3RAPR

The small g protein rap2 in a non catalytic complex with gtp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
167
structure length
167
Chain Sequence
b'MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the small G protein Rap2 in a non-catalytic complex with GTP.
pubmed doi rcsb
molecule keywords PROTEIN (G protein RAP2A)
source organism Homo sapiens
molecule tags Signaling protein
total genus 56
structure length 167
sequence length 167
chains with identical sequence S
ec nomenclature
pdb deposition date 1999-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rapR00
1W36D 1RZ3A 1I4LD 3ZYCA 1P72A 1VDZA 1KZ7B 2OBMA 1QDEA 5CB8A 3P1JA 4KAXA 4M9XA 4DXAA 1E2GA 1I4DD 3G82C 1U99A 2O8DA 3N5CA 4JLNA 4BASA 2JJ1A 1R0XA 2VLIA 2G83A 2P3SA 3BBPA 4WIAA 4AKGA 2OO7A 3A36A 1NMZA 2HCBA 2WM9B 1E0SA 4WXRA 1OLOA 2ORIA 3GLHA 4V02A 1FOEB 4FW9A 3IIMA 1SVOA 1YZUA 2IS1A 2CHVA 4TSFD 4MRNA 4TMZA 1U90A 2FE4A 4JLKA 1M6NA 3OAAD 5SZHB 1NF3A 3U6KA 4EQ6B 4OJKA 3V4RA 5GJVC 4DRZA 1XTSA 4OI0A 2WWYA 1DG3A 1YRAA 4RD4A 4BFYA 5LB2A 3NWJA 3RANA 2WIBA 4LBVA 3WBJA 3M0EA 5EZ5A 1F3OA 2O8BA 4TQUS 4BRWA 1JEDA 2N1BA 4NP6A 1CR0A 3CO5A 3RS5A 2V1XA 4DEYA 1DEKA 2D62A 5BYKA 5L3RA 4AD8A 1RIFA 2HF8A 3SQXA 2JDIA 3MFYA 3PEUA 2DFTA 3NIBA 3MRSA 1G8HA 1SZPA 2XNDA 3T1TA 2W6JD 2JLYA 3IO3A 1Z3IX 3EPJA 1XU4A 1G17A 2LKDA 1AS2A 2WJYA 1P2VA 2NO9A 5AWFC 3AF2A 1ZM7A 4M1TA 3LXRA 5FR1A 2UZ3A 4YC7A 1IN7A 4ZDJA 1CIPA 4Q1FA 5C18A 2AXNA 1NSFA 1MO4A 3KJIA 3KKOA 4NZYA 121PA 3GLHE 1EXMA 1DADA 1MABB 1YU9A 2GESA 2HLDD 2JGNA 2PEYA 2ZRLA 1AZTA 2ZI6A 1BIFA 2XNSA 3H1TA 4I1OA 2D3WA 4LPKA 1AGPA 1ZD9A 2ZU6A 1JNYA 2H18A 5IDVA 4D4KA 3ZVMA 5FBVB 2A30A 2PX3A 3IPYA 1NN3A 4QG7A 3EA0A 2DWPA 2YWGA 4JVNA 1NKTA 4BEJA 5B2ZA 1E9BA 1FX0A 3CPHA 3WRXC 3K70C 1CXZA 2QM8A 2GZDA 4DSTA 1EX7A 4PAOA 1FUKA 2F55A 3SS8A 4ABYA 1SVKA 4HAXA 4DVGA 5KDOA 1HUQA 4A0FA 2PBRA 3IEUA 4A8JC 4NCJA 3OEED 2QBYA 3RWMB 1Q20A 2A5GA 2YZ2A 3LDAA 3OEHA 4D4LA 1XCGB 3A1VA 4JLMA 1W0KA 2R44A 4KFRA 2JJ8A 3W5IA 2P2LA 2V4ZA 1KNXA 4R71A 3FWYA 5IRCD 4M1YA 2F1RA 4YQFA 1MRSA 1X8KA 1D2NA 3T1VA 4B44A 4M1MA 1KO1A 3KXLA 2XZPA 1AKEA 1G3MA 1U98A 2CCGA 2PZGA 5EXTA 4QHTA 2P0EA 1K6MA 3SOPA 1G1MA 2J9RA 4BFWA 2Q9CA 2AWNA 1W1WA 4PC2A 3AP3A 1JBKA 1WCV1 3KTAA 5FI0B 4BPBA 3B82A 4LV6A 2X77A 5FTJA 4HLUC 1E9RA 1OKKD 4Q00A 4CIDA 3LV8A 2IYQA 1H8HD 3EASA 1NI3A 4OK5A 4Q1DA 1E2HA 4Q4JB 1J2JA 2YOGA 3CNOA 4OL0A 2FPLA 2C95A 3AGQA 4JZKA 1UKYA 2PJRA 1E1QA 4CEJA 2Z6VA 4DDTA 3QKRA 3R9IA 2AFIE 1H65A 3ZZUA 3TLXA 1HV8A 4Q4HB 1QHSA 2CLDX 1D5CA 4G5SA 2D2FA 3W90A 4U02A 1CBUA 4C2UA 1ZU4A 2QNRA 3QNUA 1GTVA 5GJWC 2Z83A 1T5LA 3NBZC 2VP9A 2ZRNA 4FINA 2ZJOA 1TU4A 3R8FA 1N0VC 2XX3A 3UWOA 2O8CB 3BD9A 4QBFA 3FE2A 3AUXA 3QKUA 4L9WA 3THWA 3V4FA 2FSIA 3LW7A 4LSGA 3UATA 3AUYA 2VP0A 3RHFA 5LD2B 5DN6A 5HR5A 1XB2A 3WNBA 1XEWY 1VMAA 2XOKD 4HUQA 2O5VA 4QOSA 3TH5A 3VHXA 4EAQA 4AKIA 1ZD1A 1E2NA 1GUAA 1W0JA 3THXA 3HJNA 2ZS8A 4EIWA 1JR3A 1MO6A 1ZNXA 3GLGA 4YMSA 1X1RA 1MKYA 2CBZA 3EPLA 2WMOB 1NSTA 3P4XA 2WKQA 3K0SA 4QGAA 4O2RA 4DIEA 4CEHA 1N6LA 3KX2A 1G6HA 3CR7A 5FBRB 4HDOB 4N3NA 4A0RA 3C7KA 4KITB 2WWXA 3GCGA 2HF9A 3KL4A 2QAGA 4AI6A 1T0HB 2AKAB 2FPMA 3L43A 4JYCA 3KB1A 4PAQA 3L2OB 4MQBA 2Y8EA 1YR9A 2PMDA 3NEYA 3LNCA 1FNNA 2DFKB 2WSSA 2ODNA 4QM7A 1OXXK 4RKFA 3LQQA 1JJ7A 3VKGA 1KJWA 1TF7A 4EFLA 2RH5A 4QJ4A 1OXSC 5E4FA 2ONJA 3NHBA 1KGDA 4D25A 1UEIA 5SZKB 5KDDA 3WYGA 5CM9C 4C4PA 1TMKA 1E0AA 4UNPA 4X8OA 1IAQA 3B60A 1JQLB 1QHNA 4L16A 2QU8A 2VHQA 3OIUA 5E7JA 1IN8A 1GFIA 1XD2A 2G9NA 1EWRA 1QG4A 5DSZA 4GI7A 4CGZA 2NO1A 4XIGS 3A6PC 1ZCAA 4AKEA 4F4IA 5HKKA 3BFVA 1OV4A 1IXSB 1NL3A 3ZS8A 5JCZA 1W4AA 5HE9A 1T3LA 4TMWA 4GRAA 2IYXA 1LNZA 5FTKA 5JS7A 2OLJA 1LF0A 2BIFA 3CF2A 1JALA 3V00A 3B5JA 1JR3E 3GLGE 3W5JA 1HURA 1OFTA 1QBKC 3LVRE 3OIVA 2GWHA 3CM0A 1DAFA 2OCBA 3AVVA 4KLZA 3FGNA 5FOWA 3C41J 2ZE7A 4FIDA 4XWAA 2AKYA 5BW8A 1JAHA 2Q3HA 2WJGA 3ADKA 4NH0A 1QHIA 4G0NA 3SR0A 4AG6A 2ZYWX 4Q21A 3AVPA 3L0OA 4Q7KA 3M1IA 3CB4A 2WJJA 4K8OA 3U3OA 1SQ5A 1MR3F 4BLTA 1U8YA 5FOUA 2D4HA 2FOLA 5HPYB 3L8YA 2QQ0A 2BWJA 2WZQA 3K0FB 3GJ0A 1NVUQ 3PR1A 4G5OA 4Q4AA 3O8RA 5CK4A 5E95A 5EP1A 3F8TA 4XTRA 1F48A 1VYVA 4HLQB 4CW7A 3W8RA 1SGWA 4PSAA 4HDQB 3AVXA 4F7WA 2OFXA 3U60B 3TR0A 1E9FA 4EFNA 5F98A 3K9NA 4RCZA 2WJIA 3RS7A 1SVMA 4M9QA 1NMYA 3HU1A 1E4VA 1J70A 1TU3A 4PFSA 2IF0A 5L3QA 3GFOA 4MDEA 1S8FA 4YXWD 1FL9A 4F91B 2DWQA 2BM0A 1CR2A 1TEVA 3BRWD 4BLOA 1LB1B 2IYZA 4GP6A 4TSFA 2HCJB 3MJRA 4X8LA 1HY3A 5AUOB 4WVFA 4O2LA 5HTKA 3AKCA 4TZ0A 1XDBA 3EIEA 4RKEA 5FH9A 1GITA 1XNJA 4EKDA 1E9DA 2DFLA 2CNWA 2FEOA 3WHKA 3UMFA 3IUYA 3A1TA 4LHVA 1JPJA 1DO0A 1KSFX 3KQLA 5D3MA 3KZ1E 1NBMD 3QKSA 2QQEA 2HXSA 1G8GA 4TTPA 3U5ZB 1KY2A 2J1LA 1C9KA 1N6RA 2DB3A 2O8EA 3W6NA 1II8A 2R6AA 3AH8A 4C0BA 3UKDA 2D06A 5FPSA 2C04A 4LUCA 4B3CA 1E69A 2MMGA 3B6EA 4A9AA 3OZXA 4IDPA 1RRGA 2E87A 5A4JA 2JDID 3BWDD 5CJPA 2W6JA 2GCPA 2EU8A 3U7FB 4TYWA 2ZJ2A 1N0UA 5JHGB 2JLQA 1G4UR 3NDPA 3BB4A 3AQ4A 2P6NA 4OK6A 4G1UC 4KO8A 3IBGA 4B3GA 3DM9B 2DY1A 2G0TA 3BE4A 3BERA 3GJ5A 3OFND 4KYIB 1BKDR 2PZFA 1NIJA 2G1JA 4DCVA 4ZCMA 3SZRA 1XXHB 2PL3A 4JIMA 4L5BA 2QP3A 5L3VA 3GLIB 2JLUA 4UJ3A 3PCRB 3DHWC 1HQCA 1XPRA 1H8ED 4DSUA 2N42A 3QY0A 1F2UA 2HLDA 2HJVA 1IHUA 2OT3B 4HZUB 2VHCA 3B78A 4HB2A 4ZPXA 3ZIAD 3KQUA 2B92A 5FBQB 3UMSA 1VYUA 3O8CA 2F43A 1KMHA 4Q7JB 3VKWA 5J4LA 2ZJ5A 1J8YF 4OI4A 1G20E 3VFDA 3JZAA 2OXCA 2AR7A 4Q18A 3CRMA 3U6BA 3LBHA 5H68A 1UPTA 1KO7A 3PFIA 2F6RA 2GK7A 2VBCA 3SYLA 1N5LA 2IWRA 2JJ2A 4BE7B 3A37A 4V0LA 1SVIA 4BZQA 3OEHD 4HATA 1DAKA 4HAYA 4DWJA 3GPLA 1U8AA 2ODBA 4BZPA 2ORVA 3QENA 4KVGA 3WY9A 3HR8A 4POAA 4CEIA 5EE3A 4MH0R 4NCHA 4AYXA 4W9MC 3C8UA 1RE0A 4RZ3A 1JXMA 3CNLA 4MRVA 5FPYA 4A8JA 3I92A 2VSOA 5JJKA 4V0NA 2C5LA 2PCLA 4MYUA 4XSHA 4WAUA 1D9ZA 1KY3A 1NVVR 1XTJA 2F1IA 2WIAA 4DT1B 1KTVA 2ZRDA 1LS6A 3U3JA 2QP4A 1OB5A 1ZIPA 1YQTA 1ETUA 3LBNA 3AVWA 1E32A 4OQFA 1XP8A 4GOKA 4QNMA 3KDSE 3QXJA 3H2YA 4MKHA 3R7WA 5DH9A 1Z47A 1H8HA 2AHOA 4BQSA 2EYQA 5L8VA 2ANCA 5TARA 4BFVA 1RFLA 1W49A 4KSCA 3U7GA 1F2TA 4IDHA 1G5RA 3T1QA 4EFMA 1E0KA 1E1QD 5CIQA 2QN6A 5KO2A 4C2TA 5C46F 2RAPA 5B57C 2HEIA 2H92A 4HLUA 1DG1G 1QVAA 3DZ8A 1X8LA 1KHTA 1KJYA 2HXYA 4ON9A 2XXAB 3ADCA 4I81A 3CZQA 1VPLA 4PO8A 4F92B 1M8PA 1JI0A 1ESNA 4TLAA 3EC1A 2FGKA 3I3SR 2OBLA 3FFBA 2Z4RA 5DN6D 2XOKA 5BN5A 3DEFA 1FTSA 2FGJA 3HWSA 4JSYA 1AA9A 3BXZA 1E2JA 1XX6A 2A78A 4KHZA 2A9KA 4ZDKA 5DE3A 5G40A 1W0JD 2XJ4A 4C0QC 3ASYA 4M1KA 3ECCA 1EFTA 3VR5A 4GBMA 5J4VA 3WMEA 1RKBA 4JL5A 1DTSA 1DBSA 4IJMA 2X1VA 3FB4A 3FOZA 3KQKA 1CULC 1W46A 3RRMA 2WICA 3CIOA 4DDUA 2PZEA 1IOZA 1GVNB 2QPOA 2WPDD 3B8HA 3CW2A 4HDCA 3Q9LA 2NQ2C 1NVWQ 1WBBA 4ARZA 2CJWB 4LBYA 1NRJB 4NYJR 1G7TA 5FBLB 1KIMA 1ZAKA 2W58A 2C99A 3I5YA 1Q1QA 4Q4LA 2X8AA 3MWKA 2MMCA 3P20A 1XZQA 2QRZA 4D4JA 4JLBA 4UQOA 4JL8A 3NXSA 4V03A 1OE0A 3DPUA 1G9XA 3B13B 3NC0C 1Z63A 3RAPR 3VTKA 5M04A 3I5XA 2EVWX 3REFA 3EAQA 4TL9A 1V43A 3U2QA 2EW1A 4CRWB 4EPXA 1ZD8A 3F0TA 4D4MA 4GFDA 3A58B 1Y3AA 3ASZA 3B7GA 1ZU5A 4TLDA 5EE5B 1IN4A 3GJXC 4XWOA 1GRRA 3T34A 3PG5A 3PEVA 2KBFA 2QENA 1AGRA 2BVNA 2ONKA 4PZZA 1M1YE 3EWSA 3Q8XB 3AVUA 3J81k 2X2FA 2MSDB 2SHKA 2ZREA 5G3YA 3T06B 4D82A 1FNMA 3RLFA 5LB4A 4KBGA 3FDIA 1KO8A 1N6HA 1T5IA 3KJEA 1OH8A 2CVHA 1OT3A 3D6TB 3PXGA 1OXTA 3E1SA 4D81A 1T3SA 4DCSA 3SFZA 3U4QA 1KDRA 3W3ZB 5JEDA 2JLXA 4JVSB 1E2MA 3THYA 2PLFA 3TSZA 3TR5A 3I62A 1W44A 2EFHB 2XGJA 2BMDA 2OXRA 4E22A 2Z0MA 4UXHA 1S96A 1VHTA 4IOKA 3UIEA 2KE5A 4GDFA 1G8YA 1OPXA 1XMVA 2GXUA 2ERXA 3BH6A 5LD2C 2REBA 4PX9A 1JXOA 4IOJA 2G3YA 1US8A 1KDOA 2VO1A 4BWYA 1FMLA 2FFQA 5A0FA 4A92A 1E2DA 4TT3A 4ZCIA 1OFUX 2FFBA 4ACAA 5UKDA 2Q3MA 1UBGA 2DBYA 4I1VA 2NO7A 2ODEA 2HDNB 2Q0HA 3D3QA 3TVTA 2B8WA 2IYSA 3IPXA 4NYIQ 5EE0A 3MUFA 4DLTA 3HU3A 5FTLA 2ZAMA 3VR3A 1FTNA 2X19A 1P2SA 2EYUA 4Q47A 4YXWA 3TAHA 2PLRA 3AVOA 2BOVA 1T8TA 4DZZA 1XJCA 4JT4A 1P7CA 3DMNA 3U7EB 2ZPTX 2BV3A 4W5JA 3BFXA 1PJRA 1ZP6A 3C5CA 4LJYA 5BN4A 3ADBA 1NNEA 1XPUA 4LCBA 4NHOA 3N70A 3KKNA 4PZLA 1EG7A 3CLVA 4Z8XA 3CBQA 4F93B 1T4GA 4PAMA 1Z0AA 4XWKA 2ZJYA 3PUYA 2F1JA 1GG2A 1E2LA 2CNWD 1U9IC 3TMKA 1QHHB 3BK7A 4JBWA 5E7IA 2RCNA 1NBMA 2QRNA 4TYNA 1CF4A 5AJYA 3NVAA 3CRW1 4URYR 5EP3A 2WAXA 3IILA 4R7ZA 2GJ8A 4C7OA 3KTAB 1OHHD 4HAWA 2H1LA 5DYGA 4Y0AA 3IHLA 4ZDIA 4LGMA 2VYFA 3SYNA 1N6OA 3A4LA 3H84A 4LI0A 2Q6TA 1Z6GA 1IJEA 2GXAA 2LWIA 1SVWA 4LBZA 1NY6A 2AK3A 5K8IA 2EFGA 3QG5A 4D0NA 2FZLA 3H0KA 4HB0A 3L82B 4BLRA 1ZW6A 3TUIC 3EIHA 1N6PA 2H57A 2R62A 2ZU0C 3QXHA 3HR7A 4O25A 1XEWX 2HUPA 2C9CA 3OFNA 1GL9B 1KI1A 4LDJA 3D31A 4PHTA 1NN5A 1T3HA 2BBOA 2FH5B 2E1RA 2ZYTX 4JLPA 5FPTA 2ZETA 4PC1A 1GKIA 2BKUA 4C0SA 4LHZA 3NBXX 4TL6A 1IJFA 1GKUB 2ZRCA 1AK2A 5JEEA 1H8EA 3CF6R 4IDQA 1R5NA 2A2ZA 2IEYA 1RPZA 3NKVA 4CF7A 1VG9B 1KSHA 2REXB 3VX3A 2WKRA 3ZIAA 4US1R 4IRUB 3ZD7A 4BLPA 5CDFA 5HE8A 5BXQC 5B58C 2Q9AA 4CVNA 4HAUA 2GJSA 4HUQB 2IYRA 4ACBA 3C16C 2HT6A 1NBME 3REGA 2GJ9A 3THXB 3AF0A 2ZJBA 3QF4A 3O8DA 4LOAA 3X1DA 4TZ6A 3HDTA 3ONWA 3I8SA 2IWHA 2WBLC 4AK9A 4ZI2A 1TQDA 2OFWA 3K0AB 4HB3A 4KCGA 4BEBA 4XTCS 1J8MF 1MO3A 2C98A 4DLWA 2OCAA 2JJ2D 3QIAA 1L4UA 2QAGB 4Q48A 2VP5A 4XH9B 1CRPA 2BBWA 5K8TA 3CH5A 3P27A 3K9GA 4CZ2A 5KUTA 4RCYA 3A8TA 4H9GA 1R5OA 2EFDB 3TQCA 2O52A 4NONA 3NTUA 4M8NE 4MGKR 3X2SA 3B1WA 2ZRKA 5DNYB 1KI6A 2OILA 2UZIR 2WWIA 3K70D 1J7KA 5K8LA 2ZI9A 5K8UA 1S3SA 1LTQA 1G19A 1EFRD 3E70C 3G5UA 2IUUA 2GBLA 4XVUA 3LLMA 2CL0X 4P32A 4W7SA 3U3MA 2ZRBA 2RGEA 3AEZA 3BB1A 1D6JA 5H8WA 4Q9IA 2YNMA 5JSZA 3RNLA 4PTLA 4WXPA 3QBTA 1JQJC 3H86A 5IHPA 1XD2B 1BYUA 4Z1MD 4BFSA 1DAGA 2FPKA 2QE7A 3LXXA 2AWOA 1IY0A 3BAFA 2HV8A 2IT1A 2PEZA 1XCPA 4M2LA 4EPRA 4ESVA 4KFUA 5CDFE 5SZJA 3GEHA 5C4MA 5TY0A 5J47A 5FTMA 1R0YA 1M2OB 4JS0A 2PT7A 4GOJA 3CF0A 2NOAA 4S35A 4PHHA 3BORA 4GZMA 2BMFA 2IC5A 1N3BA 2DWOA 3M6AA 4KYUA 3ZZTA 1E79A 4DLZA 1P73A 2J41A 3BH0A 3W3AA 4IXMA 4MUAA 3IEVA 1UKVY 2FMXA 5FFMA 2ZI4A 1P9RA 4X8MA 3LD9A 1SKYB 3RS2A 2VIIA 3ZDQA 3K0CC 3U44A 3VU9A 2FN4A 1WF3A 2ZSAA 1PLLA 5AJXA 4P4TA 3EZ6A 1VG8A 4DDWA 4FXPA 1OF1A 1ZIOA 1YZQA 3VQTA 1TX4B 721PA 2ZJ8A 4B2PA 5IF9A 4OQLA 5KPJA 3DOFA 5CIWA 2WAYA 3GJ8A 4IW3B 1ZM9A 3CUEF 2DYKA 3FMIA 2GHIA 1GNPA 4TLCA 3B2EA 1JJVA 1BH2A 5H70A 1FP7A 4WZBE 3EZ7A 4A82A 2ZSBA 1IBRA 5DIFA 2VHTA 4Q4AB 4M1SA 3WNDA 1DE0A 1CJMA 2B21A 4IKEA 2P6RA 3MMPA 3ZLJA 2CEAA 4B76A 1W36B 5EJEA 2V6JA 2C78A 2ZRGA 1G3UA 1G291 5G53C 4L4UA 1W4BA 4LC1A 2QUZA 1MABA 3WP0A 1NVXQ 4TQAA 2OBNA 4JT2A 2PT5A 1S3GA 4HAZA 1CJTC 1F5NA 3CRQA 2WPDA 2ZI5A 3BIFA 4DLUA 3EG5A 5L3QB 2J0SA 4LZZA 3QPVA 1Z2CA 2OFOA 3CR8A 3QUSA 3EPKA 2WHXA 3BOSA 1OXVA 1Z0KA 3CPEA 4IDOA 3WNCA 1YVDA 3ZS9A 3N2EA 3B1ZA 5CK5A 4B43A 1U8ZA 1D2EA 3E2IA 1A4RA 1KZGB 4NCNA 5G3ZA 2R6GA 1E99A 2H8KA 1O3YA 1A2KC 3DVLA 1UF9A 4TYYA 3JVVA 2R9VA 1Z6TA 1SXJC 1XPOA 3CX7A 1UJ2A 3K53A 3IIJA 5D3MB 3QVUA 3QKSB 4EPWA 3MWYW 2GEVA 4RD1A 1E9SA 2QMOA 2UVQA 5JZVA 2AK2A 1XWIA 2ZJZA 3Q7QA 4QNRA 1HA3A 2XZLA 1II8B 1GM5A 4QFMA 4RZUA 1VTKA 3SN6A 4PC7A 821PA 4RFSA 1G3IA 4FN5A 3FMOB 4MYCA 2YV5A 1M34E 2A7QA 2XTNA 4JLDA 4OKSA 2A5YB 5CLQA 3AF4A 1AQUA 521PA 2X2EA 1E2EA 2FV8A 1SXJD 1UBFA 2XSZD 3RS4A 4MYHA 3UMRA 4E07A 3TW4A 4C0JA 2GETA 3RWOA 3OIWA 1XRJA 2RGGA 2ATVA 4LJ4A 4D0GA 1ZBDA 2WV9A 5AR1A 4QBGB 3PUXA 1LS1A 1QHXA 2RGXA 4XD7A 1ELOA 5A5GA 4AIIA 5GADl 1E2IA 4Q4JA 3SEAA 5L3SA 1OH6A 1LV7A 5FPKA 1NLYA 1YR7A 2B8TA 1XEFA 2ZTSA 2ZYVX 4CYMA 1NG9A 3P4YA 2HJGA 1GL6A 2DHRA 4Q9KA 3DKVA 4NCIA 1F2UB 3EX7C 1U2RA 4LV8B 4Q4HA 1TNDA 4DLRA 1PLJA 4TTRA 1UBCA 1XBTA 2R65A 4OJQA 1P2UA 2ZR0A 4RFVA 2QT1A 3UG7A 1RRCA 5ANRB 2ERYA 3IHWA 1NN1A 4TT3D 1VYTA 5KNDA 3AVYA 2DFNA 4LC0A 3LH5A 1GIAA 2ODWA 4KV9A 1OSNA 2HYDA 2MSEB 2PJZA 2O8CA 2VP2A 1HYQA 3OHMA 1BOFA 3HPRA 4GNKA 3ADDA 1BYIA 4LHXA 3UWKA 4Q9LA 3SYKA 2QZ4A 1Q1BA 4NCKA 4Z8YA 2V55B 1CKEA 5B64A 5ELXA 1RJ9A 2IYYA 3D8BA 1E2FA 1XF9A 4BUJA 2ZAOA 2QM7A 5HZHA 2QTFA 3PQCA 4B3DA 1KDPA 2ZVQX 2BKEA 2Q21A 4LK2A 4TL7A 3QKTA 5P21A 3ZQJA 2PH1A 2MSCB 1GL7A 1W48A 5JBQA 2AFHE 2P67A 1Q22A 2A5DA 3HU2A 1TTTA 4CEIB 2QGZA 2JA1A 5E7MA 2EFEB 3OESA 4ASUD 4OBEA 2GJKA 5KSOA 4Q66C 1GZSA 3GLFA 3GFTA 4RZXA 4C3ZA 2V9PA 4MKIA 4NYMQ 4QGFA 1TUIA 5DYIA 4EJSB 1D9XA 5CJ2A 4Q1CA 4DKXA 1AS3A 4PZYA 2BBSA 3OIYA 2YHSA 5BQ5A 2V7QD 4HYYA 1OHHA 4R2IA 1R0WA 2QMUA 1TL7C 4HI0E 1QHGA 2GK6A 1FQJA 2GZAA 2ZE5A 3EXAA 1KAGA 3KKPA 1PUJA 4MITA 2OLKA 4Q7LA 2IHBA 1D8TA 5FI1B 2VPPA 5FPHA 3ZQ6A 2FJUA 1ZC3A 2ZM5A 1FQKA 3C4JA 1U9IA 1YR8A 2WTUA 1GRNA 4L9SA 4MRPA 5DLQC 4D6PA 3I72A 4HB4A 1R2QA 2QY9A 4TLEA 3SFVA 4LRWA 2FFHA 1FUUA 2H17A 3NH6A 2ZRHA 2J7PD 1TQ2A 2I1VB 2J3EA 1YKSA 1VECA 3A1UA 3I1FA 4PPQA 4ZIRA 4NU0A 4Q9JA 4TMXA 2ZRPA 3C14C 2VQSA 2BMJA 1LF5A 2IA5A 1KDTA 1ZRHA 2F1HA 2VEDA 3S1AA 2JLVA 2ZYUX 1UKEA 1DO2A 4M1OA 3DOEA 4QGGA 1CJVC 4LJ6A 2V3CC 5GJBA 1G41A 3VR6A 1NN0A 1ZINA 2J0UB 1T6NA 4WW0A 2CMKA 3U7HB 4LYHA 3PUVA 1EESA 1CLUA 2BJWA 4N0EA 1VHLA 4Z51A 3GLFE 1W47A 5DI3A 4A1FA 3LO5A 2XB4A 3TUJC 3GJ4A 3Q72A 4RD0A 2YC2C 3TBKA 4DUGD 5KPDA 3ZGXA 1HTWA 1WQ1R 4RJLA 3FMFA 1RRPA 5KSYA 5DHAA 4EPYA 2NIPA 3AF1A 2IUTA 2O0KA 2HYIC 2IXFA 4I99A 2DPXA 3K0FA 2OM2A 5IT5A 3FHCB 2C77A 2VA8A 2W2TA 2QA5A 5JWOA 1J90A 1E96A 1KI3A 5BN3A 4QXAA 4QJ3A 3GMTA 3F3YA 1GAJA 4IXNA 4BZXA 1EFRA 1EWQA 4MUBA 4A6PA 3LY5A 1SKQA 4H1VA 4FMDB 1NG1A 2ZXUA 3BGWA 4ERNA 1LVGA 4A6XA 1I2MA 3X1WA 4MA4A 4TMTA 2ZANA 3PEYA 3T61A 1UM8A 2GILA 2ORWA 1G3QA 3VR2A 4B74A 3TSWA 5JI3E 4Z1MA 3MWJA 5JRJA 2W2XA 1K8RA 1XTIA 2QE7D 3FHOA 3WXMA 1N6NA 2B7BA 2KB0A 3P32A 3VHLB 3CPJB 4C0AC 3ZVLA 4UNNA 2VH5R 5FTNA 3T15A 4AC9A 2VHUA 4Q5IA 1EFCA 4ZCLA 4D80A 3EC2A 4TL8A 4KXFB 4ZKDA 2D2EA 3P26A 4GP7A 1GILA 2AXPA 3EWAA 4YDSA 1GOTA 3MSXA 1P75A 1E79D 2BHRA 3KKMA 1OIXA 5JHHB 3RC8A 3EZ9A 3TAUA 5J4KA 1HT1E 4FMCB 4OHVA 1R0ZA 2ZEJA 4GL2A 3H4MA 5DISB 3FVQA 1DAMA 1R8SA 2IUSA 4URVR 3U4QB 3NDBB 8OHMA 3AM1A 4QHYA 3N2IA 1PV4A 1G3RA 2CCKA 4KFSA 2CL7X 2JAQA 3THYB 1EFHA 1UADA 1ANKA 5EUQB 4TMKA 5TDHA 4GOXA 3TJZA 5D3QA 4CT4B 1X8JA 5TMPA 2ZRMA 3WYFA 4JLVA 3K0CA 3EW9A 1E2QA 4JVMA 4KFTA 4XVRA 1EFUA 5EXSA 4YMVA 1P5ZB 2GZHA 1E1RD 4OQXA 1XMJA 1G7RA 1N0WA 1WXQA 4LJ8A 3IKJA 1CP2A 2IEZA 1RC8A 3AGPA 1L7VC 5CYPA 4DBLC 4IEEA 4F4JA 1AN0A 4HZUA 3RRNA 1IONA 5HCNA 1S9DA 2RGBA 3U3KA 3IQWA 3L0PA 2FZ4A 2O8DB 5AUNB 1FP6A 1YR6A 1XJ0A 2F9MA 2FG5A 2NO6A 2QAGC 5KYKA 1A2BA 2BDTA 2V8OA 5TVKA 1IM2A 421PA 3GLHB 3C15C 4AYTA 3R8CA 2JLRA 3FYHA 4B33A 5J4HA 3AKEA 3ZVRA 4PQYA 5CM8B 3DKPA 3NBFA 5B30A 1XTRA 1W4RA 3B9PA 2BEJA 2QSZA 3LRPA 1QVRA 3A4MA 2OG2A 1G6OA 3SJAA 1G64A 1Q1EA 3BS4A 5FUYA 5JFGA 2JEOA 2NMVA 1G8PA 1L8QA 3MLEA 3UANA 1E94E 3KUCA 2O8BB 4Q1BA 2FSGA 2G6BA 2CVFA 3SU8A 1L4YA 2D74A 4XVQA 3WYAA 3ZVNA 2GF9A 4C7OB 1F6BA 1Z07A 4A15A 2OE2A 1T0JB 1NJGA 2ZS9A 3Q3JB 4WBSA 4ZI3A 2GEDA 1XXHE 5DHFA 3GLIE 2ASEA 5JRZA 2GJAA 1XEXA 2F3RA 2IYTA 4NTZA 2YWEA 1SXJA 1RRFA 2XSZA 5JWRA 4KBFA 2D7CA 4FD2A 1N2CE 1NMXA 5EE1A 4DLVA 5CB6A 1VG1A 1YZNA 3SJBA 4HAVA 2EWVA 1S9HA 2G77B 2IX3A 4GPTA 2Q3FA 4IOLA 4B2LA 1SHKA 1DAHA 2G1KA 3QOFA 3KKQA 4B3XA 4XD7D 2GCOA 3W8NA 3K9LA 2LKCA 4M22A 2KBEA 3LX5A 2G0NA 3MD0A 4RZ2A 2GTPA 2RGNC 5KNCA 5FUVA 3BC1A 3KFVA 4BLSA 4C9BA 3ZJYA 2ZUBA 4QM6A 4DB2A 2VSXA 3SNHA 4AYWA 5AUPB 1IQPA 2P5TB 3L0SA 4LYJA 2YWFA 4JMPA 4PHFA 4TWZA 1AKYA 2XTZA 4PO9A 3SHWA 3CKLA 3W34A 4BFTA 5EZ6B 3DMDA 1BS1A 3WRYC 3CNNA 1P61B 3SQWA 1R6BX 1TAGA 2IXGA 3PENA 4M1WA 1YHNA 4D0LB 5E3HA 2XXAA 1FX0B 2AD5A 2KJQA 3NC1C 3NHAA 2Z5FA 4JLOA 3EPHA 4II7A 1DOAA 3EA5A 4JYBA 2AX4A 2W83A 4N0DA 4Q01A 3VMFA 2CHQA 3TIFA 3R9WA 2FSFA 2BBTA 1P2TA 4E09A 5EE9A 4EPTA 2WMNB 2P6UA 2RB4A 1Q21A 3KUDA 3MWLA 4ZO4A 4DJTA 4F4CA 3QEJA 4DSOA 2QBYB 1NIPA 4IFEA 1G4AE 2IF2A 4XOIA 4OHWA 1Z8FA 4G5RA 2WWHA 5TB5A 1WA5A 4URXR 1SXJE 3QEOA 3AKYA 4NE2A 3DDCA 4JLJA 4B34A 1DS6A 1GSIA 1KI6B 4M4SA 1G7SA 3TUZC 1WP9A 4ASUA 2NTYC 2AL7A 1JPNA 4GSYA 3UXMA 3LFUA 5C4GB 4MRSA 3KB2A 3Q5EA 4JKIA 3F5FA 1KSJA 2CJWA 4PC3A 1M7BA 5C1BA 5JSZB 1A5TA 2V7QA 3QQ5A 3BH7A 1XD9A 2PCJA 4LHWA 3DM5A 3MAAC 4FCWA 3THOA 5KSZA 2RMKA 3RS0A 4IVPA 5FOTA 4B73A 1EK0A 1R8QA 4P4SA 1II9A 1QRAA 3WMGA 4O3MA 1YE8A 4NBSA 3X1YA 4B35A 4B6EA 1F60A 2GAOA 1VCIA 4NMMA 3KJHA 3RYTC 4NYIR 1ZJ6A 2RHMA 1RYHA 3I32A 1A7JA 2L0XA 1CR4A 1ZC4A 3I73A 1ZNYA 1QG2A 3VX4A 3VNUA 1KOFA 1XMSA 2OUKA 4C30A 1ONBA 1OYWA 3FTQA 1ODFA 1EGAA 4CEJB 3LBIA 1G7CA 1T8UA 4P31A 2J7PA 2OCPA 3QKRB 2OZEA 1OIVA 2NPFA 4LJ5A 1FW6A 2JATA 3WMFA 5HCIA 1P60A 2BJVA 2VHJA 1WMSA 1QHYA 3PEWA 2NZJA 3CRVA 3PUZA 3SDZA 4I4LA 2BC9A 3K0EA 4J0QA 4QHSA 3RC3A 3VU9B 4B2IA 3U44B 3UPUA 5TV2A 5F9FA 1G8FA 1OIWA 4DHEA 1OH5A 3L0IB 4Z54A 1R5BA 4UNQA 3KJGA 1XFAA 1TF2A 1Z29A 4MGIR 5J4YA 4P4UA 5HZKA 4K81B 4WA7A 4M53A 1G18A 1CU1A 2O8FA 3T35A 5AJWA 1AIPA 1NY5A 3THWB 3ND9A 1OYYA 4F38A 1KKLA 1XCMA 4PANA 3B1VA 3HPQA 1KK2A 1DELA 2CE7A 1R7RA 3RS3A 1HH4A 3WHLA 1P9NA 4DUGA 4ZV4A 2CK3A 4MRRA 1MO5A 3GLGB 2IS6A 5EXXA 4QRHA 2C96A 2IS2A 1KKMA 3ICQB 4LYFA 4CEHB 4OYHA 4DSNA 2ZRIA 1CJKC 1NLZA 1OW3B 1OJLA 3X1ZA 4HSEA 2W0SA 1PUIA 1Z6YA 4LPSA 4C0KA 4PR0A 2B6HA 4MGYR 1KI2A 1WDTA 4IDNA 1E9AA 1WE2A 1ZM2A 1ESMA 1D2MA 4RVCA 4OHYA 1A82A 2JIZD 1P6XA 1T9HA 2GKSA 3OF5A 1AM4D 2P65A 2WWGA 2ANBA 3TGPA 5JJIA 3T5GA 3QPWA 4M9ZA 1UDXA 1W2GA 5AJZA 1E2KA 2VP4A 1G16A 1NP6A 4JKYA 4XSGA 3LLUA 4B47A 4EJSC 4B6FA 2ATXA 2QP9X 1ZNZA 2QG6A 4UXIA 1W4CA 3AB3A 1PVOA 1Z06A 4URWR 2W2VA 3IBYA 3JVUA 3LA6A 2GDJA 3SHFA 1RYFA 4KJZA 4EQ6A 2FWRA 4G5GA 2W00A 1AZSC 1CS4C 1CTQA 3GP8A 2PX0A 4RFSB 3BJIC 1KI4A 2NPIA 4WZ6A 2ZRAA 1B23P 1QHHA 2IBMA 1P4SA 2ZUDA 3ZZ0A 2A3RA 2ZR9A 1NJFA 3CONA 1OFHA 3QI2A 5IK2A 3Q5DA 2BEKA 3HYTA 221PA 2C8VA 1VCOA 4URZR 5BYJA 3K09C 1WB9A 1KNQA 4U00A 3RRZA 1ZVQA 4M21A 5AUQA 2XEXA 4PPNA 5JMTA 2GXSA 5G41A 5FL3A 2QORA 4DDVA 3OE7A 2YC4C 5L3SB 4D2IA 4Q19A 2KI5A 2ZSEA 4EUNA 4AWXA 4BECA 3TQFA 4IHQA 4BFUA 1JB1A 5EQTA 3LX8A 1X1SA 3C5HA 1N5IA 1Q1ZA 2FFAA 3IDQA 5F9HA 3QSYA 2WOJA 3RABA 2G88A 2R2AA 1J99A 4AKHA 2CHGA 2J5XA 1E1RA 3M4YA 4Q02A 4PSKA 4Q1EA 4JL6A 2IK8A 4OK3A 3L8ZA 3SJZA 2IS4A 4MYTA 4L15A 2FEMA 3NH9A 4QKQA 1COWD 1HE1C 3TW8B 2BMEA 2NG1A 2JLSA 1XJQA 4KU4A 5GJCA 1Q3HA 2ZJAA 5FBWB 3I4LA 1RJ9B 3QPUA 2IYVA 1FFHA 1ZMXA 4G01B 4GT1A 5KSPA 1E3MA 1HEIA 1B0UA 2XB2A 2EWWA 3D7MA 2ZI3A 3KXIA 4OQNA 3JZMA 1K5DA 2CDNA 1HE8B 1YZGA 2WJHA 4C0HA 1NKSA 2A5FA 4P33A 4QBHA 1XTQA 3SBDA 3K0AA 3CX6A 3GFPA 2J87A 2IHYA 2ZR7A 4LBWA 1P9WA 4YMUA 3T12A 2C9YA 4M9SA 4WZAE 3IO5A 1IN5A 1YRBA 5JECA 4PHGA 2A5JA 4LJ9A 3GLFB 3WP1B 1XTKA 2C03A 1DPFA 5FOXA 1KYIA 1TQ4A 3W9YA 4US0R 1MV5A 2JLWA 3QXSA 3TK1A 3KQNA 2W6ID 4H1UA 4GZLA 1TQ6A 4A2WA 4UXJA 4Q7MB 1AJEA 4V0KA 2O8EB 1PZNA 2QPAA 3ND8A 5KHOC 4YDHB 3TNFA 2QEQA 4RD6A 1Q44A 3VAAA 2WJVA 1VIYA 4LHYA 2XZOA 2WWFA 3MGCA 1UFQA 2C2HA 1E4YA 3ETLA 1ZUHA 1YZKA 2VP6A 4HUTA 3LQRA 2H16A 5LPNA 1GKYA 5GVRA 4A4DA 2OV2A 1YJ5A 4PPGA 1BMFA 4U5XA 1XZPA 1IXZA 4ZKEA 4D26A 3GQBA 4UKDA 1GDDA 2RHDA 5JWHA 3SE0A 1KI7A 2Z4SA 1TPZA 4ZIRB 1R10A 4MDFA 1FZQA 4ZDWA 3TE6A 2P5SA 4OQMA 4A36A 5J40A 3CX8A 4R2HA 1IY1A 3QJYA 1YZTA 1II0A 3S1AB 4BGDA 2RKOA 3AV0B 4FCTA 1KJZA 4TN1A 2YINC 2V54A 1DVRA 4A0HA 1S4QA 4DIDA 1E9EA 1SVSA 4IVQA 1S2MA 3A1SA 1XD8A 2GA8A 1X86B 1GNQA 5LBIA 2F43B 1KMHB 4Q9HA 2YJTD 3ICEA 3VKHA 4RY2A 5DI3B 4RD3A 5DO9A 1SHZA 3FKSD 1U94A 2ZSDA 2RGNA 4QL3A 5FL7D 2QPTA 4FWIB 1TUEA 4P0TA 1QZXA 2UKDA 3PIRA 2QSYA 1S1CA 2FNAA 4PPFA 1SULA 4G3XA 2XAUA 1Y63A 4ESHA 4B71A 1ZM4A 4AURA 1RVDA 1KK0A 3MG9A 3PV0A 2AN9A 1Z6XA 2GCNA 3W6OA 1KI9A 4S2EA 4PQFA 2JLZA 4JBYA 4LJAA 3K70B 4LX0A 2FA9A 3I61A 2NO0A 3UK6A 1I4TD 1UEJA 3BB3A 1K5GA 1KK1A 2GNOA 5LDDC 3B9QA 1Z2AA 1SVLA 1ZM3A 1KO4A 4A8JB 1KO5A 1VCMA 4DC9A 2YKGA 2JJ1D 4QBIA 3MJHA 4FMBB 4YMTA 2ZQ5A 1E0JA 4KSBA 1Z6AA 1LW7A 2XJ9A 3LWNA 3EIQA 3B1XA 2ZS7A 3GJ6A 5CLLA 4Q1AA 4MGZR 4TMVA 3NEJA 3AVQA 3OAAA 4JLAA 1VCNA 3R7WB 1SKYE 3ZD6A 5GVSA 4YMWA 6Q21A 1FPMA 2KWIA 4GMDA 2YYZA 4Y0VA 1R4AA 3AKDA 4BLQA 3R9XA 3B1YA 3QXXA 3RVBA 3EZFA 2ZI7A 1G21E 2FX3A 1F2TB 3MCAA 5KU1A 1X3SA 3QG1A 1U0HC 1ZNWA 1KI8A 4PO1A 3WBKA 3HYRA 5BWMA 4JSTA 4AG5A 4XJXA 4AY2A 1HT2E 4LYAA 4RSGA 3SC3A 3X1XA 3LAWA 3PITA 2R6FA 4OI1A 3EARA 2WVJA 3U61B 1DAEA 2OSBA 3Q85A 1OXUA 2YOFA 4FMDF 5FUXA 1JECA 4HLDA 1CJUC 4IOMA 2I1QA 2OAQ1 2XNDD 2KSQA 1N25A 5FOVA 1JEEA 3RDPA 4MKFA 3ZH9B 2ZSFA 4NYMR 5JLJA 1JAIA 1GRQA 3VNVA 1OB2A 2HT1A 3NG1A 4UNSA 2IL1A 4DEXA 2GRJA 4FWTA 1N5KA 2VRWA 5SZIA 1IY2A 4IEIA 4LY6A 4ITRC 4URUR 3CWQA 1N6KA 4I1UA 1MH1A 1BO6A 4N1AA 1W5TA 2ZITA 2CK3D 2VF8A 5C2JB 2NZ8A 2V1UA 2RGDA 4B48A 1NVVQ 1KMQA 2IYLD 4YONB 4HZIA 2GAAA 4JVLA 5F2EA 1CEEA 3EZ2A 4B32A 4E5UA 1E9CA 2J0QA 1NLFA 2XTMA 2GVDC 5KOYA 4IFBA 1GWNA 1N6IA 3QE0A 5EXPA 2AD1A 2QTVB 3FKQA 4FMCF 4YLGA 2N46A 3RSLA 3K1JA 3CZPA 4ARZB 2DR3A 2O0HA 5FOSA 2D7DA 2QT0A 3DO6A 4CT5A 2JIZA 4FCVA 1W2HA 4TLBA 1N5JA 2TMKA 3Q7PA 5JCPA 2YWHA 3GEIA 2BCJQ 3IIKA 2K5UA 3TVDA 2I3BA 4JBXA 2GBLC 1E98A 5CITA 2GF0A 1X6VA 3OEEA 2F9LA 1Q3TA 3PJRA 3GD7A 1Z22A 2CLCX 4W5HA 3U3RA 3CH4B 4EPVA 1W0KD 4TQ9A 2FF7A 2CCJA 4QGHA 2QL6A 4DLXA 5CYOA 4CDGA 2XITA 4OI2A 4E03A 2R8RA 4PC6A 2Q9BA 4B3BA 2WKPA 2ZRFA 3AP1A 4EJSA 2ZE8A 4KODA 1Z0FA 3GJ7A 2E9SA 4NPHA 1XEXB 4DCNA 1VIAA 2QMEA 1SXJB 2YVUA 3BFKA 4A0GA 1Z08A 3NBYC 1Q57A 2OCYC 4O0MA 3UG6A 4DB4A 5IK2D 1U0JA 3QXCA 3FHTA 1PLKA 1DARA 3A1WA 1OFIA 4WOPA 1OKKA 1UKZA 2OEPA 5F3WB 1Z0IA 5FUWA 3SI7A 5KTYA 2GCOB 1T91A 3QVVA 4V0MA 3OE7D 2GXQA 2R6DA 3CWZA 1Q12A 4LV5B 4R9UC 4NKRA 4HLCA 2RGCA 4OHXA 2VL7A 2ZRJA 1Q0UA 3SBEA 3TKLA 2VF7A 4DCUA 4OHZA 1TADA 1U0LA 3AF3A 2WWWA 1GP2A 3K09A 1QF9A 4LJ7A 4NYJQ 1V5WA 2EFCB 4FI3C 1US8B 1XXHA 2ZUCA 4KVAA 2I4IA 2QI9C 3GLIA 2FDCA 1UAAA 4B3FX 4PQRA 3GJ3A 2ECKA 1YZLA 1KAOA 1COWA 3DZDA 4QC2A 4Q03A 3PUWA 2ZE6A 2IXEA 3TSOA 4BRUA 1IN6A 1G5PA 2ZVPX 2ZROA 2J0UA 3LW8A 4X8HA 4JJKA 1LFDB 4TYQA 4PSVA 5DGXA 1OH7A 1S0UA 3RRYA 4KI0A 4RD2A 2W0MA 2J0VA 3AVTA 1P3JA 1GNRA 2V6IA 2J46A 1Z28A 3KQHA 2J45A 3PVSA 2BCGY 3VR1A 3O8BA 4QJ5A 5AJVB 1MRNA 5EP2A 2WOOA 2IW3A 2JASA 1MOZA 2C9OA 2NGRA 2OHFA 1JR3D 3A4NA 5JJLA 3QBVA 2CLSA 4EDHA 5KNBA 1Z0JA 2OAP1 3I8XA 2FSHA 3V9PA 1WBDA 1LY1A 2B7CA 4NDZA 1Z5ZA 3K8YA 2IYWA 4DCTA 1ZUIA 3RSOA 3R20A 1RW4A 2QAJA 1C1YA 3O47A 4V0ME 4US2R 4BFXA 1UBEA 2W6IA 4GMXA 1VKJA 1U81A 3T5DA 2JCSA 4DLSA 3SJCA 2IYUA 3FFAA 1O87A 3TRFA 1ZCBA 4TYPA 4MKGA 4BFZA 5KDLA 2WSSD 1WRBA 2GEUA 2OESA 4KLNA 4A2PA 1S1MA 4R98A 3IQXA 3K9HA 4HEJA 5EP4A 1ZUNB 4P4SB 2J7KA 1E2PA 1EX6A 4ILEA 621PA 1DAIA 1Z0DA 4DT1A 2R6CA 3E5HA 3QF7A 2QMHA 3G0HA 5JI2E 2H7VA 3KFXA 5AK0A 1M7GA 2F7SA 1ZYUA 5H1YA 1BMFD 1Z83A 4K46A 3B85A 1P62B 1CR1A 4L8GA 5TXGA 1KSGA 1AS0A 2QGNA 1FMJA 3LVQE 5HKKD 4W5WA 5JS8A 3AP2A 2J59A 2H5EA 4V0OA 2WSMA 2GVZC 1TEXA 3HP1A 4DLYA 1A1VA 4NL4H 3T1OA 4JJZA 1W5SA 2Z43A 3FMPB 2RGAA 1M74A 2CXXA 2O8FB 1VG0B 2ZIAA 2VSFA 1C4OA 1W7AA 2O0JA 4I1SA 4P3YA 5EUMA 2PMKA 1E6CA 1HQYE 4UJ5A 3VR4A 2CE2X 5DI9A 3DL0A 4M0LA 1W36C 3FKSA 4C0LA 4LWZA 3FPAA 1XMIA 1TF5A 5FL7A 2FU5C 2QROA 4UNRA 2LCFA 4A2QA 3QF4B 1G5TA 3GEEA 2BM1A 4B75A 2QTHA 1I2DA 2VTKA 4G5QA 4PXAA 3CRRA 2CL6X 3KXKA 1CRQA 4IVRA 4TTQA 3IGFA 1MT0A 2REOA 3W6PA 1M7HA 1UDWA 2DCUA 5FR2A 4U7DA 5J5CA 1JR6A 1L2TA 2EQBA 1IXRC 2F3TA 2YOHA 1AQYA 1KK3A
chains in the Genus database with same CATH superfamily
1ZY2A 4KWCA 3CVWA 3ZY5A 1L7NA 5FAKA 4YRMA 2OBMA 3IAAA 4IS2A 4D5EA 3KLMX 3C6XA 4JB0A 5CB8A 1WXGA 3OLWA 1UZMA 1TECE 2FQXA 1Y5IA 5JVDF 1E2GA 3HKDB 2COEA 5BMOA 3O1JC 3SHQA 2GYUA 3N5CA 1O6ZA 4JJ4A 4E2YA 5JSFA 5EWJB 1UKAA 4BASA 5K99A 3WS7A 3VA7A 2WZCA 4KYVA 4XCVA 1A9PA 1C8LA 2VYCA 2YV1A 2P6PA 3A36A 1U3DA 3Q9NA 5JTUA 2Z3VA 1AZWA 4CCWA 5E4TA 1T2VA 3KPWA 4V02A 3DFMA 4UCFA 3DBVO 4FW9A 3OJFA 3ILVA 4AY4A 3ZE8A 3TR6A 3QUCA 4PVCA 3WYEA 3HO1A 4X3OA 1XAHA 3WIOA 2FE4A 4JLKA 4MI9A 1M6NA 4EQ6B 2AN3A 4DRZA 4JU9A 2NVOA 3RROA 2ZDHA 2JCVA 2GZ1A 2Q28A 3I83A 4MWTA 3OEWA 4GM0A 5EWMA 3RAJA 1DG3A 3CJTA 3DFUA 4H3VA 4QVIA 1HXHA 1VOTA 2YDYA 5DNCA 1NXTA 1BCSA 3OQIB 1L1EA 4Y2SA 5I01A 2CY0A 3DCYA 3INTA 4CPDA 1E6KA 1ICEA 3M0EA 1F3OA 3WL7A 4BRWA 2R5WA 1G9SA 1WCWA 1JYSA 1CR0A 3CO5A 4JYZA 2MSKA 3HY6A 1HMYA 2VK1A 5JIBA 3QWHA 1QLHA 4GKBA 3OJEA 5L3RA 2O2SA 1RIFA 2PH5A 2HF8A 3JYNA 4PFKA 4JI4B 4Z4CA 3NIBA 4A27A 4F2PA 1AZLA 3MRSA 5B3JA 1G8HA 3GFFA 3T1TA 3INYA 4TLLB 2YUTA 3Q7EA 1UL1X 2XD9A 1YONA 2J3HA 3ZHSA 2VJAA 3D8NA 1JQDA 1AS2A 2WJYA 4TWRA 1P2VA 3S8EA 1Y6FA 1EFLA 4JR2A 2EGUA 4WNYA 5C3UA 1K86A 3EEYA 3K2IA 1J0EA 1DMSA 3LXRA 1UPXA 5HGJA 1V25A 2UZ3A 3AFHA 4YC7A 1JQ3A 4C14A 1QTNA 4M9RA 5LXTB 2XCQA 4FJ0A 4G81A 3NMUF 2B8EA 1KEUA 3KJIA 3KKOA 1MJGA 4N9QA 3NP7A 3R4VA 1RYNA 1TVCA 4N48A 1USKA 121PA 3GO4A 3B6ZA 2RHLA 4JP5A 1MW8X 3PGMA 2CJXA 1FCJA 2V0NA 3SYMA 2DH5A 1MABB 1F8GA 2GESA 2F3SA 3H1TA 2ZRLA 1AZTA 4I1OA 4Z4QA 2V6FA 4Q4DA 1SBQA 3W8DA 1DKUA 3BRCA 3EA0A 2AV6A 1FP4B 1A5BB 2DWPA 2ISSD 1J7JA 3O92A 4JVNA 1TCAA 1NKTA 3CUUA 3KAKA 4BEJA 4X1YA 3GHHA 1R74A 1H4QA 3IAS6 3E48A 3GFRA 3GRVA 4YAEA 5SY9A 4LY9A 4QQFA 2X40A 1CXZA 5TSDA 4Z3KA 3K70C 2GZDA 2AFIA 1L7QA 2XOXA 3H2IA 2JLAA 2RK4A 4YK7A 5F5LA 4FGKA 4DSTA 1QZZA 4F4DA 1FUKA 2OBFA 2HLHA 3JYOA 2ZBQA 4MUYA 3SS8A 4ABYA 4R16A 5C7IO 3T4EA 1VE3A 3EMBA 3GW8A 4D9NA 4GUAA 4JITA 2CBGA 3A1VA 4IJUA 4BPRA 1M1XB 1W0KA 1NQ5A 2FPSA 1CQJA 1RXEA 1I5EA 3VISA 2AQ8A 2OXFA 1E3QA 3BJRA 3WDLA 3KYIB 2AG5A 1U4OA 2JJ8A 4Q9DA 5HP4A 4U7WA 4E51A 3TLAA 3VSDA 1NPDA 4R71A 3K6SB 2BEVB 2PRKA 3E53A 4M1YA 4ZCSA 4EMBA 1YBMA 4YQFA 2OGTA 4JQZA 1JIKA 5CA1F 1ENYA 2BEWB 2CHFA 1JFVA 4BCCA 2MR6A 4D74A 5CGZA 3VOSA 5LJIA 4PRKA 1MJGM 1A72A 4J03A 1Y48E 4W5TA 3S2GA 4O2BA 2EKLA 4KSYA 4XYGA 1VYHA 4DA9A 1CEYA 1Q7BA 1XDGA 3A0RB 5HK9A 3B7PA 3QYJA 4BFWA 4CI9A 2QG4A 2WHEA 5CEJA 3H0CA 4R4JA 1Q0QA 3AP3A 1BGXT 3KTAA 2PZAA 3CZ9A 4KLAA 3AK4A 4Z9XA 3VR4H 3B82A 1PQWA 3H5WA 2FPPB 3P0RA 3ZQ4A 1E5XA 1D0VA 5SV2A 5CT4A 1OKKD 4ALNA 3RUCA 2H1RA 2EXXA 3EASA 3KZOA 4OK5A 1AB5A 1NI3A 3UWPA 1Z2OX 1AB6A 1GTL1 2FRDC 3FXAA 3CNOA 2F9FA 4PGGA 3W78A 5AVUA 1NDHA 1L4GA 3TINA 3AGQA 4ZVRA 1ZA1A 4O2AF 4HGNA 4BN5A 3L49A 4CLEA 4D9IA 4DRYA 2Y68A 4M0UA 1IPFA 2AMJA 4MIKA 1ZN2A 1ACMA 5B7GA 2ZVDA 1HV8A 4Q4HB 1SHUX 2ZSIA 4DLPA 4UTNA 4M99A 3NHLA 4WCVA 2Q1WA 1FRVA 4L51A 3FX2A 4U02A 3DMPA 3N75A 4IAOA 1DC3A 2LE0A 4C2UA 4EHKA 1MU0A 4ISBA 4OHBA 2Z83A 1T5LA 2G8NA 4IQ4A 4C88A 3SF8A 3K9QO 4YRCA 5CVJA 5CXUA 3GPDG 4FINA 5LOVB 1G21B 3R8FA 1NNSA 5KTSA 4EJ2A 2IHZA 4JLSA 3QKUA 5FEUA 1Y8AA 3AEUA 4FFOA 4RNDB 3WMXA 1NZFA 3AEKA 3LW7A 4N47A 2VP0A 2VRCA 1IOVA 2IQ5A 5AHKA 1ZIXA 5DN6A 3FDFA 4L0CA 2HQBA 1WD5A 3RFFA 3ZE6A 4MW4A 4HVLA 4F3TA 4IXDA 2XOKD 4HUQA 3VHXA 4RYLA 4DJ5X 4EAQA 3DT9A 4UATA 1ZD1A 4KYTA 4AKIA 4N6GA 1DC6A 2LP4Y 3LUKA 3MELA 1IBSA 1VPTA 2PFGA 5SY4A 1GNTA 5C5CA 3THXA 2ZS8A 1U1GA 2OVFA 1GZ3A 5DDIP 4J0DA 3SQLA 2AC4A 3CLUD 2QLFA 3I6YA 3P4XA 2WKQA 2D8AA 2XEDA 3PL5A 5AVJA 3DONA 4AUEA 5EEGA 4LYYA 4KITB 1G6HA 4RK5A 5FBRB 4ZVOA 2BKLA 1PEAA 1C9MA 2BFWA 5FLKA 1S2IA 3FBTA 4LMPA 5DM60 3P2MA 5F9MA 3FYUC 1LX6A 5EJFA 2VPYA 2Z1DA 4M98A 5GM1A 4AI6A 2O7VA 4OMUA 2FPMA 1G98A 5K3EA 2DR0A 4JYCA 2RG7A 4PAQA 2O19A 1H2FA 1YHYA 3LZ6A 4MQBA 4RGYA 4S04A 1IRXA 1YR9A 1UXJA 5AOBA 2E7ZA 5JC1A 2PYIA 4KC0A 2WSSA 1GGEA 5CPBA 5IABA 3QFHA 4MUXA 1NASA 5GONA 2OD2A 2C94A 3OX1A 1EK5A 3VKGA 3AF5A 4DLLA 2RH5A 2X22A 3FBGA 1WO8A 3KQYA 4DNXA 5SZKB 3U1BA 3MS2A 2XWQA 1TMKA 4J7XA 3KAQA 1IAQA 1POWA 4QQNA 2H9YA 3QX3A 1EWRA 2O48X 4H4EA 2NUAA 4JSRA 2HAEA 4X6UA 2QLJA 3K1YA 1CS0B 3O31A 4AKEA 2FFJA 1PBTA 3BFVA 5K6AA 1NL3A 1IXSB 2GUWA 3ZS8A 2OPBA 1W4AA 3EISA 3RYIA 2PZBA 1BFDA 3PXEA 2ZP1A 1KPIA 1IJKA 2DWUA 3U1TA 5JS7A 4ZT7A 1VSBA 1K89A 2BIFA 3VU0A 1GTRA 3HCRA 1JALA 1P9OA 3TIGA 1GNVA 4E4RA 3OZVA 1JR3E 2CFCA 2H4FA 3K96A 4UNIA 1IHXA 1HURA 3I1JA 4C2AA 4WK2B 1IZ7A 1D4AA 2YIVX 4MB2A 2ACKA 2M32A 4HOYA 3VZPA 1ZK1A 2GWHA 1DAFA 1ZIDA 3E2PA 3HKBA 4FDMA 2BGMA 3FGNA 4LMBA 4XDZA 3W4JA 5MGNA 4ETMA 2ZE7A 4BTVA 5CBPA 5AVZA 4G4SP 2AKYA 1ZJZA 1X7XB 2VG8A 4QYWA 3VR4D 2WJGA 4NH0A 4Y7CA 1QHIA 3HFJA 4LXQA 3SR0A 3TZQA 3PEEA 3C43A 3CB4A 2WJJA 4OQYA 4K8OA 1NUPA 1XR3A 5CW1A 1MR3F 1ND6A 5A2GA 4P3NA 4PLWA 4ZV7A 3GNSA 4MLCA 3I09A 3COWA 2N3ZA 3PR1A 3DE2X 3C70A 5EP1A 1NFRA 1GPLA 2JI4A 2QGFA 2XDYA 1FS4A 3E9YA 4XTRA 4HLQB 1VYVA 3D7KA 3HWRA 1GTZA 4EO9A 1RJEA 1I6KA 2XKBA 4NEQA 4JMLA 2VJKA 1MAHA 1OY1A 2B25A 4J75A 5T41A 4F7WA 5CP8A 4J49A 5TS2A 4L57A 5BN3B 1GM5A 3TR0A 5AVWA 4EFNA 5IM4F 1N1EA 3N2GA 3QJ5A 4BO7A 4AW9A 4R8SA 4ZREA 3UAVA 2D0DA 4PFSA 3RFUA 4OUKX 1QF6A 1V48A 2JD0A 5CGQB 1KGSA 3F6PA 3SIRA 4CKEB 1CNFA 3VR3D 2DERA 4YT4A 1Z0UA 1JE1A 1YZVA 1FSSA 4F91B 4FFBB 2BM0A 4I55B 2C1XA 4ZU3A 4YY3B 4FQ7A 2JK1A 1Q74A 1YAJA 3A6EA 3FUUA 1SOUA 4H6PA 4PIVA 4J3NA 5B58T 4A03A 4UBLA 3MJ4A 1LB1B 3I76A 5EUCA 3UKOA 3RUFA 4TSFA 2FCRA 5HUJA 2R6ZA 1JSRA 4BX9A 4WVFA 3AL3A 5HTKA 5AKJA 2FMFA 2H85A 4BNXA 4V39A 1FXUA 3USCS 1SOVA 3OFSA 5FH9A 1IUPA 2ILTA 4ALMA 1NW7A 1GITA 4OBXA 4UM9D 1XNJA 4EKDA 3B53X 5CRIA 4ER7A 4ND7A 3UMFA 3IUYA 3GEPA 4LHVA 1PR5A 3KOWA 1XZHA 5IKXA 1K8ZB 3MF4A 3QKSA 2QLBA 4TRRA 2X4GA 1R12A 4RADA 4ARUA 1RWMA 1G8GA 2NZYA 3UM9A 4B6GA 5JZSA 3VC3A 2WB2A 3U5ZB 1C9KA 3BXXA 3GXOA 4BNDB 2DB3A 2X0NA 3WB9A 1G2IA 2OY0A 3W6NA 1II8A 2R6AA 4GOND 4I4TA 4C0BA 2ECQA 2IJGX 3EJWA 1CWUA 3ICWA 2P75A 3KK0A 3LP8A 4L85A 4B3CA 1E69A 3DUFA 3PHLA 5L4LA 4MR7A 2OC4A 4UTRA 2E87A 1TRHA 5CJPA 2QTAA 3NVMB 2W6JA 2GEJA 3UWSA 2EU8A 2IYOA 3QWFA 2FMTA 4Q82A 4W1PA 3SD7A 3C74A 1C3LA 3HZRA 3OFVA 2JLQA 3PTLA 3NHSA 3R0XA 2QY6A 4J8PA 1NPTO 1L5RA 1ABFA 4OK6A 4B3GA 4WY8A 4KYIB 3BE4A 1RI4A 3GJ5A 3OFND 4FUQA 4MS1B 5C8YA 3QVGB 2PZFA 3O3MB 3OWHA 1Q7GA 4ZCMA 2X3FA 1K0UA 2VHXA 4XIIA 4TQGA 3HBNA 4L5BA 2QP3A 2QHXA 4KO1S 4UD2A 2HMUA 4CR8A 4L0MA 1HQCA 5IVIA 1LWNA 2LTAA 1YO6A 2YQ5A 4ZAZA 3TRKA 1EE1A 3BWBA 4IILA 2N42A 3G23A 3QY0A 1F2UA 2OT3B 2HJVA 1M6EX 3L7OA 3HTXA 4S1VA 2BGNA 3CUSA 4G0QA 3AIMA 2J5BA 4HB2A 4L75A 2E21A 2HQSA 4QO8A 2HPZA 3GH1A 5FBQB 5IYZF 4E2WA 2IVFA 3UMSA 1GFZA 1KYXA 5D01A 1JX6A 1RAGA 1ZD2P 3GPCA 4L3OA 4DV7B 1ITZA 1M5TA 2J4FA 4I6JA 4X7PA 1FFCA 2ZKLA 4OIMA 4Q7JB 4FU0A 4F6CA 1J8YF 2R4QA 2BFFA 1ULBA 3PCXA 4OI4A 4RIGA 4UEKA 5DOVA 3UMCA 4DY6A 2AR7A 4Y9DA 1E92A 2IY9A 3P9IA 4WLOA 5IS2A 4CTOA 3U7FB 2O3TA 2VOEA 1NJ2A 3ROGA 3CTMA 2A9VA 4Z0NA 5U4XA 3L1KA 5TMEA 4Y9UA 1Z34A 2IITA 3N9IA 3HC7A 4NDNE 3PFIA 4ZOCA 5JU6A 1T36B 1KY5A 3A11A 1BQ4A 2AI3A 4HYTA 2JIMA 1Z6ZA 1N5LA 4S05A 2JJ2A 1U7WA 3SSAA 4B0OA 2FPIB 2AN1A 2XTAA 3MXTA 1SVIA 3OA0A 2XUIA 4V0LA 3FCAA 5TEVA 3U7IA 4HATA 4BZQA 5IKPA 4DWJA 3FZEA 1TGYA 2ODBA 2QMQA 2DKNA 3IDZA 5IF3A 1JV2B 4F85A 3BWEA 2ORVA 3IKLA 1KRHA 3O90A 4BB5A 2HWUA 2O3QA 3GJYA 2V7WA 1CY6A 1G1AA 3PDUA 4QU8A 5MFZA 1UPCA 1NXWA 1XDWA 4QDKA 4Q93A 1E5TA 3T5AA 4PXSA 1MP0A 4AWBA 2CN1A 4V0NA 2C5LA 2PCLA 2ZPAA 2ZUVA 1ZUD1 4WAUA 4XSHA 3TX2A 1PWEA 3LK6A 1KTVA 1PTJC 5TQ2A 3QA9A 1XQYA 2GFHA 2LDXA 1OB5A 4F6LA 4CM7A 3TPFA 3QE4A 1ZIPA 3VJMA 1YQTA 1OLXA 3PGA1 4GI1A 3U4HA 4C29A 1TUBA 1SO8A 1XP8A 2HQOA 4GOKA 3TN7A 2FEAA 2FSUA 1VPWA 1K63A 4YHHB 4MKHA 2CB0A 3EQ6A 4OVKA 4OU4A 5K3DA 2XAAA 3IESA 3DDHA 3H3JA 4CNQA 1G5FA 2NADA 3JWGA 4RY9A 5EJ7A 4MV9A 4A8HA 1J2RA 2CDAA 5L8VA 4J90A 4PYKA 2O14A 4JC5A 3V8QA 5KKAA 4EB3A 4ES6A 5LP1A 3NJ4A 4DADA 4LNHA 1JLSA 4FQ5A 3RC1A 2XIJA 3IBTA 1Y6JA 4GLFA 5CIQA 2QN6A 5D8DA 1KOJA 1NR7A 3RFCA 4BIMA 4X84A 2E3JA 5B57C 3B51X 4RGQA 3F73A 4E5SA 2J67A 2OORC 4FEAA 1KZ4A 4MIYA 4IPTA 2RK6A 4UU8A 3DAHA 3IQDB 3S81A 3MINB 5AT1A 3ZNNA 1NOKA 1X8LA 5ED4A 5M7EA 2VK2A 2FRDA 2SBTA 3BJZA 3CIFA 3UCFA 3E5MA 2XT0A 4F3RA 2ZGVA 3KJXA 1I4EB 3CZQA 4K9SA 4G85A 5KIAA 3CUVA 4F5EA 3VU8A 4EYGA 3CCFA 1JI0A 1J06A 1NUTA 4TLAA 1UMBB 3EC1A 5DN9A 1WETA 2VUHB 2OBLA 4DPMA 5DN6D 3UBMA 2J9ZB 2O7NA 1JMYA 4JSYA 4FGSA 4EQZA 3KKLA 3IMFA 2RHCA 2PGXA 1KAQA 3DCNA 4KHZA 4JJ6A 5DE3A 1QB7A 2XJ4A 3D5EA 3EGIA 3FRJA 1VE7A 4YRAA 1QO0D 3UPUA 3VR5A 5K0SA 4GBMA 5J4VA 1DTSA 4TT8A 1M10A 1P1IA 2PQMA 1PU2A 2FW9A 3G6WA 3NV7A 2P62A 2N0SA 1HF3A 2WICA 3K72B 3RRMA 4F56A 3QI7A 3OM8A 4DDUA 2C31A 2PZEA 2WPNA 3B8HA 1NVWQ 1L7MA 1XYVA 4KLCA 2JHFA 4BTLA 4G89A 4ARZA 5ITVA 2B2NA 2GN8A 4N3AA 3C48A 4NYJR 2R2GA 2B5VA 1EP2B 1G2OA 4R2MA 1E59A 1ZAKA 1EVJA 5CEEA 3EW7A 4G0XA 4HVCA 3DOJA 2X8AA 1I6MA 2FSVC 3P20A 3T3IA 2EHJA 2QRZA 3Q7SA 2AJTA 4WBNF 4JLBA 1DBPA 2C0PA 2C20A 3NFYA 3SX4A 1QHFA 2XCOA 2GLXA 4GW3A 1UBHS 1ZMTA 3FYUA 1Z63A 4HX2A 4UU1A 3TJRA 3VTKA 3MAGA 3I5XA 1QP0A 1GUFA 1VJCA 2X8BA 4MUIA 2JIBA 4W7HA 3GMDA 2GHQA 4LRUA 1D4FA 1QIFA 1UOPA 4X6LA 1JLRA 2OK8A 4CMBA 1QX4A 3LT1A 5SYAA 4CRWB 3M4NA 2C92A 5EGSA 2C2BA 3DEAA 1M6HA 5B4UA 2SCUA 3LSYA 3U9LA 3A58B 3ASZA 4QPJC 4WRRA 5AKGA 5HILA 3B7GA 4TLDA 2AG8A 5LUAA 1M9NA 1PNRA 1GRRA 3UUGA 4H35A 1AGRA 3DWEX 3FDZB 4NC9A 2ONKA 4J2OA 3VR6H 4XX0A 5CDTA 1V71A 1PV1A 1M1YE 3EULA 5A1TA 3U4GA 4LTDA 1RXIA 2B7LA 2WIJA 3J81k 1TCVA 4PG8A 1T1GA 3DE3X 5G3YA 4D82A 5EG5A 3T06B 3T1YB 5LB4A 1Q2UA 1T3GA 4KBGA 4RKRA 4FYHA 3FDIA 3VKFA 2GM9A 1N6HA 4ZP1A 2X23A 3KJEA 1AUOA 1NVFA 2CVHA 3OLVA 3PXGA 3T54A 4D9KA 1OH8A 3E1SA 4YJFA 4JQSA 3HLTA 1V9LA 5JADA 3AUKA 5DK6A 1IHPA 2I34A 2JLXA 4HQNA 4KIUA 3RVNA 4AJOA 3ZY6A 3ET4A 3O2SB 1BOOA 3TR5A 3FHLA 1MX3A 2BMDA 3NHPA 2XD4A 3OP1A 5DMHA 2XDQA 3UTDA 1OPRA 1VBFA 1VHTA 4E22A 2AZ4A 2X4LA 5AO9A 3UIEA 1XMQB 3SICE 4DTCA 2D0OB 1QTIA 1OPXA 2XW6A 5LZ4A 5FPQA 1XZAA 4YQYA 3DNMA 1D8AA 3UO8B 1XQVA 2VO1A 3GZNB 3IC5A 3V8PA 5A0FA 3RGWS 5E2IA 5JCOA 2C5AA 4ACAA 5UKDA 4F12A 1IE3A 1SEPA 2E4UA 4A0QA 2BKAA 3VUFA 4B09A 4B32A 4FKBA 2NO7A 2ODEA 1ZVKA 2OOSA 2Q7OE 3TVTA 1TOAA 1VLMA 3HV0A 3O8NA 3TRHA 2G07A 1SAYA 1SN7A 3ZOKA 4J6FA 3UENA 3F1LA 4J76A 3IBFA 1JH9A 4DZTA 3R7SA 2R68A 2Y3IA 3BMCB 2YS6A 5DWVA 2FEKA 2LR0A 2FHPA 2IOFK 4DZZA 1DRUA 1M1NA 5HFNA 5LXTF 2R60A 3DMNA 3BRWA 4AF8A 3QGMA 4FDTA 3BFXA 1IXKA 5G4LA 2JFXA 3AFOA 4WMLA 4TXLA 1AHIA 4OHPA 4LCBA 2BGLA 4YP1A 3KKNA 3EOZA 5C5EA 3E9DA 3JAWB 1EG7A 1XXLA 1ZONA 2G17A 3IRUA 3ITNA 1KC1A 3OOEA 2CDRA 1NW4A 5I4CA 3PPXA 4IF6A 1TO2E 4XWKA 1ODIA 2HRBA 4CV3A 2QZPA 3BK7A 4JBWA 4TLMB 4ZQEA 1NBMA 3IPRA 3UAOA 1GCOA 4FBLA 5ALQA 5EPOA 1QP7A 1YGYA 3CRW1 4YJ2F 1B0AA 4GYWA 1OLUB 2NTJA 3ITKA 1KEEA 3U16A 5H59A 3KOUA 2WAXA 3IILA 3W2FA 2GJ8A 3EVNA 4F1WA 2PV7A 3KTAB 4HAWA 4LHEA 4NSNA 2OD9A 4PF1A 2BFCA 1SUCA 1USWA 2VYFA 4RHUA 4GI3A 3WTBA 1YS4A 3U4MA 3A4LA 3H84A 1EGHA 4LI0A 3JY6A 4KW7A 3MTIA 4LBZA 2J85A 2AQIA 2O5EA 4QYIA 3T1NA 3B2NA 3C3CA 3RTEA 2FZLA 4D0NA 3L82B 5MGBA 1Y3CE 4DQVA 1TJYA 2YY7A 2C5SA 4GWLA 1A2QA 1T2NA 4B45A 1XEWX 4YP0A 3KJQA 4XR4A 1N3LA 1BFUA 4XFDA 1UFOA 5CT9A 2WY2D 1FXSA 4Q3KA 3V8EA 4COKA 1F8YA 1NI4B 2V7EA 5E6SB 3D31A 1IEQA 4IWXA 4TSKA 1T3HA 2BBOA 1AOXA 3FPLA 3JWIA 4PC1A 3Q3IA 1DHRA 1ZMBA 3I39X 3E7WA 3EYWA 5GZ3A 1RBQA 2ZRCA 2H7CA 3CF6R 5D6OA 5MFPA 1R5NA 1U1DA 1RPZA 4UTVA 4HGQA 3NKVA 1J00A 2C82A 1JIIA 5B6JA 3VR6D 2C5BA 4NNJA 4J4HA 5CLGA 4IRUB 1N3IA 3KVYA 2NQ8A 5LLDA 4NZPA 2W43A 3V2IA 2WTBA 3AEKB 3KT3A 3LGXA 5DISB 2OGWA 4D56A 5K0BA 2H7YA 4XQGA 2Q9AA 3V1MA 3F5SA 1LPBB 2OMKA 4JD5A 4HUQB 4FQ8A 3V8BA 3UUWA 4IDCA 3GF4A 2AZMA 4LQCA 4DV1B 3HCBA 3THXB 3NEAA 2V4MA 1MTOA 1TA0A 1PR3A 2C84A 3QF4A 3O8DA 4LOAA 4LWPA 4QOIA 2ZFUA 4RFLA 3V1LA 4AK9A 2DSTA 2YQ4A 4AJJA 4C3UA 1MC8A 2MTBA 2OFWA 3K0AB 4HB3A 4JBNA 5EMNA 2Q5QA 2ASVA 1PW7A 4XA8A 2PMFA 4XTCS 5CUQA 2R1VB 4AO7A 2ZW9A 5KOIA 4IGIA 1R5JA 2ZYRA 4ENUA 3VNSA 2JIOA 3IULA 1OVMA 1RDFA 2VSNA 4UBIA 2JJ2D 3QIAA 1L4UA 1OWLA 4Q48A 2VP5A 3RHZA 5T8KC 1JAZA 3VH3A 4ARVA 4KIFA 3JD2A 1RQNA 3CH5A 4HWTA 2XMZA 1SD2A 5ALHA 3S7ZA 3VO2A 4QWWA 1SBYA 2OL4A 1E1KA 5HF9A 3K70D 1STOA 2OILA 2UZIR 2WWIA 3PWTA 4RF3A 2CVOA 2VATA 4GE3A 1HDIA 5GONB 1GZ4A 2YYAA 2GBLA 3UJ8A 2RHHA 3N6VA 3HV2A 1L1FA 4P32A 4W7SA 2ZTLA 4Z9BA 3U3MA 3ZCSA 4C87A 4GBED 2RGEA 3AEZA 4YA6A 2WTEA 3NHMA 3O94A 1K9VF 2AJCA 1EHYA 3ZCVA 3JVEA 4AZ3A 2AC2A 5HS6A 2IDMA 1JQJC 2BFDA 3EUEA 3O73A 3QLVC 5IHPA 1E61A 3PGJA 4BLVA 4Y2UA 1OD6A 2NUAB 4GXQA 4II2A 3BAFA 2IT1A 3N2KA 5E1DA 4BE4A 3NTLA 5CDFE 1CPYA 3HCAA 5HMLA 5A5VA 2RHOA 5TY0A 1R0YA 3CN7A 3X1JA 1G0NA 5K1ZA 1HT0A 1YKFA 2JFYA 4P7KA 1M2FA 2V6MA 3WLNA 1PTJA 1JDPA 2H2HA 1ODSA 2ZUEA 4HNTA 4X85A 1DIAA 4PCUA 1MCZA 4BQEA 3M8KA 1UZLA 4PWZA 5FFMA 2ZI4A 2E4AA 3EB9A 2QVYX 3LD9A 3ZXYA 1UJMA 3RS2A 3ZHQA 3HKBB 1O96A 4C4TA 1KYWA 5CBPB 4AKTA 3OQ6A 1OF1A 4MUEA 3RTAA 3JQFC 4CR7A 3B5IA 2PJUA 1TX4B 1UR5A 4K3VA 5DP1A 2WABA 5DT9A 4OQLA 3K8OE 2TS1A 4B2PA 4YRFA 3E5NA 5IF9A 5LIPA 2WAYA 2RH8A 3FOBA 1N32B 1A5ZA 1FDUA 4OJTA 3WIBA 1ZM9A 1C7QA 1GR1A 2Z58A 3FMIA 5IJ9A 1W30A 1GNPA 1VB3A 2GHIA 2JGFA 2RBGA 3P9RA 2C42A 4MR8A 5EPEA 3BL5A 3TQRA 1B7GO 3R5XA 5H70A 1FP7A 4WZBE 4QUIA 2C8JA 3H9QA 4XOUA 1ZCZA 4M1SA 1JLLA 3GVCA 2NYVA 4OYRA 3GY0A 2YW2A 2P6RA 4HWOA 4X63A 4CMAA 5IEBA 1W36B 3QVWA 3TECE 3ZCUA 3UGJA 3UYKA 2JH3A 2Y9PB 3T9BA 3G17A 3H1PA 1J1UA 2ZRGA 1KYZA 1QE3A 1G291 3PXUA 1D0SA 2DQKA 4YRTA 2QUZA 4H7KA 1Y98A 3RC7A 3WP0A 1V35A 1NVXQ 4TQAA 1YQDA 3PQDA 2Q5FA 3GVHA 3INRA 1QP4A 2TYSB 3F71A 1H1DA 4D43A 5CHEA 2W2OA 2J0SA 3EG5A 2XY4A 3L6CA 4UHCA 3QITA 1ZXXA 3JXEA 3WK4A 3LCUA 2I76A 5FWYB 4NHEA 1WL8A 4RLHA 2G63A 4NR0A 2IZ0A 1E9VA 2IPOA 3P0FA 4UVEA 5TEWA 2UU9B 1P8AA 4DMUB 1YE3A 1Z0KA 2CKMA 1YVDA 1OGJA 1ZOLA 2V0CA 3G9UA 3REQA 1R4ZA 2ZZMA 2XGOA 1DIHA 1S8AA 1SU7A 2R7MA 3HGQA 1YDMA 3E2IA 1KZGB 4NCNA 2CWWA 2WYWA 2X6RA 1I6LA 3PS9A 4NICA 4HK4A 3NCHA 2R6GA 5G3ZA 4OGFA 1Y1RA 2Z6QA 1A2KC 1WHTA 3DVLA 5CBKA 2OR3A 4C7VA 3ZWBA 4ZYXA 3MRVA 5H81A 3UQYS 4C03A 4DZRA 1P45A 1UJ2A 3K53A 1WR8A 3B3GA 1AK1A 1EVZA 1RWPA 3QKSB 2GEVA 1W5AA 2JD1A 1AMUA 3T0GA 1SFRA 2ZJZA 1TW2A 2FSVA 4EFDA 4MVJA 1II8B 4HQRA 1FFWA 5HBGA 3FUVA 3GIWA 3IUMA 3PQ2A 821PA 3JALA 1L5MA 2C9DA 4FN5A 3FMOB 3L6BA 3D59A 3M6WA 3EGEA 2UUPA 3DUFB 4UVGA 5T67A 1ATZA 2XTNA 3L41A 4MR7B 4OKSA 4Y2QA 1FDIA 1M8KA 2XMBA 4C6TA 5I7RA 2GF2A 3ZXUB 3PQ5A 2GNAA 1AQUA 3TZKA 2HU7A 1EJ0A 3NOOA 1LKZA 1SXJD 1UBFA 2XSZD 3SC4A 3ANNA 2AFHA 1TVKA 1FSFA 4K6OA 4MYRA 4OA8A 5G4KA 3MTAA 3TW4A 4C0JA 4ARAA 3I5MA 3T5TA 1XRJA 5IH3A 1SCUA 1B8NA 5TE9A 1KAHA 4QTTB 4E2FA 5IAOA 1TYDE 1HDZA 3DT8A 1K8YB 3KLPX 4LRYA 3IDOA 5EOVA 2QX4A 4XD7A 4CF6A 5BR8B 1K8QA 4J1NA 3U3DA 1X15A 1N5DA 2VXOA 4Q4JA 3SEAA 3ZWVA 5H3CA 5BYBA 2WR8A 1GKKA 3BGVA 1NLYA 2B8TA 1XEFA 2ZTSA 2ZYVX 3ILSA 4HDSB 3UCXA 1NG9A 4RHXA 4CIBA 2ZYIA 1PG0A 3P7MA 1GL6A 1H5UA 1QXSA 1TJ3A 1F2UB 4W9NC 2ZYHA 5DWDA 1S2DA 3WKAA 2Y93A 1TNDA 3ZZMA 4BQRA 1PLJA 2BL4A 4BNUA 1ILWA 1XBTA 2VAMA 4IJKA 1XZBA 3OJLA 4NATA 4OJQA 1P2UA 2ZR0A 3L40A 2G1UA 3UG7A 4R0NA 5EHZA 1KU0A 2RHTA 2XVZA 3NATA 3OJOA 4ZXPA 2ROQA 3AVYA 1I9CA 5LYJA 5EKTA 4AP6A 2BFFB 3C3KA 1U8TA 3HJRA 3HJTA 3LH5A 2A7XA 3FD8A 1N8TA 1EZZA 4DG9A 4PYMA 2O8CA 4IR7A 2GYYA 4RX1A 2VP2A 4Q0MA 3R75A 2ZDGA 3T3HA 3TNLA 4J4TA 3HPRA 4MVJM 3IB3A 4LHXA 2CHEA 5A4DA 4K28A 3E7FA 4Y2GA 4YI5A 4HYQA 4QU9A 3SYKA 3ZKAA 3RWBA 1CVLA 3T3PB 1ORVA 2QL5A 2VZ8A 1FPQA 3DFIA 4KVFA 4EO4A 3AZQA 2W6PA 3HWX1 3VHRA 2CNOA 1EDBA 1JQEA 2CLHB 3PQCA 3HVJA 1L4LA 3SEZA 2XKKA 1KDPA 1SMKA 4TL7A 4BKRA 4F3KA 2QXUA 2Q49A 3ZQJA 2MSCB 5F1OA 4BMOB 4RPKA 3NR2A 1N4DA 2QSJA 3DDUA 2XVMA 3IE0A 3L8MA 1SBNE 4RHCA 4WLEA 1TTTA 3L6EA 2EFEB 3TTXA 5D86A 4NXNB 1YZFA 1E2UA 1FEZA 4OBEA 5KSOA 2XBLA 1VSTA 2B1QA 3NJRA 3GFTA 1W87A 2ZULA 1U65A 2OECA 2W4QA 4NYMQ 4QGFA 4FHCA 4QE3A 4EJSB 1D6SA 3U48A 3PNLA 3UJBA 4HTFB 2Q7XA 1P4GA 4DKXA 4MV6A 4PNEA 1GPDG 5ALNA 1B73A 2O3SA 5BQ5A 2ZIXA 1E8DA 1XELA 1K3FA 4ZVTA 5EJGA 2QU7A 2ZUWA 4V2IA 4R2IA 4B6RA 3PSHA 1TL7C 3LMKA 4HI0E 4K1LA 3STHA 2DUMA 1FQJA 2GZAA 3KKPA 1V1MA 1PUJA 5G0UA 3WL8A 2OLKA 4MUNA 4IQ0A 4Q7LA 1DRVA 3ZQ6A 3ID6C 4N39A 1I1HA 5B55A 1YQ9A 2QTBA 3DXFA 5JNTA 5FQOA 1YR8A 2BKXA 4HDNA 3LYHA 1PDVA 2V65A 3STVA 3ZWCA 4L9SA 3U0VA 2WFLB 1TJ4A 1ZR2A 4RAQA 3SVZA 2VT7A 4PLHA 4BV2A 4EF5A 2IH2A 2I65A 1JA1A 5INTA 3LDUA 4RGBA 2XVYA 2J3EA 1Q7RA 1YKSA 1H2BA 4ND6A 5CU7A 3EFHA 3VPBA 1O6CA 4ZIRA 3AL0C 2A0YA 4MUFA 4TMXA 2ZRPA 1NBOA 1GYQA 4PSCA 3A9SA 1W4ZA 2VQSA 2BMJA 4MZXA 4ZQGA 3ZNQA 1ZFNA 1MEJA 2ET6A 2XPCA 4H6WA 2F1HA 3S1AA 1TFUA 1SHJA 2A35A 4PYIA 3LUHA 4LJ6A 4BRSA 2E48A 2C29D 4J0JA 2H5IA 1YD7A 3MGAA 1R18A 1JWBB 3LUAA 5KYUB 2PH3A 2AYXA 2V03A 3A2KA 1MT3A 1T6NA 4KGXA 1DV2A 2YWXA 1W5BA 5FA6A 5TQJA 4I8XA 1T8PA 3HVIA 1CLUA 4FKMA 4IY1A 2A5LA 2MYTA 3C6QA 1YFKA 4N0EA 4UUNA 6REQA 5ECDA 3LO5A 5F12A 4ENSA 4TV9A 2HMVA 1ZHOA 3V1YA 1U31A 2JAWA 4DUGD 3DAFA 4HNGA 4YCDA 4RJLA 5KSYA 3O74A 1K5PA 2C5GA 3GL9A 1AMOA 3COVA 3D4LA 3IL2A 2AJ8A 1YCDA 2DECA 3F90A 2UUOA 1VL0A 2C5HA 1CZRA 2DPXA 1HOXA 1E7SA 2OM2A 3FCXA 2ILVA 1TCCA 1QH1B 3BHNA 3MIIA 5IT9A 1B1AA 1MIOA 4ECEA 1BXRA 1W52X 3LHDA 4P82A 4IIUA 3RJ9A 3BJEA 2B1JA 1RXWA 4QDJA 2QLTA 2CFOA 1KFCB 4NCXA 1MORA 2W2TA 4CDMA 2FPRA 4JIGA 4MV7A 3PUHA 3OIDA 3OPQA 3SKVA 5HIAA 3T5BA 1FXWA 5KWSA 4WXMA 4QXAA 1OREA 1N2BA 1T2UA 1N9GA 2FZWA 1Z7BA 4IXNA 1RHQA 5I9LA 4U9IS 1SQGA 1FDRA 1UJ4A 1RLMA 3LY5A 4FMDB 1YUBA 5ENDA 2GCEA 4G1BA 2CGEA 5J63A 5IC6A 4CIXA 3BGWA 2XUQA 3FYUB 3MRXA 4JCCA 3SZLA 2WYHA 3D9QX 3TIIA 1FX1A 4AROA 1EUCA 4MA4A 5T8KA 2EEZA 2Q4BA 2JVIA 1UM8A 2V7GA 2ORWA 5DVZA 3VR2A 3WJ7A 4N3GA 4Z1MA 4GE0A 3NM5A 3A9WA 3OETA 5AXCA 3VH4A 5E6UB 1ZGHA 3BTOA 5BR7A 4UMEA 1EE2A 3BSSA 1RSZA 3WXMA 4J29A 3SF0A 3IFSA 3LPCA 4JOQA 3S29A 3NTQA 5IHXA 2HD4A 2VH5R 2Y66A 3ZG6A 4AC9A 1JILA 4OXKA 3SBXA 4ZCLA 1USIA 2A9QA 5CT6A 3EC2A 2DQSA 2OPHA 4QVGA 4DDHA 5A4KA 5JO0A 1HO3A 2AMVA 4MQMA 4DCJA 1R8JA 3QJGA