3RAPR

The small g protein rap2 in a non catalytic complex with gtp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
167
structure length
167
Chain Sequence
MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the small G protein Rap2 in a non-catalytic complex with GTP.
pubmed doi rcsb
molecule keywords PROTEIN (G protein RAP2A)
molecule tags Signaling protein
source organism Homo sapiens
total genus 56
structure length 167
sequence length 167
chains with identical sequence S
ec nomenclature
pdb deposition date 1999-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rapR00
2AHOA 3EASA 4I1VA 2RGBA 2A30A 2C96A 3LLMA 2KJQA 2JLVA 1Z0JA 1NN3A 4LPKA 3TRFA 3HU1A 1FQJA 4A36A 5FR1A 3KKPA 4CIDA 3L43A 2EW1A 5EJEA 2CCKA 1K6MA 1E32A 3H86A 1SZPA 2AFIE 1NG1A 5KSOA 3ZLJA 1H8EA 2FEMA 1DO0A 2ZI9A 3N70A 2ZJ5A 5F9HA 5KSPA 3RSOA 1OXXK 1SHZA 2VO1A 3EIQA 5JWRA 2C2HA 5DGXA 5ELXA 2YWHA 3B1YA 2C9CA 3BIFA 4DCNA 4OQMA 2VEDA 4JL5A 1TQ4A 3FWYA 5B64A 1W36C 2WJJA 2O8BB 1A2BA 2CLCX 2F1JA 2R6FA 2ZSFA 4RZ2A 3BB4A 1KNXA 3K0SA 2YWEA 3B9PA 2ZROA 2ZU0C 5JI2E 1JEDA 2NO9A 1VCMA 2J0SA 3PEYA 4M1TA 5FUYA 4ZIRB 1ZD8A 1Q12A 3OZXA 5KNCA 2WAXA 1NJGA 4TYQA 5JSZA 2QTHA 5HCNA 1F5NA 1R0XA 4OI2A 621PA 1KDTA 5CB8A 1DE0A 3WNDA 1ESMA 1NLZA 1U99A 1OB2A 2G9NA 2OV2A 2FPKA 4N0EA 5GADl 5A0FA 1RE0A 2V55B 2WHXA 5KSYA 1D8TA 1P2TA 3FPAA 3LV8A 2FJUA 2GXSA 3FKQA 2GHIA 1YVDA 4HAVA 4M1OA 3I62A 1G291 4URYR 5G40A 1HURA 5SZIA 1E94E 2VHQA 4TWZA 1E9EA 3MRSA 2C9YA 1DBSA 5JBQA 1UM8A 1J70A 1JXOA 2ZM5A 2OBLA 3O8DA 4P3YA 2GNOA 1NVUQ 1W4CA 2DFTA 1NP6A 2XZPA 3EWAA 3QNUA 4CGZA 1HEIA 4TZ6A 1PZNA 1X86B 2ZJ8A 4UNSA 2ATXA 2ZRPA 2HF8A 4JLBA 4UXJA 3T35A 2JJ1A 2OILA 3AB3A 2BOVA 4ZDWA 4C0AC 1CXZA 4GP6A 2GAAA 2FOLA 2QZ4A 1KK1A 4C9BA 3QF7A 3ZYCA 3SU8A 3EZ9A 3U4QA 3D8BA 4HB2A 4Q9IA 4M1KA 3GJ8A 3KKQA 2VRWA 1BMFA 1SVSA 2ONKA 1NL3A 2C95A 4B6EA 2RKOA 1LW7A 2WAYA 5DN6D 4GBMA 3TUIC 5AWFC 1XPRA 1I2MA 3GLHB 2IS4A 3O8RA 3B1XA 5H70A 5DYIA 1G8PA 1S9HA 5G3YA 2ZRNA 1UBFA 4FCWA 4PSVA 3U7EB 2IS1A 1QBKC 4HAUA 3VNVA 2GWHA 1AQUA 4LBYA 4DBLC 4NMMA 1W7AA 4Q4AB 3GJXC 1P3JA 3EZ2A 1N6LA 2ZRKA 2ZR7A 4LJYA 2WMNB 4OI0A 1TU4A 3ECCA 4MDEA 2OCPA 2GVDC 4OQNA 2F3RA 3EXAA 4M1MA 3KB1A 3L0IB 1MH1A 4GFDA 2EYQA 3ADDA 2IS2A 4Q21A 1R5OA 4CVNA 3J81k 1JR3D 3U7FB 2IHYA 3C8UA 1SXJA 1MABB 2YWFA 3QSYA 3GJ5A 2CHVA 2F9MA 3KJEA 5BXQC 2DB3A 2YHSA 2NIPA 4FMDB 3VR5A 1Y63A 3GFPA 5CK4A 4ZO4A 1NIJA 3QF4A 3C4JA 3NXSA 4Q1CA 5C2JB 4JLPA 4Q4AA 4XH9B 1VPLA 2J9RA 2H1LA 3F8TA 1WBDA 3X1DA 3V9PA 3ETLA 3B78A 1IXZA 1YRAA 1QF9A 4O2LA 5J4HA 4X8MA 1X8KA 4EJSC 2D06A 1EXMA 4QBHA 1N6KA 2HXSA 2HJVA 4DB2A 1SVOA 2V7QA 4PPFA 5DISB 1MABA 3BORA 3CX6A 1G7RA 4US1R 1B0UA 2CCJA 3C14C 4WA7A 1E99A 3KZ1E 2JLXA 2HT1A 1W46A 1IONA 2GA8A 3EPLA 1DARA 1UKYA 4QJ5A 3W6OA 1C4OA 1GFIA 2GCNA 5FBVB 2ZI3A 2ZVQX 4LBVA 3SEAA 4D81A 1N6RA 3GLFB 2G1KA 3T5DA 2FDCA 1AZSC 1QDEA 1I4TD 1UFQA 2LKDA 1PV4A 4B71A 4N3NA 3IIKA 5HZHA 2C8VA 3THXA 1X6VA 4E5UA 2V3CC 1QHSA 1KHTA 1ZUIA 2W2XA 4D0LB 2WMOB 1CF4A 2EFCB 1KO4A 4LK2A 4DEXA 2MMGA 4DLXA 4DDUA 4MRPA 4NCHA 4NCJA 3MG9A 1L8QA 4LZZA 3SE0A 4D26A 4Q9LA 1OKKA 1IY2A 1NIPA 3BH6A 3GLFA 2X77A 2ZE8A 4I1SA 2QN6A 1P2SA 1XF9A 5KNBA 3LBNA 4JLNA 4BEBA 2DBYA 1ZUHA 5FPHA 1CTQA 1IHUA 5FR2A 5SZHB 1XXHA 421PA 1TQ2A 3LY5A 4E22A 4US2R 3T1TA 2WWFA 2OESA 1T9HA 2GCPA 3CX8A 4EPVA 3TKLA 5KSZA 4ASUA 3H84A 1T3LA 4LC0A 4BFXA 2NMVA 4R9UC 3OESA 5KOYA 3GJ3A 1F3OA 4V0MA 3BOSA 1JEEA 1G6HA 4GOKA 5FBWB 4C0SA 4G3XA 3DOFA 4KU4A 1ZCBA 2ODBA 1AKEA 1LS6A 1X3SA 4NCKA 4OK6A 4YMWA 3DO6A 2CEAA 3X1YA 2QE7D 2IUUA 3KQUA 2WWWA 4CT4B 2QAGB 4XVRA 2MSDB 5F9FA 3K0AA 1U0LA 1OSNA 4RY2A 4IFBA 4Q7MB 1SXJE 2ERXA 3IUYA 3VNUA 2ZRHA 5FTLA 4PQRA 1NN5A 5UKDA 2J0UB 1YR9A 3A58B 5JRZA 1IN8A 2PEYA 4QBGB 3VTKA 5IF9A 1V5WA 2W2TA 3NHBA 1VG0B 3L8YA 1EFUA 1S1MA 5JI3E 2O0HA 2KWIA 4ERNA 3GLGB 4R2HA 5G3ZA 4OK3A 5JWHA 1AS2A 3AVVA 3BH0A 2RGDA 4B32A 2OBMA 2QGNA 1KI6B 4XSGA 4LC1A 2QAGA 5L3SB 3W3AA 4M1SA 4BZPA 4HDCA 1G9XA 1UDXA 2A3RA 4Q1EA 4IDNA 3A6PC 3I8XA 3UMFA 2D3WA 3R8CA 5GJWC 5F3WB 5AR1A 4J0QA 5HCIA 2V54A 3VX4A 1XMVA 3SFVA 2FGKA 4KXFB 1D5CA 4JLVA 3RS4A 5EP3A 2NO1A 1AJEA 4DLRA 4TT3A 3P1JA 2O8CA 5EP1A 1KI6A 2ZUDA 4EFNA 1BKDR 4U7DA 4B3GA 2PCLA 2V9PA 4DB4A 3JVUA 5AK0A 1VIAA 2ZR0A 3FHCB 2GBLA 2AKAB 2VQSA 4A15A 2UZ3A 1EG7A 4BLTA 3W6PA 2BM1A 1ZAKA 1VTKA 2W58A 1ZNWA 4ZCIA 1ZCAA 4JIMA 3T06B 4FMDF 1G7CA 1GIAA 1L4YA 4PO9A 5CITA 1M7BA 4M9QA 1JXMA 5E3HA 3H2YA 1QHXA 1XJ0A 2ZYTX 4BFWA 2P65A 1OXVA 1SVMA 4BFSA 1HH4A 1KI8A 4URZR 1T0JB 1Z6TA 3K09C 2VHUA 3FB4A 3B82A 2G88A 4PC2A 1XXHE 1GG2A 2WOOA 4NCNA 4WXRA 2IXGA 3ZIAD 4WZBE 4G5QA 5EE3A 1UPTA 3QKRB 4B44A 4KVAA 5J47A 2QORA 1CJTC 2BV3A 4L5BA 1R8SA 3PXGA 2OFOA 1HTWA 3M6AA 3A1SA 1COWD 2QROA 3OHMA 4JBYA 4KVGA 4V0ME 4B3BA 1FL9A 2CJWB 4XVUA 2J7PD 1G8GA 2W00A 1Z6YA 3B7GA 1CEEA 1XEXB 1NF3A 3MGCA 2ZJ2A 5DSZA 2CHQA 4PAQA 5H8WA 2AK2A 4NP6A 2EFHB 3FMIA 3LX8A 5BWMA 3BERA 2IF2A 2PZGA 1QHHB 3TSOA 5KNDA 3U5ZB 3SS8A 2QPAA 4IFEA 3B13B 1E4VA 2RMKA 2GEUA 1TQDA 4DSNA 1XD8A 2ZAOA 2VP9A 3DM5A 3IQWA 5DI3A 4IEEA 4C4PA 1GRRA 3OIWA 1J7KA 1T3HA 4KFUA 4DCUA 5CDFE 3QKSB 4HAXA 1HA3A 3QXSA 4PANA 3VKGA 5FL3A 4DIEA 2JIZA 1RKBA 1VG9B 2AKYA 4PHTA 1KY2A 1A4RA 2VTKA 5J40A 2D62A 3LXXA 1Z6XA 5E7IA 1D2MA 3G0HA 2FG5A 5GJCA 4QM7A 1XEFA 1UBEA 3PEVA 1IN7A 1YKSA 4Q1FA 1QHHA 4F4JA 1J2JA 4ZDIA 1W36B 4TMZA 4RZUA 1I4DD 2SHKA 4XWOA 3F5FA 1E2DA 2P67A 4OI4A 2OLJA 2JDIA 2ZRFA 4HZIA 4A82A 4ACBA 1W5TA 2F6RA 2B8TA 2IEYA 5LB4A 2ZYWX 1WP9A 4CZ2A 2QMEA 3QKSA 1OE0A 5J4VA 3I92A 1ZBDA 4U00A 3T34A 3RHFA 1LY1A 1YZNA 3B9QA 3AH8A 4QFMA 1N6HA 4AKHA 1P75A 2CL7X 3KJGA 1XD2A 2EWVA 4TSFD 3S1AA 4EKDA 2F43B 2XEXA 4C0HA 5IT5A 1G5PA 2ERYA 3B8HA 2XJ9A 4TMWA 5ANRB 2QMHA 1Q21A 2CNWD 5JS7A 4KI0A 4IXNA 1FUKA 4TL9A 1IAQA 5LPNA 2IWRA 2NO7A 2XITA 3KTAB 2YOFA 2FMXA 4AD8A 3QPUA 2HJGA 2BC9A 4NTZA 2QQEA 4MKGA 1UF9A 2HYIC 1YRBA 3CB4A 3JZAA 4B75A 4BZQA 3QI2A 1UADA 1W2GA 5FOWA 1WDTA 2YOGA 5EP4A 3AP2A 2N1BA 4BFTA 1A7JA 1P4SA 4MYUA 2XZLA 4M9SA 4B76A 3Q85A 2WWIA 1CR1A 1XMIA 2JJ8A 1OXTA 3TIFA 1KSGA 2ZPTX 4IOMA 1Z0DA 3RS7A 521PA 2ZJZA 4W5WA 1PJRA 3DZ8A 3OIUA 5L3RA 2C98A 1E2QA 5CM9C 2OZEA 2GZHA 4IW3B 3T1VA 1E1QD 4JLJA 3RDPA 3ZZ0A 4PHFA 4IHQA 3GLIB 2DFKB 3B85A 2BEKA 3RLFA 3LXRA 3I61A 2QSYA 4B48A 1RYFA 2GF0A 1XD9A 4IVPA 1WQ1R 3IO5A 3EWSA 4TL7A 3ASYA 1U9IA 4ZI2A 4AKGA 2ZJBA 4GZLA 4KBFA 4FI3C 4Q1BA 1Z28A 3OFNA 5JWOA 3AVUA 5EZ5A 4C2UA 2RHMA 1ZM4A 1E2EA 1ESNA 4NPHA 1D6JA 4TMKA 1ZRHA 1ZJ6A 4ABYA 2AL7A 2FH5B 3VR3A 3FGNA 2BIFA 4DDTA 2JJ2A 1E0AA 1KO5A 1SVWA 2P2LA 2GK7A 3TGPA 3QPWA 2WPDA 3AF0A 1FNMA 4PSKA 4RJLA 3BFKA 5HZKA 3ZQ6A 2Q9CA 3FTQA 3B1ZA 1Z08A 4QC2A 4FWTA 1XJCA 1YZTA 2JLWA 2VHJA 3SYKA 4DJTA 4Q48A 3BE4A 2V1XA 3LBHA 1E9BA 1NJFA 3BC1A 4QGHA 5CJPA 1F2UA 2HXYA 4PR0A 1M34E 3AVOA 3N5CA 4Q4JB 1TU3A 3QVVA 5BW8A 5FPSA 3WRYC 1G3IA 2CLDX 2YOHA 1HQYE 1TUIA 3AF3A 3DVLA 3OEHD 3I32A 1NMYA 4LHYA 1Q1EA 4V03A 3ND9A 2I1VB 4EJSB 5K8TA 2C78A 1XTSA 1E1RD 2O8FA 2MMCA 5KPDA 5AJXA 1RC8A 2FGJA 3EZFA 3NBYC 4WW0A 3HP1A 1ANKA 3W8RA 4LHXA 2I1QA 2ZREA 3I4LA 4Q4JA 5EP2A 2ZE6A 4QGFA 2RGGA 1Y3AA 5JCZA 5CYOA 3BD9A 4IDPA 3ZD6A 3A1VA 1YR6A 3CLVA 3WMEA 4MRSA 3WMFA 1U8ZA 4TLEA 3IBGA 1XB2A 3TAHA 4DSTA 2AXNA 2BEJA 2PMKA 3EA5A 4KAXA 4KV9A 1G41A 3WP1B 4JBXA 3DOEA 3I1FA 4HLDA 4XSHA 3R8FA 3RAPR 2F1RA 4PXAA 1OF1A 2QRZA 1BYUA 2FPLA 4MYCA 3VAAA 3CPHA 3U3MA 3AF2A 4LHVA 2NTYC 4P32A 4C7OB 1G18A 2FNAA 1P61B 1M6NA 2ZE5A 3TBKA 3FYHA 4TYPA 4D80A 3IKJA 4M2LA 1ZYUA 5FOXA 1FPMA 1NG9A 4LX0A 4XVQA 3QENA 1XTQA 1MO5A 3ONWA 1Q22A 2GRJA 2IL1A 2JLQA 1KO1A 3M1IA 1OXUA 3ADCA 1IXRC 1Z63A 1J99A 4HLUC 1XCMA 1II9A 5EUMA 1U8YA 4YXWA 3U3JA 2BJWA 4W7SA 4C0LA 3KX2A 2P0EA 5G53C 3U2QA 5L3QB 1GKUB 4G0NA 2ASEA 1U2RA 2ZUBA 3THWA 3LVRE 1YZGA 5FI1B 3U6BA 1NMXA 2GCOB 3HWSA 2K5UA 4HB0A 1R6BX 5KDOA 4FN5A 5IK2D 4M1YA 4EUNA 3NG1A 2L0XA 4RSGA 5GJBA 4A8JC 1XMSA 4TLBA 5HTKA 4Q18A 1UEJA 4F38A 2FU5C 4NZYA 4C3ZA 1R4AA 1V43A 3PG5A 1TEVA 3SQXA 2QBYB 1XEWY 5L3QA 3TUZC 2QEQA 2R6CA 3CUEF 1R7RA 3NC1C 1GDDA 2GCOA 4NU0A 1KSFX 5FFMA 4KHZA 2OXRA 3CF6R 3H0KA 4URWR 2X19A 4TLAA 5FL7D 2V1UA 2ZTSA 1EFRD 3HPRA 3NC0C 4RFVA 4FIDA 2IS6A 1CRQA 5CB6A 1YE8A 2FFQA 2X2EA 3QXCA 3PUWA 5KO2A 3A1TA 4A2PA 2BBWA 4MA4A 2Q0HA 4L16A 2QRNA 5AUNB 2XJ4A 4WZAE 2IF0A 4TYYA 1U0JA 4RD6A 3REFA 2G3YA 1YZKA 3QOFA 4JKIA 1P5ZB 4Q9KA 2J7KA 4OHZA 3CZQA 3RWOA 4C0QC 3IHWA 4HEJA 4PQYA 5EQTA 3OAAA 1NN0A 3W6NA 3SHWA 5C46F 4V02A 4D4LA 2ZRAA 2AR7A 2GZDA 1XZPA 4DCVA 2EFDB 2OSBA 4Q66C 2XXAB 3PQCA 3ICEA 5DI9A 2N46A 2WJHA 4WIAA 1N2CE 1AZTA 1H8ED 2QMOA 1PLKA 4CDGA 3RNLA 5FUXA 1AGRA 1OT3A 1PLLA 5FOUA 1GNRA 4LGMA 1P60A 3LRPA 2HLDA 2GEDA 1W4RA 2R62A 3TQCA 4ZV4A 2F9LA 1KMQA 1AN0A 4LI0A 1KDRA 2J41A 4JSTA 4OKSA 721PA 1YJ5A 1ZD1A 5KPJA 1QG2A 1P7CA 2IC5A 3T61A 2ZRLA 2J1LA 4ZI3A 4BEJA 3Q5DA 2G6BA 2DHRA 4DLUA 4M4SA 2YZ2A 2I3BA 4QM6A 5AUPB 2O8BA 5FBRB 1HUQA 1RIFA 4JLAA 1DVRA 1ZUNB 2ZS8A 1RRFA 3GEEA 1RVDA 1DS6A 1XP8A 3X1ZA 2AN9A 3HYRA 4ZIRA 1XBTA 2VSFA 5L8VA 3OE7A 3EPKA 4LSGA 2AWOA 3VMFA 2ZRCA 2REBA 4YMTA 4DT1B 1QG4A 4X8LA 1N0VC 2PCJA 4QG7A 5K8LA 4LWZA 2RGNC 5TY0A 3DHWC 2FZLA 5KDLA 4PPQA 3ZGXA 1UDWA 5FUVA 1UJ2A 4TYWA 1CP2A 1OXSC 4HB3A 2IUSA 4DIDA 4ESHA 4A6XA 2ZAMA 2PT7A 4QNRA 3KXLA 1VHTA 4FMBB 1GITA 4PC6A 2DFNA 2IYTA 2PJZA 3P26A 3WHLA 3TNFA 4TTQA 3SZRA 5FI0B 3ZS8A 1N6NA 1ZC4A 4QGGA 3MD0A 2V4ZA 1FMLA 2ECKA 4NYJQ 3LAWA 4LPSA 1VCIA 2ATVA 4FCVA 3FMPB 3PFIA 2EYUA 5B2ZA 3MUFA 4BQSA 2NGRA 5EXSA 4EFMA 2A5DA 5FTKA 1QHGA 2CXXA 4B3CA 3X1XA 1U98A 2PH1A 4YMVA 2NOAA 2VP6A 2ZRDA 4CEJB 3L0SA 4TN1A 4XTCS 1NSTA 1E79A 1L4UA 1DOAA 5IDVA 2R6GA 2JAQA 3GJ4A 5H1YA 3ZD7A 1II8B 1A1VA 4DUGD 3KJHA 3K0FB 4NDZA 1E9CA 1KMHB 4NYJR 3IPYA 4MRRA 2ANCA 1BO6A 3PUVA 2G77B 2VA8A 1E2PA 5L3VA 1VCNA 1G5TA 3QQ5A 1SVIA 2VBCA 3AKDA 3GLHA 3KFXA 3D31A 4OQLA 1AGPA 2O52A 1OHHA 4JLMA 4M1WA 1FFHA 2R6AA 4G5RA 4W5JA 2IW3A 3A4NA 3RS5A 1S4QA 3EC2A 4LJ6A 1T3SA 5SZJA 5BN4A 1II8A 5JMTA 5IRCD 3D7MA 4TQ9A 5AJZA 1KMHA 4G01B 2JLYA 1FUUA 3LWNA 3QG5A 3AEZA 4Y0VA 1SXJD 3AVXA 4LJ5A 1WB9A 1FMJA 1HE1C 4PC3A 1ZMXA 3C5CA 2J59A 2BMDA 3BXZA 2DPXA 1KAGA 1LFDB 4BECA 1W49A 2WKQA 1GNPA 5K8IA 2IT1A 3PUZA 4GP7A 3EZ6A 4OHVA 1NRJB 2IYLD 1Q1QA 3L82B 1RRGA 3E5HA 2OO7A 1Z0KA 1LF0A 1YU9A 2AK3A 3KUCA 1DAGA 3HYTA 3IIJA 3U7GA 4FINA 4O25A 4ITRC 4Z1MA 1EX6A 2NQ2C 3AVPA 2WTUA 2YNMA 3BK7A 1XPUA 2OFXA 4KFSA 5FH9A 1CIPA 1C1YA 4HYYA 3LDAA 1Z6AA 4QRHA 1HYQA 1Q3HA 3R7WB 4AYWA 2Q6TA 4A0RA 2QM8A 3U3KA 3MCAA 3ZVRA 1U90A 2QL6A 1H65A 3K0CC 3ND8A 1W4AA 2RB4A 4BWYA 4G1UC 4PZZA 3P32A 4S35A 3TAUA 3TJZA 2Z83A 1M7HA 1NKSA 1VYTA 2Q9AA 5G41A 4JVSB 2GXQA 4KJZA 3W9YA 1S96A 2ZSAA 3SBEA 2AD5A 1S3SA 3T5GA 4DLSA 1EK0A 3KDSE 4RD0A 1ZD9A 4PHGA 3WXMA 4MRVA 4C2TA 1SKYB 3ZS9A 2RGCA 3CWQA 1WF3A 4P31A 3VU9B 1OKKD 3P4XA 4FMCF 4I1UA 1M74A 2B6HA 2BMFA 4LBZA 1OH6A 5DO9A 1QHNA 4QKQA 2G0NA 1TPZA 4YC7A 1Z22A 3D6TB 4EPYA 5EE0A 2EFEB 1Z2AA 2Z0MA 3E70C 4KFRA 1YZLA 2BCGY 4QBIA 2F1HA 3VKHA 1SKQA 4LV8B 3QPVA 3NEJA 4NKRA 3GLHE 1LB1B 1P9RA 1KNQA 5K8UA 3OF5A 1HE8B 1FTNA 3LNCA 3HPQA 2FSIA 3PJRA 4K8OA 3U60B 2QE7A 3PIRA 3SJBA 2HYDA 1W1WA 4URVR 1N3BA 1Q0UA 4FWIB 4JVLA 1D9ZA 1E0JA 2JLRA 3VR4A 4HUQB 5KU1A 3F0TA 3TSWA 1E9AA 1H8HA 3N2EA 2PX3A 3UANA 4GSYA 2ZIAA 3B6EA 3NBZC 2RGAA 2VP2A 4R71A 3RABA 4GNKA 4MKHA 3RRNA 1Z83A 4KCGA 1T0HB 3K0EA 2QU8A 3Q72A 1T4GA 1OFIA 2J0UA 2ZI7A 4GI7A 2FSFA 1AKYA 2VHTA 3KQLA 5FPYA 4YDHB 2FSGA 2XSZA 4D6PA 2BM0A 2WWGA 3V4FA 1GKYA 1KI7A 1YHNA 1Z2CA 3Q9LA 3SJZA 4RCYA 4QBFA 2Z4RA 3AGQA 3GLGA 2GF9A 2EU8A 4KODA 4PSAA 3AF1A 1QRAA 2H57A 4KITB 2ODNA 2UVQA 4PTLA 2ORIA 5L3SA 2FN4A 2QQ0A 3WBJA 3DKVA 3Q3JB 4QOSA 4KLZA 5CM8B 2IHBA 5KUTA 3TR0A 4FD2A 4URXR 2VPPA 2CL6X 5DE3A 4TT3D 1R5NA 2OFWA 4LCBA 1IOZA 1K8RA 2CCGA 2XNSA 4V0NA 1EESA 4A8JB 1OH5A 2NO0A 5A4JA 1UAAA 3GLFE 2QAJA 1GSIA 3AUYA 1Q20A 2IYZA 1IY0A 3IEVA 3U3OA 2EVWX 2UZIR 3EIHA 3U6KA 1OB5A 1KI2A 4Q9HA 3DM9B 4U02A 3KUDA 4D2IA 4RD2A 1LS1A 3AV0B 1XJQA 4TLDA 5BN3A 3CRRA 1NLFA 3R9WA 4BFVA 1TUEA 2ODWA 2YYZA 3B2EA 3ZIAA 4D0GA 4HB4A 3AVWA 1G3UA 1NN1A 1NI3A 2VF7A 2PL3A 2OT3B 3W3ZB 2E87A 3A4MA 3QE0A 3NBXX 3TVDA 4D4JA 3MMPA 5DHFA 4AG6A 3CH4B 3M0EA 1E2GA 2J7PA 3NDPA 4JL8A 4NL4H 3B60A 2X8AA 2XTNA 3Q7QA 3QBVA 3QKRA 1JQLB 5CYPA 5AUQA 5BYKA 4XD7D 3CR8A 4LJ8A 4Q7KA 2CE2X 2IYYA 3BWDD 4B35A 2D4HA 2ORVA 1JJVA 2CLSA 4BLQA 4IOJA 5C4GB 1J90A 2CJWA 4B34A 4DLZA 4HLCA 1OH7A 1DAKA 3VR1A 1UKEA 3B1WA 3C7KA 3NKVA 1XEXA 5A5GA 2RCNA 4LYHA 1ZM7A 4Q01A 3PR1A 4Q7LA 2GTPA 1TADA 2I4IA 2IA5A 4LDJA 4B3XA 1TMKA 1JALA 2OCBA 2W6JD 4RD1A 4QXAA 4BASA 4MRNA 2PMDA 1VYUA 1G21E 1AM4D 4AI6A 2JIZD 3I3SR 2PJRA 2W0SA 3DDCA 4DXAA 5J4YA 1ZM9A 1T6NA 4N0DA 1F6BA 3NWJA 4JVMA 1P2UA 3C41J 2QT1A 1R0ZA 3QIAA 3DL0A 5J5CA 3TLXA 4DSUA 2QP4A 3CO5A 1BH2A 4IKEA 3NIBA 2ZU6A 2BWJA 2IYWA 4JLKA 5FPKA 3FKSA 3GLGE 2O0JA 1XU4A 3CRMA 3TE6A 4A0FA 4Q03A 4ZKDA 2MSCB 3PEUA 2WM9B 2J3EA 1JAIA 2JDID 4NE2A 4CEHB 2NO6A 1VIYA 4Z8YA 3VHLB 2GDJA 2OCAA 4F4IA 2F3TA 4UKDA 4GL2A 4UQOA 4HATA 2OG2A 4XWAA 2OM2A 2NZJA 3Q5EA 5DNYB 1M7GA 1DAEA 1RZ3A 4H1VA 1RJ9B 4EAQA 1NMZA 2YC4C 5TB5A 1M1YE 3ZZUA 2XNDD 3EZ7A 1SXJC 4B3FX 2O8EB 3BH7A 1DAIA 2FSHA 2W0MA 1E9RA 2IYVA 4URUR 5FUWA 2ZJYA 3AVQA 4MGYR 2GKSA 121PA 1RRPA 3VR6A 2VP5A 1E2FA 2QSZA 4DLVA 1WRBA 2GJKA 4CEHA 4B2PA 1CKEA 1QHYA 3U61B 4LYJA 3EA0A 2GJ8A 1CU1A 4RZXA 3C5HA 2W6ID 2F43A 5GJVC 1Z3IX 4A92A 2GXUA 3CBQA 4C0KA 3PITA 3EPJA 2D7DA 2ZRIA 1ETUA 4DLWA 5JS8A 1W0KD 2G0TA 2BBSA 1ZW6A 2D2FA 1IJEA 2KSQA 2P5SA 3L0OA 3NH6A 4GOXA 2OE2A 3KTAA 1L7VC 2A7QA 3SOPA 2HF9A 3CPEA 4DSOA 4WZ6A 1U94A 4PC1A 3W5IA 1SVLA 2YJTD 3ZH9B 1YR7A 3RS2A 1VHLA 3FHOA 1S9DA 1W0JD 4TTPA 4ARZB 3LQRA 4AYTA 5GVRA 1WE2A 1QHIA 2Q21A 1E9SA 3LX5A 3LQQA 2D7CA 1Q1ZA 4Q1DA 2YWGA 4LV5B 4MDFA 4B2IA 2VSOA 4BE7B 4B2LA 4ON9A 3K9GA 4RD4A 1XTKA 2J87A 1TQ6A 1E1QA 3CNNA 3JZMA 4CRWB 5JHGB 2GJAA 2HV8A 2ZE7A 5JCPA 1DAHA 5DIFA 1GTVA 1E9FA 4E07A 4YQFA 3U7HB 4L15A 3THYB 1FX0B 5DHAA 1KOFA 3K9LA 1EFTA 3VKWA 1EFHA 3BB3A 5F2EA 3GLIA 2B7BA 4RFSB 3N2IA 5HE8A 5FTNA 5C1BA 3DEFA 4CF7A 1N6IA 2QMUA 5DLQC 1XMJA 4AYXA 2JJ2D 4B33A 4MGZR 1I4LD 3T1OA 1MV5A 5HPYB 1G4AE 3AKCA 1PUIA 1CRPA 2WPDD 4LYFA 3OIVA 4BFUA 1NY6A 2NG1A 3DMNA 4DDWA 1GKIA 4TMXA 5JJLA 2BHRA 2ZI5A 1ZM2A 2ZR9A 2Q3FA 3LLUA 3LW7A 3THYA 2O0KA 4ZKEA 3MJHA 4EQ6B 2BVNA 4NYIQ 4AK9A 2KBEA 1X8JA 2R6DA 1US8B 2LKCA 1Q1BA 2GEVA 4RFSA 4JJKA 4L4UA 5FOVA 4OJKA 5B57C 3OEEA 4TTRA 4UJ3A 1WA5A 4L9WA 1ZU5A 4EFLA 3K70D 3G82C 3CNLA 2WJIA 3A4LA 2CDNA 4BLRA 4IOLA 4MUAA 4C0BA 4F93B 3HJNA 1NBMA 1SVKA 4NYIR 4EQ6A 1FP7A 2C9OA 3TSZA 4HAZA 4JSYA 1G3MA 1P6XA 5B30A 1JAHA 2A5GA 3A1UA 1AS3A 1DPFA 2W2VA 2ZS9A 2GXAA 4Q4HB 1NSFA 2B21A 2RAPA 5HR5A 1KKLA 4EJSA 3A1WA 2WSSA 4DRZA 1LF5A 2IXEA 4QGAA 4MUBA 1GOTA 3LA6A 2GVZC 3WYFA 1XDBA 3QKTA 1LTQA 1FOEB 3W90A 3SHFA 3IO3A 2YV5A 3RRZA 5HKKD 1K5DA 3I73A 3BFVA 3UMRA 2AD1A 3O8BA 5EZ6B 4M22A 4F4CA 5GVSA 3ZZTA 2FWRA 2G1JA 4KLNA 5M04A 3GPLA 3PEWA 4DHEA 1P9WA 3GMTA 5JJKA 2EQBA 2Z5FA 1ZM3A 4LUCA 2BBTA 3THOA 2JATA 1VMAA 1ZNXA 3GD7A 5AJVB 3PUYA 1R5BA 2WJGA 1P2VA 4HUTA 3K8YA 5FPTA 3RS3A 1ZINA 2IX3A 2IYRA 4KFTA 5D3MB 3IILA 3MSXA 4QJ3A 1IN6A 3K0CA 4IRUB 3UIEA 4JS0A 4C7OA 2V6IA 2GBLC 2F55A 2YINC 4MITA 3NVAA 4B74A 4A1FA 2CK3A 3GQBA 2TMKA 3GLIE 2BMEA 2ZRMA 1T5IA 2ZSDA 1W44A 2AFHE 2FPMA 2ORWA 2VP4A 2XTMA 3FE2A 1Q57A 3CZPA 4R2IA 4YXWD 3W34A 5D3QA 4DCSA 5JZVA 1KKMA 4LBWA 4PX9A 2WKPA 2ZEJA 4RZ3A 2QNRA 3BGWA 4LJ9A 1N6PA 2ZSEA 1TF2A 5IK2A 3CW2A 2ZANA 3VHXA 1XCGB 1CJUC 1VDZA 1AA9A 1E69A 1N5LA 4BRUA 2QGZA 4P4SB 3WY9A 2QA5A 4JYCA 2XOKA 2JLZA 2QTFA 5EXXA 1RRCA 3H1TA 4M53A 5TARA 3HU3A 4JYBA 5TXGA 4BLOA 4U5XA 4OYHA 3LO5A 3B1VA 1NNEA 4RD3A 1JI0A 4US0R 4IXMA 1IXSB 3GFOA 4AKIA 2IWHA 1L2TA 3MLEA 3IIMA 2QBYA 3IBYA 1NBME 2WJVA 3BBPA 4AG5A 2CVHA 2BDTA 1DADA 2ZRBA 1R2QA 1QZXA 4P4SA 1UKVY 3OIYA 1G5RA 2YC2C 4L8GA 5P21A 5KYKA 2WIAA 3PUXA 4V0LA 1AS0A 2QPOA 4P4TA 4PO8A 4B6FA 1KO8A 1O3YA 2W83A 4RKEA 2BCJQ 3HU2A 1FW6A 3T15A 4DDVA 1PVOA 3CR7A 2LCFA 1XCPA 2A78A 3WNBA 3UMSA 4B47A 1G8HA 1JNYA 3UG7A 1GILA 1YQTA 4JVNA 3DMDA 3CONA 3OAAD 4N1AA 3K9HA 4EPRA 1ONBA 2MSEB 5JRJA 1KJYA 4Q1AA 4AURA 3KJIA 4DC9A 3FFBA 4POAA 2FEOA 4UXHA 4KO8A 3ZDQA 2R9VA 2ANBA 3AF4A 3GEHA 4UNNA 2KE5A 3PCRB 4MYHA 3CKLA 1BOFA 5JSZB 2IYSA 3V4RA 3K1JA 1EWRA 5AJWA 2HLDD 3IEUA 2HCBA 1JR6A 1O87A 2XXAA 3REGA 1G1MA 2CE7A 4R98A 4FMCB 1NVWQ 1LV7A 1CS4C 4I4LA 1N25A 3NH9A 2PLFA 4PPNA 6Q21A 2Z43A 4X8OA 3GFTA 2OUKA 2HT6A 2HCJB 2REOA 3UK6A 2BBOA 4A6PA 2D74A 3DZDA 1Z8FA 2OHFA 1LNZA 1KSJA 3KQNA 1G7SA 1KI9A 2IYXA 3IDQA 2OXCA 3K09A 3GJ6A 1PUJA 4GRAA 4PQFA 4BPBA 2O5VA 1E6CA 2WIBA 4II7A 2BMJA 4AWXA 1VG8A 3TVTA 3BS4A 1A82A 3CX7A 2FE4A 1R8QA 1KI1A 3RANA 4PZYA 1AK2A 1P72A 3OE7D 2YKGA 4C0JA 2GETA 4BGDA 4ESVA 4LJ7A 1F60A 2ZS7A 5BYJA 3AQ4A 3GCGA 1E96A 3UWOA 4OK5A 3SC3A 1S1CA 2RGEA 1NVXQ 1IN5A 2AX4A 4OQXA 1Z0FA 2V6JA 3U4QB 3FHTA 1CBUA 1HQCA 4GDFA 3ZQJA 1IQPA 2OAP1 4M9ZA 2JJ1D 4DT1A 3LW8A 2AWNA 1TL7C 4XJXA 1JQJC 1KO7A 3ADKA 4JT2A 1EGAA 3EG5A 2OBNA 4XTRA 3GJ7A 5C18A 1D2EA 1U9IC 5CJ2A 4DLYA 1J8YF 3FFAA 2QG6A 2QENA 1BMFD 1XEWX 2ZJOA 5CLLA 4E03A 1JPNA 3WRXC 4Q9JA 1N5JA 4HDOB 1F2TB 5DN6A 2Y8EA 2WWYA 3R9XA 2FFBA 1B23P 1HT1E 3NHAA 1OH8A 4GZMA 5FOSA 4DWJA 1E79D 3SYLA 3T1QA 3TQFA 4M21A 3ZVMA 1BS1A 2JA1A 3CRQA 3WYAA 5LD2C 4D25A 4IEIA 4DUGA 4M0LA 4H9GA 3AP1A 3AP3A 2E1RA 1VECA 3UATA 1SXJB 4CEJA 1AQYA 2R44A 2BJVA 1SGWA 1F2TA 2WOJA 3QF4B 4KBGA 1D9XA 4S2EA 2JASA 3K0FA 5DH9A 1OYYA 1JR3A 3NBFA 3K70C 4UXIA 1OHHD 2QT0A 3U3RA 1ZNZA 1RYHA 1X1SA 2HUPA 3L0PA 4FW9A 4UJ5A 4XWKA 3FOZA 2H5EA 2KBFA 3CF2A 2RH5A 4IVRA 4JL6A 3KB2A 4YMUA 2JGNA 3MWYW 3W8NA 1CR2A 1ZNYA 3MFYA 1G19A 3R20A 4FXPA 3CPJB 4Q00A 3L2OB 3EX7C 1NKTA 1MKYA 4LHZA 1KK3A 1KDOA 4OL0A 4D4MA 1UBGA 1XNJA 1EX7A 2HEIA 4LRWA 4BRWA 2PLRA 4IVQA 3CM0A 1GVNB 2V7QD 2ZRJA 5IHPA 2PZFA 4AKEA 1IJFA 2VSXA 1GNQA 4BLSA 2PT5A 4JZKA 3A36A 4UNPA 1JBKA 1NLYA 3Q8XB 1MRNA 1W5SA 3THXB 2VF8A 1CULC 1EFCA 2ZETA 1XTJA 4BZXA 1IN4A 1E98A 3AVYA 1TTTA 1Q44A 2QM7A 4Z1MD 3E2IA 2Q3HA 2BKEA 4ACAA 4V0OA 1FTSA 1KZ7B 4GMXA 2FA9A 1A5TA 1OW3B 3SQWA 4CYMA 1ZVQA 4P33A 5BQ5A 4JKYA 1E0SA 1HT2E 2WICA 4YDSA 2Q9BA 3RWMB 1XXHB 3MJRA 3NTUA 4HSEA 1N5IA 1IM2A 2FV8A 4UNQA 3R7WA 3QEJA 3WNCA 1TNDA 5EUQB 4GPTA 3BRWD 3K9NA 5E4FA 4LJAA 5FOTA 4LOAA 4A2WA 4EPXA 1M8PA 1Z0IA 2VYFA 1ZIPA 1G20E 1GAJA 3PVSA 3P27A 3QJYA 2WSMA 4OHXA 821PA 4G5SA 1TF5A 4QNMA 2DWPA 2DWQA 2YVUA 4JLOA 3SDZA 3LH5A 4ASUD 3JVVA 4MKIA 1GM5A 1NVVQ 3K0AB 2HDNB 5EXPA 1XFAA 2ZSBA 5TVKA 3VU9A 1T8TA 3VQTA 2FZ4A 3VR2A 4A2QA 4E09A 2WKRA 5TDHA 2CBZA 2GJSA 4ZDKA 1JR3E 4GT1A 4O2RA 4CT5A 4WBSA 2VHCA 3KFVA 3V00A 4IJMA 4TLCA 3R9IA 3RYTC 2H17A 3TR5A 4Z54A 3MWLA 1YR8A 1NVVR 5E7MA 4BLPA 4W5HA 4CEIB 4PHHA 4F92B 2VP0A 1XX6A 1KK2A 1S3GA 4JT4A 2CVFA 3WYGA 3UPUA 1JJ7A 4I81A 4JMPA 3RRMA 5LB2A 1H8HD 1KYIA 2ZYUX 3EW9A 4HLQB 2OLKA 1GL9B 1XWIA 2RGXA 3KXIA 5CDFA 4NH0A 4IDHA 4OI1A 4Q02A 4NHOA 1ZC3A 4HUQA 4LYAA 5C4MA 4QJ4A 1YZQA 3D3QA 1FQKA 3UG6A 1E2NA 1UKZA 2O8CB 4Q47A 2A5YB 3IQXA 1W4BA 1WCV1 4ZCMA 2ZJAA 3SN6A 3IPXA 1G7TA 4NCIA 4CEIA 1XRJA 3FDIA 2XSZD 4TMTA 4OQFA 2H7VA 2Q3MA 5KDDA 1CJVC 1DG1G 2FFAA 4LY6A 3SI7A 2XAUA 4FCTA 4LV6A 4EDHA 2X1VA 1OIWA 1X1RA 1W47A 2VLIA 4PFSA 3KQKA 4PAMA 4A4DA 5JLJA 1EWQA 1GL6A 1MR3F 1N0WA 4QL3A 2QP3A 3QY0A 3O47A 1G4UR 3SR0A 1Z29A 2D2EA 4PZLA 4HLUA 2IYQA 2IUTA 3NDBB 2XGJA 1KK0A 2H8KA 1JPJA 2A5JA 2UKDA 4C30A 2GESA 2DYKA 2XTZA 3EAQA 3BJIC 2V8OA 3W5JA 1F48A 2ZITA 8OHMA 2B8WA 2H92A 4A8JA 2A2ZA 4D82A 4OHYA 2P6UA 1ZU4A 4NBSA 3HR7A 1W2HA 3SJCA 4YLGA 4L9SA 3QG1A 5JECA 3O8CA 1GRNA 2GK6A 3QXXA 2IEZA 1COWA 3SYNA 1RFLA 5JFGA 1FNNA 1QVRA 1SKYE 1KIMA 1E0KA 4Q5IA 1YZUA 2CMKA 3C16C 1VCOA 3MWJA 4KYUA 5JHHB 5TV2A 3C15C 5HE9A 2OAQ1 4HAYA 4AIIA 3UWKA 4M9XA 3TH5A 5DI3B 1VYVA 1WXQA 1E2JA 3U44B 1E9DA 5AJYA 2Z4SA 1AIPA 1OFHA 3F3YA 4HAWA 4EIWA 2QTVB 3DKPA 4TL8A 3BFXA 1GRQA 3TW4A 4Q4LA 4UNRA 2XB2A 1WBBA 1MT0A 5DYGA 4XD7A 1I2DA 4D4KA 4HDQB 5CLQA 3AUXA 3AKEA 3IGFA 1RPZA 3EARA 1P62B 4KYIB 3TW8B 1R0WA 5JJIA 2QY9A 3WHKA 4MH0R 3RS0A 2QP9X 1S8FA 2PEZA 3WP0A 3ZVLA 3K53A 4EPTA 4KSCA 1GZSA 1MOZA 1WMSA 2NZ8A 5J4LA 1GP2A 2WV9A 1G3QA 4TQAA 1A2KC 2J0QA 1VG1A 3QXJA 2O8DB 2DFLA 1VKJA 3U44A 1TF7A 2R65A 3I5YA 4B3DA 1E2HA 2W6JA 2REXB 4HI0E 3SJAA 2CHGA 1CJKC 3IHLA 4DEYA 2DWOA 3H4MA 2QUZA 1OYWA 4B73A 1DTSA 1XD2B 3QEOA 3S1AB 4LJ4A 3TMKA 1NY5A 1CLUA 2DY1A 3BB1A 4MKFA 2VH5R 1UEIA 1R0YA 1DAMA 2CL0X 4B43A 3FKSD 4MGIR 3KQHA 1GL7A 2C99A 2P5TB 5FBQB 5FBLB 3SBDA 4AC9A 2O8DA 4TSFA 3FMOB 2B7CA 2P6NA 4BFYA 4BFZA 2CNWA 3X1WA 1II0A 1TX4B 1W36D 2KI5A 1XTIA 2WWXA 2ZI4A 3I72A 4PAOA 2XNDA 4QHTA 2XZOA 3P20A 2QI9C 3MAAC 3TK1A 1P9NA 1JECA 4Q7JB 4X8HA 4TYNA 4MQBA 3TUJC 2GILA 2IYUA 2C77A 5B58C 1OPXA 4IOKA 2C03A 1RJ9A 4PC7A 5EE1A 1DO2A 4A0GA 2O8EA 1DAFA 1HV8A 2W6IA 4JLDA 1TEXA 1DG3A 2OEPA 2H18A 4ZDJA 3X2SA 1W0KA 2J0VA 1KGDA 1QVAA 2AXPA 2GAOA 1KZGB 1E2LA 3RRYA 5BN5A 3UXMA 2QPTA 3AVTA 4WXPA 2RGNA 2PBRA 2ZVPX 4MYTA 4ZCLA 1W0JA 5JEDA 4DLTA 1K5GA 3VFDA 2IBMA 1CR0A 1OV4A 2B92A 4P4UA 1XTRA 5SZKB 4O3MA 1KTVA 4OHWA 5CK5A 3VX3A 1Z47A 4ILEA 4YMSA 3RVBA 4ARZA 3KKOA 3FVQA 3OFND 4QHSA 3WBKA 5TMPA 5LD2B 3CIOA 4KSBA 1KJWA 1E4YA 3QVUA 3LBIA 4Z8XA 3BAFA 4Z51A 1HY3A 2J45A 2A5FA 3KXKA 3ICQB 4I1OA 3UKDA 2P3SA 2H16A 4YONB 1F2UB 5JEEA 3NEYA 4G5GA 4F91B 1U8AA 3B5JA 1BYIA 1FX0A 1G8FA 3K70B 2C5LA 1OFUX 1Z6GA 3QKUA 3AM1A 1KSHA 2JEOA 4IDQA 5CIQA 1G16A 221PA 1DELA 3ADBA 2XX3A 1OLOA 2JLUA 1T91A 2FF7A 2O8FB 1OIXA 3PV0A 4DCTA 1U81A 3T12A 1N0UA 1TAGA 2WVJA 3QBTA 3OEHA 2EWWA 1S0UA 2XB4A 3G5UA 2WJYA 4A9AA 1CR4A 1M2OB 2ZRGA 3AKYA 4A0HA 3OEED 1E1RA 4P0TA 5E95A 3CF0A 3M4YA 3GEIA 4M8NE 2PX0A 1SULA 4QHYA 1X8LA 2ODEA 1FP6A 1US8A 1Z07A 1T5LA 1GWNA 3ASZA 4W9MC 3EPHA 3KKNA 4DZZA 2IK8A 4JBWA 1OJLA 3HDTA 1NBMD 1OIVA 1E2KA 2ONJA 2WWHA 1D2NA 3AGPA 3EC1A 4GOJA 4RKFA 1U0HC 1GUAA 3LD9A 2VL7A 1CJMA 3GP8A 3I8SA 2QAGC 1G3RA 4NYMQ 4D0NA 1Z5ZA 3SFZA 4RVCA 2J46A 4R7ZA 3ZVNA 4NONA 5LBIA 2WSSD 2NPFA 3P4YA 1E2IA 3GJ0A 2F7SA 1KI4A 1KI3A 5H68A 4HZUB 4Q4HA 4LHWA 5E7JA 2ZQ5A 4WAUA 5HKKA 2KB0A 4Q19A 1BIFA 5J4KA 3RC3A 1MO4A 1SHKA 2FFHA 3CRW1 3CWZA 3QUSA 3L8ZA 3CH5A 3ZJYA 1XPOA 1W48A 3PENA 1G17A 4WVFA 2ZI6A 1ODFA 4NYMR 3DPUA 1KJZA 2DCUA 2DR3A 2ZYVX 1ZIOA 1MRSA 1Z0AA 4OJQA 3A8TA 1N5KA 3SNHA 1G6OA 3THWB 2WBLC 2BKUA 1MO3A 1XZQA 1ZP6A 1OFTA 2NPIA 3LFUA 5EXTA 1G8YA 4HZUA 4EPWA 1Z06A 1P73A 2WZQA 4XOIA 3QXHA 3CNOA 4H1UA 1UBCA 4V0KA 1E3MA 2E9SA 4OBEA 4PO1A 5AUOB 3RC8A 3WMGA 2JLSA 1E2MA 3LVQE 1KDPA 2PZEA 2CK3D 2G83A 1KAOA 5EE5B 5D3MA 1PLJA 5FTJA 2FX3A 3E1SA 2GZAA 1Q3TA 3KKMA 1LVGA 2F1IA 4K46A 2A9KA 2R8RA 2N42A 4TMVA 2EFGA 2IXFA 4BUJA 4TL6A 4F7WA 5KHOC 4MGKR 4G5OA 4RCZA 1SQ5A 4WOPA 3Q7PA 3EIEA 4O0MA 1T8UA 1J8MF 4PPGA 3I5XA 1N6OA 4I99A 1IY1A 4Y0AA 5CIWA 5LDDC 2LWIA 4TZ0A 2GJ9A 2X2FA 1G64A 2XOKD 1RW4A 4XIGS 3HR8A 2Z6VA 3FMFA 4K81B 3KL4A 5EE9A 5FTMA 5FL7A 2R2AA 1S2MA 2ZUCA 4GMDA 4DVGA 1MO6A 4DKXA 5F98A 1EFRA 2RHDA 1ELOA 3RSLA 3MWKA 3A37A 4JJZA 1C9KA 1JB1A 1IBRA 2ZXUA 2C04A 2P6RA 1FZQA 1KY3A 4ZPXA 4TQUS 2JCSA 3CRVA 1R10A 2J5XA 4CW7A 4AY2A 2VIIA 4IDOA 2OCYC 5KTYA 1DEKA
chains in the Genus database with same CATH superfamily
1P19A 2AHOA 4O4JA 2J09A 5BVGA 2PNJA 1N2JA 3KSZO 4HWGA 2WEKA 2E0IA 3Q88A 1X42A 2HD4A 4UMVA 1RFGE 1NN3A 4FZRA 4LPKA 4XYBA 1FQJA 1YNOA 3N58A 1LD3A 3M5CA 4AKTA 5EJEA 3RLIA 2CCKA 2QVLA 5KKAA 1O58A 2ONYA 2QTCA 4MUKA 1C8VB 1NG1A 2AFIE 3ZV7A 4EGJA 1A98A 3ZLJA 2ZTHA 4ZVRA 4NBTA 1L4HA 2XH8A 3DZFA 3D3JA 3UA4A 4EGQA 5BSWA 2ZI9A 2B9EA 4FMPA 3N70A 1VE1A 3V1NA 1DXHA 5KSPA 2OYRA 2Y1CA 3RSOA 1QQ7A 3PE4A 3EIQA 2GJ4A 2KPOA 1TLTA 2C2HA 2P6PA 3QLVA 2YWHA 2C9CA 3BIFA 4X65B 3QVWA 4DCNA 1DDIA 4KX3A 2RKWA 3IELA 1TQ4A 3CMCO 2INGX 4P3OA 2FQ1A 3HZZA 4V0RA 3SQNA 1D2GA 3ESZA 3VDRA 3ZI4A 3ZX5A 5MN5A 1L0BA 3OT5A 3K0SA 4FFDA 4KQCA 1M10A 1N4DA 1VQ1A 3B9PA 3OJEA 4GG1A 2J48A 5BV0A 3BXXA 5IXSA 1YTUA 3SX4A 2J0SA 1OGJA 1H2WA 1JT2A 4NBLA 5GOZA 1N4AA 3U49A 4ZIRB 1Q12A 2E4YA 4MEBA 4L5IA 5E2BA 2WAXA 4TYQA 2QTHA 2QK4A 4UHFA 4EB6B 1SOMA 1WXEA 4HKTA 2G07A 621PA 3B1KA 1KDTA 3D4NA 4BTLA 3IAXA 5HS6A 2CJXA 1ZIXA 4JR2A 5GADl 1TJPB 4N0EA 5A0FA 3VTZA 1RE0A 5DWQA 3OZIA 1P2TA 3DQZA 4FPXA 4PLFA 3NWPA 2GEFA 3X1KA 3I62A 1YVDA 4LDZA 4X97A 4OH7A 3PFFA 2DJIA 4TVKA 5DXFA 3WISA 3GOQA 1U5BA 3OMXA 2JAXA 1BGVA 1HURA 1LSOA 4I4NA 4I4TB 4L1KA 1BXKA 2NADA 4HYTA 2ZCUA 5JALA 1UM8A 3IESA 3B3GA 2DVMA 2VNAA 3L7NA 1R8YA 2DFTA 2J67A 5AI0A 3V4VB 4AP6A 1X86B 4UNSA 3CRNA 1S3FA 2ATXA 3EGIA 4Z0HO 2XT9A 3G1WA 2BR4A 4DMLA 1CP3A 3HYSA 3U09A 4A0SA 4JLBA 3WB9A 2XF8A 2JJ1A 4HAIA 3ABZA 2XD4A 1CXZA 1T35A 3H5WA 4B17A 1Y82A 1N8KA 4LCJA 3T95A 3KD2A 5BSVA 3WQHA 3SU8A 2NZ2A 3M3HA 2VRWA 1SVSA 4XDGA 1NL3A 1AG9A 1GGVA 1HE4A 5A6VA 4L7VA 2C95A 3Q3EA 4I9FA 2B6NA 2YVKA 2XVZA 2YJ6A 4OYLA 4Z0PA 5DN6D 3AIOA 2YVLA 4PPYA 4N3AA 5AWFC 4JYZA 1T4MA 1UMKA 4YRZA 3B1XA 5H70A 3SEZA 2FG7C 2HHCA 2BI8A 2PH3A 3JQQA 2FLVA 3KKEA 4JEMA 1W25A 2F3PA 2EARA 4NE9A 3GLQA 4GYJA 4TWJA 4YR7A 1TU0A 1U2QA 2O14A 4CL3A 1NJ2A 3EBLA 1QBKC 3FUXA 3VNVA 4J6EA 3VYVA 3I0NA 4E3ZA 4KR2A 1JDZA 2HPHA 2XWSA 4LBYA 4RE6A 5I9TA 3SZ3A 4JASB 1DXQA 4DBLC 2QRGA 3GJXC 1LA2A 2Q3BA 4J16A 4LG1A 4P8RA 4Q4AB 3V7NA 3BULA 1N6LA 3K0BA 1DQSA 4OPMA 4E5NA 1AUOA 4WLNA 2WMNB 2YN2A 3I5AA 1TU4A 3ECCA 4MDEA 4GD3Q 1SD1A 1H4SA 4KAJA 2F3RA 3BMOA 1FFSA 3KWJA 4OXKA 4I55B 1MF7A 1MH1A 4OAQA 1C2YA 1ZVVA 2IS2A 2DKFA 4Z53A 4Q15A 4ZHQA 3J81k 1JR3D 3U7FB 2MT9A 2OECA 1SXJA 3C8UA 3JYQA 1R4ZA 4FOPA 2DB3A 3VU1A 3GVHA 5BXQC 3I5MA 3IAHA 2BFEB 1ISSA 3ZTWA 1GUDA 1RAHA 2C92A 2FXIA 3DZBA 3FYCA 3MWDA 2Q49A 4Q1CA 5FRDA 3V8PA 3VPCA 1SOWA 4ZEOA 4JLPA 4Q4AA 2GFIA 1VPLA 3LZ6A 3R0QA 1P0IA 5E8RA 3ZNNA 1TC1A 3GA0A 1NW5A 4QPJC 2V5UA 4IXWA 4Q6WA 3AUUA 5IMBA 5J4HA 3SWWA 2GPBA 4K0KB 1D2RA 1SUSA 1WZNA 3LC7O 5KJEA 1CNEA 4JB3A 2HWXA 2ESRA 2HJVA 3BTSA 4R5MA 1A8IA 2V7QA 1SPBS 5DISB 3TNJA 5L9AA 2HQSA 2ZAGA 1I33A 3NUGA 1SD2A 2CFOA 5CFPA 2W90A 3N8NA 3FR8A 4IIJB 2OBXA 3USZA 2YNMD 3R5HA 3PWSA 4PYOA 1YSCA 3GHYA 2CNOA 3MS2A 4OOFA 1R4MB 4QJ5A 4RMHA 2YICA 3W6OA 4AO8A 4BFWA 3NXKA 2DWCA 2KYRA 1R6VA 4A8HA 3W5HA 1RWWA 1P1RA 2CLOB 3JD0A 3N74A 3P2OA 3T5DA 2IV2X 3ZZ1A 2EKZA 4UHEA 1I4TD 1UFQA 3IUQA 4DCMA 5MGNA 2RE8A 4B71A 1PJTA 5FLEX 1N1DA 5J2UF 1Y3DE 4FDLA 1T13A 4ZT3A 1UPAA 2Q2WA 1YDHA 3NVMB 5CDHA 3OPNA 3I53A 4BV2A 5ALRA 2I2DA 4AULA 1HK7A 2P2ZA 2WMOB 2BM8A 1CF4A 4IIJA 1JSRA 2BZ1A 4DLXA 4KO1S 4JUCA 4RXUA 4TXJA 1RXCA 5AM5A 4MRPA 4NCHA 4LE1A 3KSRA 4LZZA 4DR1B 1T8RA 3ZBUA 1OKKA 5DNDA 5KHLB 2ZE8A 2P41A 2GHQA 5K3FB 1PR6A 2QN6A 3BZBA 1ONOA 1DXOA 1V47A 1RHRA 5E4YA 4W6ZA 4JLNA 1MD9A 1PJZA 4M1QA 2WYHA 5FR2A 2X2PA 1OPRA 4US2R 3C5WP 4RDIA 4E22A 2CXHA 2X0EA 3EXG1 2WWFA 3AMVA 3EVCA 1NUPA 3IVGA 4KIWA 4PINA 1KZ4A 1HL7A 2XBUA 3CX8A 3L1JA 3LPAA 3OZGA 4MS3B 5IAGA 2WHPB 2PUJA 2Y2VA 3TKLA 1NP7A 3WXBA 4BFXA 1TEZA 5H4HA 3SG0A 5L7YA 4H16A 2V98A 3OESA 4G26A 3TXXA 3R0JA 4DYDA 4HWKA 5DTQA 3V7YA 1WUHS 3RT9A 1CW2B 1KOGA 4CM6A 3DBVO 1WSBA 3EEIA 2AQ8A 5A3RA 1JFVA 2QX6A 2M6SA 5LYYA 2QLLA 5KIAA 4OK6A 5L4NA 2DH6A 3DO6A 4TZTA 2IUUA 3VOTA 3KQUA 4N8SA 2QAGB 4XVRA 6NULA 2BFNA 3EDOA 1U0LA 3K0AA 3WK8A 2AN1A 3ONEA 1SXJE 3HVIA 3JRWA 3VNUA 1NHWA 3CLUC 3ZCUA 1MC5A 2GPTA 5UKDA 5GIPE 2WHPA 4C6TA 4RIEA 4ZMBA 5IABA 4JQCA 4QBGB 4BVHA 2F2TA 3DE7X 5ERYA 5C1PA 5IF9A 1AKMA 1UMBB 3NHBA 2QT9A 2EBFX 3PQ7A 2OZLA 3UHFA 1XDWA 1UFOA 5LOVB 3BWMA 2P5UA 4FHEA 3GLGB 1AGNA 3LGXA 4OK3A 4PSUA 2D0OB 5EXDA 5ALEA 4B32A 2RGDA 5L45A 1Z88A 3QITA 3V1TC 2OBMA 1W0CA 3IUJA 4HHEA 1KI6B 4AWBA 5CVJA 3ULKA 1T5TA 2QAGA 5AOCA 1YCGA 3CT6A 4M1SA 2WJPA 3UT0A 1P39A 1G9XA 3DHVA 4QRIA 2A9QA 3X43A 3NC4A 1S89A 5CVEA 1TZKA 2CMHA 5I45A 2E4WA 2I76A 1GZ5A 2Q4BA 5GJWC 5A5VA 2G9RA 4H7HA 4C6SA 2YDXA 1Z2NX 2YFHA 3E4CA 4GXRA 2X1MA 5FNVF 3AY7A 3VX4A 5CVTA 2CMGA 4CMGA 5CPBA 3SFVA 1X7GA 4ED9A 2FGKA 2X58A 2Z8YA 3U48A 4IP0A 1D5CA 1EDEA 4Q1VA 3RS4A 1L8LA 4JXKA 5B1IA 4P5EA 1AJEA 5EINA 4B81A 2NUBA 3S29A 1Y4UA 4I36A 1KI6A 2ZUDA 3U37A 2FHPA 2CNKA 3KTOA 3OLXA 2Y0DA 1H1LA 2V9PA 3W9BA 2D0IA 2QUAA 3JVUA 1VE7A 2LW7A 1NLMA 2ID7A 2NU9B 4WLEA 3U80A 3ZHBA 1K6XA 2GBLA 1HOTA 4A15A 4N5IX 1IPEA 5C7OO 1VBNA 3I0ZA 4ZICA 4ZO6A 1GRVA 3BILA 3DXZA 4N12A 1QWSA 5BN3B 5KC8A 1XSEA 3S81A 3V2HA 2W58A 1Y3IA 1G7CA 4PO9A 4G0WA 3IVMA 1M7BA 1C30B 1I3NA 3IEIA 3UAXA 3S8YA 1JXMA 2ZYGA 3QK7A 1SUCA 4K1XA 3AHCA 2HIAA 3F6EX 4IUBS 2ZYTX 1KMCA 3ZHZA 7REQB 2YZNA 2SKDA 2P65A 3ABQB 1OXVA 1SVMA 2PL1A 2VI5A 3GAZA 3PICA 3W7BA 1VL8A 4HD8A 3OFJA 1AV6A 3L6UA 1Z6TA 4DV0B 1NRWA 3MUEA 2C0QA 3O1JC 4NRDA 3B82A 3RIHA 4C2BA 5H81A 3BTOA 3AONB 4WXRA 1JEOA 2V03A 3ITKA 1W52X 4WZBE 4ENSA 4G5QA 1WV0A 2XNHA 4OB7A 3RARA 4KVAA 5ECGC 1CJTC 5BSRA 3SEQA 3Q40A 4OQZA 1GGJA 1W4ZA 4NZOA 3PXGA 3JD3A 5I51A 1U3DA 5LUBA 1CG6A 4MX8A 1K3UB 2QROA 1U8EA 4JBYA 1NKVA 4F2GA 2DX7A 4Z6KA 2Y99A 1OI2A 1UANA 4Z49A 4XVUA 1GDHA 4E14A 3EVGA 1NDQA 1CEEA 2DSNA 4PR3A 3EYWA 3D7SA 4ER5A 3N0WA 5LU9A 1TKCA 4R81A 4PAQA 3W8DA 1V2GA 3G17A 3AHJA 2XY4A 1QH8A 3NAZA 3FMIA 5DM2A 5LQJA 3LX8A 3ME5A 3R0XA 2IF2A 4WY5A 4X3OA 1KEEA 1NU6A 3QVLA 1OLSA 3P9PA 3SS8A 3KXPA 3OTQA 5FWDA 1E4VA 2RMKA 4QJBA 3SGLA 2Y1GA 5DGDA 1ZJJA 3DM5A 1R9NA 1CQXA 3RVMA 4RTQA 4XDZA 5FOQA 4C4PA 3KHTA 4B6SA 1P44A 2CHEA 1GCOA 3EHEA 4GLOA 4L57A 4R7GA 5E4TA 3Q8MA 3N86A 3T3OA 2AKYA 2BD0A 3ESAA 3V32A 4CTOA 4PGAA 4RWEA 5SY6A 2EF1A 5DCLA 4P7KA 4X85A 4WJKB 2YX1A 1U8TA 2AG0A 3UJPA 3OCZA 4BP9A 2NYRA 4AJ2A 4Q3CA 1AKRA 4KQXA 5K0NA 1L1EA 3R5JA 1IN7A 1W5EA 4Q1FA 5H3CA 3RTGA 4V3CA 2CB9A 4EO7A 5C1DA 1W36B 1SHLA 4RZUA 1I4DD 3CA8A 1FP1D 4GX0A 4TM7A 5FFFA 1E2DA 3VU8A 5BSGA 2OLJA 2JDIA 2QW8A 1U7UA 2C4TA 2ZRFA 3N2YA 4Z9FA 2B8TA 4M7PA 2H07A 4EL0A 3TQRA 3EVAA 4CZ2A 4RQBA 3JVDA 1OE0A 3D6VA 1TK9A 1J9ZA 3IMGA 4YAFA 4B5LA 4IKOA 5FI3A 2JIQA 3TF5A 5FBHA 4U7WA 5DTMA 3RHFA 1LY1A 4YRIA 4JY7A 4FEAA 4MB2A 3D2BA 4QFMA 1N6HA 4E88A 2IU0A 1PGPA 2JA2A 3KJGA 5B7GA 3ZWDA 3VC2A 1XD2A 2EWVA 2G76A 1MB0A 5FEUA 2XEXA 4C0HA 1Q1NA 1X1BA 4ZI5A 2B9VA 2ERYA 2WFAA 2YWXA 5ANRB 2EWMA 1GPUA 1AT1A 4ZU3A 1I1QB 3S1LA 4MHTA 4RTPA 1J9GA 3VNQA 4Z3OA 1QJ4A 5KVVA 4HWSA 4FFWA 2IFTA 4TL9A 3O8NA 1SB9A 2NO7A 3NP9A 2IWRA 1ORWA 1IRIA 5J2TF 4ITUA 1QIDA 1SIOA 5BYBA 5ES4B 4FT4A 2FMXA 4GMHA 1VHJA 1V1JA 2E5WA 4MW5A 5IAKA 1R9JA 3PJFA 3V4OA 4IV5A 3PU6A 3JWHA 3MCUA 3QPUA 2HYIC 1RWPA 1YRBA 3A9VA 3NB0A 3CB4A 1RJGA 3DLCA 4BZQA 3ANNA 3QI2A 3WGMA 5HF6A 1W2GA 5JY6A 2GTHA 3UAGA 4UQLA 2AQHA 2GKOA 1R0KA 4UULA 2N1BA 4CM5A 1FC0A 4JSRA 3SJZA 3BEOA 3DDWA 1NW7A 1A9XB 2JKYA 3GAFA 4MYUA 2C7VA 2NPOA 2JJ8A 4NFSA 1X15A 4Q3BA 1DJMA 2O1EA 4X0EA 5J59A 4MO9A 4RJTA 1Z0DA 1CUIA 2JF0A 2ZG6A 4A1OA 1H6CA 4ZTBA 3DZ8A 3OIUA 4YN3A 4IHAA 2F90A 3TLGB 1ZD2P 3BMCA 2PH7A 2BAGA 4NFLA 1PYGA 3WQQA 3FNIA 4L3VA 2IUFA 2J3IA 4KN6A 2BEKA 1SOAA 1H4VB 1QHFA 3LXRA 1FDWA 2WIJA 4XAQA 2WT4A 3P52A 5HUHA 1XD9A 2VJKA 4A73A 2BMWA 2FLWA 3TQSA 4AKGA 3AJ8A 5KQRA 5KBYA 5IS2A 1W29A 1OVMA 5TGDA 1HBJA 2RBGA 4CV2A 1SCNE 4Q1BA 3JQGA 5JWOA 2R79A 5IM4F 5EZ5A 3WRXA 1HDOA 4C2UA 4EKEA 1JFSA 4LMAA 2FUKA 1D6JA 4EB8A 2IU4A 1WHSB 1T8SA 1ZJ6A 1ZRHA 5A7GA 3DBOB 3SF0A 4ABYA 1JILA 2I6TA 1XL0A 1D2AA 2IPAB 5EIBD 3Q87B 2OMEA 2WD7A 1P7YA 3FGNA 9MHTA 2JJ2A 3ESQA 4BB0A 2P2LA 3LRTA 2GK7A 4UUBA 3WYCA 2PSJA 2YQ4A 2WPDA 1LWNA 3K6KA 3L7OA 3M5DA 1CYDA 3NWBA 4LKRA 3BFKA 4PSKA 2Q9CA 5F12A 3VSAA 4N54A 2VPTA 4FWTA 3GFFA 3ZKAA 3ICWA 3AB7A 1ZY2A 1QONA 1NNSA 4UVIA 3I4FA 4BAZA 3F9RA 3BC1A 3COYA 2H06A 3AFNA 2V7TA 4QBKA 2HXYA 4LIPD 4PGMA 4Q4JB 4MWBA 5HJ5A 5A4IS 1RYBA 1ZI6A 1JDVA 3V8MA 1ML3A 1EBFA 3GJZA 2JGIA 5GONF 4CDNA 5CDGA 5FPSA 3RAFC 5GGYA 2DOKA 4J1TA 4PTZA 1DKMA 1G3IA 2CLDX 2YOHA 2VK4A 3PC2A 3WI7A 4O29A 5IT5A 5KYWB 1Q1EA 4V03A 4J9VA 1JE0A 3AY0A 1KH2A 1F0PA 3AZOA 2C3YA 1I8TA 1Q0QA 2W2KB 3M89A 1F51E 4QDOA 5AHOA 1I24A 5BMVA 3GGCA 3BREA 5KPDA 1RC8A 2FGJA 3EZFA 1WXFA 3HP1A 5C7YA 3CKYA 1BE1A 1EFPB 5LNK6 1SA0B 1SXPA 3L6BA 1GNLA 3DW3X 3KQMA 5IDXA 4I14A 3I4LA 3IC5A 2PY6A 4Q4JA 1U4OA 3WFJA 1MENA 1JHQA 4MR8A 5DRYA 2PMFA 3N0VA 3PXAA 4PNPA 2AXQA 5DM60 1O9GA 1HEYA 4KR3A 3LP6A 1FTQA 1YS1X 4CMCA 2WWRA 2VPQA 4TS4A 3TAHA 2BEJA 2PMKA 3UJNA 4KAXA 3RIMA 1VRVA 2P35A 2YMLA 1NQXA 1IATA 3NYQA 1UEXC 1K63A 4R2KA 1AMOA 1F20A 4WACA 4XSHA 2YH2A 3RUCA 1LLCA 1X9IA 3R8FA 4PXAA 2QRZA 1XG5A 1Q17A 2IKQA 3E9ZA 4P2BA 4UMDA 3HXPA 3SNKA 4S0XA 1RMTA 3RBZA 2XKJE 4O6VA 3WGNA 3ZCQA 1P1FA 2PMWB 4P3KA 4D92A 1V2HE 3GPIA 3IKJA 4PRZA 2NV2B 2O4CA 1XUOA 1YS2X 5CYFA 2P4SA 1G2IA 1Z4NA 1ZYUA 2BZ0A 1K88A 2JFNA 3CH6A 3PRYA 5FOXA 3ZU3A 2GM5A 5B4UA 5EPOA 2GERA 4LF9B 3T99A 1MAWA 4RPCA 2IL1A 1CHNA 3EEQA 1KO1A 3M1IA 3PEFA 4RK1A 3ADCA 1FS4A 1J99A 1OTYA 3AI1A 4MZDA 4EEXA 3RU7A 5KQLA 1VMIA 1II9A 3VHXB 1E3LA 3ENKA 4QQ8A 3UJ9A 1LX7A 1WWKA 2FPIB 3DP7A 3SSAA 4C0LA 2P0EA 3HRHA 5CEFA 1ZR2A 3RM3A 3HHEA 5ECYA 1HZZA 2B83A 1NMXA 1OTHA 4O2BA 5KDOA 3FROA 1U7ZA 4C43A 4ZCPA 3ZOZA 5KOJA 4EUNA 3UGJA 5GJBA 2FPSA 4HDMB 4RSGA 1JHYA 5JS6A 1IBCA 3D4OA 4JMLA 4F1KA 4JJFA 4ISBA 4PX2A 3HP7A 1UEJA 3HWX1 4N03A 5CTAA 5K0GA 4NZYA 4YHBA 3E15A 2X15A 3SIPA 4DPKA 3HADA 1QO7A 3KQWA 3H6HA 5IANA 1S3IA 2C5GA 3NDRA 2EKBA 3B8EA 1QLWA 1I5RA 3BGDA 3HUUA 4F60A 2R6CA 3AB8A 3H5TA 1R7RA 1IZ7A 4NU0A 1GTMA 5FFMA 4KHZA 4UBNA 3L9XA 1HNWB 4R2WA 3CF6R 3H0KA 1AF7A 3EH2A 4PG7A 2HEGA 7ABPA 4GWGA 1IBMB 1M6VA 1TGYA 4JOSA 4C4SA 4MULA 5TC4A 3HPRA 4KDFA 2CMFA 3NPAA 2VZEA 4FIDA 4XASA 1SK8A 3V2UA 1CRQA 2HRDA 2YZKA 3W3AH 3KCNA 2QJFA 3FZNA 3MOGA 5AJHA 3UN1A 2A0UA 3ZY4A 3JATB 5ALLA 4HVAA 2Q0HA 4L16A 4MA4A 5CVVA 2DU8A 3QMVA 5IBQA 4A2CA 5AUNB 4M54A 4R3UC 1PKEA 2C59A 2VAVA 5C32A 4TYYA 1WUTA 4RD6A 2GPNA 5EN4A 3QOFA 4JKIA 3SEFA 4E5YA 1I4OA 4Q9KA 1V39A 1FFGA 1XVVA 2J7KA 2PXCA 4OHZA 3RWOA 3IHWA 4HEJA 3NHWA 4XQEA 5DASA 4C0QC 2IEIA 1FDRA 3OUUA 4L5AA 1NN0A 5PNTA 3NM6B 2QUIA 3RFVA 5C46F 4V02A 1ZSVA 3I6IA 4KPYA 4GI3A 5D00A 1XZPA 1Z74A 4DCVA 3F97A 1JIIA 2SKCA 2OL4A 1PNVA 4Q66C 1Q0PA 1VLLA 3ICEA 1H8ED 2QMOA 1PLKA 4QECA 5AKIA 1P5FA 5FUXA 3AEKA 3REOA 3FTCA 5FOUA 9GPBA 1CRLA 1P60A 2WYVA 5IDWA 1F3LA 3ROGA 4N01A 1NONA 2R62A 5D3ZA 4HMOA 5ALIA 3OSZA 4ER0A 1AN0A 4LI0A 5D86A 5CB4B 3DFMA 3D6NB 3NBQA 3EGVA 3H87A 1YJ5A 2WP0A 3FETA 3A6LA 3MUNA 4QG3A 4MIEA 2PNFA 1Y7TA 2AVNA 5EUCA 5IEBA 4BP8A 4YP0A 4J4HA 4DMUB 2AJ8A 4KQ6A 2EBUA 4QU0A 2PSDA 5ER6A 5FWYA 1EDOA 2IC5A 1Z12A 3ANXA 3F6CA 3LCRA 1YASA 3OA2A 3D8TA 1V11A 3PPWA 2ACVA 3NHSA 1YJCA 4R8LA 4RJIA 3RGWS 4DLUA 5AUPB 2O8BA 1I9GA 1PQYA 5FBRB 5HEKA 5JXHA 3JR3A 1DC8A 3PTAA 3NHFA 2ZS8A 1YS4A 4LOLA 1P5HA 1KYZA 3S2IA 3SE7A 5KCMA 3VNSA 2XNJA 3IV7A 3FZYA 5CFZA 4YJGA 1THTA 5CFQA 3X1ZA 4KB5A 5E9QA 4LSGA 2YYYA 3OX1A 3ZCXA 4Y67A 2REBA 3WDSA 1SQFA 1F5SA 1UOQA 1SZDA 4BHTA 4NXNB 4DC1A 3KKZA 3TRIA 1JDUA 1P77A 2Q0SA 1X7WB 4Y2SA 3UJ3X 3MM4A 2FZLA 3KLPX 4OGFA 3L4SO 1UDWA 2ACKA 1CUUA 4U2EA 4L3WA 1WXHA 4C1NA 1PQUA 3PRKE 3WV5A 4ESHA 2OWEA 5A6SA 1F8UA 2EKDA 2X0RA 4E5SA 2GM9A 4FMBB 1GITA 3NGMA 2IYTA 3KSAC 2JB9A 3P26A 3M9WA 2WVHA 1U28A 4D4IA 3IKTA 4TS3A 5AW5A 2OTCA 4OQYA 3K2QA 4TTQA 5CHYA 5E38A 5FI0B 1M1NA 2I6FA 2P9FA 3MOSA 1N6NA 4TUYB 4TQGA 3EGDA 3AZQA 2V4ZA 5ENVA 3LAWA 1THGA 3CF4A 5IKPA 5EC8A 4BV8A 1I7DA 1KYWA 2G5GX 2EYUA 1JR2A 4RA6A 4ZQFA 2NGRA 5EXSA 3V4ZA 4E4RA 2A5DA 3FZGA 2UUBB 3I6MA 3CINA 3L9WA 4EVIA 4CEJB 3ORYA 4XTCS 4F2PA 3NHKA 3MA0A 1H1TA 3KZKA 1K4YA 4MZXA 4RK4A 4WT7A 3ZU4A 2FRDC 3GJ4A 4M9RA 1J5XA 1EEXB 1KJQA 1MB9A 3A06A 3KJHA 4Y0NA 4NDZA 4DUGD 1E9CA 2HA4A 4CR7A 1KMHB 4DMRA 5KNLA 3IPYA 1M8GA 4MRRA 4TUYA 1Z0SA 2GN8A 3KR2A 2VA8A 4Z0NA 1IUNA 4HNAB 1GQRA 4RJKA 4DQXA 4GMGA 2H00A 3SHOA 5L3VA 1VCNA 1G5TA 1NVBA 4O59O 1K7XB 3AKDA 4PYJA 3GLHA 1CSEE 2ZYIA 2QR5A 3D31A 3KFXA 3OIFA 4AP9A 3H04A 3W9SA 2XT6A 1FFHA 2R6AA 4DXHA 1Y1PA 2GWRA 3L18A 4MIYA 4ALKA 3UAWA 1BE6A 3H65A 4LJ6A 2IOHA 3JQ9A 2G4VA 4IJUA 5IRCD 4TQ9A 3GDHA 2Z5GA 1KMHA 2OOSA 5AXAA 5K8CA 1A9SA 3PGMA 1IG0A 3AEZA 3UCXA 8ABPA 4R1TA 1NYLA 3V8VA 3AVXA 5JCJD 4Q93A 1BWRA 4EZBA 4M1EA 3T7EA 5K3EA 2QD3A 3D0RA 3GP3A 3BXZA 3VR5D 4EL5A 1KAGA 4MCHA 1O94C 1LFDB 3E35A 3S5JA 2IT1A 2NZYA 5IYZF 3N2KA 3QZUA 4Y9SA 4X63A 3OD1A 1HQKA 2IYLD 2JBWA 1GGEA 1ZGHA 3ZCRA 4L72A 4JDPA 3L82B 2Q4RA 1RRGA 4Z2YA 3K4PA 3D3KA 4FLMA 1PNTA 1RQ7A 1ZXBA 1X7XB 2AK3A 2QTAA 3MFQA 4R8RA 5CT4A 4YS6A 1DAGA 1WTCA 3B5EA 3IIJA 4LVOA 4CTJA 1K6EA 2RGYA 2ZYHA 3NBKA 4FDVA 1ES9A 1EX6A 4DMFA 5LXTA 4HRVA 1DRWA 2YNMA 3LQ1A 2WFMA 5L7TA 2OFXA 4KFSA 1LNQA 5FH9A 1OUMA 1KBQA 2FSPA 3KYCA 3SZLA 4AZ3B 2J33A 2XB8A 1CR6A 1Z6AA 3DA8A 1HYQA 3LDAA 4QRHA 1E7MA 2P9YA 1W30A 1GTRA 4O4IA 5A2GA 4ARSA 2G70A 3OF3A 1F1BA 2JFVA 2GB4A 2AKEA 1U90A 4FP9A 3HACA 2QM0A 4Y9RA 3ND8A 1TZ2A 1W4AA 2IY7A 4AECA 1G63A 2RB4A 3IAM6 3EVEA 4JU9A 4PZZA 1B6SA 5LBUA 4F3CA 5K03A 2Z83A 2QDXA 5BNZA 1PJSA 4IICA 5E1MA 3HCEA 3VPHA 4JVSB 4OFZA 1M83A 3JS5A 4E7OA 1NASA 1PG0A 1S3SA 1TK3A 2AD5A 3O4IA 4G5FA 3TLAA 3HE3A 1FUEA 3K96A 3WXMA 1MOSA 2FUNB 2YZGA 3VVLA 4C2TA 2QMZA 3CWQA 3D8NA 3MLBA 4ZRNA 2PS9A 1KDZA 1I2CA 2BEWB 4LOJA 3PFHA 4LZAA 4KVZA 5DO9A 3RC9A 3G8AA 4V1CB 3STXA 1VJ1A 4G5HA 4QKQA 4X93A 1TPZA 4X94A 3G2QA 2A1UA 1LDNA 3COVA 3D6TB 4IYJA 2QYSA 5EE0A 3OZFA 1B16A 3E70C 4V2IA 5HXAA 4KFRA 3MCVA 2AHRA 2HA2A 1E1KA 1I3KA 5TJHA 3CTPA 1GUYA 3QPVA 4PY2A 3D64A 3NEJA 5IZCC 2PN1A 2VWHA 2X0JA 1GCAA 3GLHE 3ISVA 4KGVA 1O0BA 3A9CA 4WVLA 4WGGA 1P9RA 4J4BA 2VWQA 1QQBA 1KNQA 1PO7A 5K8UA 3OO1A 1FTNA 1NI5A 1ZS9A 3LNCA 1YFLA 1QDUA 2VJMB 1EXDA 3DBLA 3SCZA 3PIRA 3G2HA 1PNOA 1W6RA 2HYDA 3GO4A 3R3HA 4Z9AA 3TL2A 3V8NA 4A5SA 4FGZA 2OHHA 3GJTA 4IIXA 5EQDA 3G68A 4ZEVA 1KMNA 1E0JA 1RM3A 2X4IA 3VR4A 1WB6A 5KU1A 2V97A 3IDZA 2EIXA 2HU5A 4QPZA 1E9AA 1H8HA 3RG2A 4MPJA 2WY2D 4ZYYA 4CM1A 3NBZC 3DNMA 3ZHYA 3NU1A 4XDYA 3WKEA 3P8ZA 4R71A 1NOKA 2VNHA 1UT8A 2R1VA 4HK4A 1VI2A 2XUZA 4GNKA 4IIUA 4YACA 4BO6A 5B36A 1Z83A 3NVDA 1G21A 1T0HB 1L8XA 1IM5A 2ECFA 2YVAA 3KEFA 3PGXA 1Z6PA 1Q7CA 3TLYA 1OFIA 2GN2A 5J9FA 3JQBA 5BUZA 3N28A 1B3BA 13PKA 4QGBA 3DEAA 3LC1O 4FYMA 4B6JA 3M70A 3KQLA 2H9YA 4D6PA 4LZWA 4Y1FA 3MINB 2VJAA 3DLAA 3W3AD 5M2QA 1D8AA 1HFEL 4F84A 3IS3A 1F7VA 2O7SA 3CKMA 4QBFA 2GF9A 4BVBA 4AU1A 4S1NA 3DLBA 5CFOA 2NU6B 3L3BA 4KITB 3D5TA 4KXXA 4LFCB 2UVQA 5ICEA 2BHNA 2ORIA 5L3SA 3GT3A 1B43A 1TC2A 2QQ0A 3MWGA 4ZVTA 3WBJA 1VKOA 5I7OA 3OE1A 1Y48E 1Z18A 4X20A 3BZUA 2VATA 4AF8A 2IHBA 4LE0A 4AN0A 5I4IA 5KUTA 3GNSA 5F52A 4TT3D 3BGOS 3DZHA 2AE2A 1CZHA 1TQHA 2X4LA 4LCBA 1D6MA 4V0NA 5BR7A 4AUNA 1M6WA 4A8JB 3NBUA 1MIOB 4DGQA 5LJIA 1DAPA 2NVUB 3WOHA 4MUEA 3OPYB 3GLFE 3NDIA 3SSOA 5I01A 1GGFA 1ZICA 1VHDA 3WB0A 1XWWA 4N3CA 3AUYA 2IYZA 1IY0A 5F3DA 1UL1X 2EVWX 2O3RA 4GS5A 3A4TA 4YH1A 4UPEA 5JNTA 1OB5A 1KI2A 1XA4A 2C07A 3KUDA 2KM1A 3WGOA 4B4UA 2OV6A 3BCSA 1K8YB 4Q3LA 1XJQA 3QVGB 5D85A 4YRDA 3P0IA 1YK0A 2ID8A 3LUFA 1ZUWA 3IT3A 1MIOA 2FJ0A 5F23A 4BX3A 5DT2A 2BGMA 4INAA 1KPHA 2QTGA 3OPYA 4O2AA 3GG9A 4WEQA 2D1RA 2HC9A 1G3UA 2HFKA 4L75A 2LD4A 1H4TA 4I1YA 3R7LA 4RQTA 1G9TA 3B3QA 2ODTX 1FZTA 1K1EA 1XTUA 3TVDA 1SG6A 1ATZA 4NF2A 1UMDA 4AG6A 4EB0A 1RJWA 3M0EA 1H6AA 4ZOCA 4ZO8A 4ENVA 2A0FA 4YWJA 5CYPA 4MVWA 1RJFA 2VN8A 4WKGA 4X00A 1FNDA 1SCUA 1S7CA 4GECA 2X0FA 4YPVA 3BWDD 2Z2YA 3BCUA 5CDUA 4BDSA 2PZLA 4BO2A 1ZGZA 1KDVA 2QVXX 3OQ6A 1PR5A 1DFHA 1IDN1 2CWDA 2DJ5A 2IE8A 4DLZA 4W8OA 1HWYA 3VR1A 3B1WA 3BJEA 3C7KA 4D9HA 1ZM7A 2VR1A 4Q01A 1EYZA 2WQ7A 3GAMA 2G08A 2IA5A 4QSMA 1BDHA 4B3XA 3PCTA 2OCBA 2W6JD 4RD1A 4ZGBA 2KMLA 2GBCA 5EXEA 4CCYB 3C3BA 1W88A 1G21E 5JLAA 1Z26A 4WCFA 5A3SA 3PT9A 4JVOA 1CQIB 2PJRA 4JAVC 4ARBA 2W0SA 4LXTA 4UDNA 4W8GA 2JIRA 1L5VA 4N0DA 5C8YA 3ZVRA 3AJRA 5ENDA 2QT1A 3TLXA 3LFHA 2J8ZA 4DSUA 1LPBB 4F1WA 4NH4A 5DTEA 2QP4A 3LUKA 1NW8A 3NV7A 3Q3CA 3VDQA 1SCJA 3TDNA 4IKEA 3VNBA 5JC1A 2RGRA 2OPBA 3JPYA 1XU4A 2W2PA 1PR1A 1ABFA 1QANA 3FZQA 3S2YA 4ZKDA 4G5XA 1JDBB 2J3EA 1JAIA 2WM9B 4J16C 4O4LF 3TNLA 1U9JA 1VIYA 4EG0A 3BSWA 4Z8YA 4D96A 2A67A 5IUNC 1SOVA 4ZOBA 4Q39A 4F4IA 2O0LA 4C7BA 4GL2A 4UQOA 4ND1A 4DMMA 5CA0B 2D5CA 3IVRA 2NZJA 1RZRA 5DNYB 1M7GA 5IAEA 4G0XA 4RTMA 1Q92A 2VT6A 1NMZA 5AVWA 4KIFA 3RADC 4HXGA 1SXJC 1Z4MA 4ILKA 2FSHA 3V2GA 2BHSA 4S3MA 3VH4A 1L7AA 3KR0A 1HORA 2VDWA 1A1SA 2IITA 1HDXA 3F7OA 3AVQA 2A7XA 3EBOA 4GMFA 3VR6A 1FUIA 2JHGA 1LPSA 2BFCB 2IZ1A 4RIFA 4JP3A 4RYDA 4V0SA 4KE7A 1CKEA 1PR0A 1YV9A 2KLBA 2J3HA 2RHWA 4TMYA 2WFLB 2JH3A 3H5IA 4FDTA 3C5HA 5HWSA 5K6RA 4MRMA 1HG1A 1UXJA 2XDAA 3SHVA 2QD2A 2IYNA 3FYUB 4H4EA 2OLEA 1ETUA 1YULA 3CX3A 3MGGA 5ALJA 5CA0A 3ROPA 4DS3A 5JS8A 1W0KD 3GRCA 3HC7A 1NBIA 1OBOA 3H2ZA 4LHSA 3WLPA 1L6RA 2A7QA 2JFYA 3BM5A 4WOCA 2BE9A 4XKJA 5E3JA 5TPZD 1SVLA 4QGSA 3K05A 2HBZA 4DR4B 1W0JD 4TTPA 4AYTA 4JBLA 3HLKA 1TRKA 4BV3A 4ZT2A 4PSCA 4DYVA 2X86A 5JAOA 5JXGA 2ID4A 2D7CA 3LQQA 3FFXA 1YFJA 2WFLA 2YWGA 3AZPA 4TOIA 4UOZA 1E6EA 5LKAA 1FSGA 4ZCTA 3FYUA 1M2VB 3E0QA 3K9GA 1XTKA 2J87A 1TQ6A 3CNNA 4PG5A 3AL3A 3FSRA 3NBMA 4CRWB 1N7JA 5JHGB 1Q0SA 1YDEA 3JTEA 2EP5A 3USES 1NVMB 1BROA 1L3CA 2FPWA 3WGVA 1H2BA 4BYGA 4BNVA 3OBBA 4KQEA 4YP9A 1E3WA 2G36A 1SBNE 3R6GA 3T52A 2I2WA 4L15A 1N5MA 1WY5A 2OWDA 4U2FA 3EGXB 3K9LA 4B3IA 4D9IA 3PJDA 1P1JA 5A1JA 1JPUA 5LQKA 3R23A 4ZRDA 1W94A 2JGMA 3G49A 1AXGA 3RIEA 3HRKA 4KN5A 1YS6A 2AFHA 3LX6A 3ZWXA 2FEWB 3N2IA 3ER9A 4G9EA 5FTNA 1YA4A 5AM0A 4BBPA 1G5IA 5C1BA 3DEFA