 5JHDB 4O9HH 2R2HB 3QDGE 4QXWA 1UKQA 3U0PA 4QRPE 3P9MA 2EC9T 4KJYB 3S5LG 5HXMA 3CVIH 4XX1G 5JUEH 2X6MA 3P0VH 4FRWA 3SOBH 4FXKA 1C8PA 5KSBE 5EZJA 1HKLL 2GUOB 5FA4A 4LSRL 3QUZD 3QDME 4CGTA 3TO4D 2ZJSH 5CJOH 5AG8A 2VDOL 4R4NC 4FQIL 3V6FB 4BKLA 5IG7B 1LK2A 4LRNH 5F3HA 3VW3H 2X44D 4R97C 3S96B 3QZWB 2FX7H 3UCRA 2CLRA 3FO2B 4KPHH 1TZIB 5CGTA 4NQDE 3TVMC 4NHUA 4P2QB 1UXWA 4PRBB 2G75A 3PP4H 4PJEF 2W65B 4ODSH 2GSIB 3FOLB 1TETL 3GI8H 2SEBB 5HHOD 1CFTA 1PG7X 5EC2B 2HVKA 1S7TA 1CD8A 1I85C 4MSWB 1XIWA 5EORH 4Y1AD 5EBGA 4R26L 3EBAA 1NCBL 2YK1H 1T66D 2YC1B 4OZIE 4I0PC 1XT5A 1I9RH 1I8LA 1G6RL 4L4TB 5TH2A 4X6BB 3NIFF 4OGZA 3OJMB 4ZAKC 1J0JA 1GIGL 3T4YB 4MA7H 3K80A 5D9SA 2CH8A 1T2QH 2FDBP 1QKZL 2LAGB 2P5ED 4GLRI 1YEFH 1OAKL 1MHEA 2HAZA 1DSFL 4WV1B 3QFDB 5D7LA 1CG9A 4JZOB 1C5CL 3K4DA 3IVKA 5CAYB 3J8F7 1YMHB 5BRZE 3QI9A 5H2BA 3LEYH 4MD4A 1ZT4B 4XBGA 2F15A 1LO3L 1HSBB 5CJQH 4D8PB 3T0AA 1QZ1A 1CLZL 3RWFA 4Y16D 4HWBA 43C9A 4LL9A 4APQC 4F8TA 3IF1B 1N59A 2BSTA 4Y19D 1Q0YH 1QP1A 3HZVA 5BCAA 4QXUH 1A6TB 3BGMB 4KV5E 1Y6KR 4KK9C 3CFDB 5BXFA 4X0KA 1HYRC 1NLBH 2R0LL 4OLUL 3C08H 4XNUH 1CFQB 4X7DC 4Q0XL 3EYSL 5L0QB 3BPLB 4JGJA 2F74A 2W60B 4NZTL 3LN4A 4FQPA 5CBEA 1F00I 3QJFB 4M1GL 4PJ8B 5KTEL 3AXLA 3VFTB 2WBJA 4HDIB 4HGKC 1MCHA 2AJUL 1QRND 2BSSA 4X80H 5EU6B 3IAQA 3QWOA 3C5JB 3A6CL 5ESAB 4R6UA 1W2KT 1AQKL 1BZQK 2UZXB 43CAA 4DFIA 3S37X 5L2JA 1FO0L 4NOBA 5F1KC 3TYFA 32C2B 1QLEL 1ZEAL 3I6LD 4POYA 1WBYB 4K3JH 3ZHDA 1YNKH 3NFNA 3RWDA 1C1EL 3ARDC 2VQTA 4NT6A 5H8DA 1IEBB 5F7YC 1FYTA 5HVWA 2C9AA 1MCSA 2JB5H 4PRDB 3VFPB 4KRLB 1MWAL 2HT2C 3SBWA 5LXGL 2IAMC 4HEME 2E7CA 1K8DA 1T89A 2Y5EA 4HK3J 3WHE0 3GHEL 2VR4A 5T1KA 3W9DB 2HH0L 5HHMD 2OXHA 4L8DA 3TNNB 2AJYL 4HXBL 2ZWLT 2OTUB 1ZLVK 5LAXA 4PJGB 1RZ8A 3GSXB 2IF7A 2NXZB 3IGAA 2VL5A 4WDIB 4Z77A 4FXLA 4CRPA 5DRXA 3BIBX 3VWJA 3P4MB 1A7QL 3N1MC 4NRZB 3AB0B 4U1KB 4OFYA 3SDYL 2YEZB 1MFDL 4LCYA 5AYUH 3FO1B 2R29H 5T3XL 1MCCA 4AIZB 3RI5K 2V5MA 3C2AL 5J9PB 5EFIB 3RNQB 3RWJA 4U6VH 1WWBX 2EH8L 3HNTH 2VZ3A 5AUMB 3FQWA 1RZ7L 3QWQB 4X4MA</