3RCJA

Rapid preparation of triazolyl substituted nh-heterocyclic kinase inhibitors via one-pot sonogashira coupling tms-deprotection cuaac sequence
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
282
structure length
281
Chain Sequence
KRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Rapid preparation of triazolyl substituted NH-heterocyclic kinase inhibitors via one-pot Sonogashira coupling-TMS-deprotection-CuAAC sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 83
structure length 281
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3rcjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3rcjA01
1VYZA 3PRFA 1K2PA 3ZO2A 2BRMA 2GS7A 3OXZA 3AMAA 3F9NA 3OXIA 5J1VA 4XG7A 4IZ7A 4E93A 3Q2MA 2GS2A 2W1HA 1XH7A 2YEXA 4FG9A 4CFUA 2IZRA 3CIKA 2XRWA 2NPQA 2W5BA 3ALNA 4CZTA 2XBAA 3KRLA 3IK3A 5CAQA 3ULZA 2VRXA 1A9UA 4ANQA 4E6CA 5GIPE 1ZWSA 2VUWA 5CEIA 4BIDA 4C4EA 5ANKA 4HVHA 4C59A 4D1SA 4I24A 2OJIA 4EK6A 3MY1A 3FPQA 3U8WA 5C8MA 4O2PA 4AU8A 5IISA 3MBLA 4ZAUA 1I09A 4QP1A 4DEGA 3G51A 4LYNA 4D2VA 2QOQA 3ZEWA 2X0GA 4C8BA 4ZEGA 2B9FA 4CT2A 5H9BA 3BE9A 2WMRA 3PXQA 3Q96A 3P79A 3EFLA 3SXRA 1ND4A 4HOKA 1Y91A 3UQGA 4F9YA 4ZJIA 4X3FC 4QNAA 4C61A 4YNEA 3CQEA 3IGOA 4ZTLA 4UXLA 4Z55A 4BCNA 2UVXA 2GPHA 2F2UA 3COKA 3V5PA 2WU7A 5K4JA 4G2FA 5K3YA 4EOIA 2WKMA 5A3XA 5M07A 5GIOE 3LLTA 4K9YA 5CEQA 4AF3A 1GZNA 4APCA 4U81A 2PVHA 5LCJA 3RPYA 2WOUA 4M69A 5E8TA 3ROYA 2PK9A 3WF9A 2ITVA 1M7NA 4U97A 4UEUA 2R0IA 1OVEA 3ZO4A 4E5AX 5HU3A 3PXRA 3IW6A 4TWOA 3W1FA 1OBDA 3QRUA 5M44A 4ZXTA 2XS0A 3HV3A 3V5WA 4BZDA 3LKMA 4GH2A 4C3FA 3PJCA 4C4HA 2QHNA 1V0PA 2V7AA 3Q53A 5JH6A 4C33A 4PQNA 2R3MA 1UNHA 1KSWA 4P4CA 3ZBFA 4E20A 1GZOA 2QOBA 2WTKB 2E9NA 5DIAA 4D5HA 3U51A 3RI1A 2HENA 4XV9A 3F3VA 3QTXA 4FTTA 2KULA 3SVVA 4ZLYA 4H58A 2PZIA 5F9EA 1JKTA 4G3CA 4BRXA 2R3OA 1TQPA 4FIEA 4EC9A 4NH1A 3ODYX 4KRCA 4FTCA 4FV4A 2ESMA 2IG7A 4ITJA 3C51A 4TWPA 3I5NA 3JY0A 5CSPA 5FEQA 3N9XA 5FRIA 5JRQA 4DBNA 3K3JA 4QYGA 3UG2A 2PZPA 3JR1A 4A9UA 2F9GA 5GZAA 3PIZA 2JC6A 4QNYA 3BWJA 3RM7A 2VX3A 2VTQA 4B8MA 4EYJA 4L52A 5C1QB 3WE8A 5C26A 1H1SA 4LOQA 5ACBC 3UC3A 3COIA 4FSMA 2KTYA 3ANQA 4IM0A 4RIWB 4EH7A 1KV2A 4RVKA 4EOLA 2EVAA 1CTPE 3F2NA 3LCOA 4L53A 1OIRA 2X2MA 2ZV7A 3COMA 2IVSA 4KKHA 3TNIA 5A4CA 5CVFA 5D9HA 3F7WA 3UQFA 3TACA 2UZLA 4KS7A 4D28A 2WXVA 4RFMA 4F1MA 3FMEA 1KUTA 3AC4A 2C6KA 4FUYA 4I6QA 4ZSGA 2WMWA 1PY5A 4BWKA 4JLCA 3ZOSA 3BI6A 3BV2A 4OLIA 3ZC5A 3DJ5A 4WBOA 3GQLA 3QKMA 3QRTA 3T9IA 4ANBA 5KMOA 4DF3A 3F66A 4YZ9A 3DJ6A 1Z57A 2ITPA 5AM7A 3ODZX 2F4JA 2DWBA 1XH6A 4JOAA 4MXCA 4R7IA 5A9UA 4YBKA 3PP1A 2J9MA 3DGKA 3OMVA 3ORTA 4ZP5A 4BWPA 5EDPA 5EH0A 2GNJA 4FL3A 4I21A 3ZEPA 3LZBA 3R83A 4BI0A 5AEPA 5JGAA 3WARA 4F0FA 3LFCA 4Y72A 2J6MA 3RAWA 3DQXA 3PXFA 2VU3A 2CNVA 2FH9A 5AR3A 3R1QA 4L42A 4FYNA 3FE3A 3IW8A 3S2PA 3DY7A 3HA8A 4M69B 4WHZA 1LPUA 4CFWA 4ZIMA 4PPAA 4BDBA 1QMZA 1PXJA 1VZOA 2JFMA 1FINA 3NAYA 3Q52A 3OBGA 3SA0A 1FPUA 3LFSA 4PP9A 2Y4IB 5IA2A 5AUZA 4PDPA 1OPKA 5HQ0A 4IVCA 4PL4A 2OIBA 3MPMA 5DMZA 4BTJA 3P7CA 3E3BX 3MSSA 4EI4A 3EFWA 3TDWA 4G3FA 3MVHA 3HMOA 5DOSA 4EQMA 1JLUE 5LXMA 3QA8A 4TYIA 1RJBA 2WOTA 4FG7A 3QZGA 4B9DA 4FT0A 3HV7A 4UBAA 2YISA 3F7ZA 3QA0A 4CMTA 3PE2A 4JR3A 3F5GA 2B4SB 1REKA 4FT3A 3KU2A 4PPCA 3GFEA 5HIDA 3SHEA 3DU8A 4HGSA 4ZTNA 3RBWA 4RBLA 3UO6A 4BDHA 2O64A 3GGFA 4YR8A 1WBTA 4G9RA 4I94A 4M67A 3FZTA 2SRCA 4HGLA 3OCBA 2ZV9A 3P5KA 4RX7A 4F4PA 2HW7A 2PTKA 1UWJA 3FLSA 5B0XA 2XIZA 3NW5A 3O96A 3OW4A 4S2ZA 4ZSJA 3ZC6A 1P2AA 2XK4A 2ZV2A 5ANGA 2WNTA 4AT5A 1KE5A 5TE0A 5E8YA 4EJ7A 4MWIA 2Z7LA 2ETKA 4FKIA 5BVKA 3TZ8A 4R8QA 1WAKA 3D0EA 3DDPA 4I93A 1ERKA 1QPEA 5EW9A 2C5OA 5FTQA 5LOHA 5EM5A 3C5IA 3QQFA 1Q61A 3SKCA 2GNHA 4LV8A 1KE9A 2ZMCA 4I5CA 2OXYA 2XNEA 5AFVA 2OXXA 4XEYA 4ERWA 3JYAA 3OROA 4OTPA 3V51A 3KXZA 1PW2A 2Z60A 3BBTB 4ZZMA 5IUGA 4BCIA 2ZJWA 3WI6A 1CKPA 2YERA 4BGGA 4C3RA 2VTNA 5ANJA 4EOSA 3P78A 1ZY4A 3TWJA 4ZSAA 4O7SA 1JAMA 4FKJA 4X2JA 1UWHA 2CCIA 4OTIA 5AV1A 5B2KA 1WVWA 4E26A 2ZV8A 3DA6A 5M55A 4N0SA 5J7BA 3L8XA 5E8VA 2R7BA 4M66A 2XKCA 3FYKX 4PP7A 2ZM4A 1E9HA 4OTQA 4TY1A 2AC5A 1YQJA 4AN3A 4DEHA 4P7EA 5C03A 2PY3A 2G2IA 3RNYA 5EM6A 3KRXA 4L67A 4NJDA 4BN1A 4MHAA 2C3IB 4F6UA 3HMMA 4BBMA 3A4PA 1Y8GA 5AX3A 3REPA 1STCE 2ZYBA 4BHZA 3W2QA 3FV8A 4OTHA 4LMUA 5D7AA 3KRWA 2VTRA 2GHGA 3ELJA 4I22A 4X0MA 4FTJA 2Z2WA 3VS0A 4D1ZA 3V5QA 3PUPA 3RK5A 2CGXA 1KWPA 4FKTA 4IJ9A 2PMOX 3FXZA 2E2BA 4MF1A 2E9OA 4HZSA 4FTMA 5TKDA 2EXCX 5HOAA 1YOLA 3HZTA 4RC2A 5AP1A 5ICPA 2WO6A 5A14A 1M52A 1OPJA 2UZWE 3UO5A 3LJ1A 2LGCA 3QX2A 3E87A 1CKIA 4V0GA 3PJ8A 1WCCA 2PVLA 5E8SA 3DTWA 3RWQA 2V7OA 2VTJA 4FOBA 4A9YA 5A46A 4WD5A 3NIEA 3RNIA 5GHVA 3UMXA 3GCUA 5IF1A 1FGIA 1HOWA 2JDVA 3O8PA 2BIYA 2F7XE 2VWVA 1ZAOA 3FQEA 3QWJA 3LFQA 4FOCA 4GG5A 3QWKA 4MNEA 2I6LA 5FP6A 5KCVA 4C4GA 4IEBA 3I0QA 3MIAA 2JDRA 3QTSA 5BVEA 4B4LA 3E7OA 4BYJA 4OBOA 1OIUA 3ACKA 3H4JA 4QMLA 4L3JA 3GOPA 3E5AA 2BCJA 3VW6A 4RJ5A 3DJ7A 4FNZA 3TZ9A 4IHPA 2QLUA 4TWCA 5AP4A 5EG3A 5DVRA 2P33A 2XP2A 4HCVA 4E3CA 5HCXA 3B2WA 1ZY5A 4C4FA 4ITHA 2XIRA 1ZMWA 3GCSA 4RC4A 4USDA 4M97A 4XG4A 1URCA 2E9VA 5AMNA 4BVUA 4EBVA 5GJDA 4YPSA 4YLKA 2ZAZA 2C47A 4UB7A 4EH2A 4JG8A 4QYYA 5L2QA 3V01A 4QRCA 4BB4A 4OAUC 2FUMA 3MS9A 4WBBB 4J71A 2I0HA 4L43A 5KMKA 4PTEA 5CVGA 3C4XA 4J52A 1SVGA 4NFMA 3TNPC 1YI4A 2UW8A 2YLFA 3ORPA 4HVIA 5DRDA 4FKLA 4C4JA 4AGDA 2WFYA 4RC3A 4JDIA 4H3BA 4PV0A 2C6OA 3DLSA 3FLZA 4N70A 4ZJVA 3ORIA 3CC6A 1ZMVA 4GW8A 3RPSA 5HBHA 5FLFA 3LCDA 4O6EA 2W1EA 3K5VA 5CU0A 3P0MA 4FNXA 4WO5A 3V5TA 4AN9A 3PXYA 3R28A 3RZFA 4FSQA 1V0OA 3W10A 3UNKA 1A48A 2QC6A 1WBSA 3NR9A 4PY1A 3TV4A 1SYKA 2WHBA 3CEKA 5KX8A 3DKCA 4CRLA 4K0YA 2HY81 3MB6A 4G6OA 3DBFA 3UOHA 2WB8A 1PF8A 3MFUA 4M3QA 3K54A 3KGAA 3RHXA 3CGFA 2W5AA 4F9AA 5H2UA 2GNLA 3EOCA 4M68A 4E5WA 3TZMA 3A4OX 4YLLA 4D4RA 5G6VA 3FY0A 2NNWB 5D41A 4Y73A 3VWAA 3ET7A 4NW5A 3FAAA 5IQHA 4RT7A 1IA8A 2XH5A 5F1ZA 5FG8A 4YNOA 4O91A 5CU2A 1Y57A 4AZSA 4FSZA 4X2KA 2B7AA 2OG8A 3HGKA 4V0GB 5ANOA 3UP7A 2W1GA 2XYNA 3D5VA 3FZ1A 2BAQA 2J0JA 4NJ3A 2R3IA 4ZOGA 4B99A 2VTMA 2B1PA 1OECA 3EIDA 3G33A 4GV1A 4C37A 4EOQA 4MNEB 2O3PA 4M84A 1OL2A 3GC8A 3ZS5A 1UA2A 3IDBA 3BHYA 2IVUA 2RFSA 4KD1A 3LFAA 4L3LA 2J0IA 4O7WA 4Z16A 5I3RA 4AE6A 4HNIA 5AJQA 3DBEA 4IADA 4R5YA 5CTPA 3DXQA 1ZARA 4YHFA 4TN6A 4CD0A 5ANEA 4JI9A 3BQCA 4YZNA 1KE6A 5DE2A 4FSWA 2OIQA 3THBA 1UV5A 3UZTA 5I4NA 4FV2A 4CCUA 4EK8A 5FEEA 2QO9A 5B2MA 5CF4A 5FDXA 3TUBA 3DOGA 3FKNA 4IWQA 5ETFA 3LM5A 3WF6A 3OCGA 4CFMA 2QG7A 2GDOA 2F7EE 3P23A 3QRKA 4BCMA 4CYJA 3V5JA 3UPXA 4GVAA 4IWOA 3Q5ZA 2Y6OA 1KE7A 3CJFA 3FMKA 3AC5A 3UOKA 5CZHA 2B9HA 4O7NA 2UUEA 1OKZA 3BU3A 3QQGA 4H1JA 4I4FA 5FM3A 4ANLA 2BDJA 2I40A 4H3QA 5AUVA 2B54A 5IH4A 2BFXA 2VN9A 4OAVB 3Q2JA 5BUIA 2P2HA 3CPBA 4K1BA 4QP8A 1Q8ZA 2WMSA 4NKAA 4UMQA 4F09A 2J7TA 1K9AA 3GC0A 3SDJA 2XMYA 3GI3A 4O0UA 1OKYA 3AXWA 2PSQA 4YHJA 2CDZA 2GMXA 4MVFA 4CVAA 4D0XA 4HW7A 2I7QA 3PPJA 1J1CA 1ZYSA 4RWLA 3ZXTA 3BLQA 3OBJA 4X2GA 3HVCA 4AFEA 3W8QA 3SV0A 4ALVA 4S31A 4PDOA 4HVDA 1YXTA 2UZNA 4WRSA 2G15A 2C5XA 3R63A 4MX9A 4XV3A 5L8KA 2VWUA 4PF4A 4OUCA 4GKIA 5IQAA 4F6WA 1Y6BA 3Q9ZA 4IANA 5EKNA 4XJ0A 4EOOA 3CPCA 2X4ZA 2XB7A 3D14A 4FKSA 2Z8CA 5DN3A 5M09A 4FKRA 3MTLA 4OW8A 4G16A 4X3JA 3PFQA 4CMUA 5H3QA 3OY3A 4TYEA 2QQ7A 5AV4A 2RIOA 3CLYA 2O63A 2XIYA 3ZYAA 3ZLWA 4ANSA 2QU6A 2IW9A 4JBPA 3R04A 2NO3A 3OF0A 2UZOA 1CSNA 3R2YA 4MF0A 1V0BA 5KO1A 4PPBA 3LMHA 4QMWA 4UY9A 2C5YA 4J95A 1J7LA 3NUSA 4IXPA 3OWKA 5HIEA 4IIRA 4DAWA 4FX3A 2HZNA 2ZM3A 4QTBA 3VUGA 1YDTE 4DFBA 3Q4TA 2C6DA 3VVHA 5D11A 3LQ3A 1OMWA 2ITTA 4FT7A 2F49A 4MNFA 4C38A 4DCAA 3CBLA 4DH5A 5J7HA 5K0XA 3L9MA 4FNYA 4AGUA 2XA4A 2OF2A 4IB0A 3UVPA 2OH0E 3GCPA 4R3PA 5IEVA 2YCFA 2JAVA 3GUBA 4AGCA 2VNYA 3A62A 3ALOA 3M42A 4DH3A 1TQMA 1OKWA 3W2OA 1Q5KA 4PL3A 3B8QA 3DNEA 1BI8A 2NRUA 2XNMA 5CEOA 2ZB1A 4BDIA 1KE8A 2XZSA 3CKXA 3NUAA 4KSQA 3P1AA 4Y8DA 4PTGA 3W8LA 1UU9A 3CS9A 1P4OA 4QTDA 3QQKA 4FF8A 3W2SA 1H08A 1NXKA 2WTVA 3EJ1A 3ZSGA 5F4NA 5CLPA 1MRYA 5LVPA 2C1BA 4QD6A 1JWHA 2RSVA 3TKHA 4O7ZA 4U5JA 5FXQA 3N4TA 4WUNA 4O1OA 3UGCA 4RJ6A 5DA3A 3FI3A 3OT8A 4LGGA 4WG3A 5HIBA 4E5BA 1MRVA 5I9VA 5J5SA 4FTLA 3ZM9A 4M13A 3POOA 4L68A 3MA3A 3WOWA 3PPZA 2PL0A 3CE3A 3UODA 3BHUA 5HVJA 4DEAA 4LI5A 3S00A 3FWQA 4X21A 5DPVA 2GCDA 2H34A 4XCUA 3HA6A 2RL5A 4KIKA 1Q8WA 3PA4A 4RA5A 2PMIA 3TJDA 4QMPA 1YXVA 4FTKA 4U8ZA 4PWNA 5A6NA 3FKOA 2WEVA 3KXMA 2JEDA 3RWPA 5L8LA 4L8MA 3EH9A 4CRSA 1YDSE 2VTTA 3KRRA 2IZUA 3I1AA 1G8AA 4IWDA 3C0IA 1OIQA 3MH3A 1YKRA 5H8BA 3AD5A 2PVYA 3NDMA 2LAVA 4BKYA 3KB7A 4BBFA 5BNJA 3PDTA 3PSDA 4CTCA 2QOIA 3MYGA 4FC0A 4O22A 3T8OA 2O0UA 3HV4A 3EYHA 1WMKA 3LAUA 2VD5A 5L6PA 4JT3A 3C7QA 4EK4A 4ZY4A 3SC1A 3DNDA 1OL6A 4NM0A 2Z7QA 4JDJA 4NEUA 3KXNA 3RCDA 4DHFA 3N4VA 2YWPA 3I5ZA 5JZNA 4R3CA 2Y8OA 5F94A 2UW9A 3ZM4A 4DITA 2QOLA 4AE9A 4O0SA 1SNXA 3MY5A 4L01A 1IG1A 3D4QA 3IG7A 4EQUA 4F08A 2OJGA 4YPDA 3B8RA 2FVDA 1M14A 4E8AA 3JPVA 3QC4A 3PVWA 5EOBA 2XNGA 5A4TA 3AC3A 1Q8UA 3QTRA 2WMXA 3IS5A 3LFFA 3PRIA 1JSTA 1WBOA 3FMNA 1UU8A 1T46A 2ZVAA 4FI1A 4RSSA 4TT7A 3BELA 4TYGA 3ZH8A 4ACGA 2W4JA 4XOYA 4FZ6A 3DXPA 4ARKA 2GHMA 4KWPA 3F3ZA 5TR6A 3DTCA 2P55A 3EYGA 3SW7A 1I44A 1CM8A 4BWXA 3QGWA 3EN9A 3WF5A 4EOJA 4C35A 4L7SA 4WNOA 1JKLA 5LWMA 2UW6A 2PULA 1H25A 3FLWA 3KEXA 4IMYA 2W7XA 2JKKA 3EN6A 3ZZEA 4DGLC 3ZDUA 3AT2A 4AA0A 4KBCA 4FKWA 4KKEA 4RLKA 4EL9A 4ZTMA 1XBBA 2O2UA 3LHJA 4RIWA 3WILA 5M06A 3DK3A 1YW2A 2J0MB 1XKKA 5KUPA 4M0ZA 5C01A 1U5QA 2FGIA 3AC1A 4ANOA 5KMLA 3TTIA 3TIYA 5L2SA 5EHOA 4FA2A 3FEGA 2W1CA 3OOGA 4S33A 3EB0A 4DFZE 3H0ZA 3RPRA 4FZDB 1APME 5HE1A 4WNKA 4KIKB 2X8IA 4LMNA 4APPA 3VRZA 3A8WA 4CKJA 5EYDA 3AD4A 3HMIA 3O17A 2OBJA 4A06A 3PJ3A 4O0WA 3KULA 2PVNA 5B2LA 3G6GA 5AUTA 4NK9A 2OIDA 3VS5A 4V05A 1UU3A 2V0DA 5E90A 5EFQA 3JXWA 4LG4A 3FMDA 3P9JA 3EZRA 4N6ZA 3GENA 4V01A 4ZMEA 4IB3A 2BDFA 3I4BA 3ZLSA 3PPKA 4XG8A 3QRIA 3FHIA 1KOAA 1CDKA 5AUXA 2GNFA 4UX9A 4DG0E 1W7HA 4UMRA 4WUAA 4QMSA 3C4FA 1U5RA 4I0TA 1QPDA 2R3FA 4NIFB 4AZWA 5M4UA 4YJNA 5HORA 3FLYA 2IVVA 4JBOA 5FQDC 5FWKK 5LWNA 4I6FA 5CT7A 3KKVA 1XH5A 2BIKB 4K8AA 4ZZNA 2R5TA 3LVPA 2BZJA 2XCHA 5BVOA 5AAEA 4CFXA 2W1ZA 3ORXA 2QR7A 3EQDA 5HX8A 4QTAA 1XO2B 4Z7HA 3NRMA 3GVUA 5HZNA 5IA0A 5DGZA 1PRYA 5CAPA 3LPBA 1OBGA 4E4MA 1S9IA 5DR9A 2FO0A 2VO6A 2X9FA 1J7IA 3A7IA 4PDSA 3SX9A 4I5PA 4ACDA 2X39A 3KXHA 1SVHA 5IQCA 2BR1A 3NX8A 5CVHA 1BL7A 3ANRA 1J7UA 1UKHA 3UMWA 3VQHA 4UMPA 1OL5A 1WVYA 1T45A 3QD2B 4F9CA 3GU5A 4G5JA 3LXNA 2OU7A 4RZVA 4FEVA 4TTHB 4LL5A 3EN5A 1DI8A 4BGHA 3H9RA 5CXZA 3K3IA 4FSRA 3HAMA 2C6MA 3CTJA 5CSXA 5CALA 5DEYA 5CAVA 5HTBA 3BLRA 4NCTC 4NWMA 4FTUA 4CQEA 1YI6A 4FSTA 2C3LA 5K0KA 3U9CA 5EI8A 3A7FA 4JS8A 2WTWA 3OC1A 4L46A 4OT5A 4E7WA 4YJRA 1DI9A 4BCHA 4F70A 3NUPA 3SG9A 4TYJA 1XR1A 5DG5A 2XIXA 1XJDA 2Y7JA 4I4EA 5CSVA 3D7ZA 2AUHA 4X3FA 3NVKI 3IPHA 3KULB 4MBJA 4MD9E 4O6LA 2VZ6A 3BYSA 3R7EA 3CSVA 3FC2A 3O8UA 4TWNA 5AV2A 2ITWA 2O65A 3RZBA 2F7ZE 4QQJA 2JKMA 4CLJA 3UTOA 3JS2A 4QPSA 4FT9A 3VULA 5FUTA 4P2KA 1DAYA 1IEPA 3C0HA 4CCBA 4S32A 3UYTA 5TOZA 3ZRKA 4E4XA 5EHLA 4DG2E 2CJMA 5T6KA 2XNOA 1OPLA 3PY0A 2OF4A 5CEPA 3S1HA 3MH0A 5FD2A 4C34A 2CKOA 4YC3A 4DFUA 3VUKA 3R22A 5AUYA 3EQHA 3ORNA 5AX9A 4E4NA 3Q32A 4LUDA 5J9YA 2WMAA 4C3PA 2C6EA 4D1XA 4FV5A 3I7CA 2OGVA 4LRKA 3BWFA 2NP8A 3F88A 3QQHA 5AUUA 2HWPA 4FODA 2VWZA 3MJ1A 4RJ7A 1GAGA 1GIIA 4JL9A 4FSNA 1BL6A 3ROCA 4GUEA 5GINE 3QCQA 4FVRA 3WZUA 4BF2A 3F69A 1VYWA 2W1IA 3KF4A 5EDQA 5CANA 2CKPA 4FV7A 3OW3A 3A7JA 5HD7A 4TXCA 3LXPA 3II5A 4L3PA 3H30A 3GP0A 1FOTA 3G9NA 3MV5A 3I79A 3P4KA 3QKLA 4HCTA 1MUOA 4FBXA 4KIQA 3ZZWA 5I9WA 4O7LA 4JIAA 4EHEA 1WBWA 3AT3A 5JFVA 4MK0A 1YOJA 2PE0A 4U43A 1OITA 4O82A 3A2CA 4U45A 5L4QA 5F20A 1JKKA 2YIYA 5EYMA 3KQ7A 4YJOA 4B0GA 2Y0AA 3KXXA 2C0OA 3GFWA 3OCTA 4BCQA 3EFKA 4D9TA 3LOKA 4FG8A 1WVXA 1GZ8A 4BL1A 1W98A 5E8UA 3D7TA 2FSMX 3LXKA 1M2PA 4G5PA 4FTNA 2B9IA 2C5NA 4QPMA 3ZSIA 4BY9E 4JX3A 3NUXA 1GIHA 4YZBA 4DT9A 3TL8A 3LCTA 4AW0A 4WIHA 4MBIA 4F7LA 4BHNA 4O0VA 4QMTA 1U59A 1PMVA 3FSFA 1BYGA 4UALA 5FTGA 4TZRA 2A2AA 4FIHA 4GT4A 4JX7A 5HVYA 3UBDA 3NNXA 3VIDA 3ZUVA 4F7NA 3FXWA 4FEXA 3RTPA 4MCVA 3PIXA 3ZRLA 2VTHA 1M2RA 3Q4UA 2XJ1A 4JRNA 4P5QA 2CSNA 4DLJA 4GYIA 5CF8A 4C58A 5IQIA 4D2TA 4GFGA 3LFBA 3OP5A 2UW7A 2XK9A 4O0YA 4RJ3A 4R3RA 2PE2A 2BILB 2OK1A 3I7BA 4FV3A 3RPVA 5IA4A 3EQCA 3TNWA 4X7QA 4H1MA 4UWBA 4G1WA 3MPTA 4O81A 4X3FB 4GT5A 3Q6UA 3EWHA 2OW3A 3QQUA 3GC7A 4IBMA 4CXAA 3CY2A 2GS6A 2IW8A 3DS6A 4GMYA 5IH5A 4DCEA 4I23A 1Q3DA 3O8TA 2BTSA 3VUMA 5CI6A 5CF5A 4Y5HA 5IQDA 2J5FA 4C0TA 2HOGA 4C7TA 4FTIA 4F6SA 3QTWA 2YM8A 3D94A 4DYMA 2ZOQA 3FC1X 2WMBA 4UMTA 4I41A 2PE1A 4EUUA 3RK9A 3SRVB 5IKWA 4DTKA 3NYOA 3VJNA 5IQFA 3CD8A 4XNEA 3U87A 3ZXZA 4L9IA 4ZK5A 2R64A 2JBPA 4FKGA 1R3CA 2BRGA 2HY0A 2ZDUA 1ZOGA 4FV9A 2C5VA 5D1JA 5EM7A 5FEDA 4EH3A 4QMQA 4EORA 4K33A 2BHEA 2UW3A 3AMBA 3JUHA 4HZRA 3N51A 3MJ2A 4DFYA 4RX5A 3RPOA 3DZQA 4YURA 3HDNA 3G15A 4Z3VA 4TL0A 1Q62A 3IW5A 1O6LA 4QPAA 4RFYA 3AT4A 5IU2A 5FXSA 4F65A 2VX1A 3Q04A 5M4IA 5E8ZA 2X8DA 2R7IA 1RQQA 4BGQA 4O7VA 5LVOA 4DT8A 4AUAA 3ACJA 2UVZA 4GYGA 4M0YA 4AS0A 2UZEA 2YJSA 1NA7A 4HYIA 5HLWA 2IW6A 5ETCA 1IR3A 3FI8A 2J0KA 3EQRA 3KREA 2VGPA 4QMUA 3SAYA 5IA3A 3PTGA 5EQYA 3R8LA 4MKCA 3VHEA 5J1WA 4GUBA 3EKKA 1NVSA 4JDKA 4CKIA 2GFCA 3PG3A 5HESA 5I9YA 5A54A 1TKIA 3CKWA 3D7TB 2VTLA 3QGYA 4HYUA 4HJOA 4UWYA 3NW7A 4QP3A 4UYNA 5I5ZA 5KKRC 4I0SA 5ETAA 3V04A 1CMKE 4ACHA 5BPYA 5JQ8A 4IB5A 3K5UA 5HG5A 3PXZA 5JK3A 1TVOA 2CNUA 5J9LA 4OR5A 3U55A 3KY2A 5E1EA 2CGWA 2OJJA 3VUTA 3QHWA 5HHWA 4FGBA 2ITOA 3BYVA 3QTZA 2VTAA 4GL9A 1ZYLA 5D7VA 4B8LA 2J4ZA 4PMTA 2R0UA 2DS1A 4NYEA 3MIYA 1JSVA 1Z5MA 3HNGA 5AADA 2JKQA 4QP7A 4LRMA 4MQ1A 2JITA 4TNDA 5DWRA 4F99A 3BLHA 1SZMA 4J98A 3PYYA 1DAWA 2WMUA 3EMGA 4GT3A 5CU6A 4EONA 4QQTA 3DFCB 4O96A 1REJA 2BKKA 4RMZA 1G5SA 4HYSA 1YVJA 2EU9A 4AAAA 1PXIA 3TDVA 2WELA 4NUSA 5EW8A 3VF9A 3QLFA 4EZ3A 3DDQA 4ALWA 1Z9XA 3GCVA 3E88A 4BDAA 5EW3A 4V04A 3MW1A 4LV5A 3UZRA 3WZEA 3TCPA 1BUHA 2R3PA 2J5EA 4GK2A 4XG3A 4AACA 2UZTA 5KE0A 3SXSA 2EWAA 4R6VA 5GNKA 4PMPA 2OWBA 4M12A 3HMPA 5J95A 3VHKA 4GVJA 5A4QA 3BEAA 4U6RA 1W0XC 4NKSA 3RAIA 4LRJA 4YJUA 4W9XA 2YABA 1FVVA 3VS2A 4NM3A 4J7BA 3OOMA 2X8EA 1B39A 5I9ZA 5CSWA 2XK8A 3V3VA 4C57A 3OZ6A 3TJCA 3LFNA 1IASA 4W4WA 2XIKA 4Q9ZA 2C4GA 2ITNA 2JIUA 5LMKA 4X6RA 4JBQA 3R9NA 5KZIA 3FDNA 3AC8A 4PRJA 4CNHA 4F1TA 2GNGA 3KRJA 4FT5A 4G6NA 4LQMA 3S4QA 4J99A 4Q2AA 4S34A 4LM5A 4U80A 1KV1A 3TV6A 4FZ7A 3PWYA 4D2PA 5JQ5A 5L3AA 3NPCA 2QOKA 5AP2A 1CKJA 4P5ZA 3RALA 3PJ2A 3RKBA 1Q99A 3UOLA 1R39A 3EZVA 2YIWA 5IDPA 5M56A 4H05A 4WNMA 3BRBA 3WIGA 4R7HA 3QFVA 2I0YA 2JDSA 5DBXA 3SD0A 4TNBA 5HG8A 2B52A 2WTIA 4AWIA 3R0TA 2PUUA 3VC4A 5AIKA 2C3KA 4RVTA 4NL0A 2R3JA 2WTDA 4U42A 3TKIA 3R1NA 3FMHA 3ZUUA 4OBQA 3VO3A 2YCQA 4YGAA 4QQCA 2RF9A 5CAOA 3I6UA 3LJ2A 2GFSA 2WPAA 4AW5A 3WF7A 2A19B 3UPZA 2YIXA 2JIIA 3RCJA 1OGUA 3B2TA 5FTOA 3BGPA 4MQ2A 3VBXA 4G9CA 4WT6A 3L8SA 4RIYA 5M51A 3VF8A 2W96B 3KVXA 2B9JA 4QMZA 2BMCA 3UOJA 1XH8A 2W1FA 1QCFA 3CQUA 2R3RA 5C27A 2IZSA 4AG8A 4XUFA 3SW4A 3QUEA 5AAGA 4CKRA 5M53A 1IRKA 4JIKA 4CSVA 3O7LD 4ID7A 4A9TA 4O7TA 3F5UA 2PUNA 3LCSA 4XLVA 3IDPA 3A8XA 2PZRA 5HO7A 4I6HA 5J8IA 4AOJA 4BCOA 5EM8A 3NCZA 3QU0A 3PSBA 3FI4A 4FKUA 4FKVA 3E62A 5M08A 3FMJA 3OEZA 2ONLA 3NUNA 3GXLA 5IA5A 2HXQA 3MVLA 3HMNA 3RAKA 4RWIA 3O51A 5FP5A 2G1TA 3A7GA 5LVMA 3L9LA 3QHRA 5EYKA 2PHKA 3IONA 2HAKA 2XEZA 5FBOA 4JG7A 2GSFA 3E8DA 3I60A 3QCXA 1RE8A 4MXAA 4Q9SA 5HLPA 4AP7A 1YOMA 3IOKA 5BMSA 2QVSE 3TNQB 4ORKA 4NZWB 1XWSA 2YM4A 4GCJA 3CXWA 4XHKB 2QD9A 1MP8A 3OUKA 4HNFA 3SQQA 4F7SA 3E8NA 3FMMA 3QC9A 3U6JA 5GZ9A 1YWVA 1ZZLA 2A1AB 5CNOA 4KKGA 5K9IA 3C4EA 4HVSA 3LXLA 3CQWA 5L6WL 3DK6A 4ZS4A 2WMVA 2EB3A 2ETMA 2PUPA 4YTCA 4JQ7A 4YTIA 5BMMA 4EYMA 5DYJA 4LGDA 5A4LA 3UIUA 3HLLA 4MTAA 3D2KA 4FKOA 2G2HA 5AR8A 1OUYA 3MH1A 2YCSA 1H28A 2X6DA 2EXMA 1HCLA 5LJJA 4XBUA 4CFNA 3BGQA 5CEMA 1PHKA 1JQHA 3QCYA 4ENXA 3MDYA 3MFRA 4X2FA 1QPJA 3D5XA 3FQSA 4AQCA 1H1PA 3UZPA 3G9LX 4XV1A 3V6SA 2GTMA 3BQRA 4CEGA 4YO4A 1AQ1A 3D5UA 3LIJA 4OTRA 3AOXA 4NTTA 3GU6A 4G34A 5HE0A 3UDBA 3GOKA 2IPXA 1OKVA 4FVQA 4ZTSA 4FZAB 3MTFA 5H8EA 3WZKA 1SVEA 3PSCA 3COHA 3IGGA 4RIOA 5DT4A 3RJCA 3FL5A 1AGWA 5EI2A 3NSZA 3W55A 4EK5A 3GB2A 1UKIA 3EHAA 3QYZA 4L00A 4KBKA 3ENMA 5DT0A 3I81A 4H3PA 3TV7A 2H8HA 4RIYB 4FIGA 5AA8A 3ZFXA 3EL8A 4PTCA 3KFAA 2E9PA 4YZMA 3FMLA 2GTNA 4BDJA 2WD1A 3Q4CA 5HX6A 3OTVA 3KK8A 3R1SA 1JOWB 3S3IA 2YDKA 3NYNA 3HKOA 5AR7A 3NMUF 4IX4A 5HE2A 1P5EA 4M15A 2HWOA 4C4IA 1FBNA 1PYEA 4MXYA 3F3WA 2BRBA 2OO8X 1JSUA 1F0QA 3F5PA 3R73A 4IQ6A 3RHKA 3OXTA 2ZDTA 3R2BA 4BZOA 4EHVA 5DT3A 1LEWA 3L8PA 2HZ4A 4ANNA 4IE9A 4FTQA 3TI1A 2WTKC 4UZDA 1V1KA 4KRDA 3GCQA 4IW0A 1H26A 4FV6A 3MFTA 3Q3BA 5IUHA 4MD8E 3QTQA 5DRBA 3ORLA 3ZSHA 2ITQA 5EYCA 4M8TA 3CTHA 4EC8A 2X2KA 4BZNA 4FE2A 2XCKA 4BI1A 2C69A 1ZOHA 4FTOA 4RRVA 4YTFA 1PXMA 2QKWB 3D2IA 1E1VA 2CHLA 2PZYA 3D5WA 3ITZA 3DK7A 3TXOA 4E1ZA 4YU2A 3ATSA 1P4FA 4FUXA 4RWJA 5E1SA 3ZFYA 3Q6WA 1P14A 5HEZA 1FGKA 2OJ9A 4CFVA 1UNGA 4HCUA 4FL1A 4MXOA 4RWKA 4DFXE 2R4BA 3R00A 4EK3A 2YDJA 3VUDA 3U4UA 2EXEA 5JGBA 4YC6A 5AV0A 3GEQA 2CGVA 1OM1A 3VS3A 4ZTHA 4M7IA 4NIFA 4X6QC 4AW2A 1Q8YA 2H96A 1JVPP 1XHAA 2YWVA 2IN6A 3UNZA 2C6TA 4DC2A 3LM0A 4TW9A 5HCYA 4BCFA 4QQ5A 1H4LA 3UIBA 3BKBA 1F5QA 3KMMA 4EOPA 4U3YA 3OTUA 2PZ5A 3E63A 3NW6A 4O7YA 4KBAA 3JY9A 3ETAA 4IDTA 4QMNA 4A4XA 1G8SA 3FZOA 3EQIA 5DR2A 2P0CA 1U4DA 4IAZA 5ETIA 4DFLA 1GY3A 3QYWA 3ZUTA 3QBNA 4J53A 5T68A 2PVMA 3BE2A 2C1AA 3FI2A 4HYHA 3R1YA 4DEIA 2PMLX 2RGPA 4Z9LA 4FEQA 3QLGA 3MFSA 4RIXA 2PVKA 2YM7A 4RVMA 4ACMA 3SOAA 4FEWA 3ZONA 1AD5A 2QO7A 3L9PA 4BR3A 4D5KA 3E93A 3PLSA 2WQOA 3GNIB 4TYHB 2HK5A 2GNIA 4F0GA 4O0RA 3KF7A 3RK7A 4ZSLA 5CXHA 3VBYA 4J96A 4UXQA 1W84A 1JBPE 3EQFA 5AR5A 5LMAA 4AFJA 2G9XA 4FV8A 5BUEA 5CAUA 4B6LA 4FK6A 3F2RA 4NFNA 3I0OA 3Q9YA 2Y4IC 4YSJA 4FIIA 1UNLA 4DN5A 4ERKA 2VWWA 2YM5A 3BPRA 4BTMA 3TIZA 3GU7A 2G01A 3UNJA 2H6DA 4F9WA 1JPAA 2YDIA 3RGFA 2OI4X 2R3GA 3OVVA 2VWXA 4IZ5A 4RA4A 5M57A 3BU6A 2B55A 4WSYA 4FIJA 2PU8A 5FXRA 4IM3A 3MN3A 3AG9A 2WQBA 4N57A 2JIVA 3L8VA 4CV8A 3H0YA 4NSTA 3BEGA 4FIFA 5FDPA 3GT8A 5LVNA 3O0GA 5JZJA 2PPQA 1YHWA 4ENYA 2QURA 2X2LA 1JNKA 1PJKA 3EQPA 1OB3A 4BKJA 5LCKA 2BRHA 2FB8A 3RVGA 4I5HA 2OICA 2EB2A 3NEWA 5DNRA 5HO6A 3PJ1A 3OG7A 5AP5A 4AOTA 3OFMA 2QR8A 1PXOA 2UW4A 3HYHA 3L1SA 3QQJA 4LOPA 4YJVA 4HVGA 4KINA 1NVQA 1PXPA 4AGWA 3H3CA 4I92A 4U0IA 5M4FA 4BCGA 2UZBA 1WBNA 5AWMA 2V55A 5HD4A 5JMSA 5EOLA 5AP6A 2AYPA 2R3LA 5DR6A 4IX5A 1PXKA 3U6IA 5HBEA 3O2MA 5AAFA 3ZU7A 3C4CA 4KUJA 3T9TA 1PYXA 2JBOA 3EL7A 3ERKA 3HECA 4UMUA 3U6HA 2OZAA 2XK3A 3G6HA 5EQPA 4IAIA 5DLSA 5E7RA 4EH6A 4H39A 3NYVA 3VJOA 2X1NA 2C0TA 3IW7A 2HZIA 3FPMA 3QKKA 4GU6A 4QP6A 1QPCA 4RX8A 5CNNA 4DH7A 4A9RA 4EOKA 2QOCA 1W82A 3E7VA 4IM2A 5C8NA 1H07A 4ALUA 3PY3A 2WQNA 2XRUA 1H24A 1YRPA 4ZS0A 2A0CX 3BZ3A 4XYFA 4RIXB 3VW8A 1M7QA 4KABA 5CI7A 4EEVA 1GOLA 2W1DA 4QMYA 3T3VA 4Z7GA 2PYWA 1KOBA 3PZHA 1ZMUA 4FICA 2WU6A 2RFNA 3ULIA 4C2WA 2V62A 2VAGA 4OTDA 3CGOA 3AGMA 4O38A 2XF0A 2J51A 2QCSA 3CCNA 2WMQA 5JT2A 3PA3A 3TN8A 4BTKA 4XG6A 3DBDA 4AT4A 4DEDA 1YI3A 5HBJA 4N4SA 2CN5A 3OS3A 1XQZA 4K6ZA 2JGZA 5F95A 3ATTA 5C9CA 4U41A 3VS6A 5K5XA 4QP9A 3VAPA 4A07A 3AMYA 4PL5A 2XBJA 3NNVA 2GQRA 1GNGA 2BZHB 3FLQA 4Y85A 2X9EA 4D58A 3N4UA 2FYSA 4YTHA 4MEDA 5AUWA 3TNHA 2YITA 4BDKA 4XMOA 2QNJA 4EH8A 4U9AA 2YAAA 4F63A 4EWQA 2H9VA 1SM2A 2WQMA 3FY2A 3C50A 3QF9A 3AGLA 4JDHA 4C02A 1IA9A 4ZMFA 2JAMA 2PMNX 4BIBA 4EZ5A 3WIKA 4NU1A 4R1VA 5I0BA 2FSLX 3ZHPC 4K2RA 1XH4A 4GKHA 4GJ2A 3UQCA 4HPUE 4A9SA 2WTCA 3QUDA 4RGJA 3R9HA 4D2WA 3W18A 5JSMA 3EKNA 3IOPA 2NRYA 3TKUA 2W05A 4DINA 3NAXA 3FZSA 4MWHA 3TTJA 4JVGA 3R7IA 4BTFA 4R7BA 3IQ7A 4BDEA 4UN0C 4U40A 2BZKB 3AD6A 4AX8A 5AP7A 3LMIA 1R0EA 3C0GA 4ZLOA 2BDWA 4FYOA 1PMUA 3QL8A 3EQGA 3SRVA 4MXZA 4CFFA 3C5UA 2YN8A 1OUKA 4IZYA 3A60A 3V8TA 4W8EA 5CF6A 4MD7E 4M14A 3QD0A 5BYYA 4F0IA 2I0EA 5DHJA 3MH2A 3VS4A 4D4VA 4AZFA 1L8TA 1PKGA 2ZB0A 1Q4LA 4BDGA 4YC8A 3HUBA 5ACKA 3DLZA 3DT1A 4C62A 4O27B 3KN6A 2OZAB 5L2IA 5IUIA 3M2WA 2OH4A 4D2RA 4GS6A 2UVYA 4GFMA 5BQ0A 2CKQA 4W4VA 2I1MA 4JXFA 1BLXA 3KCKA 3W2CA 2IO6A 4CG9A 2W0JA 1U54A 4C36A 3NWWA 4QYFA 1H8FA 3BGZA 2W9ZB 2XM8A 5I3OA 2XK6A 2YA9A 5ANDA 4W9WA 2GU8A 5E8WA 4WG5A 5BVFA 4KNBA 1R0PA 4BYIA 4MAOA 2C68A 2E9UA 2OJFE 3NGAA 4G3GA 3TG1A 4ZJJA 3FKLA 2DYLA 4PUZA 4MH7A 4Q5EA 4CLIA 1VEBA 5C8KA 4JQEA 4YBJA 1LEZA 3LFEA 4O7RA 1ZYDA 4NCTA 3F6XA 3UC4A 3R8PA 3UYSA 5I9UA 3H9OA 2WTJA 1ZZ2A 2ETRA 4EKKA 5AIRA 4RQKA 1ZYCA 3MB7A 5A6OA 5JN2A 2VWIA 2XJ0A 4KSPA 5BVWA 5CENA 3PP0A 4L7FA 2ACXA 3R7UA 3R6XA 3QXOA 2UW0A 5CSHA 2XNBA 4DH8A 5E9EA 4FV1A 5IQBA 2EUFB 4NM7A 2C6IA 3UIMA 1R78A 1UU7A 4KIPA 4BFMA 2YFXA 3G90X 2JFLA 5G1XA 1ZLTA 2CKEA 4DBXA 3LFDA 5IEXA 2WZJA 3EQBA 3EFJA 4K18A 3LLAA 1OL1A 1OI9A 2HELA 4F1OA 3F2AA 3CD3A 4DTAA 4DG3E 2W06A 3IECA 3SLSA 4AW1A 4CMOA 4A4OA 1YXUA 4XH6A 4DTBA 2BFYA 1WBVA 3KN5A 3LCKA 4KAOA 3HAVA 1M2QA 2CLQA 3A7HA 4FV0A 1YWRA 4CT1A 1Q41A 3LMGA 3ZO3A 5IZFA 5AP3A 4EKLA 3UP2A 4I0RA 3QZFA 4YMJA 3DB8A 3R30A 5BUJA 3KXGA 3KK9A 2QODA 4D2SA 3D15A 2QOHA 2WEIA 3UO4A 4PMSA 1OIYA 2P4IA 3VS1A 1IAHA 4EZ7A 1L3RE 5HGIA 4EHZA 3H9FA 3G2FA 3Q9WA 4IC7A 2YZAA 4YO6A 4N6YA 3ZFMA 5IH6A 2J0LA 3NUYA 1Q8TA 5E91A 3RP9A 3W32A 2G2FA 4BCKA 4EQCA 1VJYA 2BALA 2QU5A 2UV2A 4YSMA 2WGJA 4TKSA 2VTSA 3MGYA 2Z02A 3O50A 2UZUE 3QD3A 4YP8A 4F64A 5FM2A 5CX9A 1J3HA 3ZDIA 4AZVA 3CJGA 3PA5A 3FL4A 4R1YA 2RKUA 3VBTA 4JNWA 5J5TA 2VNWA 4G31A 5M4CA 4U3ZA 2XNPA 3MPAA 4II5A 5CASA 3WZJA 1FVTA 2UW5A 4FSUA 4FEUA 2QKRA 3KA0A 3E3PA 3LJ0A 2Z7RA 3PY1A 3E8EA 3GQIA 4G3DA 4KA3A 3LW0A 4U44A 3DFAA 1VR2A 3PG1A 1U54B 3Q5IA 5KMJA 2WIPA 4ZY5A 4F9BA 1W83A 4KB8A 4XOZA 3ORKA 2BHHA 2X7FA 4GFOA 4IAFA 4IVDA 3RM6A 4AA5A 4ZLZA 4DE4A 5DFPA 3P08A 4DEEA 3ZMMA 2BTRA 4Y83A 3QRJA 4NM5A 5AR2A 4NW6A 4FVPA 5IG1A 2QLQA 2X7GA 3ID6C 4XP2A 2W5HA 2W99B 4D0WA 3UVQA 4A4LA 5HNIX 1FQ1B 3OY1A 2BPMA 4FMQA 4GSBA 5HG7A 3FZRA 3R7VA 3CY3A 5AV3A 5FGKA 4KIOA 4GEOA 4NT4A 1MRUA 2A4LA 2P3GX 4LL0A 5BYZA 3KC3A 1PMNA 5CY3A 4BICA 4DGOA 4JQ8A 3RAHA 5LMKC 5LQFA 3FUPA 1TQIA 3NIZA 2X6EA 3V8SA 4CTBA 2IJMA 4G3EA 4U7ZA 3ZTXA 2BUJA 3MI9A 3QXPA 4O1PA 5JRSA 3RMFA 1H1QA 4QMMA 1K3AA 3VBQA 2YM6A 3VUHA 5L2WA 4WOVA 4BDFA 2X81A 5B7VA 4WSQA 5BX0A 5E4HA 4YJPA 4G6LA 3GC9A 4XLIA 4X2NA 4J1RA 4CYIA 2DUVA 2QO2A 4O84A 4EH9A 5ANIA 5FBNC 4BIEA 2F57A 4FTRA 4RJ4A 5TO8A 1NY3A 2CLXA 4PMMA 2PVFA 4QMOA 2QOFA 3QTIA 4D9UA 5IDNA 5KBRA 3M1SA 4R78A 4PNKA 4QO9A 3P7BA 3R8UA 2R3NA 4GRBA 3R8MA 2O5KA 3DAKA 3U54A 3UIXA 2WIHA 4UYAA 2Q83A 3AQVA 4J97A 5EDRA 3IDCA 1BMKA 1XBCA 5EKOA 4HGEA 4AZTA 1X8BA 4IACA 5E8XA 5KMNA 2F2CB 4JR7A 2X7OA 4YUQA 4WKQA 3VBVA 4R5SA 4B7TA 1LR4A 2XK7A 4RVLA 1BKXA 2QG5A 2BRNA 3R7YA 2YCRA 4DEBA 2GQSA 3HL7A 3NNWA 3UJGA 2HXLA 2IWIA 2UZVA 2REIA 2RFDA 2Y4PA 3DKFA 5CU3A 3T3UA 3D9VA 3R71A 5H8GA 4AA4A 4QMVA 4E4LA 2YAKA 4RX9A 3OCSA 4CZUA 1MQBA 3IO7A 5KNJA 5GJFA 4G17A 5IQGA 1YXSA 3E64A 3V6RA 3BHHA 2ITZA 5HO8A 2QONA 4RJ8A 3LE6A 3QX4A 2ONLC 3VRYA 2R3KA 2FA2A 3VBWA 2RG5A 5LMBA 4QYHA 3QZIA 4RG0A 1PMEA 2XVDA 3ZO1A 4E73A 3OHTA 3FBVA 4Q5HA 4YJTA 3W33A 4XRLA 5KMMA 3P7AA 3RINA 1H1WA 3GBZA 2ITUA 3IW4A 3OD6X 4NTSA 4IDVA 4FTAA 3NS9A 4IJPA 4XP3A 1S9JA 4WA9A 1H0WA 2W9FB 4C2VA 2WQEA 4IWPA 2OSCA 3BHTA 5DH3A 1UVRA 3CTQA 1NW1A 5JGDA 3BU5A 3IKAA 3JVRA 1XH9A 3PVGA 4UV0A 4ASEA 4UWCA 5KHXA 4YZDA 4Y5QA 4PX6A 5E92A 5HNBA 5JFXA 2R2PA 1LP4A 3P86A 2Y9QA 3G5DA 3QUPA 4YJSA 4OGRA 3DBQA 1WBPA 4GK4A 3C9WA 4YZCA 3DV3A 2YHVA 2V5QA 1H27A 3DAJA 5HE3A 1YWNA 3OUNB 5HTCA 4OTWA 2YLEA 3U9NA 1ZXEA 3R9OA 4GU9A 4DFNA 4QP4A 2I0VA 2ZM1A 4FR4A 5T3QA 2HW6A 3F3UA 3FXXA 4I20A 4Y95A 5CS6A 4ZSEA 3UG1A 4DGMA 4O83A 3WBLA 2PVRA 4IH8A 5AA9A 4QTCA 5GZ8A 5HVKA 3VUIA 4GK3A 2YZLA 4FZFB 2QI8A 4TRLA 4DH1A 4EOMA 2JDTA 3ENHA 1JKSA 4IAAA 2W4OA 5IMEA 1J1BA 4F7JA 4BDCA 5HTIA 3CR0A 3VQUA 4D4SA 3TUDA 4DA5A 2JD5A 4R77A 1ZYJA 1FMKA 4JG6A 3UVRA 4BC6A 3G0EA 5EI6A 4BDDA 4D4YA 3PLAE 3BX5A 3QALE 3NYXA 3O23A 3ZLXA 3PE1A 3NNUA 4IB1A 5C4KA 4ZZOA 4WNPA 5J79A 5KBQA 2YIRA 1URWA 2VV9A 2WMTA 3SXFA 5AM6A 1YXXA 3TEIA 3DCVA 3HP5A 5L6OA 2XJ2A 2PVJA 3NUUA 5HCZA 2BVAA 3BCEA 4ONAA 3EN4A 4RQVA 1WFCA 3GU8A 1PKDA 2XKDA 3SG8A 3DKOA 3U4WA 4QTEA 5KZ0A 5JKGA 3R7OA 5EQEA 1U46A 2JDOA 3MWUA 3HX4A 3PZEA 3Q9XA 5C4LA 1XBAA 5IMXA 3R9DA 2VTPA 3H10A 1F3MC 4OTFA 3MVMA 3G0FA 4JJRA 2ERKA 4EWHA 4AZEA 4GG7A 1O6YA 2UZDA 2C30A 2Q0BA 3MESA 3S95A 3FHRA 1B6CB 5BVDA 1NT2A 2A27A 1GJOA 2OXDA 3KVWA 4AT3A 4U79A 2VO3A 3DAEA 3L9NA 3OT3A 3QZHA 3QTUA 4S30A 4CV9A 5HU9A 4O0XA 4RZWA 2QOOA 3QAME 4AOIA 3TUCA 4L45A 2CGUA 4JAJA 3HDMA 2OKRA 2DQ7X 4JRVA 3SGCA 3Q4ZA 5CT0A 3K2LA 3O7LB 4BI2A 3HRCA 4XG2A 2BKZA 5EK7A 4LUEA 4MBLA 4CZYB 2XKEA 1R1WA 3BYMA 3W2PA 1WZYA 3EN7A 4LGHA 5I9XA 4YLJA 3TT0A 4ITIA 2WAJA 2J2IB 5IEYA 5KKRB 1OZ1A 4ACCA 2J90A 2BROA 2YIQA 4L6QA 5HG9A 2C0IA 4O2ZA 5TT7A 2GQGA 1IAJA 2JKOA 4OBPA 3W2RA 4L44A 3WYYA 3ZRMA 1BI7A 5HKMA 4IAYA 4IAKA 2PWLA 3BBWA 4QOXA 3V5LA 3R8VA 2VTIA 3DQWA 5K5NA 4XV2A 5HNGA 4IC8A 3BIZA 4E6AA 2YJRA 4FK3A 3DXNA 3UE4A 1Y8YA 2VTOA 2ZMDA 1E1XA 4IVBA 3PIYA 5D12A 4GIIA 4J8NA 4TYHA 4QT1A 1QL6A 2VWBA 1ZRZA 1O9UA 1G3NA 4MYGA 4IVAA 4ANMA 5DI1A 2J50A 1BX6A 4OT6A 4XG9A 3DBCA 4BCPA 4IX6A 3S0OA 5BVNA 2BAJA 2PUIA 5HICA 5AP0A 4XRJA 1DS5A 5CWZA 4EUTA 1ZOEA 1YHSA 4IFGA 2JLDA 3NZ0A 4WG4A 3LQ5A 4WRGA 3BYOA 2R3HA 3C1XA 3PVUA 2CNQA 3A61A 5CZIA 4IX3A 5IPJA 4FL2A 4XP0A 3KMWA 3HV5A 3CP9A 3VNTA 3SOCA 4FKQA 4OTGA 2XKFA 2YM3A 3TZ7A 1B38A 3FSKA 3QD4A 4O86A 3HP2A 1RW8A 4TPTA 3MY0A 4O0TA 2HYYA 5CQUA 3F5XA 2CMWA 1YHVA 4ZTRA 4QP2A 5DEWA 3R8ZA 4K11A 4I1ZA 2XNNA 2OZOA 3ZCLA 2OLCA 4GIHA 4H36A 4W8DA 3ZBXA 4RLLA 4GJ3A 1SMHA 3NLBA 2P2IA 4IZAA 4PNIA 3FZPA 4I6BA 2BZIB 2IVTA 5CQWA 4D55A 2VO0A 3FJQE 5IA1A 5JFWA 4CGAA 2W17A 1SNUA 3HEGA 3DB6A 2CPKE 1H01A 3BV3A 4FSYA 4HGTA 2ITXA 1ATPE 1Q3WA 2HZ0A 3DZOA 4FNWA 4A7CA 5HI2A 4DLIA 5CYIA 3NVMB 3W16A 3TM0A 2VX0A 3O71A 4E6DA 4ASXA 3OWLA 3ORZA 3WZDA 1NVRA 3WF8A 3QCSA 2Z7SA 3E8CA 4QMXA 2IZTA 3FLNC 5K4IA 4JBVA 3D83A 4DGNA 4LFIA 2BAKA 3Q60A 4BCJA 3MVJA 4I5MA 2XEYA 4LOOA 1EH4A 5ITAA 4EH5A 4RPVA 3PWDA 2OFUA 5EHYA 3FQHA 1M17A 2GHLA 5HLNA 3R01A 1DM2A 2C3JA 3VS7A 1Y6AA 2HCKA 3JVSA 4ASZA 4CQGA 3M11A 4FKPA 2W4KA 5CEKA 3QQLA 4XS2A 3BYUA 2B0QA 3VN9A 4MXXA 2B53A 3R7GA 4O21A 2XYUA 3NCGA 5LVLA 2VO7A 2XM9A 3V8WA 4K77A 4HPTE 4I3ZA 4USFA 5KHWA 5LARA 5A4EA 3R21A 1PXLA 1H00A 3C4WA 3FYJX 1FMOE 1Q24A 2RG6A 3ZLYA 4DGGA 2O8YA 2QHMA 3C13A 4ASDA 5JEBA 2VGOA 5GJGA 4BKZA 1GZKA 3AC2A 3I6WA 2Y6MA 4RFZA 3HRFA 2CCHA 2R9SA 3HRBA 3R9RA 1W8CA 2RFEA 3KMUA 4YHTA 2V22A 3WYXA 4BBEA 4J8MA 4E6QA 3F61A 4JAIA 4YJQA 3HV6A 1J91A 1O6KA 4AN2A 2AC3A 2YACA 1H1RA 4XBRA 5BYLA 2ITYA 3MA6A 2CN8A 4EH4A 1YDRE 4EHGA 4EJNA 3OWJA 3A99A 4KS8A 4XX9A 4ZTQA 1MQ4A 3R02A 2ERZE 3OEFX 5IQEA 2C6LA 5L2TA 3OWPA 1Q97A 2FSOX 5AR4A 3F82A 3C4ZA 4AXAA 2R3QA 4UZHA 5CU4A 5D10A 4W4YA 3HUCA 3KCFA 2Q0NA 3ORMA 5L8JA 4PDYA 4IFCA 1GIJA 3DPKA 3WE4A 3DKGA 4W4XA 2OFVA 2X4FA 1A06A 5J9ZA 3POZA 4FGRA 4CG8A 2FSTX 3PXKA 4QYEA 2VWYA 3LQ8A 5KMIA 1RDQE 3BHVA 4EBWA 5J87A 4USEA 3F3TA 5TF9A 2XUUA 1HCKA 1PXNA 3KL8A 3E92A 5JFSA 1OL7A 1H0VA 4P90A 3GU4A 3PVBA 4Y46A 4ZY6A 1LUFA 2HIWA 1FVRA
chains in the Genus database with same CATH superfamily
1VYZA 3PRFA 1K2PA 3ZO2A 3BLAA 2BRMA 2GS7A 3OXZA 3AMAA 3F9NA 3OXIA 5J1VA 4XG7A 4IZ7A 4E93A 3Q2MA 2GS2A 2W1HA 1XH7A 2YEXA 4FG9A 4CFUA 2IZRA 3CIKA 2XRWA 2NPQA 2W5BA 3ALNA 4CZTA 2XBAA 3KRLA 3IK3A 5CAQA 3ULZA 2VRXA 1A9UA 4ANQA 4E6CA 5GIPE 1ZWSA 2VUWA 5CEIA 4BIDA 4C4EA 5ANKA 4HVHA 4C59A 4D1SA 4I24A 2OJIA 4EK6A 3MY1A 3FPQA 3U8WA 5C8MA 4O2PA 4AU8A 5IISA 3MBLA 4ZAUA 1I09A 4QP1A 4DEGA 3G51A 4LYNA 4D2VA 2QOQA 3ZEWA 2X0GA 4C8BA 2NYAA 4ZEGA 2B9FA 4CT2A 5H9BA 3BE9A 2WMRA 3PXQA 3Q96A 3P79A 3EFLA 3UDSA 3SXRA 1ND4A 4HOKA 1Y91A 3UQGA 4F9YA 4ZJIA 4X3FC 4QNAA 4C61A 4YNEA 3CQEA 3IGOA 4ZTLA 4UXLA 4Z55A 4BCNA 2UVXA 2GPHA 2F2UA 3COKA 3V5PA 2WU7A 5K4JA 2X0PA 4G2FA 5K3YA 4EOIA 2WKMA 4LV7A 5A3XA 5M07A 5GIOE 3LLTA 4K9YA 5CEQA 4AF3A 1GZNA 4APCA 4U81A 2PVHA 5LCJA 3RPYA 2WOUA 4M69A 5E8TA 3ROYA 2PK9A 3WF9A 2ITVA 1M7NA 4U97A 4UEUA 2R0IA 1OVEA 3ZO4A 4E5AX 5HU3A 3PXRA 3IW6A 4TWOA 3W1FA 1OBDA 3QRUA 5M44A 3AKLA 4ZXTA 2XS0A 3HV3A 3V5WA 4BZDA 3LKMA 4GH2A 4C3FA 3PJCA 4C4HA 2QHNA 1V0PA 2V7AA 3Q53A 5JH6A 4C33A 4PQNA 2R3MA 1UNHA 1KSWA 4P4CA 3ZBFA 4E20A 1GZOA 2QOBA 2WTKB 2E9NA 5DIAA 4D5HA 3U51A 3RI1A 3ML1A 2HENA 4XV9A 3F3VA 3QTXA 4FTTA 2KULA 3SVVA 4ZLYA 4H58A 2PZIA 5F9EA 1JKTA 4G3CA 4BRXA 1XMMA 2R3OA 1TQPA 4FIEA 4EC9A 4NH1A 3ODYX 4KRCA 4FTCA 4FV4A 2ESMA 2IG7A 4ITJA 3C51A 4TWPA 3I5NA 3JY0A 5CSPA 5FEQA 3N9XA 5FRIA 5JRQA 4DBNA 4DDGA 3K3JA 4QYGA 3UG2A 2PZPA 3JR1A 4A9UA 2F9GA 5GZAA 3PIZA 2JC6A 4QNYA 3BWJA 3RM7A 2VX3A 2VTQA 4B8MA 4EYJA 4L52A 5C1QB 3WE8A 5C26A 1H1SA 4LOQA 5ACBC 3UC3A 3COIA 4FSMA 2KTYA 2X0OA 3ANQA 4IM0A 4RIWB 1KV2A 4RVKA 4EH7A 4EOLA 2EVAA 1CTPE 3F2NA 3LCOA 4L53A 1OIRA 2X2MA 2ZV7A 3COMA 2IVSA 4KKHA 3TNIA 5A4CA 5CVFA 5D9HA 3F7WA 3UQFA 3TACA 2UZLA 4KS7A 4D28A 2WXVA 4RFMA 4F1MA 3FMEA 1KUTA 3AC4A 4MUQA 2C6KA 4FUYA 4I6QA 4ZSGA 2WMWA 1PY5A 4BWKA 4JLCA 3ZOSA 3BI6A 3BV2A 4OLIA 3ZC5A 3DJ5A 4WBOA 3GQLA 3QKMA 3QRTA 3T9IA 4ANBA 5KMOA 4DF3A 3F66A 4YZ9A 3DJ6A 1Z57A 2ITPA 5AM7A 3ODZX 3W0RA 2F4JA 2DWBA 1XH6A 4JOAA 4MXCA 4R7IA 5A9UA 4YBKA 3PP1A 2J9MA 3DGKA 3OMVA 3ORTA 4ZP5A 4BWPA 5EDPA 5EH0A 2GNJA 4FL3A 4I21A 3ZEPA 3LZBA 3R83A 4BI0A 5AEPA 5JGAA 3WARA 4F0FA 3LFCA 4Y72A 2J6MA 3RAWA 3DQXA 3PXFA 2VU3A 2CNVA 2FH9A 5AR3A 3R1QA 4L42A 4FYNA 3FE3A 3IW8A 3S2PA 3DY7A 3HA8A 4M69B 4WHZA 1LPUA 4CFWA 4ZIMA 4PPAA 4BDBA 1QMZA 1PXJA 1VZOA 2JFMA 1FINA 3NAYA 3Q52A 2AEGA 3OBGA 3SA0A 1FPUA 3LFSA 4PP9A 2Y4IB 5IA2A 5AUZA 1OGYA 4PDPA 1OPKA 5HQ0A 4IVCA 4PL4A 2OIBA 3MPMA 5DMZA 4BTJA 3P7CA 3E3BX 3MSSA 4EI4A 3EFWA 3TDWA 4G3FA 3MVHA 3HMOA 5DOSA 4EQMA 1JLUE 5LXMA 3QA8A 4TYIA 1RJBA 2WOTA 4FG7A 3QZGA 4B9DA 4FT0A 3HV7A 4UBAA 2YISA 3F7ZA 3QA0A 4CMTA 3PE2A 4JR3A 3F5GA 2B4SB 1REKA 4FT3A 3KU2A 4PPCA 3GFEA 5HIDA 3SHEA 4JMQA 3DU8A 4HGSA 4ZTNA 3RBWA 4RBLA 3UO6A 4BDHA 2O64A 3GGFA 4YR8A 1WBTA 4G9RA 4I94A 4M67A 3FZTA 2SRCA 4HGLA 3OCBA 2ZV9A 3P5KA 4RX7A 4F4PA 2HW7A 2PTKA 1UWJA 3FLSA 5B0XA 2XIZA 3NW5A 3O96A 3OW4A 4S2ZA 4ZSJA 3ZC6A 1P2AA 4AXDA 2XK4A 2ZV2A 5ANGA 2WNTA 4AT5A 1KE5A 5TE0A 5E8YA 4EJ7A 4MWIA 2Z7LA 2ETKA 4FKIA 5BVKA 3TZ8A 4R8QA 1WAKA 3D0EA 3DDPA 4I93A 1ERKA 1QPEA 5EW9A 2C5OA 5FTQA 5LOHA 5EM5A 3C5IA 3QQFA 1Q61A 3SKCA 2GNHA 4LV8A 1KE9A 2ZMCA 4I5CA 2OXYA 2XNEA 5AFVA 2OXXA 4XEYA 4ERWA 3JYAA 3OROA 4OTPA 3V51A 3KXZA 1PW2A 2Z60A 3BBTB 4ZZMA 5IUGA 4BCIA 3PFYA 2ZJWA 3WI6A 1CKPA 2YERA 4BGGA 4C3RA 2VTNA 5ANJA 4EOSA 3P78A 1ZY4A 3TWJA 4ZSAA 4O7SA 1JAMA 4FKJA 4X2JA 1UWHA 2CCIA 4OTIA 5AV1A 5B2KA 1WVWA 4E26A 2ZV8A 3DA6A 5M55A 4N0SA 5J7BA 3L8XA 5E8VA 2R7BA 4M66A 2XKCA 3FYKX 4PP7A 2ZM4A 1E9HA 4OTQA 4TY1A 2AC5A 1YQJA 4AN3A 4DEHA 4P7EA 5C03A 2PY3A 2G2IA 3RNYA 1W2CA 5EM6A 3KRXA 4L67A 4NJDA 4BN1A 4MHAA 2C3IB 4F6UA 3HMMA 4BBMA 3A4PA 1Y8GA 5AX3A 3REPA 1STCE 2ZYBA 4BHZA 3W2QA 3FV8A 4OTHA 4LMUA 5D7AA 3KRWA 2VTRA 2GHGA 3ELJA 4I22A 4X0MA 4FTJA 2Z2WA 3VS0A 4D1ZA 3V5QA 3PUPA 3RK5A 2CGXA 1KWPA 4FKTA 4IJ9A 2PMOX 3FXZA 2E2BA 4MF1A 4O4CA 2E9OA 4HZSA 4FTMA 5TKDA 2EXCX 5HOAA 1YOLA 3HZTA 4RC2A 5AP1A 5ICPA 2WO6A 5A14A 1M52A 1OPJA 2UZWE 3UO5A 3LJ1A 2LGCA 3QX2A 3E87A 1CKIA 4V0GA 3PJ8A 1WCCA 2PVLA 5E8SA 3DTWA 3RWQA 2V7OA 2VTJA 4FOBA 4A9YA 5A46A 4WD5A 3NIEA 3RNIA 5GHVA 3UMXA 3GCUA 5IF1A 1FGIA 1HOWA 2JDVA 3O8PA 2BIYA 2F7XE 2VWVA 1ZAOA 3FQEA 3QWJA 3LFQA 4FOCA 4GG5A 3QWKA 4MNEA 2I6LA 5FP6A 5KCVA 4C4GA 4IEBA 3I0QA 3MIAA 2JDRA 4DHJA 3QTSA 5BVEA 4B4LA 3E7OA 4BYJA 4OBOA 1OIUA 3ACKA 3H4JA 4QMLA 4L3JA 3GOPA 3E5AA 2BCJA 3VW6A 4RJ5A 3DJ7A 4FNZA 3TZ9A 4IHPA 2QLUA 4TWCA 5AP4A 5EG3A 5DVRA 2P33A 2XP2A 4HCVA 4E3CA 5HCXA 3B2WA 1ZY5A 1TZDA 4ITHA 4C4FA 2XIRA 1ZMWA 3GCSA 4RC4A 4USDA 4M97A 4XG4A 1URCA 2E9VA 5AMNA 4BVUA 4EBVA 5GJDA 4YPSA 4YLKA 2ZAZA 2C47A 4UB7A 4EH2A 4JG8A 4QYYA 5L2QA 3V01A 4QRCA 4BB4A 4OAUC 2FUMA 3MS9A 4WBBB 4J71A 2I0HA 4L43A 5KMKA 4PTEA 5CVGA 3C4XA 4J52A 1SVGA 4NFMA 3TNPC 1YI4A 2UW8A 2YLFA 3ORPA 4HVIA 5DRDA 4FKLA 4C4JA 4AGDA 2WFYA 4RC3A 4JDIA 4H3BA 4PV0A 2C6OA 3DLSA 3FLZA 4N70A 4ZJVA 3ORIA 3CC6A 1ZMVA 4GW8A 3RPSA 5HBHA 5FLFA 3LCDA 4O6EA 2W1EA 3K5VA 5CU0A 3P0MA 4FNXA 4WO5A 3V5TA 4AN9A 3PXYA 3R28A 3RZFA 4FSQA 1V0OA 3W10A 3UNKA 1A48A 2QC6A 1WBSA 3NR9A 4PY1A 3TV4A 1SYKA 2WHBA 3CEKA 5KX8A 3DKCA 4CRLA 4K0YA 2HY81 3MB6A 4LDTA 4G6OA 3DBFA 3UOHA 2WB8A 1PF8A 3MFUA 4M3QA 3K54A 3KGAA 3RHXA 3CGFA 2W5AA 4F9AA 5H2UA 2GNLA 3EOCA 4M68A 4E5WA 3TZMA 3A4OX 4YLLA 4D4RA 5G6VA 3FY0A 2NNWB 5D41A 4Y73A 3VWAA 3ET7A 4NW5A 3FAAA 5IQHA 4RT7A 1IA8A 2XH5A 5F1ZA 5FG8A 4YNOA 4O91A 5CU2A 1Y57A 4AZSA 4FSZA 4X2KA 2B7AA 2OG8A 3HGKA 4V0GB 5ANOA 3UP7A 2W1GA 2XYNA 3D5VA 3FZ1A 2BAQA 2J0JA 4NJ3A 2R3IA 4ZOGA 4B99A 2VTMA 2B1PA 1OECA 3EIDA 3G33A 4GV1A 4C37A 4EOQA 4MNEB 2O3PA 4M84A 1OL2A 3GC8A 3ZS5A 1UA2A 3IDBA 3BHYA 2IVUA 2RFSA 4KD1A 3LFAA 4L3LA 2J0IA 4O7WA 4Z16A 5I3RA 4AE6A 4HNIA 5AJQA 3DBEA 4IADA 4R5YA 5CTPA 3DXQA 1ZARA 4YHFA 4TN6A 4CD0A 5ANEA 4JI9A 3BQCA 4YZNA 1KE6A 5DE2A 4FSWA 2OIQA 3THBA 1UV5A 3UZTA 5I4NA 4FV2A 4CCUA 4EK8A 5FEEA 2QO9A 5B2MA 5CF4A 5FDXA 3TUBA 3DOGA 3FKNA 4IWQA 5ETFA 3LM5A 3WF6A 3OCGA 4CFMA 2QG7A 2GDOA 2F7EE 3P23A 3QRKA 4BCMA 4CYJA 3V5JA 3UPXA 4GVAA 4IWOA 4QDEA 3Q5ZA 2Y6OA 1KE7A 3CJFA 3FMKA 3AC5A 3UOKA 5CZHA 2B9HA 4O7NA 2UUEA 1OKZA 3BU3A 3QQGA 4H1JA 4I4FA 5FM3A 4ANLA 2BDJA 2I40A 4H3QA 5AUVA 2B54A 5IH4A 2BFXA 2VN9A 4OAVB 3Q2JA 5BUIA 2P2HA 3CPBA 4K1BA 4QP8A 1Q8ZA 2WMSA 4NKAA 4UMQA 4F09A 2J7TA 1K9AA 3GC0A 3SDJA 2XMYA 3GI3A 4O0UA 1OKYA 3AXWA 2PSQA 4YHJA 2CDZA 2GMXA 4MVFA 4CVAA 4D0XA 4HW7A 2I7QA 2ZFYA 3PPJA 1J1CA 1ZYSA 4RWLA 3ZXTA 3BLQA 3OBJA 4X2GA 3HVCA 4AFEA 3W8QA 3SV0A 4ALVA 4S31A 4PDOA 4HVDA 1YXTA 2UZNA 4WRSA 2G15A 2C5XA 3R63A 4MX9A 4XV3A 5L8KA 2VWUA 4PF4A 4OUCA 4GKIA 5IQAA 4F6WA 1Y6BA 3Q9ZA 4IANA 5EKNA 4O4EA 4XJ0A 4EOOA 3CPCA 2X4ZA 2XB7A 3D14A 4FKSA 2Z8CA 5DN3A 5M09A 4FKRA 3MTLA 4OW8A 4G16A 4X3JA 3PFQA 4CMUA 5H3QA 3OY3A 4TYEA 2QQ7A 3AKKA 5AV4A 2RIOA 4FRFA 3CLYA 2O63A 2XIYA 3ZYAA 3ZLWA 4ANSA 2QU6A 2IW9A 4JBPA 3R04A 2NO3A 3OF0A 2UZOA 1CSNA 3R2YA 4MF0A 1V0BA 5KO1A 4PPBA 3LMHA 4QMWA 4UY9A 2C5YA 4J95A 1J7LA 3NUSA 4IXPA 3OWKA 5HIEA 4IIRA 4DAWA 4FX3A 2HZNA 2ZM3A 4QTBA 3VUGA 1YDTE 4DFBA 3Q4TA 2C6DA 3VVHA 4QDVA 5D11A 3LQ3A 1OMWA 2ITTA 4FT7A 2F49A 4MNFA 4C38A 4DCAA 3CBLA 4DH5A 5J7HA 5K0XA 3L9MA 4FNYA 4AGUA 2XA4A 2OF2A 4IB0A 3UVPA 2OH0E 3GCPA 4R3PA 5IEVA 2YCFA 2JAVA 3GUBA 4AGCA 2VNYA 3A62A 3ALOA 3M42A 4DH3A 1TQMA 1OKWA 3W2OA 1Q5KA 4PL3A 3B8QA 3DNEA 1BI8A 2NRUA 2XNMA 5CEOA 2ZB1A 4BDIA 1KE8A 2XZSA 3CKXA 3NUAA 4KSQA 3P1AA 4Y8DA 4PTGA 3W8LA 1UU9A 3CS9A 1P4OA 4QTDA 3QQKA 4FF8A 3W2SA 1H08A 1NXKA 2WTVA 3EJ1A 3ZSGA 5F4NA 5CLPA 1MRYA 5LVPA 2C1BA 4QD6A 1JWHA 2RSVA 3TKHA 4O7ZA 4U5JA 5FXQA 3N4TA 4WUNA 4O1OA 3UGCA 4RJ6A 5DA3A 3FI3A 3OT8A 4LGGA 4WG3A 5HIBA 4E5BA 1MRVA 5I9VA 5J5SA 4FTLA 3ZM9A 4M13A 3POOA 4L68A 3MA3A 3WOWA 3PPZA 2PL0A 3CE3A 3UODA 3BHUA 5HVJA 4DEAA 4LI5A 3S00A 3FWQA 4X21A 5DPVA 2GCDA 2H34A 4XCUA 3HA6A 2RL5A 4KIKA 1Q8WA 3PA4A 4RA5A 2PMIA 3TJDA 4QMPA 1YXVA 4FTKA 4U8ZA 4PWNA 5A6NA 3FKOA 2WEVA 3KXMA 2JEDA 3RWPA 5L8LA 4L8MA 3EH9A 4CRSA 1YDSE 2VTTA 3KRRA 2IZUA 3I1AA 1G8AA 4IWDA 3C0IA 1OIQA 3MH3A 1YKRA 5H8BA 3AD5A 2PVYA 3NDMA 2LAVA 3UDTA 4BKYA 3KB7A 4BBFA 5BNJA 3PDTA 3PSDA 4CTCA 2QOIA 3MYGA 4FC0A 4O22A 3T8OA 2O0UA 3HV4A 3EYHA 1WMKA 3LAUA 2VD5A 5L6PA 4JT3A 3C7QA 4EK4A 4ZY4A 3SC1A 3DNDA 1OL6A 4NM0A 2Z7QA 4JDJA 4NEUA 3KXNA 3RCDA 4DHFA 3N4VA 2YWPA 3I5ZA 5JZNA 4R3CA 2Y8OA 5F94A 2UW9A 3ZM4A 4DITA 2QOLA 4AE9A 4O0SA 1SNXA 3MY5A 4L01A 1IG1A 3D4QA 3IG7A 4EQUA 4F08A 2OJGA 4YPDA 3B8RA 2FVDA 1M14A 4E8AA 3JPVA 3QC4A 3PVWA 5EOBA 2XNGA 5A4TA 3AC3A 1Q8UA 3QTRA 2WMXA 3IS5A 3LFFA 3PRIA 1JSTA 1WBOA 3FMNA 1UU8A 1T46A 2ZVAA 4FI1A 4RSSA 4TT7A 3BELA 4TYGA 3ZH8A 4ACGA 2W4JA 4XOYA 4FZ6A 3DXPA 4ARKA 2GHMA 4KWPA 3F3ZA 5TR6A 3DTCA 2P55A 3EYGA 3SW7A 1I44A 1CM8A 4BWXA 1W2FA 3QGWA 3W0PA 3EN9A 3WF5A 4EOJA 4C35A 4L7SA 4WNOA 1JKLA 5LWMA 2UW6A 2PULA 1H25A 3FLWA 3KEXA 4IMYA 2W7XA 2JKKA 3EN6A 3ZZEA 4DGLC 3ZDUA 3AT2A 4AA0A 4KBCA 4FKWA 4KKEA 4RLKA 4EL9A 4ZTMA 1XBBA 2O2UA 3LHJA 4RIWA 3WILA 1XMLA 5M06A 3DK3A 1YW2A 2J0MB 1XKKA 5KUPA 4M0ZA 5C01A 1U5QA 2FGIA 3AC1A 4ANOA 5KMLA 3TTIA 3TIYA 5L2SA 5EHOA 4FA2A 3FEGA 2W1CA 3OOGA 4S33A 3EB0A 4DFZE 3H0ZA 3RPRA 4FZDB 1APME 5HE1A 3TMOA 4WNKA 4KIKB 2X8IA 4LMNA 4APPA 3VRZA 3A8WA 4CKJA 5EYDA 3AD4A 3HMIA 3O17A 2OBJA 4A06A 3PJ3A 4O0WA 3KULA 2PVNA 5B2LA 3G6GA 5AUTA 4NK9A 2OIDA 4AAYA 3VS5A 4V05A 1UU3A 2V0DA 5E90A 5EFQA 3JXWA 4LG4A 3FMDA 3P9JA 3EZRA 4N6ZA 3GENA 4V01A 4ZMEA 4IB3A 2BDFA 3I4BA 3ZLSA 3PPKA 4XG8A 3QRIA 3FHIA 1KOAA 1CDKA 5AUXA 2GNFA 4UX9A 4DG0E 1W7HA 4UMRA 4WUAA 4QMSA 3C4FA 1U5RA 4I0TA 1QPDA 2R3FA 4NIFB 4AZWA 5M4UA 4YJNA 5HORA 3FLYA 2IVVA 4JBOA 5FQDC 5FWKK 5LWNA 4I6FA 5CT7A 3KKVA 1XH5A 2BIKB 4K8AA 4ZZNA 2R5TA 3LVPA 2BZJA 2XCHA 5BVOA 5AAEA 4CFXA 2W1ZA 3ORXA 2QR7A 3EQDA 5HX8A 4QTAA 1XO2B 4Z7HA 3NRMA 3GVUA 5HZNA 5IA0A 5DGZA 1PRYA 5CAPA 3LPBA 1OBGA 4E4MA 1S9IA 5DR9A 2FO0A 2VO6A 2X9FA 1J7IA 3A7IA 4PDSA 3SX9A 4I5PA 4ACDA 2X39A 3KXHA 1SVHA 5IQCA 2BR1A 3NX8A 5CVHA 1BL7A 3ANRA 1J7UA 1UKHA 3UMWA 3VQHA 4UMPA 1OL5A 1WVYA 1T45A 3QD2B 4F9CA 1G8KA 3GU5A 4G5JA 3LXNA 2OU7A 4RZVA 4FEVA 4TTHB 4LL5A 4O4FA 3EN5A 1DI8A 4BGHA 3H9RA 5CXZA 3K3IA 4FSRA 3HAMA 2C6MA 3CTJA 5CSXA 5CALA 5DEYA 5CAVA 5HTBA 3BLRA 4NCTC 4NWMA 4FTUA 4CQEA 1YI6A 4FSTA 2C3LA 5K0KA 3U9CA 5EI8A 3A7FA 4JS8A 2WTWA 3OC1A 4L46A 4OT5A 4E7WA 4YJRA 1DI9A 4BCHA 4F70A 3NUPA 3SG9A 4TYJA 1XR1A 5DG5A 2XIXA 1XJDA 2Y7JA 4I4EA 2A98A 5CSVA 3D7ZA 2AUHA 4X3FA 3NVKI 3IPHA 3KULB 4MBJA 4MD9E 4O6LA 2VZ6A 3BYSA 3R7EA 3CSVA 3FC2A 3O8UA 4TWNA 5AV2A 2ITWA 2O65A 3RZBA 2F7ZE 4QQJA 2JKMA 4CLJA 3UTOA 3JS2A 4QPSA 4FT9A 3VULA 5FUTA 4P2KA 1DAYA 1IEPA 3C0HA 4CCBA 4S32A 3UYTA 5TOZA 3ZRKA 4E4XA 5EHLA 4DG2E 2CJMA 5T6KA 2XNOA 1OPLA 3PY0A 2OF4A 5CEPA 3S1HA 3MH0A 5FD2A 4C34A 2CKOA 4YC3A 4DFUA 3VUKA 3R22A 5AUYA 3EQHA 3ORNA 5AX9A 4E4NA 3Q32A 4LUDA 5J9YA 5BV3A 2WMAA 4C3PA 2C6EA 4D1XA 4FV5A 3I7CA 2OGVA 4LRKA 3BWFA 2NP8A 3F88A 3QQHA 5AUUA 2HWPA 4FODA 2VWZA 3MJ1A 4RJ7A 1GAGA 1GIIA 4JL9A 4FSNA 1BL6A 3ROCA 4GUEA 5GINE 3QCQA 4FVRA 3WZUA 4BF2A 3F69A 1VYWA 2W1IA 3KF4A 5EDQA 5CANA 2CKPA 4FV7A 3OW3A 3A7JA 5HD7A 4DDIA 4TXCA 3LXPA 3II5A 4L3PA 3H30A 3GP0A 1FOTA 3G9NA 3MV5A 3I79A 3P4KA 3QKLA 4HCTA 1MUOA 4FBXA 4KIQA 3ZZWA 5I9WA 4O7LA 4AQKA 4JIAA 4EHEA 1WBWA 3AT3A 5JFVA 4MK0A 1YOJA 2PE0A 4U43A 1OITA 4O82A 3A2CA 4U45A 5L4QA 5F20A 1JKKA 2YIYA 5EYMA 3KQ7A 4YJOA 4B0GA 2Y0AA 3KXXA 2C0OA 3GFWA 3OCTA 4BCQA 3EFKA 4D9TA 3LOKA 4FG8A 1WVXA 1GZ8A 4BL1A 1W98A 5E8UA 3D7TA 2FSMX 3LXKA 1M2PA 4G5PA 4FTNA 2B9IA 2C5NA 4QPMA 3ZSIA 4BY9E 4JX3A 3NUXA 1GIHA 4YZBA 4DT9A 3TL8A 3LCTA 4AW0A 4WIHA 4MBIA 4F7LA 4BHNA 4O0VA 4QMTA 1U59A 1PMVA 3FSFA 1BYGA 4UALA 5FTGA 4TZRA 2A2AA 4FIHA 4GT4A 4JX7A 5HVYA 3UBDA 3NNXA 3VIDA 3ZUVA 4F7NA 3FXWA 4FEXA 3RTPA 4MCVA 3PIXA 3ZRLA 2VTHA 1M2RA 3Q4UA 2XJ1A 4JRNA 4P5QA 2CSNA 4DLJA 4GYIA 5CF8A 4C58A 5IQIA 4D2TA 4GFGA 3LFBA 3OP5A 2UW7A 2XK9A 4O0YA 4RJ3A 4R3RA 2PE2A 2BILB 2OK1A 3I7BA 4FV3A 3RPVA 5IA4A 3EQCA 3TNWA 4X7QA 4H1MA 4UWBA 4G1WA 3MPTA 4O81A 4X3FB 4GT5A 3Q6UA 3EWHA 2OW3A 3QQUA 3GC7A 4IBMA 4CXAA 3CY2A 2GS6A 2IW8A 3DS6A 4GMYA 5IH5A 4DCEA 4I23A 1Q3DA 3O8TA 2BTSA 3VUMA 5CI6A 5CF5A 4Y5HA 5IQDA 2J5FA 4C0TA 2HOGA 4C7TA 4FTIA 4F6SA 3QTWA 2YM8A 3D94A 4DYMA 2ZOQA 3FC1X 2WMBA 4UMTA 4I41A 2PE1A 4EUUA 3RK9A 3UDZA 3SRVB 5IKWA 4DTKA 3NYOA 3VJNA 5IQFA 3CD8A 4XNEA 3U87A 3ZXZA 4L9IA 4ZK5A 2R64A 2JBPA 4FKGA 1R3CA 2BRGA 2HY0A 2ZDUA 1ZOGA 4FV9A 2C5VA 5D1JA 5EM7A 5FEDA 4EH3A 4QMQA 4EORA 4K33A 2BHEA 2UW3A 3AMBA 3JUHA 4HZRA 3N51A 3MJ2A 4DFYA 4RX5A 3RPOA 3DZQA 4YURA 3HDNA 3G15A 4Z3VA 4TL0A 1Q62A 3IW5A 1O6LA 4QPAA 4RFYA 3AT4A 5IU2A 5FXSA 4F65A 3KIOC 2VX1A 3Q04A 5M4IA 5E8ZA 2X8DA 2R7IA 1RQQA 4BGQA 4O7VA 5LVOA 4DT8A 4AUAA 3ACJA 2UVZA 4GYGA 4M0YA 4AS0A 2UZEA 2YJSA 1NA7A 4HYIA 5HLWA 2IW6A 5ETCA 1IR3A 3FI8A 2J0KA 3EQRA 3KREA 2VGPA 4QMUA 3SAYA 5IA3A 3PTGA 5EQYA 3R8LA 4MKCA 3VHEA 5J1WA 4GUBA 3EKKA 1NVSA 4JDKA 4CKIA 2GFCA 3PG3A 5HESA 5I9YA 5A54A 1TKIA 3CKWA 3D7TB 2VTLA 3QGYA 4HYUA 4HJOA 4UWYA 3NW7A 4QP3A 4UYNA 5I5ZA 5KKRC 4I0SA 5ETAA 3V04A 1CMKE 4ACHA 5BPYA 5JQ8A 4IB5A 3K5UA 5HG5A 3PXZA 5JK3A 1TVOA 2CNUA 5J9LA 4OR5A 3U55A 3KY2A 5E1EA 2CGWA 3W0QA 2OJJA 3VUTA 3QHWA 5HHWA 4FGBA 2ITOA 3BYVA 3QTZA 2VTAA 4GL9A 1ZYLA 5D7VA 4B8LA 2J4ZA 4PMTA 2R0UA 2DS1A 4NYEA 3MIYA 1JSVA 1Z5MA 3HNGA 5AADA 2JKQA 4QP7A 4LRMA 4MQ1A 2JITA 4TNDA 5DWRA 4F99A 3BLHA 1SZMA 4J98A 3PYYA 1DAWA 2WMUA 3EMGA 4GT3A 5CU6A 4EONA 4QQTA 3DFCB 4O96A 1REJA 2BKKA 4RMZA 2XARA 1G5SA 4HYSA 1YVJA 2EU9A 4AAAA 1PXIA 3TDVA 2WELA 4NUSA 5EW8A 3VF9A 3QLFA 4EZ3A 3DDQA 4ALWA 1Z9XA 4FJVA 3GCVA 3E88A 4BDAA 5EW3A 4V04A 3MW1A 4LV5A 3UZRA 3WZEA 3TCPA 1BUHA 2R3PA 2J5EA 4GK2A 4XG3A 4AACA 2UZTA 5KE0A 3SXSA 2EWAA 4R6VA 5GNKA 4PMPA 2OWBA 4M12A 3HMPA 5J95A 3VHKA 4GVJA 5A4QA 3BEAA 4U6RA 1W0XC