3RAPR

The small g protein rap2 in a non catalytic complex with gtp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
167
structure length
167
Chain Sequence
b'MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (G protein RAP2A)
molecule tags Signaling protein
source organism Homo sapiens
publication title Structure of the small G protein Rap2 in a non-catalytic complex with GTP.
pubmed doi rcsb
total genus 56
structure length 167
sequence length 167
chains with identical sequence S
ec nomenclature
pdb deposition date 1999-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rapR00
4PAMA 2JASA 1KDTA 3RSOA 5FUYA 1YR8A 3AM1A 4BZQA 1NN0A 4CEJA 1K6MA 3AKCA 3GJ5A 4B3CA 4KODA 2IYYA 1EFCA 2JDID 2VPPA 3FMIA 3RANA 4JVLA 1ZUHA 5JSZA 2JLRA 4BPBA 1Z29A 1Q12A 3CWQA 4W5JA 3P20A 1TTTA 1WXQA 3W8NA 4LHWA 2OUKA 4A82A 1XMVA 2VHUA 3A1SA 3CNOA 4M1YA 1ZIPA 4HDCA 1PUIA 4JS0A 621PA 5FL7D 3EPLA 4JLKA 1KI1A 5EE5B 2X2EA 3NC0C 3F0TA 4LJYA 4GMDA 1U2RA 1QVRA 4Q4HB 3QKTA 3CB4A 4LY6A 2A78A 4HLUC 2BM1A 3UWOA 3SJBA 4BLSA 3GJ6A 1JAIA 1G19A 3C7KA 3I1FA 1TQ6A 5KDOA 2JA1A 3QOFA 5LB4A 3T1OA 3ADDA 4B44A 1KHTA 3EZ2A 2VTKA 1S4QA 4OK3A 3BH0A 4NPHA 3I8SA 2ORWA 1IY0A 3V4RA 1VYUA 2ZETA 4HAYA 5LB2A 1SZPA 3RNLA 1XMJA 4PC1A 3QKSA 1JQJC 3TRFA 4PZYA 3B7GA 3BFVA 3MWJA 3AV0B 4M9ZA 2GNOA 2ZJ8A 2O8DA 1OHHA 2FPLA 4ARZA 3SJCA 3P32A 1SVMA 4B32A 5E3HA 1TF7A 2ZJBA 4G3XA 1XB2A 4QGGA 1W5SA 2NZJA 3ECCA 3PEYA 4K8OA 1XF9A 3CW2A 2AFIE 1D2NA 3PVSA 1QBKC 2WWIA 4MGZR 1N6KA 5KNBA 3B9QA 5FBLB 4FCTA 3OEEA 2EQBA 1R7RA 1F60A 1J8YF 1VPLA 1ZINA 1J7KA 2ZJ5A 4HZUB 4PAQA 1E69A 4DLSA 1Z2CA 1LB1B 4Q18A 3H2YA 5IK2A 3MWKA 3W5IA 4C7OA 3T06B 1TU4A 1UADA 4MH0R 1E79A 2E1RA 2RMKA 2BJWA 4D6PA 1HTWA 4BLRA 3NEJA 4KFUA 4Z51A 2GXSA 4XSGA 1E9CA 1IXSB 3EX7C 2B7BA 1Z0JA 4GP7A 2QAJA 2D3WA 3Q7QA 5J4KA 2CNWD 4IRUB 4ZKDA 4Q9HA 1T3SA 2PL3A 2ZAOA 5KYKA 2ZPTX 2ZI3A 2ZRJA 3IIKA 1KY3A 3CF6R 4IDPA 1HQCA 1CU1A 4JLOA 4W9MC 2FGJA 821PA 1E0SA 5JS7A 1Q1ZA 2RCNA 5JZVA 5KDDA 1E1RD 3K8YA 2VA8A 4G01B 3MMPA 3WRYC 4GDFA 1BOFA 1MV5A 3FMPB 5P21A 1AK2A 4A0RA 4C2UA 1VDZA 4A15A 4RY2A 4BFYA 1OXSC 3GFOA 3RRNA 4M2LA 4WOPA 3FTQA 4TN1A 2OCBA 3OEHD 3LBIA 4PXAA 5ANRB 1E9DA 4IOJA 1CR2A 2X77A 3EW9A 4AG5A 4E09A 5CB6A 1ZUNB 4ZKEA 1YRBA 1F5NA 1KZGB 2Q21A 2F1RA 1YQTA 1XZQA 2W6JD 1KDPA 3TUIC 2RGGA 1FP6A 4DSNA 1N6HA 3LFUA 1GRQA 3KKMA 5AJWA 4PPGA 2HYDA 1T9HA 1YHNA 4TQUS 3TE6A 1HY3A 4BFXA 3EIEA 2HDNB 1EESA 3RYTC 3DOEA 1G17A 3MWYW 5B58C 1H8HD 1SVIA 1AN0A 1SXJE 4KLNA 1E2JA 1E4VA 3ZLJA 4OK5A 4QC2A 5FOSA 3EASA 3CNLA 3U4QA 4B3GA 1ZYUA 3ZVRA 3Q5DA 4NCKA 2CVFA 1G16A 1AKEA 3TW4A 3D31A 3QBTA 1FX0A 4Q48A 4PTLA 3T61A 1DG3A 3C15C 3OFNA 1IY1A 4HUTA 2REBA 3FWYA 3CNNA 3ZGXA 1TAGA 1BH2A 3W5JA 4RVCA 2VRWA 2KWIA 2P3SA 3KKOA 5J47A 2VP0A 1G7CA 3NC1C 4DUGA 4A9AA 5FBVB 4C2TA 1OFTA 1II0A 4Q21A 2QP9X 4KSBA 1EGAA 1W36C 2PLRA 1FQKA 1U9IC 2IXEA 4G5GA 4RD2A 4A2WA 1E9FA 1JPJA 1XTJA 1YZUA 1CTQA 2W6ID 5FOWA 3TW8B 5JEDA 3SQXA 5FPYA 1KI2A 2QRZA 1NBME 4N0DA 4XTRA 1UBEA 2HYIC 2R6AA 3AVUA 1C1YA 2RB4A 5AJZA 2HEIA 4BLTA 1XD9A 1XCGB 2F9MA 2YOGA 3KJHA 4C0LA 1KNXA 4D81A 1G5PA 5F3WB 1SULA 521PA 1P7CA 3QUSA 3AVWA 3LQQA 721PA 2F9LA 4BFZA 3SYLA 3IIJA 1UKYA 2VHTA 3LH5A 2ZRKA 4URWR 4DDUA 1J70A 4HAWA 3FHOA 2HUPA 1S9HA 1G8PA 3TKLA 1I2MA 2ZE6A 3NHAA 4M1SA 3QQ5A 4DEYA 1MO5A 4L8GA 4CEJB 3RABA 1TF5A 5L3QA 2Z0MA 2AKAB 5DI3A 1E1QD 2BEJA 2V8OA 3UWKA 2BM0A 2LKDA 4LX0A 3UPUA 1SKYB 5CB8A 1RYHA 3I4LA 2NO9A 3LLUA 1UAAA 4HDOB 1U0LA 1E4YA 2XOKA 1Z0IA 2EFDB 4PPQA 1NIPA 1PV4A 1XD2A 2WICA 2RGXA 3DZ8A 4Z54A 3AVOA 1XU4A 1Z5ZA 1VCOA 1G7SA 3FOZA 2SHKA 1LF5A 2Q9CA 2H92A 5FTLA 3LD9A 4O25A 2JJ2A 1Z3IX 5SZJA 1XXHE 2OSBA 3NXSA 4LHZA 2IYRA 1RC8A 1CJTC 5J4VA 5B57C 4TLEA 4TT3A 3J81k 1QHYA 2WWXA 4D80A 4YMVA 3MUFA 1N0UA 4MKGA 1CULC 5E7MA 1WB9A 3FVQA 1ETUA 4ZPXA 4EQ6B 3A1VA 4RZ2A 2ZYUX 1E2KA 1XNJA 1F2UB 1QRAA 1T91A 5TVKA 2AN9A 2IX3A 2CK3A 4GMXA 1J90A 2WWGA 1XDBA 1N2CE 4NHOA 2VP9A 2GJKA 1Q3HA 1TNDA 4TL8A 3GLGA 3THWA 3ASYA 2PBRA 4LJ7A 4EJSC 4L15A 3W90A 3SYKA 5GADl 1KK2A 2V55B 4BE7B 1G6OA 3H1TA 5BWMA 1UFQA 2A5GA 1G3IA 3EZ7A 4JYCA 4NYIR 2PZEA 4QXAA 5EE3A 4UXIA 4BEBA 1K5GA 1G7TA 1FW6A 2O8CB 4YMWA 1Z63A 2GF9A 1M8PA 2IYZA 5IHPA 2FGKA 3BC1A 4R98A 2GCPA 3H4MA 4UXHA 3QPUA 4IDNA 3SBEA 1N5LA 4URYR 3QIAA 1SVOA 2ZYWX 2NO7A 2IBMA 2PEYA 3WP0A 4BWYA 1ZU5A 3EZ6A 3WBJA 3NBFA 2IYLD 3FFAA 4LV6A 3TAHA 4F93B 1KGDA 3S1AA 5FOVA 3TGPA 1GG2A 1N6OA 3IO5A 4PHTA 4Q02A 1J99A 3D6TB 3TQFA 2W6IA 2PT7A 2ORIA 2CHVA 3L82B 4WW0A 1AM4D 4GSYA 4U5XA 5GJVC 4IW3B 2FN4A 5DI9A 3TVTA 4X8HA 2RKOA 2DR3A 4OI1A 4AY2A 3AVVA 1XZPA 1GNRA 3QE0A 4YMSA 5BQ5A 3KXLA 4WXPA 2N46A 4QNRA 4CYMA 4PZZA 1Q22A 2XTZA 4P32A 5J4YA 1HQYE 1CS4C 1HT1E 4X8LA 3KQLA 3OIWA 4KO8A 2HCJB 2ZRCA 4KVAA 4CVNA 4NYMR 4DBLC 2BBWA 1ZCAA 1NG1A 3RRMA 2QEQA 5KDLA 5JLJA 1NKTA 2RHDA 2W58A 4QG7A 1CJUC 4Z1MA 4GFDA 4N3NA 4D0GA 2C95A 4LJ6A 1GTVA 1ZD1A 3RS5A 4TT3D 1RRFA 3A1TA 4MGIR 1W4BA 1YZTA 2DBYA 1ZC4A 2P5TB 2R44A 4QL3A 5ELXA 3DM9B 4H1UA 1CR4A 3FMOB 3LW7A 4KFTA 3BERA 4D0NA 1KAGA 1D5CA 2KBFA 5KNDA 2RGEA 1P9RA 1D2EA 2CJWA 4A2QA 2QQEA 1CRQA 3DM5A 3NKVA 5FTMA 4C9BA 4JL5A 2CLDX 4JYBA 2ANBA 4Q9IA 2P6UA 1XX6A 1KDRA 3SNHA 3A8TA 2ZRIA 4BECA 3OEHA 4M8NE 5AUNB 3U3OA 2N42A 2GBLA 5HCIA 4LYAA 4E5UA 2OFWA 3N2IA 2RAPA 2BBOA 4M9XA 2D2FA 2PJRA 5CJ2A 1E2LA 1E9BA 2F1JA 4QGFA 5DHFA 3ZZTA 4EQ6A 2BWJA 1KNQA 5K8UA 1GM5A 1I4DD 4IDOA 2XGJA 4DLTA 4DDTA 1A2BA 3VR4A 1VIYA 2ZJOA 4HSEA 1B23P 1EFHA 5JJKA 1E9RA 3GJXC 1QHXA 3I8XA 4V0LA 1FZQA 4XD7A 4HB2A 1MABA 1XXHA 2D74A 3OAAD 1Q21A 2A5JA 2DFTA 2QPAA 3B82A 2FX3A 4KLZA 3QKRB 1SQ5A 4JLVA 4MYUA 1FP7A 4GL2A 4H9GA 5FI0B 4GRAA 2X8AA 4B6EA 3KL4A 3LDAA 5FOUA 1ESNA 2WJGA 1WBDA 4F38A 3RC8A 1RYFA 3CZQA 5FOTA 1Q3TA 5KPJA 2I4IA 2OFXA 1G6HA 2G83A 2GILA 4FMDB 2FG5A 3CH5A 2O52A 5BYKA 1KI8A 2WOOA 5H8WA 3AVYA 2A5FA 5C4GB 2VIIA 2CMKA 5C1BA 3PXGA 1F3OA 3CX7A 1ZM2A 1S0UA 3B1XA 3GCGA 1R4AA 4MQBA 2IUUA 4DRZA 4I99A 4A0FA 4XWOA 1OW3B 3OFND 4FIDA 121PA 2TMKA 3IBYA 2GXAA 4KHZA 4RFSB 4M1KA 4Q9LA 2ZI7A 1LW7A 4Q9JA 3W34A 1SXJB 3AB3A 4PR0A 2V7QD 3GJ0A 3BAFA 5J4LA 2WSMA 2HXSA 2G0NA 4QHSA 2Z5FA 3P1JA 2C04A 5C46F 3CBQA 2AK2A 3D7MA 3FYHA 1AA9A 4B47A 1Q1BA 4TLCA 1S2MA 5AUQA 5DGXA 5FUVA 5G41A 3SDZA 1FTSA 1G3QA 2JLYA 2H18A 4AYWA 5L3SB 1GKYA 2EWWA 1V43A 4DT1A 2BJVA 3GFTA 2HCBA 2OV2A 3T5GA 3OIUA 4LC0A 1JALA 4QM7A 4NDZA 2GWHA 4IOLA 1IAQA 2A3RA 1M2OB 2QT0A 4HI0E 4TLBA 4URZR 3BE4A 4Z1MD 2QT1A 1MO6A 4IVRA 5FL7A 4DVGA 5EXTA 1N5KA 4AKEA 3MCAA 1P9WA 2ODNA 1DO0A 4FCVA 3ZZ0A 5JWRA 1JR3D 3LLMA 4OQMA 1FNNA 2NGRA 3SU8A 5DIFA 4RSGA 5AUOB 4LBVA 4MKFA 3T1TA 2GJ8A 1JJVA 2ZRPA 1P62B 3ZIAA 5K8IA 2PX3A 4CEIB 4JBXA 4B75A 2FF7A 4XSHA 2C9OA 2DWPA 3FPAA 1ZNYA 3DMNA 4MRVA 4ZV4A 4NU0A 1XMSA 4Q7MB 3QVVA 3LRPA 1XBTA 1RJ9B 3QKUA 2H57A 2IK8A 4B71A 1LFDB 4RKFA 5L3SA 1OYYA 1HE8B 1BMFA 4UNRA 3GP8A 1Z6TA 1ZU4A 3CX8A 4XWKA 3NWJA 3EC2A 1XEWY 3QJYA 1S1CA 4TYNA 2G9NA 1Z07A 2IYQA 3RWMB 1E3MA 1XXHB 4RCYA 4U7DA 3P4XA 1NMXA 3GLIE 4NCNA 1KOFA 2ZSAA 2OBNA 5FR2A 3WYGA 4EFNA 2JAQA 3G82C 1Y63A 2GDJA 4ZCIA 2NIPA 5JHHB 1N6PA 5LD2B 3C4JA 3KKPA 3TJZA 4V0NA 2GXUA 2XZPA 2ZTSA 4JIMA 4ZCLA 4YXWA 3VFDA 1AS3A 2B8WA 3EG5A 3FE2A 3MRSA 2WTUA 3QXXA 2WHXA 3LNCA 2QBYB 1MO4A 1COWA 3IIMA 3X1ZA 2ANCA 3IUYA 2O8EA 3GMTA 1SKYE 4US0R 1JAHA 2QPTA 2JLUA 3K0CA 1YZGA 3K0FA 4P4UA 1YZQA 1GUAA 1IN7A 3U61B 1DELA 4M22A 3GEEA 4IJMA 4DLWA 3K0SA 1NVUQ 3R8CA 3QNUA 1GP2A 2CL6X 5AUPB 3EC1A 3HR8A 4HZUA 3WYAA 1ELOA 1QF9A 4C30A 2Q3FA 5CJPA 1BIFA 2WWFA 4LBZA 5KSYA 3BRWD 4TSFA 3SQWA 2FFHA 3E1SA 1RZ3A 2C96A 5HTKA 5IDVA 3SEAA 4AC9A 4C0JA 4A0HA 5BYJA 4RFSA 2I1QA 1V5WA 1OH8A 3U7EB 2J0UB 4Z8XA 3AF4A 3OIVA 4RD4A 4AG6A 1S1MA 3GEIA 4Q4AB 2BC9A 2ZUCA 3KB1A 1UM8A 4N0EA 3V00A 1BYIA 5J4HA 3VKHA 1XEWX 5LBIA 3A1UA 1U94A 4M9QA 2OM2A 3PQCA 1WF3A 1JB1A 4QRHA 2JJ8A 3NHBA 1TF2A 3PEUA 3GLHA 3L0IB 3QKRA 1DS6A 4KBFA 4JSTA 4EAQA 1VCMA 3IO3A 3AUYA 2CLSA 3CF0A 2ZAMA 3JZMA 3CF2A 2AWOA 4QGHA 1A5TA 2VBCA 3X1WA 3GQBA 2QAGA 1DG1G 3KB2A 2FSHA 1VIAA 5L3RA 2CXXA 2ZJ2A 3U3KA 4DLVA 1LVGA 2WSSD 3IGFA 3GJ7A 2AXPA 4OQFA 5KO2A 3W9YA 1XMIA 1MT0A 3PUVA 1W0JD 2IHBA 4A0GA 2ZXUA 1G21E 1W0KA 2QAGC 3DDCA 2ZUBA 4NMMA 1WA5A 5DLQC 3QSYA 1KMQA 1WCV1 5G3YA 3G0HA 2ZVQX 3WMFA 2QA5A 3ND9A 4ZI3A 1UKEA 2NMVA 1E2IA 5C4MA 1JNYA 3CIOA 3M1IA 4EPVA 3UMSA 3O8DA 4JLBA 4QBFA 3ZQJA 1E0AA 1OB2A 3LVRE 3WY9A 1FMLA 4OL0A 4B3DA 4IVPA 4FCWA 4AWXA 3DVLA 3LAWA 1GKUB 1U8YA 3OEED 4HAVA 4HUQB 3L0OA 3MGCA 2XB2A 4ACAA 4W5HA 3GLGB 1KTVA 1QVAA 1XCPA 2EFEB 3TAUA 4JL8A 2ZM5A 3KQHA 3SC3A 2BMJA 3MAAC 1KYIA 4JL6A 3CR8A 1F2TB 3K70C 5GVRA 4IDQA 4J0QA 4TYWA 2Q0HA 4G5SA 5DNYB 2WMNB 2CCGA 4LC1A 1TU3A 1U0HC 2O8FA 3BH7A 4TL6A 3NVAA 5KSPA 1JXMA 2QQ0A 5KU1A 4OI0A 2ZSBA 2ZE8A 1VCIA 5G53C 1YR7A 1NMZA 4AIIA 1CKEA 1NVWQ 4WA7A 3UIEA 2GJ9A 4XD7D 3N2EA 2OHFA 3QG5A 4B3BA 2XOKD 1KK1A 1GITA 4GOKA 3P26A 4QNMA 3QEJA 2ZRMA 4H1VA 3SJZA 3TNFA 4HLCA 4UNNA 1T4GA 5FR1A 1W46A 3AP1A 4EJSA 1B0UA 2V4ZA 1XWIA 4XVQA 5LD2C 4FW9A 3ZIAD 3R7WB 4M53A 4G1UC 4I1OA 5DYIA 3U7FB 2F6RA 2IT1A 2EFHB 3H84A 2L0XA 3GJ3A 2XZOA 4JKYA 5FFMA 4FXPA 3TSOA 2WVJA 1OXUA 4R2HA 3QXCA 3SJAA 3TMKA 3RLFA 3OESA 4O2LA 4A36A 2ZIAA 5AJXA 3MFYA 1NL3A 3HYRA 3VR1A 4C0QC 1F48A 1P5ZB 2C03A 2ZI5A 2CCJA 3G5UA 2PMKA 1E2PA 5BN4A 1CLUA 2V54A 2VSOA 4Q9KA 3RWOA 3P27A 2WJYA 4LGMA 4TZ6A 3KQUA 5FTKA 3U44B 5F9FA 1N0VC 2GKSA 5EQTA 4C0HA 2GAAA 4Q7KA 5H1YA 3C16C 3QXJA 3TUJC 3X1DA 2C99A 4FINA 3A4LA 2GETA 3TVDA 4B35A 1DAKA 1PLKA 3B5JA 3C14C 1M34E 3LQRA 5HR5A 2V3CC 4QKQA 2PMDA 2C5LA 4A2PA 2FMXA 2FDCA 3RS3A 2Q9AA 3Q72A 4B33A 2FSFA 1GDDA 4QBHA 3KZ1E 1VYTA 1XCMA 4US2R 3LY5A 4CDGA 1F2UA 2ZJYA 3RRYA 4HZIA 4LHXA 4LV5B 2ZS9A 4Q66C 3CX6A 4PPNA 3IILA 5L8VA 2J3EA 1KK0A 2A9KA 4B3FX 3LX8A 5K8LA 4IKEA 1U0JA 1F6BA 3Q3JB 4Q4HA 3OF5A 3TR5A 1AGPA 4CW7A 2K5UA 2EU8A 1W48A 2HJGA 2WJJA 2BV3A 2ATVA 1U9IA 2JLZA 3QVUA 4PQFA 1X6VA 4LJ4A 2O0HA 1FL9A 4QJ4A 3U44A 3CRMA 4KI0A 2OXCA 3DKVA 221PA 2LWIA 3VX3A 2ZR9A 2D06A 2GZHA 3K09A 1FMJA 3LX5A 4YDHB 2QE7A 3QF7A 3UMRA 1PZNA 2ZRLA 1N6IA 4ZIRA 2YVUA 2XJ4A 2ECKA 3TBKA 1P2UA 2F1HA 1NI3A 1E1QA 3IBGA 4MGYR 1JEDA 1IM2A 2DFNA 5CITA 4G0NA 1WDTA 2G88A 2JGNA 4Q00A 3RC3A 2B21A 2P65A 3THYB 3T35A 1VECA 2FSIA 3PG5A 4XOIA 1E9AA 4L16A 1LTQA 5AJVB 5AWFC 1Z08A 2RHMA 2OO7A 2GZAA 2F43A 4UXJA 5GVSA 2N1BA 3FGNA 4MYHA 2UVQA 2DFKB 4W5WA 4QHTA 1K5DA 1CR0A 4WIAA 2ZI4A 1UJ2A 1KY2A 2J0VA 2J5XA 4DDWA 1EG7A 3GJ8A 5AR1A 1W1WA 1I2DA 2BDTA 3EA0A 4PC2A 3I5XA 2R6DA 4AKGA 3R7WA 4E03A 2PH1A 3HU1A 1KI9A 4NYJR 4PHGA 4TZ0A 2XTNA 4F4CA 5JCZA 2IS1A 2LCFA 1SVWA 4UQOA 2V1UA 5CLQA 1VG0B 1P2TA 1DAGA 2NOAA 1DAMA 2EFCB 4NP6A 4TYQA 4QBIA 5EUMA 3ZS9A 5JCPA 1T3LA 1OFIA 2QTFA 4W7SA 4YC7A 4V03A 3CPEA 2CHGA 3WMEA 2J87A 3N5CA 4A6XA 2J0QA 4MA4A 3VR6A 2REOA 1LV7A 1RKBA 2IEYA 3O8RA 1SHZA 1Q1QA 3I92A 5HKKD 1KSJA 1XEXB 4RFVA 1X8LA 2CK3D 2JDIA 5TDHA 2QSZA 1UBFA 1OPXA 4DLUA 4OQNA 3K9GA 3IHLA 4B43A 2FE4A 2D62A 2W0SA 1J2JA 1II8B 2E9SA 3U3JA 4D26A 2FWRA 1JBKA 4WZBE 2AKYA 2Z43A 2QTHA 1E0KA 2QENA 1KSGA 3I5YA 2C98A 2XX3A 4IVQA 4B2PA 1YU9A 3C8UA 3Q85A 2BKUA 1IQPA 1Z6AA 1ZCBA 1NSFA 5AJYA 1G1MA 2IYXA 4PC3A 4OQXA 3KJEA 1PLLA 2RH5A 1OFUX 3AF2A 2IHYA 4L9SA 4YONB 1I4TD 4ASUD 3PUYA 1SVSA 1XTSA 1T8UA 2X1VA 1TX4B 1MR3F 2AD5A 3NIBA 3OHMA 2F3TA 4ZDIA 3W3ZB 2GTPA 3UG6A 4D82A 4OQLA 4F92B 5TV2A 2IF0A 1CJKC 4DSOA 3CRQA 2F7SA 2GRJA 5EXXA 2C2HA 3KTAA 2O8BA 2OLKA 4OI2A 1JR6A 3AP2A 1EFRA 4ZCMA 2V9PA 3R9WA 3GD7A 1UPTA 2WOJA 1HYQA 2HV8A 4B2LA 4DLZA 2GCOB 1Z6XA 2WSSA 5A0FA 3THXB 4JLAA 1RFLA 3ZYCA 3I72A 3PJRA 3F8TA 1GWNA 2QY9A 2JLXA 4MRRA 1EX6A 1KI3A 3I32A 4PHHA 4OHYA 1ZD8A 4TLAA 2JEOA 3P4YA 4LBWA 3UANA 1OF1A 3AKDA 4V0OA 5D3MA 4JLMA 4LSGA 2VL7A 1VTKA 4A92A 2A30A 2YKGA 5TMPA 421PA 1OYWA 3B8HA 1FPMA 3CRRA 3T15A 4HAXA 3DEFA 3GLGE 1PLJA 1R8SA 1IJFA 2XSZA 1C9KA 1ZJ6A 2A5YB 1R10A 3A58B 3BJIC 3C5CA 4NCIA 5DHAA 4MYCA 4X8OA 3GFPA 4ZDWA 3ZVMA 4IXMA 4DCVA 1OXVA 4Q47A 2Z83A 2G6BA 1NKSA 1OIXA 1R6BX 3ZH9B 2NO1A 4PHFA 2CDNA 1TMKA 3Q5EA 2YYZA 1YR6A 1P60A 1M1YE 1RJ9A 4POAA 3R9IA 4MKIA 2DYKA 3DPUA 2IYWA 2ZRDA 2VHJA 3KTAB 5JI2E 4LYFA 5FL3A 5LPNA 2ZANA 1P3JA 2IYTA 2ZU0C 3B1VA 4CT4B 2W0MA 1TQ4A 4GP6A 5HKKA 1NLZA 1CJMA 3SHWA 2KSQA 4P4TA 5EE1A 3VU9A 4HLDA 4D2IA 2ERXA 2ZS7A 5HZKA 4Y0AA 4IEIA 4OI4A 3TQCA 1G291 1QHHB 5B2ZA 2GEVA 1A82A 1II9A 4WVFA 4C0KA 4LOAA 2AR7A 4II7A 4MRNA 3X1XA 3F3YA 1S96A 5L3QB 2UKDA 1MABB 4OHVA 4UNPA 5KOYA 4TQAA 2OZEA 2D7DA 1IN4A 1P73A 2FZLA 4DCNA 1NJGA 2QP4A 4LDJA 3OIYA 2GVDC 3DKPA 3AVPA 1QG4A 1IN8A 5BW8A 2R2AA 1MKYA 5KSOA 3L43A 3K0FB 2XZLA 1Q0UA 1KO5A 1E6CA 2FEOA 2VP4A 2KJQA 1E32A 4LJ8A 3R9XA 4QJ5A 3PCRB 4TMZA 1R5OA 3FFBA 3H86A 1T5LA 4DHEA 1VG8A 4URXR 1N6LA 1SGWA 2GXQA 5JEEA 3K09C 4LUCA 1EX7A 2H7VA 4ZDJA 1ZW6A 1ZIOA 3CRVA 1T0JB 3HP1A 4JSYA 4HAUA 4DCSA 3U5ZB 2FPKA 1NBMA 4PAOA 5JWHA 1QHHA 1WE2A 5EE0A 4ZO4A 4B3XA 4TTPA 3M6AA 4JJKA 2YC4C 2MSCB 3BORA 3A6PC 1W4AA 4Q4JA 2XITA 1FUUA 2YC2C 5JFGA 5E95A 5JS8A 4LV8B 1XPOA 4GOJA 5EZ5A 3KXIA 4AYTA 1E2HA 2PEZA 3DHWC 3U3RA 2Z4RA 1AIPA 2HT1A 4C0BA 3NH9A 4AK9A 2CL7X 4BEJA 2JLVA 2FJUA 4L9WA 4G5RA 4OHXA 3LBHA 1NP6A 3O47A 2B7CA 8OHMA 3ND8A 1A1VA 5BN3A 4V0KA 4QJ3A 3QF4B 4PO8A 3QI2A 4RZ3A 4V02A 5UKDA 3WMGA 4EPWA 1ZM7A 2ORVA 4BGDA 3KDSE 2REXB 4KJZA 3GLIB 3SI7A 3U3MA 3LXXA 4F4JA 2ZSFA 5BN5A 1E1RA 3A1WA 3WYFA 3FHTA 1GVNB 1DEKA 2J7KA 4ZI2A 5JBQA 2J59A 1G8YA 3AVXA 4YLGA 3HDTA 1CF4A 1GKIA 3SE0A 4I4LA 3EPHA 3RSLA 1YZKA 2Q9BA 3MJRA 3HJNA 3VHLB 4JLDA 1GNPA 4D4JA 2W6JA 4JT2A 2C9YA 1E2GA 3T5DA 5SZHB 4Q7JB 1TQ2A 4HB0A 4TMWA 2A7QA 2BEKA 2OE2A 2XEXA 1O3YA 1NIJA 3IDQA 4DCUA 3HWSA 4P33A 4CT5A 5HPYB 3ICEA 3K0AB 1NVVQ 3FDIA 2O8CA 1GILA 5DO9A 2JLQA 3IEUA 2XJ9A 1Z6YA 2VHCA 2J1LA 2J45A 4JLNA 4M21A 1G9XA 3RS0A 3AKEA 5FH9A 1VHTA 1KKMA 4M1MA 4TSFD 3QF4A 1O87A 4ESVA 3QPVA 3W6OA 1AZSC 1NLFA 1R0ZA 5JJIA 3EA5A 4WXRA 4G5QA 2PX0A 5F9HA 5FOXA 4V0MA 2Z6VA 4XTCS 4O3MA 2ZITA 4IXNA 4NYJQ 1OKKD 4BZPA 1ZUIA 2V6JA 4C3ZA 4EUNA 4PANA 1DO2A 1BMFD 4WAUA 4AKHA 3CPJB 1X3SA 3NG1A 4BFVA 2EYUA 4P0TA 4LYHA 1FOEB 3TUZC 1A7JA 2J41A 5EUQB 3I73A 1ZAKA 2IS4A 1OXTA 1G3RA 3ZZUA 5IRCD 2WIAA 3N70A 3BB3A 4NONA 5CK5A 2HXYA 2AXNA 4MUBA 1HH4A 2YWEA 4RD0A 4D4MA 2J7PD 3TIFA 1ZNWA 1KDOA 3VTKA 2YZ2A 2QP3A 3SYNA 3ZDQA 5EP1A 1IONA 4IOKA 4PPFA 1G3UA 3THXA 1EXMA 1AJEA 1R8QA 3TK1A 2BHRA 4DT1B 5EP3A 1EFTA 1OJLA 2FU5C 3IQXA 3EARA 1VCNA 1ZM9A 4LHYA 1G4UR 2IL1A 5DI3B 4TTQA 1W0KD 1R0WA 2CVHA 2WKQA 2ZYTX 3KUCA 2CL0X 4F91B 4S2EA 5F2EA 4US1R 1SVKA 3R20A 2BIFA 4PQYA 2QROA 1X1RA 1OH7A 4PC6A 3PIRA 4JVSB 2JLSA 1JXOA 5JI3E 1DOAA 1XTIA 1S3GA 3K0EA 4E22A 3PUWA 2GHIA 2BOVA 5HCNA 1D9XA 1U99A 4PX9A 4F4IA 2KB0A 3W6PA 1A2KC 4KXFB 4DLRA 4NYIQ 2PCJA 1FNMA 4DIDA 1DAHA 5TARA 1XFAA 1NY6A 1US8B 1NF3A 2YOHA 3EWSA 3KXKA 5CDFE 2QTVB 2Z4SA 1U90A 2FFQA 2NO6A 3BS4A 5CM8B 3UMFA 1GSIA 1ZRHA 2OT3B 3UATA 2HF8A 3EWAA 3M4YA 1N3BA 5CYPA 4EIWA 4NL4H 3KKQA 3C41J 2R9VA 1HUQA 2MSEB 1BKDR 3EIQA 1H8EA 4RD1A 2WWWA 2QM8A 5CDFA 2PJZA 1OSNA 1Z0KA 5EZ6B 2HF9A 2CE2X 4B76A 4DIEA 1NN1A 5C2JB 4LJAA 4JJZA 4EFLA 5KNCA 2WJIA 5L3VA 4QM6A 4GI7A 5F98A 1G5TA 3TR0A 4LBYA 2WWYA 2XTMA 4CGZA 2D4HA 1NJFA 2ZRAA 3BFKA 4P4SB 5FPTA 3WP1B 3RS7A 3U2QA 5JJLA 4Q1AA 4HUQA 4R71A 2F43B 4IHQA 2QMHA 1EK0A 3OAAA 3EIHA 4GBMA 3AVTA 4AKIA 1CBUA 4D25A 3A4MA 3T34A 3NBZC 4OKSA 1YE8A 1DAEA 2IWRA 1OKKA 1W2HA 5IF9A 1W47A 3ADCA 3KQKA 2JCSA 4Q5IA 3B85A 2NG1A 3BXZA 4Y0VA 1ZD9A 3T1VA 1D2MA 2IYSA 4K81B 1DBSA 1XD8A 2QE7D 1Q57A 1OFHA 2MSDB 5TY0A 2PCLA 4Q19A 1W2GA 2ZJAA 4F7WA 1Z28A 2RGNC 2IWHA 3M0EA 2ONJA 2GCNA 2KBEA 1OXXK 1NG9A 3VMFA 1WMSA 5EXPA 2ZVPX 4XVUA 5SZIA 2Y8EA 4V0ME 1LY1A 3REGA 5DN6A 1QHNA 3V4FA 4D4LA 1JEEA 4TTRA 2CBZA 2QGZA 5JWOA 2NZ8A 4RJLA 2CEAA 2JLWA 1RRCA 2I3BA 2FNAA 2NTYC 4Z8YA 2VP5A 1MRNA 5DISB 5FTNA 3GLIA 5JRZA 1TQDA 2E87A 3B1YA 1GAJA 1SVLA 1GFIA 2GVZC 2AK3A 2O5VA 3HYTA 1XPUA 1OV4A 2B8TA 3W8RA 1ONBA 3VHXA 4ON9A 4XVRA 1RRPA 2YWHA 2ODBA 2DWQA 2OLJA 1DVRA 2WWHA 3EPJA 2EFGA 4NZYA 1P2SA 3QXSA 5GJBA 3AF1A 1G64A 1M6NA 5DE3A 5FBRB 1US8A 5EP4A 1XTRA 3A36A 2VHQA 3KKNA 3PFIA 4LK2A 4A6PA 2C9CA 2CHQA 3MJHA 1Z47A 1IY2A 4EDHA 1W7AA 2FA9A 2DWOA 3THOA 3QENA 3WNBA 3NDBB 3CKLA 3FMFA 4DSTA 1HURA 1P4SA 4DEXA 2DFLA 2GESA 1JI0A 1G18A 4MYTA 3B60A 1N6NA 3CR7A 3KJIA 1SXJD 4QFMA 2B92A 4XJXA 2XXAA 2R6CA 1KSHA 3ETLA 3U6KA 1XEFA 4A4DA 1A4RA 2ODWA 3MSXA 2D7CA 5CLLA 2GJSA 4AI6A 1GOTA 3JVVA 1KK3A 4LYJA 3SFVA 2RGBA 4KU4A 4DJTA 1KKLA 3CPHA 1CIPA 2GA8A 2ZQ5A 2X2FA 4HEJA 3R8FA 4TQ9A 1XEXA 1T0HB 1R5NA 4C0AC 2QI9C 1YJ5A 4GZMA 4BLPA 3Q8XB 5JMTA 4Q1FA 3VKGA 1N6RA 2ERYA 2ATXA 4MDFA 1OIVA 2P6RA 2IEZA 5JSZB 1W36B 1H65A 5H70A 1JQLB 3CO5A 4M1TA 2MMCA 2AX4A 3AKYA 3AQ4A 3BIFA 5EP2A 2JIZA 1QG2A 3VKWA 4AURA 2MMGA 1I4LD 1VKJA 1Q44A 2R6GA 4A8JA 4ERNA 2ZRBA 3IHWA 4MRPA 4WBSA 1HT2E 1NVVR 2OCPA 2OILA 4KCGA 2IW3A 4BRWA 1KO8A 5G40A 5FBWB 1C4OA 1K8RA 5DN6D 1N25A 4YXWD 2O0KA 1EFUA 1S8FA 1Y3AA 4TMKA 2ZROA 4UKDA 2QMUA 1IXRC 2EYQA 2VLIA 2F3RA 4O0MA 2RGCA 2AHOA 2WAXA 1OH6A 1E2NA 2XXAB 3U7GA 2IXGA 5C18A 1OIWA 1Z2AA 4JLPA 2J9RA 2CE7A 2BMEA 2YJTD 4S35A 5JECA 1X86B 4A1FA 1HV8A 2GEUA 1UEJA 1CEEA 3IKJA 1KJYA 3PEVA 1L8QA 1H8ED 3BBPA 2QN6A 1AQYA 1HE1C 1M7BA 2QSYA 3BWDD 4OYHA 3DL0A 3K9HA 2UZ3A 3K70B 2DB3A 1ANKA 4KV9A 5IT5A 1DPFA 3V9PA 2BVNA 3NBXX 1AZTA 1Z06A 3ASZA 3THYA 1ZC3A 2C78A 3TSZA 1IBRA 4IOMA 5JHGB 4M4SA 3RVBA 4NE2A 3PR1A 3DO6A 2HLDD 3HR7A 2AL7A 4HB4A 4A8JC 2GK6A 4JBYA 4KBGA 1J8MF 1ESMA 2BMDA 2O8EB 3FKQA 1N5IA 1W4CA 4MGKR 4CF7A 2VF7A 4TL9A 5J5CA 3ZQ6A 4P4SA 2C8VA 3OE7D 3BFXA 1KO7A 1ODFA 2H8KA 3UKDA 3ICQB 3BOSA 3B13B 3JZAA 4GZLA 1GL6A 2GEDA 1JPNA 2C77A 2KE5A 2IF2A 4OJKA 5TXGA 1E96A 3T12A 4K46A 3U7HB 3L0PA 4FWIB 4LJ9A 5FTJA 2W2VA 4GT1A 3WBKA 2Q3MA 4MITA 2WPDA 3L8YA 4DCTA 3C5HA 3NDPA 3X2SA 3VU9B 4BFTA 1QZXA 4FMDF 1NLYA 3AGQA 3RDPA 5FUXA 1VG9B 4I81A 1TADA 1Z0AA 1F2TA 4FMCF 3REFA 4HATA 4WZAE 2ZYVX 2EVWX 2YWGA 4NKRA 1TEVA 4DWJA 2O8FB 4GPTA 1NRJB 1SHKA 3U4QB 1N0WA 3B2EA 1Z83A 4I1VA 2G1JA 2VEDA 3CZPA 5GJCA 3VR3A 4YQFA 3GLHE 2QNRA 4BASA 1VG1A 2OCAA 3SS8A 1WRBA 2J0SA 3ADKA 5FI1B 4PFSA 4FI3C 2JATA 4LPKA 1IN6A 5A5GA 2D2EA 4TMXA 4RD6A 2ZJZA 1PVOA 3RRZA 4Q1EA 4R2IA 1MRSA 2ZR0A 3QPWA 4B48A 1GL9B 2AFHE 1Q1EA 4CEHA 4LHVA 4BZXA 1T8TA 1DADA 4P3YA 1EFRD 1XJ0A 2XNDA 4Q01A 4DDVA 1OH5A 1Z6GA 1ZP6A 4LI0A 1JR3A 4PO1A 1DAFA 2W2XA 2ZI6A 4KSCA 4BLQA 4JVNA 3IQWA 3MLEA 5FPKA 4EJSB 1KAOA 2ZREA 3Q7PA 2O0JA 3A37A 2P2LA 1E2MA 1T6NA 1COWD 2QMEA 3ZVNA 2EW1A 2F55A 1KIMA 2FFBA 4FMCB 4CRWB 3LVQE 3TLXA 5KTYA 4RKEA 1P72A 3VNVA 1P75A 3HPQA 3KJGA 2JJ1D 1YZLA 1E99A 2ASEA 4HAZA 5CIWA 3I3SR 4IEEA 3CM0A 2GCOA 5CYOA 3W3AA 2WM9B 5G3ZA 1PJRA 4PC7A 3GLFA 1W5TA 5EE9A 1GRRA 2OAQ1 2BMFA 2YNMA 1NMYA 2V6IA 2ZRGA 4HLQB 2YINC 2WBLC 1PUJA 4HDQB 4LRWA 1X8JA 3WXMA 2QU8A 2OCYC 2ZUDA 4DB4A 2FEMA 4N1AA 4ESHA 2VYFA 2PT5A 1S3SA 4QHYA 4FD2A 1IXZA 1UBCA 2QM7A 4LPSA 4NBSA 5B64A 4NCHA 1AS2A 4GNKA 4OHWA 4ZIRB 1G8FA 2ZI9A 1VHLA 4U02A 3NBYC 3B78A 3LXRA 3BGWA 1M7GA 3PUZA 5HE9A 1RE0A 2HLDA 4I1SA 1X8KA 2GBLC 4ACBA 4TLDA 5TB5A 3EZFA 1E2QA 2J46A 3DMDA 2WPDD 3LBNA 5K8TA 5HE8A 2IA5A 2XB4A 4ARZB 3WHLA 5FBQB 2BKEA 4HB3A 1NNEA 1ZBDA 4RD3A 3IPYA 4NH0A 4BLOA 3E70C 2OBLA 4A8JB 2JJ2D 4LZZA 1XJCA 3NTUA 1KI6A 1Z8FA 3FKSA 3O8BA 4IFEA 3SR0A 3IEVA 1U98A 4UNSA 3PUXA 4C4PA 4DXAA 1LS6A 2I1VB 4ZDKA 3DZDA 4JMPA 3CWZA 1CJVC 2O8BB 4JVMA 2ZSDA 1GZSA 2PZFA 5KSZA 1RRGA 2IUSA 2G77B 4MRSA 3KUDA 1UDXA 4MDEA 2GAOA 2WV9A 2QRNA 3PENA 3AP3A 3L2OB 4KAXA 2OESA 4C0SA 2YOFA 1RPZA 2QMOA 4TYYA 1OE0A 2LKCA 1OT3A 4ILEA 4XWAA 4BUJA 5M04A 1GRNA 3BH6A 4X8MA 4OHZA 1X1SA 1NSTA 3VX4A 2YWFA 3W6NA 1D8TA 2P5SA 2QZ4A 4OK6A 5LDDC 2FZ4A 1W0JA 2PLFA 5FUWA 3EPKA 1TEXA 2CJWB 2W83A 2VSFA 2DCUA 3VNUA 2YHSA 4CEHB 4KYIB 4PQRA 2G3YA 2VP2A 4RZUA 4OJQA 1G4AE 4DC9A 1D9ZA 1GNQA 2OG2A 3K9LA 4NCJA 3BB4A 4B34A 5CM9C 4TWZA 1L4YA 3OZXA 1KSFX 1YVDA 4PSKA 1E94E 1KI6B 1JR3E 2P6NA 4DUGD 4GOXA 4Q4JB 4QBGB 3F5FA 5E4FA 2IC5A 1P6XA 1NY5A 1QHIA 4BFUA 1G7RA 2IYVA 1TUEA 3B1ZA 2JJ1A 3D3QA 1KO4A 3K53A 3UXMA 1RW4A 1XTKA 2DY1A 1Q20A 1P9NA 4FMBB 3HU2A 3AVQA 2OXRA 4KYUA 3WNCA 2ONKA 2FSGA 4LCBA 1E2FA 3ADBA 1DE0A 5EXSA 4AYXA 1WP9A 1AQUA 2H16A 2R65A 2P0EA 4URUR 2NPFA 1R0XA 1E2EA 4L4UA 2FFAA 4P31A 1OB5A 2DHRA 2A5DA 1UKZA 2GJAA 4YDSA 3ZD6A 4UJ5A 1LNZA 3AF3A 2ZU6A 3T1QA 3ONWA 4DZZA 3D8BA 1R2QA 1SXJC 2F1IA 1T3HA 1IHUA 4FWTA 3QBVA 1MO3A 3GJ4A 3LO5A 2H5EA 2WJHA 3U60B 4B6FA 4QGAA 4DLYA 2ZS8A 3PEWA 2QORA 2FOLA 5J40A 4Q1BA 1ZMXA 2NO0A 4B73A 1UBGA 5BXQC 4CEIA 1SXJA 1XJQA 3VAAA 2RGNA 2BBTA 4TMVA 3WHKA 3AUXA 3QY0A 1W44A 3JVUA 4Q1DA 2GF0A 1G5RA 3B1WA 4WZ6A 4EFMA 5KPDA 3OE7A 1FFHA 1FX0B 1GL7A 4BFWA 4DLXA 4UNQA 1E2DA 1BYUA 1DARA 4CIDA 1WBBA 3ZD7A 1IOZA 4URVR 1MOZA 3KFVA 4ABYA 4D4KA 5CIQA 5CK4A 3CUEF 4Q1CA 5E7JA 4LWZA 3E2IA 1MH1A 5DSZA 1UKVY 3B9PA 2G1KA 4NYMQ 4DKXA 3SZRA 1NN5A 2XNDD 2HT6A 1R5BA 2BCGY 3AH8A 1RIFA 2QBYA 5FPSA 1L2TA 1KI4A 5IK2D 4G5OA 2NQ2C 3RHFA 3AF0A 3HU3A 3MD0A 1XPRA 2A2ZA 1SKQA 3TSWA 2G0TA 3BB1A 3K0CC 4DB2A 4Q4LA 1G8GA 1CP2A 1YRAA 4EPYA 1ZM4A 4KVGA 1N5JA 3X1YA 1DAIA 2R6FA 2W2TA 4TL7A 1UF9A 3PITA 2W00A 2WIBA 1NVXQ 2GZDA 1KO1A 1TUIA 2KI5A 2ZEJA 3DOFA 4JBWA 3GLFE 1QHGA 2WMOB 3QXHA 1FUKA 5H68A 1D6JA 2H1LA 2J7PA 3U6BA 3QG1A 4R9UC 1ZVQA 2RGAA 4E07A 4D0LB 3EAQA 1L4UA 3K70D 4KFSA 1G8HA 4XIGS 5HZHA 4M1WA 3GLFB 4Q7LA 1S9DA 3K1JA 3FB4A 5B30A 3THWB 3SHFA 2VH5R 1Z22A 2XNSA 4RZXA 4EKDA 3AGPA 4MUAA 2WJVA 1E0JA 2IS6A 4EPXA 1E9EA 2R62A 3LW8A 3K0AA 4RCZA 1OHHD 1YR9A 2WZQA 4KFRA 1BS1A 1ZNZA 1T5IA 4EPRA 1IJEA 2QUZA 1AS0A 3O8CA 3CRW1 3GEHA 1GIAA 1P2VA 1YKSA 2Q6TA 2V7QA 3SOPA 4JT4A 1VYVA 6Q21A 1ZNXA 4M9SA 3GPLA 3SFZA 4KITB 1JECA 2ZE5A 2ZRNA 1KJZA 1EWRA 3VQTA 1VMAA 4I1UA 1W49A 2VF8A 1FQJA 5A4JA 1EWQA 1KJWA 2QL6A 3BD9A 2Q3HA 2VSXA 1M7HA 2ZE7A 3SBDA 3KX2A 3LV8A 4HYYA 4PSAA 2AWNA 2UZIR 1TPZA 3VR2A 4OBEA 5EJEA 3ZJYA 4DSUA 1AGRA 1G3MA 1KI7A 1BO6A 1P61B 2BBSA 1HA3A 3MG9A 1RVDA 4NTZA 1R0YA 3CLVA 3EXAA 2NPIA 4B74A 2VO1A 4YMTA 4CZ2A 3L8ZA 4TYPA 3KFXA 4XH9B 4MKHA 3A4NA 3I62A 3LA6A 3BK7A 4LJ5A 4Q4AA 5D3QA 1E98A 1M74A 3H0KA 1Z0FA 5KUTA 2JIZD 3UK6A 3VR5A 2B6HA 3EZ9A 2FH5B 4FN5A 4B2IA 4Q03A 4QOSA 3AEZA 5GJWC 2OFOA 3FHCB 4U00A 1LS1A 4BQSA 4PZLA 3I61A 4TMTA 2ZSEA 3FKSD 1HEIA 3K9NA 3HPRA 1XP8A 2OBMA 1NBMD 1W4RA 1CXZA 3QKSB 1OLOA 4IFBA 2R8RA 1IN5A 2H17A 3E5HA 2HJVA 1XRJA 3NEYA 3WNDA 1ZM3A 2IUTA 1W36D 2XSZD 4BRUA 2WAYA 2O8DB 3L0SA 4JKIA 2ODEA 4M0LA 3QEOA 2PZGA 1FTNA 2QAGB 4JLJA 1KZ7B 1Z0DA 1U8AA 1KMHB 4BFSA 1CR1A 2AD1A 2XAUA 1AKYA 3GLHB 4L5BA 4R7ZA 4EPTA 5E7IA 1WQ1R 2EWVA 1YZNA 3CONA 3B6EA 4AD8A 3ZVLA 1H8HA 2RGDA 1L7VC 1TL7C 3RAPR 1JJ7A 2IXFA 3NH6A 1CRPA 2VP6A 1XTQA 4JZKA 4M1OA 4C7OB 2BCJQ 2ZRHA 5FPHA 1UEIA 3UG7A 1NN3A 3MWLA 5DYGA 5KHOC 3S1AB 4PO9A 3ZS8A 2QG6A 4ASUA 2FV8A 3SN6A 5AK0A 4ITRC 2GK7A 2ZRFA 3KQNA 2QPOA 2CNWA 2ZR7A 4O2RA 3TH5A 4HLUA 5D3MB 3CH4B 2YV5A 2IS2A 2VQSA 2FPMA 2QGNA 1DTSA 1LF0A 3RS4A 2V1XA 2IYUA 5SZKB 2CLCX 1U8ZA 4PSVA 4YMUA 1E79D 2J0UA 2OAP1 3RS2A 3WRXC 2CCKA 3PV0A 2WKRA 5DH9A 1U81A 1QHSA 1XD2B 1G41A 1UDWA 2OEPA 2P67A 4UJ3A 3LWNA 4IDHA 5JRJA 3IPXA 2X19A 2DPXA 1E9SA 1II8A 1KMHA 2WKPA 3Q9LA 1QDEA 1G20E
chains in the Genus database with same CATH superfamily
1M1NA 1VJDA 4YJHA 2IHNA 2I2WA 3EVTA 3KE8A 1RQ2A 2O50A 1CJCA 1XZGA 5EGNA 3AR4A 3RSOA 2VKQA 4F56A 5KVSA 1P5JA 3G2JA 1U0NA 4JHXA 4B3CA 3C97A 5F21A 4KODA 4K9QA 1FRFS 1RNLA 1G6KA 2MR5A 2QYOA 2VPPA 1N7HA 2ECFA 1ZD3A 3B52X 3FMIA 3JASB 5CUQA 5DTQA 5HBRA 3TTUA 5MFZA 4N76A 3NMUF 3FZYA 4EG6A 1QE0A 2XYGA 3P20A 2P7HA 4P7GA 4ZV7A 4LHWA 3JQGA 2BRUA 1JLMA 3ZWCA 3W2TA 1ZIPA 4H7IA 1PZXA 1W30A 2OHHA 2R97A 3I28A 2Z8YM 4N49A 3E4CA 3EF1A 2JGDA 3W8EA 3NC0C 2CXOA 1AE1A 4GMDA 1U2RA 4PICA 3RFTA 1QVRA 3QKTA 1UFKA 4F7DA 3K6JA 1JE1A 4BLSA 5U4XA 3S2ZA 5IXJA 2XQGA 1GDTA 3P9KA 1JAIA 2QWXA 3C7KA 1NVEA 2BLNA 3MERA 4ZRMA 3ZW7A 4B44A 4Z3KA 5A5VA 4YYZA 2C83A 3BH0A 1NTOA 1TQ8A 1JIVA 2YHUA 2Q4BA 2W2MA 3Q8LA 1Q74A 3V4RA 4F96A 3QITA 4Y2QA 5CFPA 2ZETA 2PHZA 1S6YA 4Y6RA 3ZHZA 1SZPA 5ESRA 3AX6A 3DJYA 3LQKA 3VYVA 4XR4A 1NXVA 1K2WA 4F46A 5LZ2A 1JX6A 1S89A 4AZ0A 4DOMA 4YAGA 3B7GA 3Q1KA 3MWJA 1V39A 3AV0B 3BIJA 1NULA 1R15A 1PD1A 3PWKA 1XQWA 2WP8J 3TN7A 1OHHA 2FPLA 5ARBA 2KLBA 3P32A 4MNTA 5E3HA 2VHWA 3EBOA 2JRLA 1CZRA 2XMDA 3ECCA 1I2CA 3RVPA 1D7OA 1L5FA 1D2NA 1Y37A 2WU8A 1P2DA 3PF8A 1QBKC 2W6PA 1IPHA 2VPYA 2WWIA 1LEHA 1EP9A 2BGKA 4MGZR 4F11A 5K8JB 1EVLA 2YRXA 2H0AA 5FBLB 4FCTA 5K7SA 5KNBA 1R7RA 4MQLA 1AKUA 3N8GA 4REQA 4CBVA 1J8YF 1VPLA 4U2GA 2Q2NA 1KGSA 1J7KA 1VMDA 3NPAA 4HZUB 4ND8B 3VV2A 2FMKA 1Z4IA 3RRBA 1Z2CA 2P5UA 3G7NA 4DLSA 3L9XA 1TMOA 2H65A 3CLUD 5IK2A 3BJZA 3MWKA 3AR9A 4L57A 3W5IA 3I9JA 4WMLA 1X0XA 2P6PA 2SICE 4MH0R 5AHXA 3T06B 1E79A 2FWBA 4IS3A 3HH8A 4LJSA 3VZPA 4KFUA 4ZOLB 4JCOA 3OTQA 3BGDA 2PBFA 1E9CA 3MHPA 3EX7C 2NP7A 3SLRA 5MN5A 1L5VA 2QAJA 4EO7A 3HJBA 1WHSA 1HWYA 1N1DA 2PL3A 2ZAOA 3T0IA 1E5DA 2ESRA 3PR2B 5BT9A 4IRMA 3ZG6A 1ZEMA 4U7FA 3IKTA 1KY3A 3CF6R 4NBKA 4JLOA 2F3UA 1PO7A 1GPH1 5LYJB 3WIOA 2PLNA 3H9QA 5JS7A 1U3CA 3EH2A 1RCFA 5EYPA 3WKEA 2RCNA 4W9NC 2ZTMA 4G01B 4GDFA 1R37A 3MMPA 4JC5A 1BOFA 5P21A 3L1IA 4MK4A 1L1FA 3WRYC 4A0RA 4F2DA 1JEOA 1XZKA 1KU0A 2OV1A 1E3JA 2GCEA 3JALB 4QAQA 3VDXA 4BP8A 4M2LA 3GT4A 1ZD5A 2Y99A 5EFOA 1NNSA 3O2JA 4RHCA 2FSVC 4TN1A 3WK9A 3OEHD 1E9DA 2ZULA 4NG4A 4AG5A 5D2CA 3OE4A 4E09A 1SWWA 1SRQA 1ZUNB 3F78A 1ZZGA 5ED0A 4O4JB 1NURA 4ENVA 1MTZA 4FOLA 1SQSA 5SYNA 2R4UA 1EUYA 4QTYA 4D8WA 3DEHA 4XARA 3L7OA 4K9PA 1FP6A 4LW8A 5GOZA 2G08A 3CLTC 1LZLA 3LFUA 3R1IA 4GG1A 4PR3A 2INGX 4QLAA 5AJWA 3OC0A 1WBJB 3Q4GA 3LOQA 1EUQA 1U6KA 3ETHA 3EIEA 4M88A 4UUNA 2PXAA 1KP3A 3LWBA 4TUYA 4ZOLF 5F5NA 3RU3A 4BRSA 2C5FA 5FTWA 3RYTC 2V0GA 1CUUA 3DOEA 4DLKA 2QVZX 1X19A 3N8KA 3REOA 2GRAA 4OAPA 4R8MA 4E4TA 2PX6A 4KLNA 4PE5B 3WICA 2JGIA 3KWLA 1DBWA 2VJQA 3C3EA 2NU7B 2WB4A 2E49A 3CNLA 4JOBA 4RIEA 5CPBA 1C0EA 5EKTA 4B3GA 3ZVRA 4K0KB 1ZK1A 2CVFA 4NCKA 1C0KA 2R8YA 1AKEA 1EP3B 5DHRA 1ENOA 1OUMA 3RUCA 3O4GA 3U80A 4NMXB 4AJ9A 1V8PA 1FX0A 4MUMA 2JFFA 1Q7BA 1Z6PA 2X5OA 2BI7A 3CNBA 3O84A 5TIIA 1AHNA 1DG3A 3C15C 4KZPA 4CN9A 2PMEA 3ILHA 4P7FA 4GLFA 4HUTA 4UZFA 2V03A 1QV7A 1JBQA 2Z56A 3TO5A 3JZIA 5HUHA 3IDAA 5GOTA 4YMHA 1TAGA 1BH2A 2BFCA 1AGYA 1XVUA 1WVIA 2AN1A 2I0FA 2KWIA 3AR3A 3KT8A 3NHMA 2C2BA 3KKOA 4R2XA 1D09A 4NS4A 5DTRA 5DXFA 3C6QA 4CMKA 1QZZA 3W05A 1V4VA 2HBQA 4OHFA 4A9AA 1OFTA 4C2TA 3CSUA 4BBZA 2HJSA 4OXIA 4B8YA 5BNTA 5I6DA 4DC1A 3IQGX 1XI2A 1U9IC 3CF4A 3I42A 2VT6A 1PQPA 2X0IA 2FZGA 4G5GA 5BMOA 3F49S 5B3KA 1ZR4A 3IMFA 2OFFA 1PZFA 5FOWA 1QIEA 1CTQA 3TW8B 5IKEA 2IW1A 1JLRA 2BGTA 3KSBC 1UBEA 2JFVA 4RKRA 3GAZA 1E6KA 4OL9A 5SYAA 4RZQA 3ER8A 2ENWA 4GYKA 1H5NA 1XCGB 3A06A 1KNXA 1C8VB 1QRTA 3RUIA 3AVWA 2HA4A 4CM6A 3LC1O 5CA0F 721PA 4I5DA 1ECJA 2E7ZA 5AVYA 1RE1A 1UKYA 3LH5A 3NYQA 2ZRKA 5TMDA 3ZWXA 4BN4A 4E1VA 4RVHA 5EIOA 2HUPA 3VSCA 1G8PA 2O7VA 1I2MA 2ZE6A 4M1SA 4ECAA 3QQ5A 3CX4A 3ETCA 4WUTA 2D5CA 5L3QA 1NASA 5DI3A 5HCIA 1E1QD 2BEJA 3TOXA 1H2FA 5IF3A 1M34B 2FUKA 4BNXA 4I19A 1DBQA 3KVRA 4LX0A 3Q9NA 1SKYB 3HDJA 1C1HA 1P7PA 1WV1A 3HMKA 3NAQA 5MN6A 3EXFA 3WDSA 3R5FA 1AUVA 1DDIA 1UDAA 4HDOB 1UAAA 4GU5A 3V8BA 3WIUA 5AK6A 3RSQA 4NY1A 4CMJA 3RS9A 1HE5A 1JLSA 4QFDA 2ZB4A 4BVKA 4RVDA 2RGXA 1T9BA 3DZ8A 4HMOA 3AVOA 2FP3A 1WL8A 1XU4A 1DTWA 4NABA 2PX2A 4PLTA 4K86A 3H1GA 4L2IA 4PX2A 4BIMA 4M76B 1VCOA 1WD7A 2AYXA 1S2OA 1G7SA 2DUUA 2MYUA 2SHKA 5E1DA 4D8TA 5IKPA 5JAMA 4HDRB 3FOAA 1RKVA 1ZN8A 1ZN2A 3NW9A 3T3PB 4YRBA 1BN6A 2H92A 2P91A 4B87A 2Y1KA 4J7AA 4OGFA 5HDQA 1QYDA 3VDMA 2XMZA 1HE4A 2DPYA 3NXSA 1PKXA 1XQ1A 1ZH6A 2P6MA 1CJTC 3DE2X 2Z9DA 5J4VA 3PKIA 1D1SA 4TLEA 4TT3A 3J81k 1FYWA 1PQYA 3DF9A 1QHYA 1TTQB 1GAQA 2VRNA 3I1IA 3MUFA 5CTAA 4D80A 4YMVA 1OAAA 4ZMBA 4Z4EA 1CULC 3F9IA 1WB9A 1UZMA 2XIJA 4NBRA 1RWXA 1U7PA 5EUCA 5AXCA 1MW9X 4GR4A 3SDSA 4BCCA 3C8MA 5TVKA 2AN9A 2NSHA 2P41A 4JR2A 1XAJA 4RPHA 1E4EB 3AEQA 3AHFA 3BBLA 3WL3A 1U5BB 3BJMA 1PWHA 5HSGA 1QDUA 5HOEA 1N2CE 1T5OA 2VJMB 4FI3F 2GZ3A 3JD4A 4D9GA 1Q1NA 1BU5A 3QHAA 1EQAA 4OHKA 4RK1A 1KZ1A 3FLAA 1CHNA 3A2LA 1VSVA 1ZN7A 2G7MC 3IVAA 3ASYA 4O1IA 4JP8A 2IHJA 4PSUA 2CUTA 4LJ7A 4F5ZA 5DNWA 1ZQ9A 3W90A 1NW8A 3B1FA 4Q3OA 1FCJA 1MB9A 4CN8A 2ZUVA 3Q11A 3PCXA 4XKJA 3P0IA 3A6EA 4QU0A 3LPDA 4PYQA 3TTSA 4NYIR 2GN8A 4QXAA 3BZBA 4UXIA 1X15A 1K5GA 1G7TA 2B35A 2HGZA 2JA2A 1QMGA 2O8CB 2EV9A 2JZCA 5IHPA 2BEUB 3BC1A 2ZQZA 1T8SA 4R98A 3T7JA 4Z5XA 3MT0A 4CIAA 1ESEA 4ABTA 4D8YA 5AXDA 3V2IA 5FWYA 1V71A 1XZDA 3CPSA 4GRIA 5CA0A 4K6OA 2A57A 4DILA 2HHCA 2AG1A 2FK7A 2QVYX 2W7TA 2E4UA 2Z2XA 2IHVA 2DR2A 4GYWA 1KOLA 3AJAA 4PHTA 2OTCA 4QPPA 2HK6A 5CDTA 1AXEA 1MV8A 3D6TB 4MQEB 1ZI6A 2C00A 2W6IA 3FTCA 1P9LA 4Q3BA 4A3SA 3HCEA 3UBTA 4BNMA 3OP4A 3LY9A 2C7GA 1XA4A 2ORIA 2ZBGA 3KPVA 3ISJA 2H2WA 2E4XA 3FI9A 1AM4D 1PEAA 2DQSA 4ARUA 1BWQA 1NE2A 1WPQA 1G21B 1KZYC 2DUNA 2PZMA 3JQ6A 4KX5A 4I0WB 4LDQA 3PFHA 4IW3B 5CLGA 2O57A 2V7WA 1H85A 1RM5A 1HXHA 2H6EA 4X8HA 1V7PC 1NW5A 1RR6A 4WWHA 5ILGA 4OI1A 3V6MA 3JR3A 5LIRA 3HZRA 2EDAA 4CYMA 4PZZA 1JFRA 4ID3A 1HQYE 1Y1TA 3B6ZA 2PKQP 3JV7A 3ZH2A 4M8IA 4KO8A 2W2OA 3Q98A 3ESXA 4KVAA 3C6MA 3RTBA 2BBWA 1STOA 2V96A 4C7XA 1PVVA 1GZ7A 3G8AA 5JLJA 1IBLB 3L7LA 2AVDA 3A1FA 2K7ZA 2RHDA 3CG4A 1NXWA 3O8LA 4ND5A 4MVJH 5B4VA 1BRMA 1KJ9A 3RS5A 3A9VA 3BQNB 4TT3D 4MYSA 3A1TA 4MGIR 3O94A 1ZC4A 2P5TB 3G9ZA 4QL3A 1UWKA 3T4XA 4PG8A 2PA3A 1PFQA 4H1UA 5H5JA 3OLCX 1JILA 3LT4A 2Q7DA 5CYFA 3BERA 2CNDA 3CQ9A 2Q7OE 4CKBA 1D5CA 3QKIA 4OK6A 1TM2A 2CJWA 2H1FA 5FTMA 4R1OA 1DFIA 4KUEA 2YZMA 4C7BA 2CLDX 4JYBA 4DN6A 4RLSA 2ANBA 2P6UA 3LE8A 3SNHA 3K73O 4DJJA 5JXGA 2R5WA 4OP2A 1O8CA 3OEHA 3OE5A 3H9GA 4DPKA 2I34A 3WISA 1SUAA 1HDEA 2CL5A 4L4ZA 3KJZA 5REQB 4CKZA 1SBZA 2XB8A 3IDOA 3UJNA 2JRCA 1YJQA 2BBOA 4EW3A 4EJ0A 1QTQA 1LDEA 4M0FA 3IA2A 5AKHA 3HKBB 2F1JA 2R4TA 3D0RA 2JFZA 2BWJA 3WKDA 2Y93A 2XGJA 1NF2A 4DDTA 2IZ5A 3H3JA 3L1VA 3NZEA 1YF3A 1JTVA 1DC4A 4HSEA 3GR6A 4XDYA 1B23P 1LI7A 1CRZA 4TV8B 4UW9A 3GJXC 5DT9A 4WINA 1L3IA 3TEJA 2Y1CA 4JH0A 2O1XA 4YB8A 5DSTA 5LJIA 4CL8A 1UK9A 2A5JA 2FVXA 4DLNA 1FLAA 3UJBA 1Q1GA 4M1ZA 4YO8A 3TI9A 3CGWA 3H11B 3DO8A 2FX3A 4MS4B 4DNXA 1YT5A 5K0ZA 4MDEA 3QZUA 1VL0A 2CMHA 3R77A 1VB5A 2XB9A 2X8AA 1JWLA 2Z1NA 1X87A 1O5IA 1C30B 2WJGA 2PQ2A 2HNKA 5IVPA 2PS3A 5AW7A 1ND5A 2I55A 2GEKA 2J33A 1RYFA 3CZQA 2M9MA 2AJDA 4K9NA 5LLDA 2G83A 3UJ6A 4FMDB 4P3PA 4CG1A 4G6ZA 1TO2E 9MHTA 3GV0A 3K9FC 1D4FA 1IM8A 1GGJA 4TLLB 1FIUA 2FUNB 2A5FA 3N07A 3C6XA 1MX5A 4RAQA 1AUQA 2CMKA 4PNPA 4MWCA 3PXGA 3OQPA 4MROA 1C41A 3BX1A 3T7IA 4TM7A 3JAKA 3GCGA 1S2GA 4IGIA 1GN8A 3QFSA 4I99A 2V7UA 4RZHA 4TTIA 3WR5A 4XWOA 2HWXA 3ZJVA 1ONNA 2TMKA 3BD8A 4U8HA 4KHZA 2IYOA 4RFSB 3I9OA 1JHQA 2GEBA 3EHEA 3HMQA 4UVEA 4B4KA 1WU8A 4B3MB 2WNSA 4ND1A 4Q9JA 2XOXA 4Z7JA 2VCEA 4ZTUB 2QXUA 3COPA 3ISVA 3PSAA 1JR2A 2BL4A 3FCAA 4LTNA 5J4LA 5C53B 2QLLA 1VYHA 4L22A 1N1EA 1QTIA 3AZQA 2AK2A 3IIIA 1AA9A 3H9UA 1LRLA 4RMHA 3E9RA 1HM5A 4DM7A 2GFQA 4YJGA 1S2MA 5AUQA 3BKXA 4BCBA 3LCRA 3SDZA 2JLYA 4LHEA 3LUHA 1GKYA 4F72A 4DT1A 4QM7A 3GFTA 5GIPE 1C7ZA 1JALA 1ODLA 5HGJA 4G65A 1T5HX 2LBPA 3C1OA 4UMVA 3VNRA 4MPPA 3T5PA 1M2OB 1K7FB 4TLBA 4C88A 1N34B 1DCMA 1LPPA 4Z1MD 1AKRA 3NONA 4I55A 4ML3A 4MWZA 2QUKA 3L40A 4DVGA 2WUFA 3N9IA 4DZZA 3T3MB 2P79A 2P9ZA 4J16A 4AKEA 1QP0A 2OKGA 2YZ7A 4PSDA 1UIMA 2ODNA 4MV8A 2EAUA 2ATCA 3BGIA 1D6MA 2WWVD 3LLMA 5CPFA 1FNNA 2NGRA 2QR5A 4UAUA 5AUOB 1WDLA 1Q0LA 5C8XA 4EGAA 4EVQA 1FLVA 1PK8A 4EI8A 5BSKA 1RQGA 3IQZA 3KPWA 2QNIA 1O9BA 2FI1A 4ENRA 3U48A 1WPRA 3AUSA 5CXXA 4E5MA 2ZT8A 3ZCVA 1KYXA 3OZBA 1R4ZA 2GFIA 3CY6A 4JBXA 5KYUA 4B75A 1Z8NA 5D86A 3VNSA 4EG0A 1HDIA 4E5VA 2PBZA 3ELBA 2WYIA 5C8YB 3VYWA 2VR1A 4JFAA 1ZD2P 4OBXA 4NU0A 4LJKA 4Z1OA 1XBTA 1VC2A 2J3MA 2IEGA 5AW6A 4PIMA 2IK8A 5JSHA 5LJLA 4XUEA 3MCWA 3GZJA 1QCYA 4HVTA 5TGTA 4ZYYA 1HO3A 2JFYA 3DMPA 4FYPA 4G89A 4LRYA 5T3UA 1GNLA 3V1LA 1T8WA 3QJYA 3ZN2A 1AV7A 4TYNA 3LF1A 1RABA 3CVWA 3R4CA 3D8NA 4BB6A 2FVYA 3RFXA 1E7SA 3TB4A 4RCYA 2YY5A 5IZCA 4YY3B 1YR3A 1VLVA 3GLIE 4R9NA 3STXA 1KOFA 2VFAA 3QE4A 4F9GA 3R0QA 1Z4NA 3AIIA 5FR2A 3WYGA 5AJTA 1O7JA 1JTFA 2ZJ4A 4TVKA 2NUPA 4D42A 1NMSA 4X5OA 2O3SA 2GDJA 4MW6A 4ILKA 4EB6B 5JHHB 2H2DA 3ADPA 3UCXA 3ZZNA 3L1JA 5LD2B 2XZPA 4P8RA 4JIMA 2PFSA 1P4RA 1AS3A 3UJHA 1CS0B 1TVKB 3QWBA 5JY6A 2JARA 1C9JA 1IIRA 1MGPA 3ZJ4A 5C7IO 4E11A 3ESCA 4EF6A 5CFRA 3T3HA 3IUYA 2H0RA 4US0R 2GTIA 4GI3A 2GR9A 2JBAA 1GUAA 1H2ZA 3SXPA 5IFLA 4CF5A 2IRWA 3PVCA 2OBYA 4M22A 5JOQA 1Z88A 2YQ5A 4IJMA 4UBNA 1NVUQ 3ROEA 1UOOA 2RAFA 4W82A 3SPXA 3CKKA 5AUPB 1BRTA 3D1LA 3EC1A 3HR8A 4ITUA 4UEJA 1GAWA 3A3PA 5AQ1A 4AS3A 1QF9A 1QIJA 3H5OA 5CJPA 2RBEA 3AVTA 2NU6A 4LBZA 4CLHA 3JYNA 4CMAA 3EZLA 1E6LA 4C0JA 3CB2A 4RBNA 5DEIA 4DAOA 1SD1A 3L7KA 3T0GA 4RFSA 2I67A 3IMKA 3KO8A 3MA0A 5B1DA 4NBNA 2XHZA 4PG6A 3RVRA 5A1TA 5BNIA 3TS1A 5CVCA 3JYPA 2J0UB 5C8YF 3U19A 3T5MA 3AF4A 4J4TA 3OIVA 4AG6A 3OE1A 1M54A 1MG5A 1G8KA 2BC9A 2ZUCA 3H7AA 4OQZA 3LL4A 4P3KA 5EEHA 3TLJA 3AL3A 3BM5A 4TWRA 2JBHA 3KB1A 1QFZA 1GPKA 4N0EA 4DRYA 5BSHA 1BYIA 1BJTA 5HK8A 5J4HA 2E3JA 4RWEA 1BX3A 4XJTA 3A1UA 4FS3A 4G37A 5IULC 1QHEA 4EG3A 2QRPA 5JVDF 1BVUA 1TCVA 3W1VA 1X7ZB 3TSCA 2XKJE 2JJ8A 3TW8A 4RHYA 1TF2A 1U0SY 2ZBVA 3G0BA 4RANA 4YWHA 4EG8A 2C5BA 2I4LA 2DT8A 3N1UA 4KBFA 1WDWB 2Q2QA 2V6BA 3IL2A 2HWWA 2MSLA 1VCMA 3IO3A 3AUYA 4UULA 3CF0A 2ZAMA 4I50A 4OM7A 4HT3B 5IANA 2JIMA 3WRWA 4E7OA 1SBYA 2VBCA 2VK8A 3A4YA 2QAGA 4WA8A 5B53A 1OLXA 4PXSA 1HLGA 2CXXA 3U3KA 1F4PA 2W42A 2HRBA 4IICA 2WSSD 2PR7A 2WYVA 1VIDA 2PBLA 3EEYA 3IGFA 4RFLA 3TLKA 5BV0A 5CW1A 1XMIA 5ITSA 3EEQA 4LY9A 4YJ3F 3LT0A 2IHBA 3DONA 4I8IA 2YMQA 1O08A 4GS5A 2FSSA 2FQXA 5CH3A 5DLQC 3QSYA 3P52A 3WMFA 2BM9A 2AMYA 3RJ5A 4WKBA 1PL7A 2MR6A 4U6NA 4XQCA 1R9MA 3ROZA 3GGDA 3C5EA 3UQYS 3CIOA 3M1IA 5AKGA 3D5QA 1Y8RB 3O8DA 5AJUA 4JC0A 5BQXA 4Q12A 2PIDA 1A72A 3OPYA 1DPGA 1BROA 4GMKA 5E2BA 4ZN6A 1XYYA 1OB2A 3RREA 2FWJA 3Q6NA 4NBUA 3CBGA 4B3DA 1MAUA 5C1PA 1JA9A 4R2MA 5JARA 1PR4A 4AWXA 2POQX 3IMGA 1Y1SA 3DVLA 3LAWA 3OEED 1Z35A 4HAVA 5FYQA 3X43A 1PX0A 3L0OA 5AM4A 5B1YA 4GAEA 2XB2A 5IMSA 3LP8A 3GCWA 1PNOA 1QVAA 3C3YA 3TAUA 2QD1A 3V7YA 3AY0A 1JFSA 1CCWA 1WHTB 4P7JA 3OHPA 4JL6A 1DX9A 2VAWA 3VI3B 1KEUA 2YBEA 3G2HA 5GVRA 2NXEA 4IDQA 4K87A 5DNYB 4K9RA 4IPTA 2MDTA 3DZIA 4DMCA 4UBKA 4IMIB 3A31A 4Y6LA 4K2HA 3BH7A 5A9RA 1JXMA 3SKYA 2VNIA 4O5OA 1J20A 1YJ8A 4M38A 2HRQA 1CKEA 1NVWQ 4RADA 4WA7A 1XK7A 3S2IA 3UIEA 4AZVA 3N2EA 4PM4A 1G8AA 2XOKD 3AMVA 3SJUA 1KFJB 1MC5A 4EB8A 1NU6A 1GTJ1 4NPCA 3WQRA 2SKCA 3P26A 5CR9A 4XIFA 2W4MA 5CD9A 4HLCA 4EW2A 2B1JA 1FFSA 3DYBA 3AP1A 3TDMA 2OC9A 1U9YA 4XVCA 4XVQA 1IZYA 2PSEA 1CLEA 2HSWA 3DW3X 3EVAA 2O2ZA 3HBFA 4FHEA 4WN9B 5DXJA 1S3FA 1V95A 3TCKA 1RYZA 5IZ4A 4YBZA 3PDUA 1QCDA 2L0XA 4XVHA 3RKRA 4NBLA 3HVRA 4LJRA 2AXQA 2LR0A 4JKYA 5FFMA 1E5XA 3IE1A 2E55A 4IX9A 4PQEA 1RQRA 4YRRA 4ZOBA 5LBTA 3ZTTA 1G66A 1OXUA 4R2HA 5AKZA 3EXHC 5IDQA 4IJQA 4Q4DA 3TOVA 2JANA 4EVRA 3GK3A 3U7QB 1I0IA 4O2LA 1D0IA 4O2BF 3TIGA 4A36A 1APBA 3E0QA 3I9NA 4CV3A 3HYRA 3W7BA 4C0QC 4XYGA 1GPMA 1U2QA 1P5ZB 1YB5A 2ZBPA 4EHBA 1U63A 2EIHA 4OATA 1G8JA 5LVAA 1O6GA 1E2PA 1TVCA 2FPRA 2V54A 3W8FA 1LSSA 4TTAA 1OBVA 1OLSA 2ZYGA 2GNAA 3C3WA 1JYSA 4DR1B 3UZUA 3NX4A 3U37A 3TX2A 5F9FA 3GT0A 2XKAA 5EQTA 4BAGA 1J2YA 3DB1A 2DPGA 3C16C 3HB9A 3FGOA 3QJGA 4E15A 3X1DA 4BWVA 4FINA 3A4LA 3TB6A 5A6SB 2ACWA 4YP1A 3DBLB 3Q0EA 4LXQA 2PU5A 1IXKA 3TVDA 1PLKA 3B5JA 1FTGA 1M34E 3FPHA 3V3TA 3JWJA 5ALLA 2P3QA 4EYSA 4F2HA 5G2OA 2IXBA 2FMXA 3DG9A 1Y1LA 5FO1A 2UYCA 1MX1A 3Q72A 3SQLA 4B33A 4TVSA 3ZE9A 5BSWA 2FZKA 5JD4A 3KZ1E 3IFSA 1RAEA 1QFMA 2XADA 4X1IB 2Y27A 2M1ZA 1J8FA 2EKZA 1FF9A 1KR5A 3CNEA 3RRFA 5GINE 2DETA 2QRLA 4HF7A 2TS1A 4AJIA 3OJEA 4PPNA 3IILA 1KK0A 4B3FX 3K15A 3LX8A 4KMRA 4B4UA 3OF3A 3W2EA 5LP6A 2P3LA 4CR7A 2I6XA 2K4MA 3EK2A 1AGPA 3R8XA 4D46A 1CRLA 2EU8A 3I53A 1C1DB 3D0QA 2BV3A 3ZV6A 2NWQA 2HA6A 1U9IA 3JQ7A 4L28A 2XUFA 3KUKA 3QVUA 4PLPA 4R9SA 4RYDA 4X1KB 6ABPA 2JLZA 2IXTA 5U4QA 1AG9A 2B3TA 4PQFA 1E8DA 4RTJA 3HKDB 2O0HA 4H27A 1FL9A 1MDFA 1U4SA 1Y1PA 1FRNA 3P94A 4P82A 4WSOA 4KI0A 1Z37A 1JV2B 1WMEA 3VX3A 2ZR9A 3K09A 3AY6A 3UV3A 3AL0C 1CK4A 4C6RA 4YLYA 1EYZA 1K5PA 1N6IA 1EPUA 1M2EA 2ZRLA 3OM0A 3HVIA 4OG2A 4RESA 4UUBA 2GBIA 1BWPA 2XJ4A 4G07A 2NUTB 4YAFA 1Q5PA 5J2UB 1WF6A 3TBKA 1NI3A 2I33A 4MGYR 2Q3DA 3D8SA 2X5XA 1NBOA 4G0NA 4GLOA 3E3NA 2PS1A 2CV1A 3THYB 1ZIDA 2FSIA 4K7JA 1LTQA 4BGIA 5AWFC 2NACA 2GZAA 1T1GA 1MB3A 1SKUA 2WYWA 2VUHB 4UXJA 5GVSA 5KC8A 3TIVA 1YXMA 2IZOA 1HF3A 2N1BA 1QQTA 2PA0A 4RCVA 4REQB 1CR0A 4KO3S 2BTEA 1RWQA 5IC5A 2JLAA 3N3BC 5HJ7A 1NYQA 1PW5A 3GJ8A 2DBQA 4WBNF 2EP7A 3G6WA 4BB0A 3ASVA 1A3CA 3GVXA 2CUNA 1ZJYA 1TIBA 3SR4A 4E03A 3I5XA 2L19A 4NYJR 4S1TA 5IVHA 4ZP1A 4ZJUA 3ORRA 3WZMA 4F4CA 5FUQA 1SVWA 4UQOA 3KP1A 2PSDA 1EJ0A 1L5WA 2CC2A 1VG0B 1P2TA 3B8EA 1DC7A 2QLTA 1NDUA 1CQJB 2FP4A 2IELA 4OH7A 4P9NA 1U2TA 5CNMA 3M6WA 5ALQA 3GRKA 1GO2A 4YC7A 4YFYA 3ZZ1A 3R5XA 5AW8A 2CHGA 3WMEA 3N5CA 2J0QA 4BOYA 3KTFA 5K01A 1G63A 1RKBA 2VDQB 4F71A 3ETDA 1SHZA 4KN6A 3O8RA 3KXPA 3H9JA 3I92A 3PXXA 1F12A 1CUEA 3CE9A 3ELYA 4IWYA 2JGAA 3OA2A 4AZTA 3VR5D 5U9CA 4WNYA 1K3UB 3D9QX 3IRUA 3VSEA 3HQ4O 1JDPA 2G9VA 2JDIA 4E51A 2H4JA 1VMKA 1G9TA 1LPBB 3VTFA 2BEVA 3OIDA 4LNHA 4R51A 3G2IA 4DA8A 4PLZA 3HUEA 2WF8A 2W0SA 4L5AA 1II8B 4OQQA 3U3JA 4D26A 4WGGA 4IGEA 4YA6A 5K9ZA 4CV0A 4WZBE 3UT6A 4BV3A 5HUQA 7AT1A 2NVWA 4EY6A 3AHEA 2O6LA 2QTHA 1O8BA 1RXIA 4HTFA 2QENA 4M98A 3I5YA 1U2SA 1WG8A 4WNAA 3L7MA 3OZRA 1YU9A 3C8UA 1RI5A 2BKUA 3SD7A 1BZYA 1QPBA 2REQA 3N7TA 3O75A 4U7PB 5FNVF 1NHGA 3WSWA 4AY5A 1GR1A 4OQXA 3OUUA 3KYIB 3NAGA 2QJWA 3KJEA 5HIJA 1PLLA 4BQIA 4YP5A 1I4TD 2PX5A 4QE3A 3GZNB 2GPYA 4H1WA 1DQYA 2J4DA 4INZA 4FMPA 2G28A 2HQSA 2X1VA 2ZG6A 3NIBA 2F3TA 4CUJA 1XWWA 2GTPA 2VXBA 4LOKA 5HG0A 1Y9ZA 5TV2A 4B81A 3F9RA 1CJKC 3ANXA 3BCUA 4DSOA 3HG7A 5JADA 1PJLA 2IYNA 2F7SA 2C2HA 2CXRA 1QOZA 3B3QA 1RZRD 3V8NA 2OR3A 1MO2A 3C1UA 4JSRA 4ZVUA 1SKAA 3GD7A 5BSMA 1TU0A 2BONA 4B2LA 3PIDA 3ERCA 4DLZA 2WSSA 4PX3A 4FGKA 5EA2A 4B85A 2QY9A 5HNKA 1H3NA 2FRDA 4KWTA 2COEA 1KBQA 4PHHA 3CGGA 1YR2A 3HB7A 1CX9B 1E1YA 4QEKA 4N6NA 1OF1A 3AKDA 4V0OA 3FCUB 1VJ1A 5D3MA 4EYQA 4V1CB 4OGKA 4LSGA 4EATA 3F6PA 2IH2A 4JI8B 4NENB 2GH1A 3DEFA 4LWOA 1NRXA 4N01A 1ZNQO 3CRNA 1R8SA 3VR6A 1IJFA 2XSZA 1OPRA 4PZAA 4RD3A 5DHAA 4NCIA 1Z45A 3SLKA 2XNHA 4E2FA 1E5TA 4X8OA 1P31A 3GFPA 4ZDWA 1H0RA 1GUZA 3LPAA 4MVJF 2HI0A 1VMEA 2VTEA 2JFNA 2Z83A 1MU0A 2G6BA 3N7UA 2HF2A 1Q16A 1PGNA 2CDNA 4WESB 4J0DA 1P60A 2BFEA 4MKIA 2DYKA 5JAQA 5FEMA 3ROXA 1THZA 1XRSB 1JIKA 3NYRA 2RB5A 2ZRDA 4I4TB 4DJTA 3SC2A 2V7PA 2NAPA 4F3NA 4UATA 3HO1A 2E6UX 4NCXA 5LPNA 4GX0A 3T4PA 1P3JA 2EW8A 2XVZA 3GRPA 3OFJA 3RVQA 4H1HA 1NLZA 4Y6PA 1SIWA 3RAJA 3LDHA 4B80A 1CUHA 1YCFA 2KLHA 2ERXA 4AUKA 4QATA 4X62B 1EU1A 4H15A 3SSNA 2TMYA 3GLTA 2DBVO 3QGMA 4DRXB 5AT1A 2V7GA 2WJAA 3MWDA 4FFSA 1K8YB 2HW8A 3K6SA 1II9A 4IQFA 5AXAA 2AR7A 1MUUA 4HGZA 3SVLA 3TW6A 2AMJA 4PZPA 5D1NA 3QW2A 4S1VA 3QRWA 2NUPB 4UNPA 5BV8A 2AE2A 5LOVA 1GPDG 2G40A 3V8VA 4LTDA 4K6CA 4ND3A 1M0TA 4YCMA 5AESA 2D7DA 4UTZA 4F4DA 2FZLA 1KR2A 1WXWA 3FCYA 1NJGA 4IUDS 3PQ6A 3PXEA 1NW7A 1AF7A 2GVDC 2WIFA 4OB7A 4TS4A 3VR4D 5FV4A 4HWSA 3RSHA 5ES3A 3RH0A 4BMVA 1NBEA 2XUDA 3H2SA 1OX4B 3MUNA 4FR2A 5IS2A 4X97A 3N05A 5ALKA 2DTDA 1Q0UA 2FEOA 4MMZB 1FS5A 4MW9A 1PL6A 1E32A 1W9MA 3UK7A 5JMWA 1CC1S 2BJHA 1JHRA 4KQGA 4QJ5A 4AB1A 1R5OA 4KE6A 4UAVA 1E62A 1KVUA 1SBNE 1PS8A 1VHDA 2FPIB 2R86A 4FGZA 4QEZA 1VG8A 5JEEA 2GQ0A 2GXQA 5GGYA 4IJUA 4PX5A 3G9QA 2HZ7A 2PYDA 2R6ZA 1ECLA 3R6LA 2EBWA 3TTXA 1ZIOA 3D2CA 5D3KA 3CRVA 3HP1A 3PHCA 3IJRA 5FV7A 3KAQA 2OMKA 3U5ZB 3FYDA 2JVIA 1QIFA 3NDIA 4MVJI 1QHHA 3OT5A 1DJPA 1QDLB 3FLBA 3IBTA 4URFA 3HWRA 3AFMA 3M6AA 4KPFC 4C87A 1Z7EA 2MSCB 3BMOB 5C7YA 2ONCA 3CUUA 4X90A 5J23A 2XITA 3FOFC 2QN9A 1I94B 1ZLYA 2IBSA 2NSJA 3QU7A 2I65A 2CXSA 1L3CA 5CX1B 3KXIA 4M8LA 4JCCA 2W48A 4TQGA 1Y5LA 2PEZA 3DHWC 5C3MA 2HT1A 4O6VA 2JIRA 2Q8QA 2QTBA 3RTDA 3A4IA 2KM1A 4AK9A 2CL7X 4BEJA 4F21A 3GT3A 4I3GA 2JLVA 4MZXA 4I50B 5LU8A 3M6IA 3FROA 3IRVA 3ZEIA 3RVKA 4MV7A 3EZGA 2HCFA 5BN3A 4PO8A 2WD8A 2WE7A 2WD7A 3WKBA 2F90A 3BZUA 4RZ3A 5T67A 5ICSA 2CV0A 1QAMA 1ZM7A 1B0ZA 2ORVA 3Q2OA 1DCFA 1ND6A 4IDGA 1SPXA 2VHXA 1EVEA 3GLIB 2PSFA 3LXXA 2ZAIA 1RU3A 2ZSFA 4LXHA 5DJ5A 2PLAA 3A1WA 2H7CA 4X95A 3FHTA 2AXEA 3OJFA 4L8VA 1X80B 2X7JA 1CDDA 1LX6A 3C45A 3ETGA 3L7CA 1GKIA 4R1MA 1RJWA 5IC6A 1FFAA 3QFTA 1E3EA 3Q7RA 4E30A 1T1SA 2QN2A 1B14A 1CHDA 1N2ZA 3EDQA 3LYAA 5JDCC 3VHLB 1WWKA 1GNPA 2IOFA 2JFHA 3E03A 2W6JA 2LD4A 3PXAA 4JT2A 2XPCA 3JQFA 3A6JA 1V9CA 2WINI 4MR8A 2ECPA 3EF0A 3FTPA 3GVIA 1KFKB 3VV3A 4A26A 4Z86A 4RYLA 1HC7A 2QL7A 2OE2A 1GRVA 1O3YA 1SC3A 3GUUA 5I8ZA 4UM9B 3HWSA 2DHQA 1ISPA 5I9MA 2N3ZA 4CT5A 1JDSA 7GPBA 3TNYA 5BVGB 1MT3A 5KHAA 1U0BB 1QE3A 5GTDA 1TJ4A 1H5UA 5TF0A 4MDYA 2XJ9A 4XDZA 4O4HF 1Z6YA 2RKBA 1XZMA 4XAQA 4CXMA 4NV3A 2AJTA 1V8BA 2J1LA 4N5HX 1M5RA 4LF6B 1M0WA 4XRRA 4GKBA 3FIJA 4NJMA 4U2EA 1T0BA 2IDKA 2R79A 3LUKA 4MQFB 4OU4A 3TCXB 4I3HA 3O2NA 4B4VA 4TSFD 5JJ5A 3QF4A 3FYSA 3RI3A 5B55A 2ETVA 2LW7A 1HSZA 3CN7A 1A5BB 3HL4A 5IWCA 4PFKA