3RCJA

Rapid preparation of triazolyl substituted nh-heterocyclic kinase inhibitors via one-pot sonogashira coupling tms-deprotection cuaac sequence
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
282
structure length
281
Chain Sequence
b'KRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Rapid preparation of triazolyl substituted NH-heterocyclic kinase inhibitors via one-pot Sonogashira coupling-TMS-deprotection-CuAAC sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 83
structure length 281
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3rcjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3rcjA01
1JVPP 2X6EA 3G2FA 4ZSLA 2QQ7A 3E8CA 2WMUA 4CFUA 2OKRA 3QUPA 2YLFA 3GENA 3PUPA 4X2FA 4E7WA 2PSQA 4EORA 3LFCA 1PMEA 5M09A 3RALA 5CF5A 4BKZA 5HE2A 4E6AA 5AR8A 5FP5A 4CYJA 3NYOA 3IQ7A 3QTWA 4NCTA 3E87A 4MK0A 3GVUA 3LOKA 4B7TA 3LJ0A 3REPA 2ZV9A 2BDWA 3RINA 4LL5A 4HW7A 3QC4A 4JAIA 4YJNA 4L9IA 4AG8A 5CEMA 4TYIA 3NYNA 3QD3A 4LUDA 3PA3A 3BPRA 2GCDA 5IQGA 3P7CA 4O0TA 3DKGA 5GZ8A 4M7IA 5IISA 1UWHA 4CVAA 5K5NA 4DTAA 2R2PA 4HYHA 1OGUA 4UMQA 4G6LA 5FEQA 3QQGA 3F3TA 3RM6A 2CCIA 2JDTA 2RG6A 4XOYA 5L3AA 4QP2A 2IN6A 3G9NA 3LW0A 5FM3A 3WZUA 4PMSA 2ZV8A 3SC1A 4BIEA 4Z3VA 1QPCA 3AD6A 1JWHA 2V62A 4USDA 2WIHA 4OW8A 3O50A 3GC9A 3W8QA 1U4DA 1WBVA 3CGOA 4FTAA 4UBAA 1X8BA 4YBKA 3P0MA 4KIOA 5EI6A 5FEDA 4AXAA 5BUEA 5HLNA 3BYMA 3LFQA 4G3GA 3NUSA 5TOZA 4GUBA 4GW8A 5IA1A 1YWVA 2UW0A 1DI9A 2YCQA 2GNIA 3OWKA 4XG8A 2UW7A 2PULA 4WUNA 3ZYAA 3FKOA 2YWVA 1H0VA 2P2IA 4G9CA 4XYFA 2YJSA 4DN5A 2IW6A 3C4CA 1MQBA 4YMJA 3GFEA 4LRMA 1RW8A 2BIKB 1BLXA 2R5TA 2W99B 2IZUA 2VX0A 3CPBA 3HZTA 3BRBA 2H34A 4S34A 3WF7A 4F63A 4IM3A 5T68A 3F6XA 4MH7A 4PDYA 5HCYA 2YIQA 3LJ2A 4QMQA 3FDNA 4NUSA 3L1SA 2HWOA 5FBOA 2QKRA 3E3BX 3FZTA 3QALE 4ANSA 4DG0E 2C69A 5FWKK 2J0MB 5EHLA 4DINA 4IZ7A 5HG9A 2OJFE 3K5UA 1ZMVA 4I6QA 3R7YA 5IDPA 3LJ1A 3U8WA 4DT8A 2XM9A 4AS0A 2HOGA 4OAVB 4BIDA 2VTRA 2C3JA 4TNDA 2UZNA 5JN2A 3BQCA 3V04A 1DS5A 5HNIX 3NNVA 3KULA 4Y85A 4QMNA 4ZZNA 2BRMA 4CQGA 5I9XA 2ONLC 1FVVA 5DI1A 2LAVA 4UWCA 5BVWA 3SV0A 4IM0A 4ZIMA 1H1SA 4F0GA 3GEQA 4F0FA 2W06A 3TV4A 5HD7A 4C4HA 2BKKA 5LXMA 3DNDA 2R3GA 3HV4A 3ANRA 3QRTA 4QD6A 4UMTA 3CKWA 4GFMA 5CZIA 5KMLA 4ZMEA 5A4EA 2J2IB 1URWA 2YACA 1WFCA 2YITA 1CM8A 4IWDA 1Q97A 4CXAA 1R3CA 5HHWA 2BDFA 4RVMA 2GS7A 4U81A 3MIYA 4YC8A 4BDEA 5CEKA 2UZTA 3O96A 5LMAA 2ITVA 4L6QA 1STCE 2V5QA 4AA0A 4IB5A 4JDJA 4UXQA 5E1SA 2WEVA 2CGUA 4ZTHA 4FEVA 2XNPA 4CRLA 1YKRA 4IZAA 5DR2A 2YIRA 5FP6A 3ULZA 4CFNA 3TN8A 1YW2A 3O2MA 2W9ZB 2QOBA 3DV3A 4C4EA 2J0IA 3ANQA 2O65A 3PY0A 2P55A 4P5ZA 4G5JA 4DFUA 4ZS4A 3A4OX 3BYUA 5HNGA 4HVHA 3LMGA 2PVRA 3ODZX 3DK6A 4JDHA 3PTGA 2HZIA 5A14A 5CU0A 2PL0A 3VS0A 2NP8A 5L6WL 3VULA 3KEXA 3VN9A 1V0PA 3QD4A 4PV0A 4PMMA 5KNJA 4A4LA 3PZEA 3DGKA 3CCNA 3TNPC 2CNQA 3U54A 5EDQA 4FSYA 4H3QA 4GKHA 5I5ZA 3IOKA 4EH3A 3H9OA 4ASEA 2W5AA 3NWWA 4I20A 3COMA 4L46A 4EH8A 4JL9A 4DITA 3QTUA 2C6IA 3P08A 2BFXA 4AFEA 5K4IA 3DA6A 4Y83A 5CU6A 5EI2A 3LAUA 4Q5HA 4A9RA 5A54A 4QMVA 5DEYA 3ZONA 5HG8A 4DEGA 3A7GA 3C4EA 4F7SA 1JSVA 3FI4A 4J7BA 2VD5A 4AGWA 1ZXEA 4EZ3A 3MFUA 2ITXA 3V51A 3VHKA 4XG9A 2WMAA 2XIXA 2WMXA 3GC0A 2HAKA 5HIDA 3AT2A 3RWPA 3WZDA 3U4UA 1G3NA 4XRJA 5BQ0A 3I1AA 2XKCA 3LQ8A 4QNYA 3QTXA 1M52A 3POOA 5K0XA 5KMOA 3QTRA 4K2RA 4EUTA 1ZOHA 4ZSEA 1ZRZA 4BR3A 2WMVA 3HV3A 5I3RA 2YAAA 2RF9A 4YGAA 3TV7A 3EQRA 4HZSA 2PWLA 4KAOA 3D94A 3HL7A 4A07A 3JY0A 4BTJA 1CMKE 3MIAA 4IMYA 5CALA 4DG2E 5C1QB 2VAGA 5IG1A 2V22A 3GCVA 2WKMA 3R2YA 5HORA 5EFQA 3ZMMA 3M1SA 1DAWA 1Z57A 3QL8A 3JR1A 4O0RA 3H10A 3I4BA 3W2OA 3NSZA 2EXCX 3MB7A 4M69B 3KREA 3CD8A 4ANLA 2W4OA 4KRDA 4UN0C 2YWPA 3DQWA 3RK5A 4BDHA 3N51A 4WRGA 4BCIA 4ANOA 4IC7A 3HAMA 4EJNA 1IRKA 5CSHA 4YNOA 4GU6A 3GQIA 4YZMA 5DEWA 3V5LA 4DLJA 5ACKA 3U87A 4IJPA 3LLAA 4FSNA 5CU4A 5IEXA 3PXYA 3OTUA 3Q04A 4QP4A 5KMNA 4FUYA 5LVOA 3IK3A 2GFSA 2JIVA 2VTIA 3WF5A 4CMTA 2WTWA 4NT4A 4C4JA 3EB0A 1J1CA 3RPSA 5HE1A 3EYGA 3FQHA 4LGGA 3IW4A 1KE5A 2Y7JA 3F82A 4G31A 2OIQA 3C5UA 2VNYA 3PXFA 4I6FA 5J8IA 2YLEA 5AP6A 3FMLA 1BYGA 1PW2A 5D7AA 3QF9A 5GJDA 3PSDA 4F7LA 4FMQA 5BVEA 3II5A 3PP0A 3DK7A 4C2WA 3LIJA 4JBPA 2BR1A 3UC4A 3UPXA 5ANGA 4O7RA 4TNBA 2W4KA 4IQ6A 4W4XA 4FIHA 5FD2A 5D1JA 2WMBA 4HYIA 4AZVA 4O1PA 3E8DA 2XIKA 3G9LX 1OL1A 2VX1A 4QYFA 3NX8A 5E7RA 2OSCA 4QTEA 2GTNA 3W18A 5IU2A 5KX8A 4QYYA 2C5NA 4FZ6A 4BY9E 4B8LA 2HWPA 3BX5A 4NTSA 3BWJA 3A99A 4PDOA 2KULA 2OI4X 3PPZA 5FM2A 3BU6A 2PUIA 2VTLA 3F61A 3HA6A 4ID7A 4GUEA 2XBAA 2YIWA 5M4FA 2ETMA 4GK2A 3QQFA 2ERZE 3BHYA 3RBWA 3UTOA 4F09A 1F0QA 5KO1A 2O0UA 4DC2A 1JKTA 2BZKB 5BUJA 1OBDA 3FLZA 2W0JA 1YRPA 1J7LA 3VIDA 4M13A 2P3GX 3R7VA 4I92A 1M17A 5AP4A 1P2AA 1PXOA 2CDZA 2CLQA 2OXXA 1E1XA 3VQHA 5IQFA 4E6QA 2RIOA 3FXZA 4Q9SA 5A4CA 3GNIB 4Z55A 2F49A 3ORIA 4XV2A 3WOWA 2GPHA 3BLQA 3K2LA 1PF8A 3ZEWA 3C50A 2VO7A 5ETFA 3L9MA 5AADA 3EQFA 3LXNA 4FZ7A 4AZTA 4BDFA 3NAYA 4IHPA 3F3UA 3OCGA 3FMJA 2OO8X 4CGAA 1M7QA 3EHAA 3LFAA 5KMIA 5DBXA 4AW2A 4KA3A 3KC3A 3MPTA 5HLPA 3V01A 1VZOA 5GHVA 3PP1A 4RA4A 3FMNA 5C26A 3BGQA 5CNNA 5ETCA 5DT4A 1GIHA 4XUFA 3OP5A 4DCEA 5E8WA 2X0GA 4HPUE 2UZLA 3D7TA 1OPLA 1JLUE 2R0UA 3HMMA 5HICA 5HTIA 3TM0A 4DT9A 3ZUUA 5DNRA 1PXPA 4MTAA 4L67A 2XKDA 3DQXA 4Y46A 4D1SA 2HW7A 3EKKA 5IA5A 3VUTA 4AE9A 3BYSA 4OTGA 4YJUA 5E4HA 3H3CA 4FSMA 3MVHA 4BZDA 3FWQA 3R22A 4F7NA 5HO7A 4IC8A 5AR5A 3KXHA 3QYZA 3EZRA 4ACHA 4I6HA 3TZ9A 5TE0A 2ZDTA 3C51A 5K9IA 1UVRA 3FLNC 4O81A 3NVKI 2CJMA 4IFCA 4WRSA 3DBCA 5K4JA 3QGWA 4TXCA 2W1ZA 3RHXA 5CASA 4TKSA 3F3VA 1GNGA 3ZRLA 1PXIA 4L3LA 4G6NA 3ULIA 2JKMA 4JDKA 5H8BA 3DB8A 4BF2A 2WTJA 2VX3A 5CI7A 2G2IA 5LMKC 4JQ8A 2I0HA 4YNEA 2XCHA 3ZZWA 4QP8A 3SLSA 4TWNA 3VBVA 4CCBA 4QYGA 2WOUA 3QXOA 4G3EA 3MWUA 1TQPA 4YZNA 2CCHA 1H25A 2NO3A 1PMNA 3B8QA 4FC0A 3ZOSA 4DA5A 1P4OA 4J8NA 2QR7A 4FX3A 2QVSE 3FL5A 4IX5A 5M55A 4KBAA 4D1XA 4G1WA 4M0YA 3UQFA 3OWPA 3G6GA 3UVPA 2CKPA 4LFIA 3QWJA 3MGYA 4R7HA 2WO6A 5EM6A 3N4TA 3E7OA 3D0EA 3VUIA 3PPJA 2ZB0A 4YO6A 2O3PA 2R3MA 4D0XA 3V5PA 3E62A 1RDQE 2BKZA 1I44A 3MV5A 3NYVA 2GNJA 3KF4A 3SRVB 4EHEA 4ZZOA 1FGKA 4IB3A 4EC8A 3AMBA 3FXXA 1OPJA 4FZDB 4E5AX 1H1RA 1J7IA 1NVSA 1YXTA 5HI2A 4QMPA 2HXLA 3HRFA 4QPAA 5FRIA 3PXQA 2WTKB 2R3RA 2BRBA 3EWHA 3BBTB 3BHVA 4PTCA 2YHVA 4RJ5A 3LQ5A 1KOAA 2CSNA 1JSUA 4G5PA 4FV0A 2YIXA 4O96A 4KUJA 3ZFXA 4FKIA 3K5VA 4D28A 4P4CA 3ZC6A 3BE2A 2OU7A 5CVFA 3W1FA 3KMUA 4O7LA 2JC6A 5TR6A 2B7AA 4E8AA 3UZPA 5IUGA 1KE9A 5FLFA 3GXLA 4BICA 3UMWA 2C4GA 5AP1A 1ZOEA 2X9FA 3PIYA 3VBWA 4FR4A 4DTKA 2QOQA 5L2IA 5EH0A 1O9UA 1FQ1B 4I4EA 1SVEA 2YDIA 3RCJA 2VWWA 4FYOA 5HVJA 3RTPA 5AV3A 3TZ8A 2R0IA 3KVWA 3ZUTA 4FTKA 3WZKA 4BZOA 2AUHA 2QODA 1A9UA 2W9FB 1FVTA 3LXPA 3TDWA 5A9UA 4O7TA 2FSTX 2O63A 4FTNA 2EU9A 4FZFB 2VO0A 4RWLA 4BN1A 3KRRA 4EONA 3F2RA 4BHZA 4E4LA 2W1EA 2F7EE 2I0EA 5CWZA 5HGIA 4EYMA 5H8EA 1BL7A 3FC1X 2R3OA 4P90A 5HBEA 2A19B 4FKUA 4FTMA 4G16A 3KK9A 5KMKA 2FSLX 3OCSA 3A7FA 2PVHA 3OXZA 4QMWA 4MWHA 3KRLA 5AV1A 4I0RA 4FTOA 3BEGA 5AR4A 5CAOA 3WI6A 4YTFA 4BCNA 2HY81 5HVKA 1KSWA 4F70A 1OKVA 4K11A 2OJ9A 3QTZA 3F7WA 4I21A 4I23A 4BDGA 4D2PA 3Q4ZA 4G9RA 4C02A 2HZ0A 2ITYA 3VWAA 4WUAA 2I7QA 4FL1A 4DGLC 3B2TA 4E26A 5AWMA 1IG1A 5HTCA 4I6BA 3G90X 5CI6A 1CTPE 3AC2A 4FGBA 3SKCA 4RJ3A 4AF3A 1ZYJA 3A61A 1WMKA 2XJ2A 4JXFA 4CT1A 3O71A 2XRWA 2BVAA 2IVSA 3MA3A 5BVDA 2Z02A 3UZRA 2DUVA 3QGYA 4BTFA 3BHUA 4WT6A 4UX9A 4K33A 4RT7A 1GIJA 3RNIA 2ITQA 3R7GA 1VEBA 1MP8A 3PZHA 4XLVA 5KBQA 4YC3A 4OAUC 4PX6A 2ZVAA 3TNWA 4WD5A 3ZO4A 5J1VA 3CR0A 4KD1A 4AZEA 3VRYA 3GOPA 3IGGA 3KMMA 3LM0A 3NS9A 3FL4A 3FYJX 3FV8A 3SD0A 2X7OA 3F3ZA 4IEBA 4UALA 5AIRA 3ERKA 5TO8A 5ITAA 4FTTA 4YHFA 3KY2A 2G01A 1OMWA 1YI4A 2UZWE 3EZVA 3ZU7A 2XK7A 3QHRA 4KB8A 2JKKA 3KRJA 4P5QA 4E6CA 5ANIA 4TWPA 3W2PA 4IX4A 4B6LA 1PHKA 3G15A 3M2WA 4Q2AA 2G2FA 3P7BA 4DEDA 3KGAA 5DVRA 5IZFA 3R9OA 4FSQA 3CXWA 4Y5HA 4FV7A 3BU3A 2FH9A 1PXNA 2C6OA 3EFWA 4E4XA 3QTQA 4K77A 2JDRA 5EQYA 4ERKA 3WYXA 3OROA 4R6VA 2YM4A 2H6DA 5FXQA 4J52A 3FMMA 1IEPA 4UZHA 3ZBXA 4YO4A 5G6VA 3ATTA 4YLKA 3QRIA 4FV2A 4DFBA 1Y91A 4C0TA 3BBWA 3H0ZA 3HECA 2BZIB 4Y73A 2QR8A 3MB6A 1K2PA 4ITJA 2RFNA 1SYKA 1MUOA 3MFSA 4EBVA 2XB7A 4YJSA 4ASZA 4Q9ZA 3DTCA 4ANQA 3Q9WA 2XK9A 4I5MA 4BDAA 2OJGA 1UNGA 1JBPE 3LE6A 4FTIA 5EYMA 2JDOA 4GKIA 3JYAA 4FL2A 4M69A 4O21A 4YLJA 2A4LA 2CHLA 4O0UA 2XZSA 4FTUA 2VU3A 5JFSA 4CFVA 1REJA 3DKOA 4QO9A 3C4WA 3PJ8A 5J5TA 1KV2A 5DGZA 1PYEA 2PZRA 3QRKA 4E4NA 5J1WA 2W1GA 5LWNA 2ETKA 1NA7A 1P5EA 4HZRA 3PDTA 4JG7A 1WCCA 3DBDA 3NNWA 4L3PA 3V6SA 3UNKA 2HELA 4U79A 3C9WA 3FLQA 5AX9A 5ANJA 2B9JA 4XP3A 2EXMA 3OC1A 1WAKA 4W9WA 4Y5QA 2Q83A 3SA0A 4U43A 5FUTA 5DFPA 1VR2A 4EH4A 3LXKA 2YZLA 4S32A 4RVKA 1PXLA 4HVSA 3ALNA 1H01A 4QRCA 4KBCA 3TNQB 4EHVA 2W7XA 2YCFA 4EZ5A 1A48A 2OG8A 3LFNA 1YVJA 2VTPA 4O7SA 4IX3A 3MH3A 3QLGA 1PY5A 1Q61A 3S4QA 4NW5A 5JK3A 5IPJA 3PVBA 3C0GA 3DK3A 4IDVA 5CYIA 1Q8ZA 3GGFA 2V55A 1YXUA 3PE1A 4P2KA 3ZUVA 3UZTA 3MY0A 3FYKX 2JIUA 3MSSA 5GINE 3A2CA 4NKSA 3LHJA 2Y4PA 3FPQA 3CS9A 3KXZA 3M42A 1XWSA 1UU9A 4FKWA 3V3VA 3A8XA 5A4LA 4EEVA 3GC8A 4LOOA 4BDBA 5IA3A 2ZB1A 4N70A 4TTHB 3NMUF 5B2KA 4HJOA 5E8YA 2OFUA 4QP6A 3AOXA 3EKNA 3KQ7A 3QX2A 4RG0A 5D41A 5EW9A 3C4FA 2A2AA 3PA4A 4CRSA 3NPCA 5CAPA 3KXXA 1S9IA 3T9TA 3SW7A 4JOAA 3HAVA 1H00A 5K3YA 3KRWA 3W32A 5BNJA 4LMNA 2UZOA 1M2QA 4UEUA 4ANBA 5AUXA 4BCOA 3AMAA 2YM3A 1UNHA 2VWYA 4APCA 1Y6BA 4GU9A 4OTQA 4HCUA 4I4FA 1UKIA 3UOJA 5BPYA 4EWQA 3VW6A 3VS4A 4WG3A 5EM5A 2BDJA 2GNFA 3RZFA 5HO6A 3U51A 2W5BA 2UVXA 3F5UA 3TZMA 2PVNA 3QBNA 2QO2A 4DH8A 4G3CA 4L7FA 2AC3A 4AE6A 1GAGA 1MQ4A 1VYZA 2IW9A 2A0CX 3SXFA 3EYHA 3CLYA 3D5WA 5ANOA 5AFVA 3PPKA 2X2LA 3TEIA 3R1NA 3HMIA 2Z2WA 4U45A 5EYKA 3THBA 3PVUA 3O8PA 4RQKA 5EQPA 2Z7RA 2IPXA 4RJ8A 2PU8A 3D14A 2B53A 4TT7A 2XNEA 4ZZMA 2VO6A 3E63A 4DLIA 2QOLA 3PXKA 5L8LA 4GV1A 3ZM9A 5F1ZA 1HCKA 3BV2A 5AR3A 2CGVA 2Y4IC 2QG5A 4H36A 5CSWA 2XNBA 4JBQA 3RWQA 3KN5A 2GSFA 2RFDA 2OWBA 2UW5A 4O6EA 1OUKA 2DQ7X 3E93A 4JRNA 3R9DA 4DEEA 3OUNB 3ORXA 3CJFA 1DI8A 5CSPA 2EVAA 3LPBA 2O8YA 5LWMA 2VWIA 3FMKA 1E9HA 4MD9E 2I40A 3MVMA 4EQUA 3DJ7A 3KRXA 3IKAA 4O7NA 1KE7A 5HBHA 3RPYA 3UYSA 3PSCA 3OWJA 4I22A 1ZY5A 3TIYA 3SG8A 4XHKB 4FOBA 3OOGA 4IBMA 3TDVA 1CKIA 3MTFA 4PRJA 3PLAE 1KE6A 3PJ1A 3BYVA 1W0XC 4ZLZA 5CF8A 1U5QA 3UIXA 2X7FA 4WO5A 2PMIA 3CTHA 4L68A 4ZK5A 4U9AA 1A06A 3R7IA 1YI6A 2DYLA 4BCHA 1M7NA 4OR5A 4QTDA 3SXRA 3NW5A 3BHTA 2E2BA 3TACA 2BZJA 2IVTA 5C8NA 2X81A 2JIIA 2XK8A 4MAOA 2WTVA 4O91A 4U40A 5DRBA 2C1AA 3B8RA 4EOKA 2IJMA 4YJQA 2IVUA 3H30A 1QCFA 2ACXA 4FSUA 4HGEA 4CTCA 4IXPA 3W2SA 4WSQA 3W2QA 4K18A 5B2LA 3DBQA 3FMEA 3ZLXA 3OW4A 4GRBA 1Q41A 4ANMA 3KL8A 4J98A 4EKLA 4QP1A 4A9SA 4HVDA 3Q5ZA 3UQGA 4MBIA 3V5WA 3DXNA 4K6ZA 3VBXA 4C2VA 3ZLYA 4MXAA 5GZ9A 3OBGA 5CSVA 5GIPE 4DYMA 5J87A 1YDTE 5E8UA 4LOQA 3DLZA 2XM8A 5L2WA 2WAJA 3I0QA 5GNKA 1LUFA 3CP9A 2GNLA 1J91A 4LGDA 1ZMWA 3VS6A 5HQ0A 3EMGA 3FHRA 2OICA 3SRVA 4OUCA 3T3UA 3RAIA 2QOHA 5HVYA 3OY1A 4C7TA 2WHBA 2X8DA 2VTTA 4OTHA 2WZJA 3QQHA 1REKA 2R3FA 3C7QA 3Q9YA 4KBKA 3DXPA 4QP9A 5A4TA 4IE9A 2H8HA 4X2KA 2FB8A 2R64A 4O6LA 3AC3A 3CQUA 4V0GB 4FVQA 4QMOA 4UYNA 5T3QA 3KMWA 3TUCA 3FBVA 3TKHA 4IVDA 3HMOA 3IW6A 3ZSGA 3EQGA 1XH9A 3DY7A 3UC3A 4IWOA 5M4CA 4NKAA 1GZKA 4DH5A 3FUPA 1Q8WA 3V5QA 2JEDA 4AWIA 4OTRA 4ONAA 3B2WA 2PE1A 2OH4A 4ALVA 4YU2A 1WZYA 4F65A 5KCVA 3DDPA 2J7TA 2QO9A 2GMXA 3EIDA 4JT3A 4AN3A 4D5KA 1YXXA 3CY2A 5I4NA 5KMMA 1XJDA 3U9NA 1YWRA 4O27B 5IMXA 4R77A 4EK6A 3TUBA 4EJ7A 5M07A 4GIHA 1IA8A 3EFLA 4KS8A 3BEAA 1W84A 2ZDUA 3NUPA 3A60A 4F6UA 3ZFYA 4UMUA 3MH0A 4FIIA 4KSPA 3R9RA 3LKMA 3FZPA 3LZBA 3QU0A 3IW7A 4FK6A 4GSBA 4N6YA 5K0KA 3VRZA 4AU8A 4LQMA 2XIYA 3S3IA 4PPAA 4HNFA 4P7EA 4PMTA 5H2UA 3T3VA 5CANA 3UODA 4NM0A 3GU7A 4BDDA 3WF9A 4OBQA 4USFA 3TNIA 3L9PA 4NSTA 4FKQA 4QPMA 4YZDA 3TI1A 3DB6A 1NVRA 3FJQE 4A4OA 2Y8OA 3HDMA 3E64A 4FSTA 3QKLA 4IB1A 3RM7A 2O64A 4X7QA 3RNYA 4AQCA 4EK8A 3NIEA 5JRQA 2AC5A 4E3CA 3UOHA 4RJ4A 4C33A 2O2UA 1M2RA 3DLSA 4D5HA 4PL3A 4IAYA 3UP7A 4ZJVA 3OCBA 4KINA 1O6LA 3ZH8A 4QTBA 4CLJA 4I41A 1G8AA 3R7UA 3DNEA 4NCTC 3H0YA 4X2GA 3KFAA 5IA2A 4GVJA 4KWPA 5BYLA 3HYHA 2W4JA 4NU1A 5I0BA 5AX3A 4TPTA 3QRUA 4FT7A 2SRCA 4AN2A 1JPAA 4RLLA 5FDXA 4D4RA 5CS6A 4O84A 2BILB 3AGMA 3Q2JA 5CF4A 2X8IA 4RRVA 4DGGA 2PYWA 2PVJA 1L8TA 2IVVA 4FKLA 5E8ZA 4BDKA 1Q5KA 2G2HA 2IO6A 2WQBA 5DR6A 3U6IA 4MQ2A 4WHZA 3FKLA 3HP2A 2VWVA 3G5DA 5IKWA 4BWPA 2P33A 3LCSA 2BAQA 2V7OA 3NZ0A 3Q6WA 4IVCA 4LG4A 3Q53A 4DBNA 3N4UA 4FVPA 2X2MA 2JITA 5JZNA 2PMLX 2ZMCA 3UQCA 2GS6A 4L52A 5JZJA 1PXKA 3G0FA 3ZXTA 3CD3A 4DFNA 4QMMA 4NZWB 5AR2A 4FGRA 4AGDA 4RWKA 4YZBA 1Q3WA 4LL0A 4D0WA 5LVPA 4WBBB 5LJJA 5FTGA 4MF1A 4ZTNA 4CMUA 1LR4A 5J95A 3F5PA 5CQWA 4O38A 2X8EA 5C03A 3QCYA 2JDSA 3QQJA 2ZV7A 4C8BA 4FIEA 3IS5A 4MXCA 4RPVA 5CY3A 2CN5A 3OOMA 3ORZA 3I81A 4FBXA 4DH1A 3ALOA 4XG6A 3EH9A 2V0DA 1R0PA 2YERA 5FTOA 2UVYA 4ALUA 2DS1A 4PP9A 4C57A 3DPKA 3OF0A 3P23A 5M51A 4M8TA 2QU6A 3UOLA 3LVPA 4ZY5A 4PL4A 4TW9A 1J7UA 2EB3A 3NGAA 3OT8A 4H58A 5AIKA 3RVGA 3K3IA 4RFMA 2CPKE 1Q62A 1ZARA 2ESMA 3ACJA 4IVAA 1UNLA 4U41A 5DIAA 5DT0A 4FTQA 3GCSA 3ZZEA 4R78A 2ZJWA 2EWAA 3PG3A 4E1ZA 4R1YA 4NW6A 3Q32A 2YEXA 4BRXA 4YURA 2VN9A 3C0IA 4CKJA 1PMVA 1R78A 4WA9A 2O5KA 5LCKA 4J53A 4RIYB 5AP7A 5LARA 4BWXA 3QD2B 3ZLSA 3WE8A 2C6EA 5HIEA 2OW3A 4PDSA 4WIHA 4C35A 3HGKA 3FZ1A 4X0MA 4M84A 2VTSA 3LCKA 5AP2A 4AA4A 4ZJJA 3Q4CA 5AV0A 1ZYDA 5HX6A 3HLLA 4RC4A 3TJCA 4GK4A 3V5TA 2F7ZE 2IZTA 3ORMA 2YM5A 3SOCA 2B1PA 3QUDA 5CQUA 4D2SA 3HV5A 1PMUA 5E8XA 5HBJA 4G6OA 4AT5A 3DAJA 4CQEA 2W1DA 3VO3A 3QAME 3CE3A 3GI3A 4I94A 2GTMA 3LFBA 4IANA 3ID6C 2WEIA 4HYSA 1XR1A 3L8SA 3P1AA 2OXYA 4NM3A 5IMEA 4D58A 3GFWA 2R3IA 1BMKA 4W8EA 4U5JA 3PY1A 4YSMA 3MFRA 5LCJA 1TKIA 2XEZA 3IPHA 1FINA 2PUPA 1ZYCA 4FKPA 2IZSA 1O6KA 3A8WA 3BWFA 3IDBA 5KZ0A 4D2WA 4BCPA 3P79A 3UO4A 5FXRA 3TTIA 3DOGA 1GZNA 4O7ZA 3AT4A 2X1NA 2YDKA 3D4QA 3TJDA 4QQTA 2J0JA 3KCKA 4NFNA 2R3NA 3FI8A 4GG5A 5LQFA 4KABA 3MFTA 3FSKA 3F66A 4I3ZA 3GB2A 4QQCA 5FG8A 4IM2A 3ZLWA 5A46A 4YJVA 3FI2A 3ZS5A 4FTJA 3QXPA 3MA6A 4JDIA 5J9ZA 4LOPA 4JIAA 1NW1A 1Z5MA 3HV6A 4BGGA 4RFZA 4BCKA 4YJTA 2R3JA 4KS7A 1W82A 3O7LD 2VWZA 4U42A 3AG9A 4JG8A 4X3FA 3DBFA 4BDCA 2B9HA 3LQ3A 2VGOA 4R5YA 4ZSJA 3TUDA 5B0XA 4NIFB 4FG7A 3I7BA 4DFYA 3FQSA 4YBJA 4GMYA 1H08A 4CG9A 2WD1A 3R8UA 1LPUA 3U6HA 3DBEA 5D10A 4EH9A 2UZEA 4ASXA 3OUKA 1KOBA 4I0TA 4R1VA 3T8OA 5EKNA 2C1BA 4KNBA 3UOKA 5CEQA 1WBTA 4N0SA 4O0SA 2OGVA 2QI8A 2FSOX 4AX8A 1K3AA 3HVCA 3UP2A 2A27A 1I09A 4MQ1A 2R3LA 2C5XA 4MHAA 2YZAA 3I5ZA 2OIBA 4BKYA 3BI6A 4OGRA 1H1QA 1P14A 3PRIA 2UZDA 4QQJA 2J0LA 4BZNA 1DM2A 4MCVA 4JJRA 3GU8A 4YHJA 5J79A 3OXIA 2UW9A 3QZIA 1FGIA 4IIRA 4ENXA 3A7HA 4JX3A 3TXOA 4QMLA 4CMOA 4PNKA 5BVFA 5IQHA 2R4BA 2XNNA 4U44A 3NEWA 3E5AA 4EKKA 4DEBA 5KBRA 1OIQA 4WSYA 3FY2A 4EK3A 4YP8A 2OF4A 4LV5A 3UE4A 5D7VA 2VV9A 2YM7A 2Z7SA 3EN6A 5DMZA 3NDMA 4ZXTA 5DA3A 1XH4A 3R8ZA 4D4SA 2QONA 4H05A 3CIKA 4LGHA 4DH3A 3PA5A 4NTTA 4GFGA 2VWXA 5JMSA 2FVDA 4FV9A 3UNZA 2A1AB 4D1ZA 4EK5A 4IFGA 2QLUA 2X4FA 2XK4A 3HEGA 2HZNA 4H3BA 5DT3A 2OXDA 5JFVA 3P78A 4BBMA 1WVYA 3HX4A 2BUJA 4GL9A 4IADA 5AR7A 2XYUA 4DBXA 4U8ZA 4BYJA 1XBCA 5F4NA 2WIPA 4AT3A 2HIWA 2JLDA 3MW1A 3CQEA 3QFVA 4RLKA 3R30A 4M67A 2PE0A 4ZOGA 1F5QA 4AW5A 4CT2A 5AUVA 4L3JA 4ACMA 1XH7A 1YXVA 4O7VA 3C0HA 5C4LA 5AP0A 4JRVA 2I1MA 2OBJA 4OBPA 3FMHA 4KRCA 5C8MA 2WTIA 4DEAA 4HVGA 4L42A 2BALA 5T6KA 1OIRA 1ZYLA 4WNMA 5AM6A 4YPSA 2P0CA 4XG3A 5ETIA 4BDIA 4PNIA 4R7BA 2E9PA 3CKXA 2CNUA 4BTKA 2VWUA 3VUHA 5EOBA 3UYTA 2PMOX 4M66A 4AZFA 5CZHA 1XHAA 2F2UA 3PIXA 3VVHA 2BHEA 4LM5A 4U0IA 3WYYA 2PVMA 2C6LA 4CFFA 4XEYA 2PTKA 4F1OA 4MVFA 3KKVA 5AJQA 2JFLA 3EN4A 1NT2A 2BFYA 2BRHA 3AMYA 1KE8A 3I5NA 4E20A 4EBWA 4C3RA 1OPKA 3NUYA 3I0OA 3KXGA 4II5A 5IQEA 4IACA 3BKBA 2XJ0A 3AT3A 4GIIA 5JGBA 3TZ7A 4KKHA 2Z7LA 1OKZA 4FODA 4D55A 5AMNA 3FSFA 3WILA 3Q96A 2Z8CA 3MVLA 3L8XA 3OS3A 5EYDA 4EQMA 1Y6AA 5KKRC 4TYHB 5M08A 3NUAA 1FMKA 2XRUA 1G5SA 2G1TA 4CZTA 3EN5A 2QO7A 3JUHA 2PK9A 5EOLA 1BL6A 3O8TA 1R1WA 3RPVA 1SVHA 3ORLA 2PE2A 2C0TA 4ZTQA 3Q4TA 3DXQA 1YHSA 3BU5A 3WIKA 4V0GA 3QLFA 3VS3A 1GY3A 2NNWB 5CU2A 5L2SA 3VUKA 5LMKA 3KB7A 4DF3A 5KMJA 3RAHA 3VBYA 5KUPA 4RGJA 3NNUA 2E9VA 4BWKA 2GQGA 4PMPA 3DJ6A 1BUHA 3D9VA 1OUYA 3GT8A 3SX9A 2NPQA 4XX9A 1BX6A 1W98A 2J51A 3GCPA 4O83A 4XG2A 1P4FA 4BIBA 5ANEA 4CNHA 3ITZA 4JLCA 1IASA 1IA9A 3R73A 4FV5A 1AGWA 2PY3A 3A7JA 4YJOA 1TVOA 4L01A 4QMUA 2CGXA 2ITUA 3D2IA 4I24A 5JFXA 4F99A 4L8MA 4CZYB 2YDJA 3V8SA 4CLIA 4U80A 1H27A 5CLPA 4TN6A 3WBLA 2FYSA 3AD5A 4XP0A 4DGOA 2CKEA 3FKNA 4J96A 4O2ZA 4K1BA 3V6RA 3QKMA 1B6CB 5EHYA 1XQZA 2PZYA 2W5HA 1H8FA 1L3RE 3PXZA 2R9SA 4ANNA 4CEGA 2QOIA 3OZ6A 4UV0A 1YDSE 3UMXA 4K9YA 5JQ8A 4KKEA 2B9IA 4HGTA 4CZUA 5C8KA 3K3JA 2FGIA 4MNEB 5A6OA 5D9HA 5AUYA 5JSMA 2YA9A 3Q4UA 4AW1A 2VO3A 3ENHA 4RVTA 4PPCA 2X4ZA 4YZ9A 2H9VA 1U59A 4IZYA 1GJOA 2RGPA 1JKKA 3M11A 4JAJA 3HA8A 5I9YA 4FF8A 5CEPA 2OZAB 3BYOA 1QL6A 3QTSA 4RZVA 4GS6A 3HV7A 5IF1A 3R1YA 2W1FA 3IGOA 3R8LA 3FXWA 1OECA 3DAKA 3CTJA 3D15A 3JVRA 4FSZA 4D2VA 4XBUA 2ONLA 4W4WA 3DS6A 4GG7A 3R8VA 4HOKA 3MBLA 5IQIA 2BHHA 2V7AA 2Y9QA 4O82A 1PYXA 4PL5A 2VTAA 3UNJA 3RP9A 2XF0A 3VS2A 4BI0A 3O8UA 4ZJIA 3WARA 5CEIA 1PXJA 4C61A 4EOIA 3F5XA 4O7YA 2J9MA 3R7OA 5CU3A 2VTNA 4IWPA 5HG5A 4ZSAA 3TCPA 4D9UA 1H0WA 2UZVA 4K8AA 2WGJA 3A62A 3L9LA 2YN8A 4RJ6A 4MF0A 4OTFA 3QQUA 5E8VA 4B0GA 4BFMA 4EH7A 4UMRA 4DTBA 1SMHA 3LMIA 4BI2A 1HOWA 1OZ1A 5EYCA 4HGLA 2ZYBA 1E1VA 4ITHA 2P4IA 4EL9A 4RX7A 2F2CB 3CGFA 3F2NA 3FLWA 4HCVA 4BHNA 4EOQA 2WMSA 1FBNA 5EQEA 3BHHA 3UIMA 2XIRA 4F9WA 3O23A 3VS1A 2G15A 2YCSA 3PIZA 3QC9A 3G51A 3UJGA 2R7BA 5EW8A 3ZBFA 4MXYA 4AZWA 3O7LB 1UU8A 2ZM1A 5KHWA 3TL8A 4C59A 5EDRA 4KKGA 3P7AA 2UW3A 4AUAA 3MY5A 3KF7A 4FUXA 4XLIA 2BAJA 2PMNX 5IH4A 1YXSA 4F64A 4L00A 2Y6OA 4YJPA 5CTPA 1AQ1A 5ACBC 3Q2MA 4FKRA 5BVNA 4JNWA 3G0EA 4E93A 3N9XA 2VZ6A 4EZ7A 2GDOA 2WPAA 5HESA 4GJ3A 4EOOA 2XNOA 4ZY6A 5AUZA 2LGCA 2VTOA 2G9XA 3Q52A 4BCFA 3BQRA 4Z7HA 3UVQA 2W05A 4XG7A 2HK5A 3D2KA 3QCSA 3R71A 3EN7A 1OBGA 5K5XA 3NUUA 5E1EA 4EOSA 3R01A 2QD9A 4QYEA 4JS8A 4CV8A 4USEA 5FDPA 1XH5A 4EC9A 4NWMA 4X3FB 3KCFA 3P4KA 5AV2A 5H9BA 3FE3A 3G33A 3QA8A 3PVWA 4MXXA 3UO6A 3IW5A 4IZ5A 3ZDIA 2XBJA 3VJOA 5I3OA 3EFJA 5L4QA 2VTMA 2XK6A 3LCOA 2B9FA 2QG7A 3BV3A 4RIYA 4Z9LA 4HCTA 4BBEA 2GQSA 3FEGA 3D5UA 4AAAA 5HE0A 4C36A 1ZYSA 2W1CA 1H28A 4UYAA 4D2RA 5CXZA 1BKXA 2WQMA 3ORNA 4GYGA 3NCGA 3R04A 5HKMA 4D9TA 2C47A 1KWPA 4AP7A 2W96B 4ZMFA 5HNBA 5BMMA 4ALWA 4ZLYA 1O6YA 4LRJA 5TKDA 4XV9A 3DKCA 5HO8A 3RKBA 2C0OA 4L45A 4MEDA 3LXLA 4NM5A 1H4LA 4M68A 5C27A 4BKJA 4EOPA 5AUTA 4JIKA 1KUTA 4RIWB 3OEFX 4F6SA 4WNPA 3VQUA 2CKOA 4F7JA 2X39A 2OIDA 5D11A 3ZO2A 2CN8A 2ZM4A 3D5XA 3FZRA 3OW3A 4DFZE 3QA0A 1CDKA 4RA5A 4TWCA 4E5WA 3QX4A 4HVIA 2VTQA 2J5EA 5LMBA 3ZSIA 2PVYA 4FIJA 4BCGA 4XV3A 3AGLA 4FV1A 5JEBA 4RZWA 2YAKA 4BCQA 2X9EA 3IONA 4FK3A 2XYNA 1Q24A 1Q3DA 4YLLA 5AUWA 3IECA 4PY1A 3LFDA 2J90A 5TT7A 5IH6A 3QRJA 3EQPA 3Q9XA 1PKGA 4PUZA 3TNHA 4J97A 1CKPA 1M14A 1SZMA 3C4XA 3NVMB 3R7EA 3ZO3A 3R8PA 3P5KA 3GU5A 2GFCA 3ZTXA 3C5IA 4E6DA 2B52A 2YABA 2ITPA 1VYWA 2IWIA 2VTJA 4NM7A 4ZS0A 5FEEA 3RAKA 4W8DA 1KV1A 3OG7A 2WU6A 4IJ9A 4DG3E 4WG5A 4G34A 3VUGA 3IDPA 2H96A 5L8KA 4BVUA 1R0EA 1MRYA 1TQMA 4NIFA 4UXLA 4FV8A 4OTPA 5CX9A 5HOAA 4QMXA 4F4PA 1ZLTA 2QOKA 5DE2A 1JQHA 2GHGA 1GIIA 3CY3A 4NJ3A 3FMDA 3TT0A 3UIBA 1AD5A 3CC6A 4B8MA 4D2TA 4ERWA 2RFEA 2WTCA 4YTHA 5DOSA 2OJIA 3MH1A 3R8MA 4RMZA 2UW4A 5A3XA 3QKKA 3QYWA 4GT5A 5DWRA 2XCKA 3IG7A 2UZUE 2R3QA 5IEVA 4MD8E 4AZSA 3UO5A 4DE4A 2IZRA 2XJ1A 4H1JA 3EJ1A 1FVRA 4RIXB 2GQRA 4S2ZA 4X3JA 3UBDA 3NCZA 2BRNA 3R2BA 4G17A 3SQQA 4BGHA 2OFVA 5M57A 3R02A 2ITZA 3GC7A 2B54A 2WMWA 4H1MA 4QTAA 3E3PA 4WKQA 5JKGA 1U54B 4B4LA 1XH6A 1FMOE 1IAHA 3E7VA 4Y72A 3V8TA 4JR7A 5G1XA 4N57A 4XG4A 2DWBA 5CNOA 2BCJA 2JKQA 1NVQA 4IH8A 4QMZA 5ANKA 3SW4A 3ATSA 3CTQA 2KTYA 2CLXA 1MRVA 3LFSA 4QNAA 3GOKA 4A4XA 3R21A 1YOMA 2E9UA 4J8MA 1V1KA 3BZ3A 4EYJA 2Z7QA 4FYNA 1SNXA 2CGWA 1LEWA 4JQEA 1PRYA 5I9ZA 1Q8UA 3R28A 4GJ2A 2JGZA 4EOLA 4TY1A 4PQNA 5F20A 5FTQA 3RMFA 1OKYA 1CSNA 2J0KA 2PUUA 5FGKA 3WE4A 4CFWA 2C68A 2UW8A 4YHTA 5M44A 2Y4IB 4DGMA 3LM5A 4FKGA 1JAMA 4NEUA 2UVZA 4CFXA 2W1HA 3IOPA 2YM6A 5HCZA 2UZBA 4WNKA 4J99A 5C9CA 5DPVA 4OT5A 1GOLA 3MN3A 5DHJA 3TKUA 3ZHPC 5KHXA 4FG8A 2YFXA 3VW8A 3D5VA 4R7IA 2RFSA 2W1IA 4FI1A 5KE0A 5FQDC 4I1ZA 1XBAA 1YWNA 3DFAA 3BGPA 3POZA 4IAAA 4MBLA 4OTDA 2WB8A 5B7VA 2B55A 1BI8A 4GT3A 3QZHA 5CVHA 5LVLA 4TYJA 5IUIA 5IQDA 4YSJA 3VJNA 3GQLA 3FAAA 3MYGA 1XO2B 4FTRA 3VNTA 4L7SA 2C30A 5E8TA 3F7ZA 1WBOA 3DT1A 4YTIA 3GBZA 3LFEA 4ITIA 4ZTLA 2QHNA 4FEUA 5F95A 4AOIA 4F1MA 1MRUA 1YOJA 3ZRMA 5M56A 3PE2A 5FXSA 3QHWA 1W83A 4ZTRA 3CPCA 1WBWA 1WVXA 3C1XA 5AP3A 3DFCB 5IQAA 3I6UA 4FEXA 3VF9A 3TG1A 2JAMA 4G2FA 2XKEA 5E90A 3OVVA 3DTWA 4I93A 4DHFA 4NYEA 2BROA 3QQLA 5E91A 2FO0A 4QP7A 4M97A 4IAFA 5AAGA 5L6PA 5IQBA 3F88A 4G3FA 3OHTA 4FV6A 3N4VA 1XKKA 3C13A 3DZQA 2QC6A 3RK7A 2C3LA 1Q8YA 4TYHA 2ETRA 2QOOA 5F9EA 1JKLA 3QZGA 1RJBA 1OIUA 3GU4A 4RFYA 1DAYA 3AD4A 4F9YA 3R6XA 2QLQA 4H39A 4FA2A 3MESA 5A6NA 4ZTSA 5A4QA 5BVOA 3KVXA 1RE8A 2C5OA 1J3HA 4RIOA 3BELA 2NRYA 2REIA 4H3PA 1XBBA 5AA8A 1OKWA 3R0TA 5IQCA 4DGNA 1GZ8A 1Q99A 3FY0A 4X2NA 3VAPA 4XP2A 4QYHA 5CT0A 3ELJA 4BYIA 4RJ7A 3V8WA 1ZZLA 4C4IA 4PP7A 1WBSA 3KXNA 5HG7A 5J5SA 3FC2A 4C37A 4NH1A 3P86A 3PG1A 4EK4A 4GH2A 4KIKB 1W8CA 2IW8A 1VJYA 1UKHA 1APME 1UA2A 3QZFA 4ACGA 4EUUA 3EQIA 4CSVA 3DKFA 4A9UA 2QU5A 4PTGA 5EM7A 4BL1A 3ZXZA 2BZHB 5AP5A 4Q5EA 3H4JA 4N4SA 3TV6A 3MH2A 4M14A 4XV1A 4AGCA 4HGSA 4ZLOA 3IW8A 3VUDA 4KSQA 4ORKA 2WTDA 3ZEPA 3EQCA 5HCXA 4E4MA 3TKIA 3DDQA 5HU9A 2HXQA 4EH6A 5GJGA 3C4ZA 3MY1A 4BDJA 3R00A 4Z7GA 5I9WA 1UU3A 4FT9A 3U9CA 4MNEA 2VUWA 1Z9XA 3OBJA 4QMTA 1WBPA 4ACCA 3ENMA 5E92A 2XA4A 4Y95A 1SM2A 4OTIA 3SHEA 1WVWA 4CKRA 2P2HA 2I0VA 3UG2A 3PJ3A 4FTLA 4MKCA 4C4FA 4CD0A 4XMOA 4MX9A 2QURA 2C0IA 2OZAA 5IUHA 2OH0E 4XNEA 2FA2A 4D4VA 3OFMA 4FNYA 4ZAUA 3EQDA 4FT5A 5ICPA 3JS2A 3VBTA 1LEZA 3KN6A 2XP2A 4FE2A 3ORPA 2Y6MA 3H9RA 4LUEA 4YPDA 2ITWA 4RC3A 2JD5A 3ZM4A 4CV9A 3U4WA 3ZCLA 1IAJA 3ZO1A 5E9EA 4V01A 4FZAB 3LCTA 4DCAA 5I9VA 4CYIA 3OMVA 2VGPA 4F9BA 3PWYA 1EH4A 3OCTA 4W4VA 4G3DA 3W2CA 3I7CA 4S30A 4EH2A 4AW0A 2PVKA 2XUUA 4M12A 4MNFA 5D12A 4MXOA 3GUBA 3IO7A 2RG5A 2F4JA 4IAIA 5HTBA 3VC4A 3ZRKA 2HY0A 1OIYA 3FLSA 5AM7A 4FOCA 3HP5A 3QCXA 5CAVA 1BI7A 3AC4A 4F6WA 3RPRA 4A9YA 4E5BA 2YJRA 5HE3A 3E88A 2GNGA 3A4PA 4EH5A 3KK8A 3L9NA 2Q0NA 5I9UA 4EWHA 2PZIA 3GCUA 1U46A 4CKIA 4F9AA 1QMZA 3QUEA 1M2PA 2GHMA 4O22A 4BBFA 1ERKA 3P9JA 3MVJA 3JPVA 4K0YA 4O2PA 3OTVA 1YDRE 3JVSA 4RC2A 2WQOA 4AGUA 3WF8A 3WZEA 5IH5A 4JX7A 5M4IA 1G8SA 3CQWA 3JY9A 2C6TA 3Q60A 4I5HA 3UG1A 5IDNA 2GU8A 2QNJA 5GJFA 2WTKC 3I6WA 5IA0A 4FIGA 3F2AA 2OK1A 4IW0A 3S2PA 1ND4A 1S9JA 2WELA 1PKDA 1QPJA 3L8VA 4CG8A 4FNWA 4BGQA 3R9HA 1OL7A 5ETAA 5AV4A 2JFMA 4TL0A 2BAKA 3NYXA 3PXRA 5F94A 3D7ZA 4IDTA 2VRXA 3FHIA 2WMQA 3CJGA 4J71A 3R63A 5IA4A 3FQEA 2GNHA 4FNZA 4ACDA 4QTCA 5DH3A 4AA5A 4AOTA 4V05A 3T9IA 4IB0A 4YR8A 3S00A 3QWKA 1ZZ2A 5CAUA 3AC8A 2BRGA 4WNOA 3V5JA 3WF6A 4MWIA 3JXWA 3WZJA 4CCUA 3RGFA 1F3MC 3AC1A 3HKOA 5E8SA 5M06A 2WU7A 3VUMA 3QTIA 5CEOA 3RK9A 2R3PA 2BIYA 3MJ1A 1OL5A 4TYGA 4RQVA 4X6RA 5LOHA 3LFFA 5GZAA 2RL5A 1ZOGA 5AEPA 2C5YA 3QD0A 2I0YA 5KZIA 1JKSA 1QPDA 4FKJA 2C5VA 2EXEA 3FPMA 2WQNA 3MJ2A 4C3FA 2PVFA 4BI1A 3PYYA 3VHEA 4JQ7A 2QHMA 4FICA 5BVKA 4U97A 4LRKA 4GYIA 2ZM3A 1Q4LA 1T46A 2HYYA 3NW6A 3F9NA 4ZP5A 2HENA 3VS7A 4IVBA 4R3RA 3MPMA 4FKOA 4RVLA 4GVAA 3BCEA 4QP3A 2X7GA 3ORKA 3EL8A 3OXTA 5C01A 5L2QA 5TF9A 5BMSA 3U55A 4FVRA 4EQCA 4FEWA 3VBQA 2BPMA 2ITTA 2PPQA 4OTWA 5HEZA 2QCSA 2OJJA 3FLYA 4DFXE 4RIWA 3BIZA 3KULB 1OITA 4RX5A 1T45A 3OD6X 4W9XA 2QOCA 4RBLA 3EQHA 2Q0BA 2ZOQA 2E9NA 3MI9A 4UMPA 4NFMA 5HZNA 4LMUA 2F57A 2GHLA 3MDYA 1JSTA 4MXZA 4UY9A 4AFJA 4LI5A 4IAKA 5CXHA 3COKA 4FT0A 2BTSA 2J6MA 2XH5A 2YISA 4BTMA 1H1WA 2FUMA 3HNGA 1ZWSA 1V0OA 1ZY4A 4F9CA 4FV3A 2JAVA 4B9DA 3EOCA 4QOXA 4RWJA 1Y8YA 2J4ZA 5CF6A 4NJDA 2XEYA 3ODYX 3L8PA 1QPEA 4A9TA 4F1TA 2PVLA 1OVEA 1CKJA 3CEKA 4L44A 3RZBA 4DFLA 5JQ5A 3NUXA 1R39A 3R1SA 4NK9A 3NIZA 2C3KA 4C62A 1UV5A 3AC5A 3GP0A 4IAZA 3GCQA 1B38A 2J5FA 1W7HA 5DLSA 5HIBA 4JBOA 1OM1A 2JDVA 5EDPA 3RJCA 3W2RA 3SXSA 3S0OA 3MS9A 3IDCA 4TZRA 2ZAZA 4ARKA 4ZTMA 3EFKA 1JNKA 4B99A 1PJKA 4TYEA 4FKVA 2OF2A 3ORTA 4O1OA 3O17A 4U3ZA 4NL0A 4C38A 2PZPA 4CFMA 4C58A 4FNXA 3E8EA 1UU7A 2XIZA 4PF4A 2ITNA 5EG3A 3PWDA 2C6KA 3DAEA 5LVMA 1OB3A 4ENYA 1FPUA 3U6JA 5H8GA 4S33A 3R9NA 4TWOA 5J7HA 4AT4A 4UB7A 2QKWB 2X6DA 4A06A 4GFOA 3MTLA 4U7ZA 3HDNA 4O0VA 4X6QC 4JVGA 2W17A 2ERKA 3LLTA 4QMSA 4RIXA 2ZV2A 5AA9A 3OT3A 4HNIA 3S1HA 2CNVA 1H24A 2R3KA 4O0YA 3ZC5A 2HW6A 2X2KA 5CAQA 4DEHA 2Z60A 4W4YA 4FG9A 1U54A 3F69A 4XBRA 2YCRA 2WXVA 1K9AA 3D83A 2XS0A 4LYNA 4XJ0A 2WOTA 4O86A 1OL2A 3PRFA 4FKSA 2JKOA 3KU2A 4JG6A 4L53A 3PVGA 4F08A 3ETAA 3WIGA 4FSWA 2BMCA 4M0ZA 1OL6A 2QOFA 3LCDA 4UWBA 1YHWA 2YM8A 3NR9A 3F3WA 2XMYA 3Q6UA 3EN9A 3COHA 3NLBA 4RWIA 3SOAA 3W16A 3EL7A 4EHGA 1U5RA 4EI4A 5EI8A 3DZOA 3UDBA 4AACA 5M4UA 1B39A 4KIPA 4OT6A 4YZCA 5CT7A 5CVGA 4PWNA 4O7WA 2EB2A 4R5SA 4TRLA 5BUIA 3E92A 2UW6A 2XVDA 4XRLA 4U6RA 3FZOA 4FL3A 4O0XA 5ANDA 3ET7A 4RSSA 2B4SB 3UPZA 5AUUA 3NRMA 2HZ4A 3BLHA 3ACKA 4OBOA 3RAWA 4JR3A 1Y57A 3KA0A 4FKTA 4M15A 4FSRA 3OEZA 4DH7A 1URCA 1WBNA 5DRDA 2CKQA 4QT1A 1Y8GA 5EKOA 4PDPA 1ZAOA 3RHKA 5IEYA 3G6HA 2C6MA 3PFQA 4WOVA 2RKUA 1HCLA 1JOWB 4MBJA 4IWQA 4HPTE 4QQ5A 1FOTA 2VWBA 3EQBA 4L43A 2GS2A 4QPSA 1YOLA 5HD4A 4WBOA 4BCJA 3TTJA 2JBPA 3NNXA 4GK3A 3RCDA 4J95A 4DAWA 5L6OA 4FEQA 4RX8A 4BB4A 1SVGA 2WFYA 4C34A 4R3CA 3ZSHA 5EK7A 5J9YA 1LP4A 4GEOA 5JH6A 3BE9A 5CSXA 4F0IA 1J1BA 2F7XE 2XNGA 3OWLA 4XH6A 3SDJA 3KXMA 2YIYA 1H1PA 4O0WA 3E8NA 2E9OA 5DG5A 5JGDA 4DEIA 4UZDA 4YC6A 3K54A 1NXKA 5DYJA 5GIOE 3R1QA 4N6ZA 3NAXA 4BCMA 4YUQA 4GT4A 2AYPA 4YTCA 4ZSGA 4AN9A 4A7CA 4YJRA 4X3FC 1V0BA 1IR3A 3LMHA 3O0GA 2CMWA 4UWYA 1UWJA 3O51A 4MYGA 4E73A 5JFWA 3F5GA 2PZ5A 3DCVA 3PLSA 2HCKA 4R3PA 4D4YA 5C4KA 3CBLA 3QCQA 4Z16A 3NW7A 2OLCA 3ROCA 3VS5A 3SAYA 2I6LA 3DJ5A 1RQQA 3HUBA 5M53A 3H9FA 2WQEA 4Y8DA 1ZMUA 3PSBA 2BTRA 2VTHA 3DU8A 4U3YA 5BYZA 5AAFA 4C3PA 2J50A 5KKRB 1OI9A 3W33A 5J9LA 3HMNA 5AAEA 2C6DA 1ATPE 2R3HA 4JBVA 4X21A 5EM8A 3RI1A 3UIUA 3ZFMA 3SVVA 1TQIA 2ITOA 5LVNA 3VF8A 4EHZA 4ZY4A 2NRUA 2R7IA 4FTCA 4EOMA 2IG7A 3HRBA 2EUFB 2UV2A 3AXWA 4CTBA 4FT3A 2Y0AA 1YI3A 2PUNA 3GU6A 4WG4A 2WMRA 4KIQA 2OZOA 4KIKA 5CENA 3PJ2A 4LV8A 4M3QA 4PTEA 5JRSA 2XNMA 3RPOA 4C4GA 5H3QA 3SG9A 4V04A 3UGCA 4XCUA 3NUNA 5HU3A 3Q3BA 2VNWA 2F9GA 5DN3A 3R83A 4ZEGA 4IX6A 5BYYA 4QMYA 2RSVA 3Q5IA 4AOJA 5B2MA 3UVRA 2XK3A 5EHOA 5J7BA 5L2TA 3HMPA 2XKFA 3FI3A 2ZMDA 3ROYA 3BGZA 5L8JA 4JI9A 4FIFA 2UUEA 4FV4A 4GCJA 3OY3A 4J1RA 4S31A 5EW3A 4BC6A 2WMTA 5BX0A 5HLWA 3CSVA 1YHVA 3FZSA 4I5CA 4I0SA 4APPA 5JT2A 3MPAA 4EOJA 1YQJA 3S95A 3PJCA 1NY3A 1Q8TA 3D7TB 4OLIA 1XH8A 2PHKA 5DR9A 4HYUA 4X2JA 4R8QA 3HRCA 3COIA 1GZOA 3AQVA 3QQKA 3TWJA 3A7IA 3W55A 5JGAA 2FSMX 3HUCA 3Q9ZA 3W10A 2C3IB 4XS2A 4XOZA 3BLRA 1H07A 3ZDUA 1H26A 1SNUA 1PXMA 4MD7E 4PPBA 3TIZA 5FBNC 3PY3A 4ASDA 3I79A 5HX8A 3SGCA 3W8LA 4I5PA 2JBOA 3I60A 2B0QA 4RX9A 2WNTA
chains in the Genus database with same CATH superfamily
1JVPP 2X6EA 3G2FA 4ZSLA 2QQ7A 3E8CA 2WMUA 4CFUA 2OKRA 3QUPA 2YLFA 3GENA 3PUPA 4X2FA 4E7WA 4DHIB 2PSQA 4EORA 3LFCA 1PMEA 5M09A 3RALA 5CF5A 4BKZA 5HE2A 4E6AA 5AR8A 5FP5A 4CYJA 3NYOA 3IQ7A 3QTWA 4NCTA 3E87A 4MK0A 3GVUA 3LOKA 4B7TA 3LJ0A 3REPA 2ZV9A 2BDWA 3RINA 4LL5A 4HW7A 3QC4A 4JAIA 4YJNA 4L9IA 4AG8A 5CEMA 4TYIA 3NYNA 3QD3A 4LUDA 3PA3A 3BPRA 2GCDA 5IQGA 3P7CA 4O0TA 3DKGA 5GZ8A 4M7IA 5IISA 1UWHA 4CVAA 5K5NA 4DTAA 2R2PA 4HYHA 1OGUA 4UMQA 4G6LA 5FEQA 3QQGA 3F3TA 3RM6A 2CCIA 2JDTA 1XMLA 2RG6A 4XOYA 5L3AA 4QP2A 2IN6A 3G9NA 3LW0A 5FM3A 3WZUA 4PMSA 2ZV8A 3SC1A 4BIEA 4Z3VA 1QPCA 3AD6A 1JWHA 2V62A 4USDA 2WIHA 4OW8A 3O50A 3GC9A 3W8QA 1U4DA 1WBVA 3CGOA 4FTAA 4UBAA 1X8BA 4YBKA 3P0MA 4KIOA 5EI6A 5FEDA 4AXAA 5BUEA 5HLNA 3BYMA 3LFQA 4G3GA 3NUSA 5TOZA 4GUBA 4GW8A 5IA1A 1YWVA 2UW0A 1DI9A 2YCQA 2GNIA 3OWKA 4XG8A 2UW7A 2PULA 4I6LA 4WUNA 3ZYAA 3FKOA 2YWVA 1H0VA 2P2IA 4G9CA 4XYFA 2YJSA 4DN5A 2IW6A 3C4CA 1MQBA 4YMJA 3GFEA 4LRMA 1RW8A 2BIKB 1BLXA 2R5TA 2W99B 2IZUA 2VX0A 3CPBA 3HZTA 3BRBA 2H34A 4S34A 3WF7A 4F63A 4IM3A 5T68A 3F6XA 4MH7A 4PDYA 5HCYA 2YIQA 3LJ2A 4QMQA 3FDNA 4NUSA 3L1SA 2HWOA 5FBOA 2QKRA 3E3BX 3TYKA 3FZTA 3QALE 4ANSA 4DG0E 2C69A 5FWKK 2J0MB 5EHLA 4DINA 4IZ7A 5HG9A 2OJFE 3K5UA 1ZMVA 4I6QA 3R7YA 5IDPA 3LJ1A 3U8WA 4DT8A 2XM9A 4AS0A 2HOGA 4OAVB 4BIDA 2VTRA 2C3JA 4TNDA 2UZNA 5JN2A 4BJJA 3BQCA 3V04A 1DS5A 5HNIX 3NNVA 3KULA 4Y85A 4QMNA 4ZZNA 2BRMA 4CQGA 5I9XA 2ONLC 1FVVA 5DI1A 2LAVA 4UWCA 5BVWA 3SV0A 4IM0A 4ZIMA 1H1SA 4F0GA 3GEQA 4F0FA 2W06A 3TV4A 5HD7A 4C4HA 2BKKA 5LXMA 3DNDA 2R3GA 3HV4A 3ANRA 3QRTA 4QD6A 4UMTA 3CKWA 4GFMA 5CZIA 5KMLA 4ZMEA 5A4EA 2J2IB 1URWA 2YACA 1WFCA 2YITA 1CM8A 4IWDA 1Q97A 4CXAA 1R3CA 5HHWA 2BDFA 4RVMA 2GS7A 4U81A 3MIYA 4YC8A 4BDEA 5CEKA 2UZTA 3O96A 5LMAA 2ITVA 4L6QA 1STCE 2V5QA 4AA0A 4IB5A 4JDJA 4UXQA 5E1SA 2WEVA 2CGUA 4ZTHA 4FEVA 2XNPA 4O4DA 4CRLA 1YKRA 4IZAA 5DR2A 2YIRA 5FP6A 3ULZA 4CFNA 3TN8A 1YW2A 3O2MA 2W9ZB 2QOBA 3DV3A 4C4EA 2J0IA 3ANQA 2O65A 3PY0A 2P55A 4P5ZA 4G5JA 4O4CA 4ZS4A 3A4OX 3BYUA 5HNGA 4HVHA 3LMGA 2PVRA 3ODZX 3DK6A 4JDHA 3PTGA 2HZIA 5A14A 5CU0A 2PL0A 3VS0A 2NP8A 5L6WL 3VULA 3KEXA 3VN9A 1V0PA 3QD4A 4PV0A 4PMMA 5KNJA 4A4LA 3PZEA 3DGKA 3CCNA 3TNPC 2CNQA 3U54A 5EDQA 4FSYA 4H3QA 4GKHA 5I5ZA 3IOKA 4EH3A 3H9OA 4ASEA 2W5AA 3NWWA 4I20A 3COMA 4L46A 4EH8A 4JL9A 4DITA 3QTUA 2C6IA 3P08A 2BFXA 4AFEA 5K4IA 3DA6A 4Y83A 5CU6A 5EI2A 3LAUA 4Q5HA 4A9RA 5A54A 4QMVA 5DEYA 3ZONA 5HG8A 4DEGA 3A7GA 3C4EA 4F7SA 1JSVA 3FI4A 4J7BA 2VD5A 4AGWA 1ZXEA 4EZ3A 3MFUA 2ITXA 3V51A 3VHKA 4XG9A 2WMAA 2XIXA 2WMXA 3GC0A 2HAKA 5HIDA 3AT2A 3RWPA 3WZDA 3U4UA 1G3NA 4XRJA 5BQ0A 3I1AA 2XKCA 3LQ8A 4QNYA 3QTXA 1M52A 3POOA 5K0XA 5KMOA 3QTRA 4K2RA 4EUTA 1ZOHA 4ZSEA 1ZRZA 4BR3A 2WMVA 3HV3A 5I3RA 2YAAA 2RF9A 4YGAA 3TV7A 3EQRA 4HZSA 2PWLA 4KAOA 3D94A 3HL7A 4A07A 3JY0A 4BTJA 1CMKE 3MIAA 4IMYA 5CALA 4DG2E 5C1QB 2VAGA 5IG1A 2V22A 3GCVA 2WKMA 3R2YA 5HORA 5EFQA 3ZMMA 3M1SA 1DAWA 1Z57A 3QL8A 3JR1A 4O0RA 3H10A 3I4BA 3W2OA 3NSZA 2EXCX 3MB7A 4M69B 3KREA 3CD8A 4ANLA 2W4OA 4KRDA 4UN0C 2YWPA 3DQWA 3RK5A 4BDHA 3N51A 4WRGA 4BCIA 4ANOA 4IC7A 3HAMA 4EJNA 1IRKA 5CSHA 4YNOA 4GU6A 3GQIA 4YZMA 5DEWA 3V5LA 4DLJA 5ACKA 3U87A 4IJPA 3LLAA 4FSNA 5CU4A 5IEXA 3PXYA 3OTUA 3Q04A 4QP4A 5KMNA 4FUYA 5LVOA 3IK3A 2GFSA 2JIVA 2VTIA 3WF5A 4CMTA 2WTWA 4NT4A 4C4JA 3EB0A 1J1CA 3RPSA 5HE1A 3EYGA 3FQHA 4LGGA 3IW4A 1KE5A 2Y7JA 3F82A 4G31A 2OIQA 3C5UA 2VNYA 3PXFA 4I6FA 5J8IA 2YLEA 5AP6A 3FMLA 1BYGA 1PW2A 5D7AA 3QF9A 5GJDA 3PSDA 4F7LA 4FMQA 5BVEA 3II5A 3PP0A 3DK7A 4C2WA 3LIJA 4JBPA 2BR1A 3UC4A 3UPXA 5ANGA 4O7RA 4TNBA 2W4KA 4IQ6A 4W4XA 4FIHA 5FD2A 5D1JA 2WMBA 4HYIA 4FJVA 4AZVA 4O1PA 3E8DA 2XIKA 3G9LX 1OL1A 2VX1A 4QYFA 3NX8A 5E7RA 2OSCA 4QTEA 2GTNA 3W18A 5IU2A 5KX8A 4QYYA 2C5NA 3UDZA 4FZ6A 4BY9E 4B8LA 2HWPA 3BX5A 4NTSA 3BWJA 3A99A 4PDOA 2KULA 2OI4X 3PPZA 5FM2A 3BU6A 2PUIA 2VTLA 3F61A 3HA6A 4ID7A 4GUEA 2XAMA 2XBAA 2YIWA 5M4FA 2ETMA 4GK2A 3QQFA 2ERZE 3BHYA 3RBWA 3UTOA 4F09A 1F0QA 5KO1A 2O0UA 4DC2A 1JKTA 2BZKB 5BUJA 1OBDA 3FLZA 2W0JA 1YRPA 1J7LA 3VIDA 4M13A 2P3GX 3R7VA 4I92A 1M17A 5AP4A 1P2AA 1PXOA 2CDZA 2CLQA 2OXXA 1E1XA 3VQHA 5IQFA 4E6QA 2RIOA 3FXZA 4Q9SA 5A4CA 3GNIB 4Z55A 2F49A 3ORIA 4XV2A 3WOWA 2GPHA 3BLQA 3K2LA 1PF8A 3ZEWA 3C50A 2VO7A 5ETFA 3L9MA 5AADA 3EQFA 3LXNA 4FZ7A 4AZTA 4BDFA 3NAYA 4IHPA 3F3UA 3OCGA 3FMJA 2OO8X 4CGAA 1M7QA 3EHAA 3LFAA 5KMIA 5DBXA 4AW2A 4KA3A 3KC3A 3MPTA 5HLPA 3V01A 1VZOA 5GHVA 3PP1A 4RA4A 3FMNA 5C26A 3BGQA 5CNNA 5ETCA 5DT4A 1GIHA 4XUFA 3OP5A 4DCEA 5E8WA 2X0GA 4HPUE 2UZLA 3D7TA 1OPLA 1JLUE 2R0UA 3HMMA 5HICA 5HTIA 3TM0A 4DT9A 3ZUUA 5DNRA 1PXPA 4MTAA 4L67A 2XKDA 3DQXA 4Y46A 4D1SA 2HW7A 3EKKA 5IA5A 3VUTA 4AE9A 3BYSA 4OTGA 4YJUA 5E4HA 3H3CA 4FSMA 3MVHA 4BZDA 3FWQA 3R22A 4F7NA 5HO7A 4IC8A 5AR5A 3KXHA 3QYZA 3EZRA 4ACHA 4I6HA 3TZ9A 5TE0A 2ZDTA 3C51A 5K9IA 1UVRA 3FLNC 4O81A 5BV3A 3NVKI 2CJMA 4IFCA 4WRSA 3DBCA 5K4JA 3QGWA 4TXCA 2W1ZA 3RHXA 5CASA 4TKSA 3F3VA 1GNGA 3ZRLA 3AKLA 1PXIA 3W0PA 4L3LA 4G6NA 3ULIA 2JKMA 4JDKA 5H8BA 3DB8A 4BF2A 2WTJA 2VX3A 5CI7A 2G2IA 5LMKC 4JQ8A 2I0HA 4YNEA 2XCHA 3ZZWA 3O5AA 4QP8A 3SLSA 4TWNA 3VBVA 4CCBA 4QYGA 2WOUA 3QXOA 4G3EA 3MWUA 1TQPA 4YZNA 4DHZA 2CCHA 1H25A 2NO3A 1PMNA 3B8QA 4FC0A 3ZOSA 4DA5A 1P4OA 4J8NA 2QR7A 4FX3A 2QVSE 3FL5A 4IX5A 5M55A 4KBAA 4D1XA 4G1WA 4M0YA 3UQFA 3OWPA 3G6GA 3UVPA 2CKPA 4LFIA 3QWJA 3MGYA 4R7HA 2WO6A 5EM6A 3N4TA 3E7OA 3D0EA 4QEBA 3VUIA 3PPJA 2ZB0A 4YO6A 2O3PA 2R3MA 4D0XA 3V5PA 3E62A 1RDQE 2BKZA 1I44A 3MV5A 3NYVA 2GNJA 3KF4A 3SRVB 4EHEA 4ZZOA 1FGKA 4IB3A 4EC8A 3AMBA 3FXXA 1OPJA 4FZDB 4E5AX 1H1RA 1J7IA 1NVSA 1YXTA 4DDGA 5HI2A 4QMPA 2HXLA 3HRFA 4QPAA 5FRIA 3PXQA 2WTKB 2R3RA 2BRBA 3EWHA 3BBTB 3BHVA 4PTCA 2YHVA 4RJ5A 3LQ5A 1KOAA 2CSNA 1JSUA 4G5PA 4FV0A 2YIXA 4O96A 4KUJA 3ZFXA 4FKIA 3K5VA 4D28A 4P4CA 3ZC6A 3BE2A 2OU7A 5CVFA 3W1FA 3KMUA 4O7LA 2JC6A 5TR6A 2B7AA 4E8AA 1W2DA 2XANA 3UZPA 5IUGA 1KE9A 5FLFA 3GXLA 4BICA 3UMWA 2C4GA 5AP1A 1ZOEA 2X9FA 3PIYA 3VBWA 4FR4A 4DTKA 2QOQA 5L2IA 5EH0A 1O9UA 1FQ1B 4I4EA 1SVEA 2YDIA 3RCJA 2VWWA 4FYOA 5HVJA 3RTPA 5AV3A 3TZ8A 2R0IA 3KVWA 3ZUTA 4FTKA 3WZKA 4BZOA 2AUHA 2QODA 1A9UA 2W9FB 1FVTA 3LXPA 3TDWA 5A9UA 4O7TA 2FSTX 2O63A 4FTNA 2EU9A 4FZFB 2VO0A 4RWLA 4BN1A 3KRRA 4EONA 3F2RA 4BHZA 4E4LA 2W1EA 2F7EE 2I0EA 5CWZA 5HGIA 4EYMA 5H8EA 1BL7A 3FC1X 2R3OA 4P90A 5HBEA 2A19B 4FKUA 4FTMA 4G16A 3KK9A 5KMKA 2FSLX 3OCSA 3A7FA 3W0MA 2PVHA 3OXZA 4QMWA 4MWHA 3KRLA 5AV1A 4I0RA 4FTOA 3BEGA 5AR4A 5CAOA 3WI6A 4YTFA 4BCNA 2HY81 5HVKA 1KSWA 4F70A 1OKVA 4K11A 1ST4A 2OJ9A 3QTZA 4DHJA 3F7WA 1G8KA 4I21A 4I23A 4BDGA 4D2PA 3Q4ZA 4G9RA 4C02A 2HZ0A 2ITYA 3VWAA 4WUAA 2I7QA 4FL1A 4DGLC 3B2TA 4E26A 5AWMA 1IG1A 5HTCA 4I6BA 3G90X 5CI6A 1CTPE 3AC2A 4FGBA 3SKCA 4RJ3A 4AF3A 1ZYJA 4AXCA 3A61A 1WMKA 2XJ2A 4JXFA 4CT1A 3O71A 2XRWA 2BVAA 2IVSA 3MA3A 5BVDA 2Z02A 3UZRA 2DUVA 3QGYA 4BTFA 3BHUA 4WT6A 4UX9A 4K33A 4RT7A 1GIJA 3RNIA 2ITQA 3R7GA 1VEBA 1MP8A 3PZHA 4XLVA 5KBQA 4YC3A 4OAUC 4PX6A 2ZVAA 3TNWA 4WD5A 3ZO4A 5J1VA 3CR0A 4KD1A 4AZEA 3VRYA 3GOPA 3UDSA 3IGGA 3KMMA 3LM0A 3NS9A 3FL4A 3FYJX 3FV8A 3SD0A 2X7OA 3F3ZA 4IEBA 4UALA 5AIRA 3ERKA 5TO8A 5ITAA 4FTTA 4YHFA 3KY2A 2G01A 1OMWA 1YI4A 2UZWE 3EZVA 3ZU7A 2XK7A 3QHRA 4KB8A 2JKKA 3KRJA 4P5QA 4E6CA 5ANIA 4TWPA 3W2PA 4IX4A 4B6LA 1PHKA 3G15A 3M2WA 4Q2AA 2G2FA 3P7BA 4DEDA 3KGAA 5DVRA 5IZFA 3R9OA 4FSQA 3CXWA 4Y5HA 4FV7A 3BU3A 2FH9A 1PXNA 2C6OA 3EFWA 4E4XA 3QTQA 4K77A 2JDRA 5EQYA 4ERKA 3WYXA 3OROA 4R6VA 2YM4A 2H6DA 5FXQA 4J52A 3FMMA 1IEPA 4UZHA 3VONA 3ZBXA 3BL7A 4YO4A 5G6VA 3ATTA 4YLKA 3QRIA 4FV2A 4DFBA 1Y91A 4C0TA 3BBWA 3H0ZA 3HECA 2BZIB 4Y73A 2QR8A 3MB6A 1K2PA 4ITJA 2RFNA 1SYKA 1MUOA 3MFSA 4EBVA 2XB7A 4YJSA 4ASZA 4Q9ZA 3DTCA 4ANQA 3Q9WA 2XK9A 4I5MA 4BDAA 2OJGA 1UNGA 1JBPE 3LE6A 4FTIA 5EYMA 2JDOA 4GKIA 3JYAA 4FL2A 4M69A 4O21A 4YLJA 2A4LA 2CHLA 4O0UA 2XZSA 4FTUA 2VU3A 5JFSA 4CFVA 1REJA 3DKOA 4QO9A 3C4WA 3PJ8A 5J5TA 1KV2A 2AEGA 5DGZA 1PYEA 2IF8A 2PZRA 3QRKA 4E4NA 5J1WA 2W1GA 5LWNA 2ETKA 1NA7A 1P5EA 4HZRA 3PDTA 4JG7A 1WCCA 3DBDA 3NNWA 4L3PA 3V6SA 3UNKA 2HELA 4U79A 3C9WA 3FLQA 5AX9A 5ANJA 4O4BB 2B9JA 4XP3A 2EXMA 3OC1A 1WAKA 4W9WA 4Y5QA 2Q83A 3SA0A 4U43A 5FUTA 5DFPA 1VR2A 4EH4A 3LXKA 2YZLA 4S32A 4RVKA 1PXLA 4HVSA 3ALNA 1H01A 4QRCA 4KBCA 3TNQB 4EHVA 2W7XA 2YCFA 4EZ5A 1A48A 2OG8A 3LFNA 1YVJA 2VTPA 4O7SA 4IX3A 3UDTA 3MH3A 3QLGA 3ML1A 1PY5A 1Q61A 3S4QA 4NW5A 5JK3A 5IPJA 3PVBA 3C0GA 3DK3A 4IDVA 5CYIA 1Q8ZA 3GGFA 2V55A 1YXUA 3PE1A 4P2KA 3ZUVA 3UZTA 3MY0A 3FYKX 2JIUA 3MSSA 5GINE 3A2CA 4NKSA 3LHJA 2Y4PA 3FPQA 3CS9A 3KXZA 3M42A 1XWSA 1UU9A 4FKWA 3V3VA 3A8XA 5A4LA 4EEVA 3GC8A 4LOOA 4BDBA 5IA3A 2ZB1A 4N70A 4TTHB 3NMUF 5B2KA 4HJOA 5E8YA 2OFUA 4QP6A 3AOXA 3EKNA 3KQ7A 3QX2A 4RG0A 5D41A 5EW9A 3C4FA 2A2AA 3PA4A 4CRSA 3NPCA 5CAPA 3KXXA 1S9IA 3T9TA 3SW7A 4JOAA 3HAVA 1H00A 5K3YA 3KRWA 3W32A 5BNJA 4LMNA 2UZOA 1M2QA 4UEUA 4ANBA 5AUXA 4BCOA 3AMAA 2YM3A 1UNHA 2VWYA 4APCA 1Y6BA 4GU9A 4OTQA 4HCUA 4I4FA 1UKIA 3UOJA 5BPYA 4EWQA 3VW6A 3VS4A 4WG3A 5EM5A 2BDJA 2GNFA 3RZFA 5HO6A 3U51A 2W5BA 2UVXA 3F5UA 3TZMA 2PVNA 3QBNA 2QO2A 4DH8A 4G3CA 4L7FA 2AC3A 4AE6A 1GAGA 1MQ4A 1VYZA 2IW9A 2A0CX 3SXFA 2XALA 3EYHA 3CLYA 3D5WA 5ANOA 5AFVA 3PPKA 2X2LA 3TEIA 3R1NA 4AXEA 4AXFA 3HMIA 2Z2WA 4U45A 5EYKA 3THBA 3PVUA 3O8PA 4RQKA 5EQPA 2Z7RA 2IPXA 4RJ8A 2PU8A 3D14A 2B53A 4TT7A 2XNEA 4ZZMA 2VO6A 3E63A 4DLIA 2QOLA 3PXKA 5L8LA 4GV1A 3ZM9A 5F1ZA 1HCKA 3BV2A 5AR3A 2CGVA 2Y4IC 2QG5A 4H36A 5CSWA 2XNBA 4JBQA 3RWQA 3KN5A 2GSFA 2RFDA 2OWBA 2UW5A 4O6EA 1OUKA 2DQ7X 3E93A 4JRNA 3R9DA 4DEEA 3OUNB 3ORXA 3CJFA 1DI8A 5CSPA 2EVAA 3LPBA 2O8YA 5LWMA 2VWIA 3FMKA 1E9HA 4MD9E 2I40A 3MVMA 4EQUA 3DJ7A 3KRXA 3IKAA 4O7NA 2XARA 1KE7A 5HBHA 3RPYA 3UYSA 3PSCA 3OWJA 4I22A 1ZY5A 3TIYA 3SG8A 4XHKB 4FOBA 3OOGA 4IBMA 3TDVA 1CKIA 3MTFA 4PRJA 3PLAE 1KE6A 3PJ1A 3BYVA 1W0XC 4ZLZA 5CF8A 1U5QA 3UIXA 2X7FA 4WO5A 2PMIA 3CTHA 4L68A 4ZK5A 4U9AA 1A06A 3R7IA 1YI6A 2DYLA 4BCHA 1M7NA 4OR5A 4QTDA 3SXRA 3NW5A 3BHTA 2E2BA 3TACA 2BZJA 2IVTA 5C8NA 2X81A 2JIIA 1G8JA 2XK8A 4MAOA 2WTVA 4O91A 4U40A 5DRBA 2C1AA 3B8RA 4EOKA 2IJMA 4YJQA 2IVUA 3H30A 1QCFA 2ACXA 4FSUA 4HGEA 4CTCA 4IXPA 3W2SA 4WSQA 3W2QA 4K18A 5B2LA 3DBQA 3FMEA 3ZLXA 3OW4A 4GRBA 1Q41A 4ANMA 3KL8A 4J98A 4EKLA 4QP1A 4A9SA 4HVDA 3Q5ZA 3UQGA 4MBIA 3V5WA 3DXNA 4K6ZA 3VBXA 4C2VA 3ZLYA 4MXAA 5GZ9A 3OBGA 5CSVA 5GIPE 4DYMA 5J87A 1YDTE 5E8UA 4LOQA 3DLZA 2XM8A 5L2WA 2WAJA 3I0QA 5GNKA 1LUFA 3CP9A 2GNLA 1J91A 4LGDA 1ZMWA 3VS6A 5HQ0A 3EMGA 3FHRA 2OICA 3SRVA 4OUCA 3T3UA 3RAIA 2QOHA 5HVYA 3OY1A 4C7TA 2WHBA 2X8DA 2VTTA 4OTHA 2WZJA 3QQHA 1REKA 2R3FA 3C7QA 3Q9YA 4KBKA 3DXPA 4QP9A 5A4TA 4IE9A 2H8HA 4X2KA 2FB8A 2R64A 4O6LA 3AC3A 3CQUA 4V0GB 4FVQA 4QMOA 4UYNA 5T3QA 3KMWA 3TUCA 3FBVA 3TKHA 4IVDA 3HMOA 3IW6A 3ZSGA 3EQGA 1XH9A 3DY7A 3UC3A 4IWOA 5M4CA 4NKAA 1GZKA 4DH5A 3FUPA 1Q8WA 3V5QA 2JEDA 4AWIA 4OTRA 4ONAA 3B2WA 2PE1A 2OH4A 4ALVA 4YU2A 1WZYA 4F65A 5KCVA 3DDPA 2J7TA 2QO9A 2GMXA 3EIDA 4JT3A 4AN3A 4D5KA 1YXXA 3CY2A 5I4NA 5KMMA 4QDVA 1XJDA 3U9NA 1YWRA 4O27B 5IMXA 4R77A 4EK6A 3TUBA 4EJ7A 5M07A 4GIHA 1IA8A 3EFLA 4KS8A 3BEAA 1W84A 2ZDUA 3NUPA 3A60A 4F6UA 3ZFYA 4UMUA 3MH0A 4FIIA 4KSPA 3R9RA 3LKMA 3FZPA 3LZBA 3QU0A 3IW7A 4FK6A 4GSBA 4N6YA 5K0KA 3VRZA 4AU8A 4LQMA 2XIYA 3S3IA 4PPAA 4HNFA 4P7EA 4PMTA 5H2UA 3T3VA 5CANA 3UODA 4NM0A 3GU7A 4BDDA 3WF9A 4OBQA 4USFA 3TNIA 3L9PA 4NSTA 4FKQA 4QPMA 4YZDA 3TI1A 3DB6A 1NVRA 3FJQE 4A4OA 2Y8OA 3HDMA 3E64A 4FSTA 3QKLA 4IB1A 3RM7A 2O64A 4X7QA 3RNYA 4AQCA 4EK8A 3NIEA 5JRQA 2AC5A 4E3CA 3UOHA 4RJ4A 4C33A 2O2UA 1M2RA 2AQXA 3DLSA 4PL3A 4D5HA 4IAYA 3UP7A 4ZJVA 3OCBA 4KINA 1O6LA 3ZH8A 4QTBA 4CLJA 4I41A 1G8AA 3R7UA 3DNEA 4NCTC 3H0YA 4X2GA 3KFAA 5IA2A 4GVJA 4KWPA 5BYLA 3HYHA 2W4JA 4NU1A 5I0BA 5AX3A 4TPTA 3QRUA 4FT7A 2SRCA 4AN2A 1JPAA 4RLLA 5FDXA 4D4RA 5CS6A 4O84A 2BILB 3AGMA 3Q2JA 5CF4A 2X8IA 4RRVA 4DGGA 2PYWA 2PVJA 1L8TA 2IVVA 4FKLA 5E8ZA 4BDKA 1Q5KA 2G2HA 2IO6A 2WQBA 5DR6A 3U6IA 4MQ2A 4WHZA 4JMQA 3FKLA 3HP2A 2VWVA 3G5DA 5IKWA 4BWPA 2P33A 3LCSA 2BAQA 2V7OA 3NZ0A 3Q6WA 4IVCA 4LG4A 3Q53A 4DBNA 3N4UA 4FVPA 2X2MA 2JITA 5JZNA 2PMLX 2ZMCA 3UQCA 2GS6A 4L52A 5JZJA 1PXKA 3G0FA 3ZXTA 3CD3A 4DFNA 4QMMA 4AAYA 4NZWB 5AR2A 4DFUA 4FGRA 4AGDA 4RWKA 4YZBA 1Q3WA 4LL0A 4D0WA 5LVPA 4WBBB 5LJJA 5FTGA 4MF1A 4ZTNA 4CMUA 1LR4A 5J95A 3F5PA 5CQWA 4O38A 2X8EA 5C03A 3QCYA 2JDSA 3QQJA 2ZV7A 4C8BA 4FIEA 3IS5A 4MXCA 4RPVA 5CY3A 2CN5A 3OOMA 3ORZA 3I81A 4FBXA 4DH1A 3ALOA 4XG6A 3EH9A 2V0DA 1R0PA 2YERA 5FTOA 2UVYA 4ALUA 2DS1A 4PP9A 4C57A 3DPKA 3OF0A 3P23A 5M51A 4M8TA 2QU6A 3UOLA 3LVPA 4ZY5A 4PL4A 4TW9A 1J7UA 2EB3A 3NGAA 3OT8A 4H58A 5AIKA 3RVGA 3K3IA 4RFMA 2CPKE 1Q62A 1ZARA 2ESMA 3ACJA 4IVAA 1UNLA 4U41A 5DIAA 5DT0A 4FTQA 3GCSA 3ZZEA 4R78A 2ZJWA 2EWAA 3PG3A 4E1ZA 4R1YA 4NW6A 3Q32A 2YEXA 4BRXA 4YURA 2VN9A 3C0IA 4CKJA 1PMVA 1R78A 4WA9A 2O5KA 5LCKA 4J53A 4RIYB 5AP7A 5LARA 4BWXA 3QD2B 3ZLSA 3WE8A 2C6EA 5HIEA 2OW3A 4PDSA 4WIHA 4C35A 3HGKA 3FZ1A 4X0MA 4M84A 1TFFA 2VTSA 3LCKA 5AP2A 4AA4A 4ZJJA 3Q4CA 5AV0A 1ZYDA 5HX6A 3HLLA 4RC4A 3TJCA 4GK4A 3V5TA 2F7ZE 3KIOC 2IZTA 3ORMA 3TMOA 2YM5A 3SOCA 2B1PA 3QUDA 5CQUA 4D2SA 3HV5A 1PMUA 5E8XA 5HBJA 4G6OA 4AT5A 3DAJA 4CQEA 2W1DA 3VO3A 3QAME 3CE3A 3GI3A 4I94A 2GTMA 3LFBA 4IANA 3ID6C 2WEIA 4HYSA 1XR1A 3L8SA 3P1AA 2OXYA 4NM3A 5IMEA 4D58A 3GFWA 2R3IA 1BMKA 4W8EA 4U5JA 3PY1A 4YSMA 3MFRA 5LCJA 1TKIA 2XEZA 3IPHA 1FINA 4O4FA 1ZYCA 2PUPA 4FKPA 2IZSA 1O6KA 3A8WA 3BWFA 3IDBA 5KZ0A 4D2WA 4BCPA 3P79A 3UO4A 5FXRA 3TTIA 3DOGA 1GZNA 4LDTA 3AT4A 2X1NA 2YDKA 3D4QA 3TJDA 4QQTA 4O7ZA 2J0JA 3KCKA 4NFNA 2R3NA 3FI8A 4GG5A 5LQFA 4KABA 3MFTA 3FSKA 3F66A 4I3ZA 3GB2A 4QQCA 5FG8A 4IM2A 3ZLWA 5A46A 4YJVA 3FI2A 3ZS5A 4FTJA 3QXPA 3MA6A 4JDIA 5J9ZA 4LOPA 4JIAA 2X0PA 1NW1A 1Z5MA 3HV6A 4BGGA 4RFZA 4BCKA