3RDUA

Crystal structure of r7-2 streptavidin complexed with peg
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
124
structure length
124
Chain Sequence
b'TAEAGITGTWYNQLGSTLIVTAGADGALTGTYESAVGNAEGSYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSASTWSGQYVGGAEARINTQVLTTSGTTEANAWKSTLVGHDTFTKVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptavidin
publication title Evolved streptavidin mutants reveal key role of loop residue in high-affinity binding.
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Biotin binding protein
total genus 28
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2011-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 3rduA00
1MM9A 2BC3A 1SWPA 2RTDB 2IZAA 4YVBA 2IZLB 2OFAA 1STRB 1SRHA 2RTHB 3RE6A 5JD2A 4EKVA 1SWOA 2C1QA 1SWKA 3SZIA 3VHMA 1SWAA 1WBIA 1NC9A 2RTEB 4GGTA 2G5LA 2F01A 2A5CA 2RTOB 1MK5A 3RDXA 3T2XA 5B5GA 2C1SA 2QCBA 1LCWA 2RTIB 1KL4A 1SWTA 2Y32A 1SRFA 1I9HA 1SWFA 3RY1A 3PK2A 2RTRB 1SLDB 1IJ8A 1VWGB 1VWPB 1VWEB 1Y52X 2IZGB 4DNEA 3T6FA 2WPUA 1LDQA 1SWHA 1VWAB 2IZBA 1SWSA 2RTPB 4BJ8A 1VWFB 2A8GA 3WZQA 1RXJA 4Z28A 1VWBB 2IZHB 4Y5DA 2OFBA 3WZNA 3RDUA 1STSB 1SLFB 2IZJA 2IZDB 2IZCB 5CSEA 1N4JA 4BX6B 1MEPA 1VWQB 4CPEA 1NQMA 3RDMA 5B5FA 4CPFA 1KFFA 1SWUA 1HXLA 3MM0A 5F2BA 3WYPA 4CPIA 3RE5A 1SWBA 1NBXA 1HY2A 1AVDA 1SWLA 2RTCB 4GGZA 4BX6A 1NQNA 1VWHB 1HQQA 1SREA 2RTAA 1VWMB 2Y3FA 1VWNB 1VWLB 1VWKB 1AVEA 2UYWA 2RTKA 2CAMA 4JNJA 1LUQA 2RTMA 4Y59A 1N43A 2A5BA 2GH7A 2AVIA 3VHIA 2Y3EA 1VYOA 3EW2A 1VWDB 5L3YA 2FHLA 1SRGA 3RDSA 1Y55X 3RDQA 4Z6JA 5IRUA 2RTBB 1KL5A 1SWJA 1RXKA 1SWCA 2MF6A 4U46A 1SLEB 1VWCB 3MG5A 4Z27A 1SWRA 2RTLA 1NDJA 1SWQA 4GDAA 1VWOB 5IRAA 1N9MA 2IZFB 1RSTB 2RTQB 3RDOA 3SZHA 2RTNB 4Z2PA 3WZPA 2UZ2A 3EW1A 3T6LA 1LDOA 1VWRB 4BBOA 4BCSA 1HXZA 1N9YA 1SRIA 4BX5B 5IRWA 3T2WA 2C4IA 4Z2VA 4IRWA 1RSUB 2RTGB 3WYQA 4GD9A 2JGSA 4GJVA 2IZEB 4BX7A 4CPHB 2OF9A 4OKAA 1LELA 1SRJA 2IZIA 4GJSA 2ZSCA 4JHQA 4JO6A 1MOYA 4BX5A 1KL3A 5K67A 3SZJA 1LCVA 3X00A 4GGRA 1LCZA 4CPHA 1SWGA 1RAVA 3WZOA 3FDCA 1SWEA 2RTFB 3VHHA 1N7YA 1STPA 5K68A 1Y53X 1SLGB 2IZKA 1RXHA 2RTJA 1PTSA 5CHKA 2FHNX 4I60A 1SWDA 1SWNA 4BX7B 1DF8A 1VWIB 4Z2OA 3RY2A 3VGWA 1VWJB 2OF8A
chains in the Genus database with same CATH superfamily
3KZAA 1K24A 3RZYA 1SWPA 4ZR2A 2AMMX 4QZUA 4UU3A 4YVBA 3KFFA 1L6MA 2QO6A 3TGAA 1GT3A 4NYRA 3KFHA 3FW4A 1ERXA 1MX8A 2G79A 2L5PA 1GX8A 3FA7A 4EKVA 1WUBA 1SWKA 4M6SA 3OJYC 1SWAA 2JOZA 4GGTA 4L3RA 4O3WA 2G5LA 3APXA 2F01A 2X32A 3APVA 2AT6X 2FGSA 4O3XB 1E5PA 4I3BA 5B3MO 2DJGA 5B11O 4TKJA 1OSPO 1KL4A 2NNEA 1AQBA 5H9AA 1I9HA 5BYPA 1O1VA 2FWVA 4NYQA 5B2AO 2WEWA 2RTRB 2FS6A 2X56A 1TOUA 2IZGB 4DNEA 4HWMA 1G5WA 3BSZE 1VWAB 5EZ2A 3DTQA 2RTPB 3KFGA 2GTFX 1HBQA 3C77X 3BRNA 3FEPA 2HZQA 2IFBA 4NLIA 5HTEA 3STMX 1STSB 1ZNGA 2IZJA 3B2LA 5CSEA 4ZJ0A 1N4JA 3S26A 1BSQA 5D47A 1MEPA 4IB6A 2M4LA 1VWQB 2F09A 3RDMA 4CPFA 4K19A 5B5FA 3MM0A 1KXOA 3RE5A 5HCCC 1NBXA 1A18A 4MVIA 4GGZA 5F6BA 1GKAB 4YCHA 3S60A 4TKHA 1NQNA 4ZHHA 2MWHA 4R0BA 2X8FA 1JZUA 2RTAA 4OMXA 1VWNB 1VWLB 5B29A 1YIVA 2RTKA 5LJBA 1N43A 4EXZA 1I06A 4YFPA 1JJJA 2Q39A 2RD7C 4FQBB 3VG6A 3B2HA 3N91A 1SXXA 1EIIA 4TNNA 5IRUA 1VPRA 2A13A 1GX9A 1P6PA 2RN4A 1ZNEA 1KL5A 2RTBB 2VFBA 2WWPA 4KCAA 5F1EA 3MVFA 1MDCA 4MVLA 4IBAA 5EPQA 3P6DA 1VWCB 1JYJA 1CRBA 2AH7X 1KT7A 3EMMA 5HBSA 4ALBA 3HPEA 4ZHFA 4IMNA 4ON1A 1ZNDA 3APWA 1QY0A 2FTBA 3BY0A 3D96A 4OELA 2IZFB 4PSQA 4MEEA 5HZQA 4C5PA 1A2DA 2I5ZO 2YG2A 3I17A 5BVSA 2AT8X 3WXQA 4U3QA 3KFIA 1SXUA 5HA0A 1LDOA 3T6LA 1BEBA 4ZH6A 4BCSA 1HXZA 4B55A 2OY7A 5DG4A 1DZMA 4GU8A 2F73A 1X89A 3FA9A 5DPQA 1NP4A 1CBRA 1RSUB 2E4JA 3SOTA 1SY1A 2JGSA 4U8UM 3HWDA 1OBPA 3FA8A 1FENA 2XKLA 4GJSA 5FFHA 2HNXA 1I78A 4JHQA 2R56A 4JO6A 1YWAA 2OL8O 1O1UA 1KT6A 2OY1O 4M7MA 3FR5A 2WQAE 5HTDA 1QFVA 4O49A 4COTA 1LCZA 1ICMA 2HZRA 4MVKA 4N7DA 1IIUA 3FENA 1RAVA 4YKMA 4A1YA 3F6ZB 4YGHA 3RSWA 4A60A 2OVAA 3TF6A 2HLVA 2NP1A 2RCQA 1GM6A 1QY2A 1STPA 3FIQA 1Y53X 3PQUA 4ID2A 4NNSA 2G78A 2BS5A 2FHNX 4I60A 4NP1A 2O62A 5HCDC 3TGBA 1SWNA 4WFVA 4BX7B 4ZHDA 2JW1A 4QRLA 4I3DA 4LKPA 5EEEA 1ZNKA 5IO6A 1T8VA 5D8JA 4YFQA 1LIDA 2IZAA 2RTDB 3EBWA 3WJGA 2HYSA 1E06A 1B56A 3RE6A 3WJCA 2HKDA 5D4AA 3U9PC 3VG2A 2JU7A 2C1QA 2QM9A 3C78X 3BX8A 3FYFA 1OBQA 1PBYA 4HPAA 1ML7A 4HPCA 5KICA 4I3CA 1WBIA 1NC9A 2RTEB 4I6SA 2X34A 1LICA 5H9LA 5LJCA 2RTOB 3FR4A 3T2XA 4NV7A 2C1SA 1JIWI 4O4SA 1LCWA 1UYNX 3EYCA 1HMTA 2W2AA 3P6HA 2R73A 4CDEA 5HWZA 1SRFA 1ZRYA 3JQOA 1BSYA 2A2GA 1GGLA 2OYBO 1BRQA 1SLDB 2QOSC 3FEKA 3MBTA 2JN3A 1VWPB 4YBUA 4CDDA 3T6FA 3VG3A 3ZW1B 1U18A 3ELZA 3LHNA 5CYBA 4CDCA 1SWHA 2IZBA 5AQ6A 3AEHA 4XMDA 4YDAA 1SWSA 2LFOA 4YCEA 1VWFB 3FW5A 1E02A 1MX7A 3MX7A 4BJ8A 4MISA 1LIEA 4GUZA 1NGLA 4Y5DA 4ZHCA 4ORWA 1BM5A 3O22A 3ZW1A 2Z4IA 3WZNA 5IXGA 4KC8A 1SLFB 4Y0PA 2BHVA 1KT3A 1U17A 4GNWA 4XMGA 5LJGA 3EBKA 1QABE 2OZQA 1KFFA 5FQ6E 1HXLA 4ARHA 4NV8A 4YGGA 4CK4A 5L8NA 5FENA 5L8OA 3QQ2A 3APUA 1ERBA 1XCAA 3B2KA 1FDQA 1R0UA 1X8NA 2YMSA 3PH5A 1EPAA 4OS3A 5BVQA 1K3BA 3P6CA 3FIDA 4OS0A 2L68A 1VWMB 4IAXA 4QNIA 1PM1X 3NADA 2LBVA 2UYWA 1ICNA 5EDCA 2A5BA 2ZAIA 4QQ1A 4WBKA 3VHIA 3QKGA 5HA1A 5LJHA 3LTWA 1I04A 3IFBA 3Q34A 2FHLA 3V8UA 1SRGA 4ORSA 1DZJA 4QGWA 1MUPA 2ALLX 2XSTA 1GX3A 4AZNA 4DQ4A 3NX2A 2LB6A 3WVMA 4AZOA 3E3CA 1SLEB 4TQ2A 4U8UO 2A2UA 5FAZA 3WBGA 4AZMA 2LA7A 1NDJA 1QFTA 2JMBA 4ZGUA 1X8OA 1EI5A 3CR6A 4GETA 5IRAA 1FELA 4YBPA 1RSTB 4IMOA 3RDOA 3SZHA 4GKCA 4Z2PA 1SY3A 3EW1A 1RLBE 1VWRB 4OS8A 3SLOA 2JU3A 4BX5B 2FLJA 4NNTA 1X71A 2W2BA 3NQ3A 3NP1A 4O4OA 4IRWA 4QGVA 4IB7A 3WYQA 4N7CA 1HQPA 4GD9A 4GJVA 1ADLA 3EC5A 2IZEB 5EDBA 1DZKA 4OKAA 1LIBA 1LELA 2AL0X 2W2FA 3HK1A 4HPBA 3U0DA 3FELA 4AYHA 4BX5A 5IO5A 3RKGA 5K67A 3AUMO 2G8CO 2CM4A 2NNQA 1G85A 4TJZA 1EALA 1QG5A 1LCVA 3HTYA 3D95A 4ORRA 1FE3A 1OPBA 1UREA 5B27A 1JJUA 1A57A 1FJ1E 1SWEA 2RTFB 3FA6A 4BVMA 2FR3A 2X55A 1SLGB 2RTJA 1RXHA 1NP1A 2GTLO 2R74A 4U9CA 4AZRA 1KT4A 3OE3A 3L4RA 1PBOA 1X8PA 3D97A 2X4MA 4YH0A 3ELXA 3RY2A 2A0AA 3IA8A 1VWJB 2OF8A 2ZAGA 1MM9A 1LNMA 4AW8A 1HN2A 1D3SA 1LFOA 3T1DA 2VDFA 4BOEA 2IZLB 2OFAA 1SRHA 1SXYA 4YMYA 5JD2A 4EFGA 1SWOA 3SLTA 2KT4B 1LIFA 4IB8A 3SZIA 1RBPA 4ALOA 1MVGA 3BS2A 5H9KA 2QOMA 2X8SA 1GT4A 2AF5A 3PQSA 4WHIA 2RA6A 4LQZA 5C0NA 3CWKA 1IFBA 5EEDA 3ZW2A 4TKBA 1JV4A 3BLGA 4A1HA 1E2TA 3PPTA 4QZTA 1ACDA 1IJ8A 1KQWA 2ANSA 4ZHGA 3P6GA 5HCEC 2LKKA 2WPUA 1LDQA 3FLLA 2X46A 3VG7A 1IKEA 3LV4A 2HMBA 2PY1A 2A8GA 3WZQA 1I05A 1D2UA 1SMPI 4Z28A 3O2YA 4YKOA 1VWBB 2IZHB 1JQPA 5FQ8E 4IAWA 3P02A 1KQXA 4I9RA 4Y0SA 3UEUA 3WJBA 4BX6B 4CDFA 2BSZA 5AEOA 4GRJA 2GTLM 3DSZA 2CBSA 1SWUA 1LKEA 5F2BA 3WYPA 4CPIA 3ZZVA 4MIRA 4QAEA 3HWGA 2RTCB 2ACPX 4BX6A 1VWHB 3NQKA 2WR6A 2ACOA 1A3YA 1HQQA 2BS6A 3BU1A 1SREA 5KHPA 4LZVA 3BDRA 4OMWA 2AT0X 3NR3A 1EIOA 3Q6LA 2CAMA 3CKFA 4JNJA 3BU9A 4L1NA 3HWFA 1YP7A 4Y59A 3SLJA 2GH7A 2AVIA 3VU1A 4YFRA 1VYOA 1VWDB 1YWCA 3F9DA 4LKTA 5L3YA 3VE1A 4A8ZA 1W4TA 3RDSA 3RDQA 1Y55X 4XMHA 2WQ9A 2RQ0A 2LBAA 1PMPA 3GE2A 1T68X 3NBXX 3UEXA 1QY1A 4ML7B 3UAQA 4GH7A 5K06A 1JJXA 1SWCA 4XMFA 4INNA 4ZH9A 4MVEA 1Y9TA 1DF3A 3S5VA 2MF6A 2CZUA 3KQ0A 4GZVA 4U46A 2FKJA 2OFMX 2FR2A 3MG5A 4AZPA 1I4UA 2FS7A 1HMRA 1SWQA 4GDAA 3ZI8A 4CV7A 1YWBA 1N9MA 2RTQB 1T0VA 1SA8A 4QGXA 5LKFA 1O8VA 1TW4A 2Q2PA 3ZW0A 5L8IA 1B0OA 1E00A 2I5VO 1S44A 2C4IA 3CBSA 1BJ7A 5D48A 3RBYA 2RTGB 3T2WA 3AKMA 2MM3A 5AJCA 1KZWA 2DJFA 2MJIA 3OD9A 2OF9A 1Y0GA 4Y0QA 1OBUA 1HMSA 3U03A 1W5RA 3KVNA 1MOYA 1ZNHA 2Q2MA 3B2JA 1Y9LA 2BLGA 4FGIB 4KIIA 4O9SA 4Y0RA 3BX7A 4FBRA 2OL7A 2AT5X 1ZNLA 1SWGA 1S2PA 2KW1A 2Z4HA 1EUOA 2POAA 3NX1A 3UEVA 3WZOA 5BVTA 4DCBA 3VHHA 3H3IA 1N7YA 1EPBA 1PEEA 1FEMA 2QMIA 4BQUA 4HFOA 2KD2A 2OL6O 1JBHA 2EU7X 4ZFXA 1JMZA 1SWDA 2MO5A 1DF8A 4Z2OA 2N93A 2K23A 3VGWA 3WOVA 3WJEA 1QQSA 1TOWA 2BC3A 1B8EA 3FR2A 3TGCA 4HPDA 4U8UN 5LJEA 4IB9A 1SY2A 1AELA 1STRB 2RTHB 3D9WA 2A3FX 3HOLA 4YDBA 1JMXA 3EM0A 1LF7A 3VHMA 2QO5A 1AB0A 4FBOA 5AJBA 1W6FA 5HZ9A 2A5CA 3PECA 1MK5A 3RDXA 5HZ6A 2OFRX 4LZUA 1SXWA 1UZ2X 5B5GA 2QCBA 5CE4A 2RTIB 4IABA 1SWTA 2Y32A 2FRSA 4ZGFA 4AZQA 1BRPA 3HWEA 2K62A 1SWFA 3VE2A 3RY1A 1TXLA 3PK2A 2L9CA 1VWGB 1VWEB 1Y52X 2RCTA 2X45A 4O4UA 5D45A 3K3LA 4NW4A 1XKIA 1BSOA 4RUUA 1GKAA 3ZUIA 1DV9A 4ES7A 3STKA 3PDFA 1VYGA 1IFCA 1CBIA 1RXJA 1OEEA 1VYFA 2GJ5A 1HBPA 2QO4A 2OY5O 1KZXA 4I95A 3CKGA 1TVQA 4DQ3A 4EEJA 2FKGA 1S7DA 2OFBA 1AVGI 5LJDA 3RDUA 2IZDB 2MHDA 1KGLA 2IZCB 3WJFA 5B10O 2GTLN 2WSJA 3P24A 1BBPA 5HZ5A 4CPEA 3C76X 3B2IA 2CM9A 1NQMA 1DFVA 2Q4NA 4ORXA 2Q9SA 2DM5A 3PH6A 2AKQA 2P8GA 1YUPA 1LPJA 3ZQ3A 1SWBA 1QWDA 3JS1A 3NPOA 4D6AA 3S5XA 1HY2A 1AVDA 1SWLA 1IKJA 4YGZA 2L67A 3RWXA 4BGFA 4ODDA 4XMCA 3GAQA 1CBQA 2Y3FA 1FTPA 3HOEA 1VWKB 1AVEA 4QYNA 1N0SA 1BLRA 3OBLA 3ZUOA 1LUQA 2RTMA 1U0XA 3CMPA 4PJ2A 2WEXA 3FMZA 3PEDA 5LJKA 2ASNX 2Y3EA 3EW2A 1BWYA 5HAEA 3I0AA 5F6ZA 5IO7A 3P6EA 4KT5A 1EQDA 4GDZA 3VPJE 1GT5A 1DZPA 1YWDA 3CQRA 1YP6A 2GC9A 4O3YA 3WJDA 3PP6A 4Z6JA 1ALBA 2KTSA 1SWJA 1RXKA 4ORYA 5HZ8A 5KIDA 3ZWEA 4OEMA 3TZSA 1JYDA 3STNA 4NLJA 1GXAA 1OEJA 2OVDA 2AT3X 4ZCBA 4I9SA 2OVEA 3P6FA 4Z27A 4GE1A 1SWRA 1EXSA 2RTLA 2VFCA 2CZTA 1G7NA 2CBRA 2NNDA 1OEKA 4D6BA 1X8UA 3CQNA 4CSBA 4TLJA 4KC7A 1VWOB 4EDEA 3SAOA 4EQAC 5FQ7E 1KT5A 2RTNB 3AKNA 5LKEA 1Z24A 1EW3A 4JGLA 2UZ2A 2OVSA 4KH8A 3WZPA 4BBOA 1CBSA 2G7BA 3NQ9A 3O19A 1N9YA 1SRIA 3D4RA 5IRWA 4Z2VA 5H9NA 1UYOX 4QYPA 5JR8A 4GNYA 1X8QA 1IW2A 3G7XA 4BX7A 3CBCA 4CPHB 1SRJA 2IZIA 4O3ZA 3VG4A 2ZSCA 3UEWA 1KOIA 1KL3A 3JSQA 5F58A 1B4MA 5H8TA 3SZJA 3X00A 4XMEA 4GGRA 2PI3O 1H91A 2BT9A 4CPHA 1SY0A 1DC9A 2WUTA 4ORUA 4UU2A 3ZW0B 3FDCA 4GK9A 1G74A 2JU8A 4WFUA 1CJ5A 5K68A 4FBVA 1OPAA 2FT9A 2IZKA 4RUNA 1PTSA 3VG5A 5CHKA 4O4XA 1VWIB 2OY8A 3F8AA 5F7GA 2KTDA 2X8TA 1GT1A
chains in the Genus database with same CATH topology
1MM9A 2BC3A 1SWPA 2RTDB 2IZAA 4YVBA 2IZLB 2OFAA 1STRB 1SRHA 2RTHB 3RE6A 5JD2A 4EKVA 1SWOA 2C1QA 1SWKA 3SZIA 3VHMA 1SWAA 1WBIA 1NC9A 2RTEB 4GGTA 2G5LA 2F01A 2A5CA 2RTOB 1MK5A 3RDXA 3T2XA 5B5GA 2C1SA 2QCBA 1LCWA 2RTIB 1KL4A 1SWTA 2Y32A 1SRFA 1I9HA 1SWFA 3RY1A 3PK2A 2RTRB 1SLDB 1IJ8A 1VWGB 1VWPB 1VWEB 1Y52X 2IZGB 4DNEA 3T6FA 2WPUA 1LDQA 1SWHA 1VWAB 2IZBA 1SWSA 2RTPB 4BJ8A 1VWFB 2A8GA 3WZQA 1RXJA 4Z28A 1VWBB 2IZHB 4Y5DA 2OFBA 3WZNA 3RDUA 1STSB 1SLFB 2IZJA 2IZDB 2IZCB 5CSEA 1N4JA 4BX6B 1MEPA 1VWQB 4CPEA 1NQMA 3RDMA 5B5FA 4CPFA 1KFFA 1SWUA 1HXLA 3MM0A 5F2BA 3WYPA 4CPIA 3RE5A 1SWBA 1NBXA 1HY2A 1AVDA 1SWLA 2RTCB 4GGZA 4BX6A 1NQNA 1VWHB 1HQQA 1SREA 2RTAA 1VWMB 2Y3FA 1VWNB 1VWLB 1VWKB 1AVEA 2UYWA 2RTKA 2CAMA 4JNJA 1LUQA 2RTMA 4Y59A 1N43A 2A5BA 2GH7A 2AVIA 3VHIA 2Y3EA 1VYOA 3EW2A 1VWDB 5L3YA 2FHLA 1SRGA 3RDSA 1Y55X 3RDQA 4Z6JA 5IRUA 2RTBB 1KL5A 1SWJA 1RXKA 1SWCA 2MF6A 4U46A 1SLEB 1VWCB 3MG5A 4Z27A 1SWRA 2RTLA 1NDJA 1SWQA 4GDAA 1VWOB 5IRAA 1N9MA 2IZFB 1RSTB 2RTQB 3RDOA 3SZHA 2RTNB 4Z2PA 3WZPA 2UZ2A 3EW1A 3T6LA 1LDOA 1VWRB 4BBOA 4BCSA 1HXZA 1N9YA 1SRIA 4BX5B 5IRWA 3T2WA 2C4IA 4Z2VA 4IRWA 1RSUB 2RTGB 3WYQA 4GD9A 2JGSA 4GJVA 2IZEB 4BX7A 4CPHB 2OF9A 4OKAA 1LELA 1SRJA 2IZIA 4GJSA 2ZSCA 4JHQA 4JO6A 1MOYA 4BX5A 1KL3A 5K67A 3SZJA 1LCVA 3X00A 4GGRA 1LCZA 4CPHA 1SWGA 1RAVA 3WZOA 3FDCA 1SWEA 2RTFB 3VHHA 1N7YA 1STPA 5K68A 1Y53X 1SLGB 2IZKA 1RXHA 2RTJA 1PTSA 5CHKA 2FHNX 4I60A 1SWDA 1SWNA 4BX7B 1DF8A 1VWIB 4Z2OA 3RY2A 3VGWA 1VWJB 2OF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MM9 A;  2BC3 A;  1SWP A;  2RTD B;  2IZA A;  4YVB A;  2IZL B;  2OFA A;  1STR B;  1SRH A;  2RTH B;  3RE6 A;  5JD2 A;  4EKV A;  1SWO A;  2C1Q A;  1SWK A;  3SZI A;  3VHM A;  1SWA A;  1WBI A;  1NC9 A;  2RTE B;  4GGT A;  2G5L A;  2F01 A;  2A5C A;  2RTO B;  1MK5 A;  3RDX A;  3T2X A;  5B5G A;  2C1S A;  2QCB A;  1LCW A;  2RTI B;  1KL4 A;  1SWT A;  2Y32 A;  1SRF A;  1I9H A;  1SWF A;  3RY1 A;  3PK2 A;  2RTR B;  1SLD B;  1IJ8 A;  1VWG B;  1VWP B;  1VWE B;  1Y52 X;  2IZG B;  4DNE A;  3T6F A;  2WPU A;  1LDQ A;  1SWH A;  1VWA B;  2IZB A;  1SWS A;  2RTP B;  4BJ8 A;  1VWF B;  2A8G A;  3WZQ A;  1RXJ A;  4Z28 A;  1VWB B;  2IZH B;  4Y5D A;  2OFB A;  3WZN A;  3RDU A;  1STS B;  1SLF B;  2IZJ A;  2IZD B;  2IZC B;  5CSE A;  1N4J A;  4BX6 B;  1MEP A;  1VWQ B;  4CPE A;  1NQM A;  3RDM A;  5B5F A;  4CPF A;  1KFF A;  1SWU A;  1HXL A;  3MM0 A;  5F2B A;  3WYP A;  4CPI A;  3RE5 A;  1SWB A;  1NBX A;  1HY2 A;  1AVD A;  1SWL A;  2RTC B;  4GGZ A;  4BX6 A;  1NQN A;  1VWH B;  1HQQ A;  1SRE A;  2RTA A;  1VWM B;  2Y3F A;  1VWN B;  1VWL B;  1VWK B;  1AVE A;  2UYW A;  2RTK A;  2CAM A;  4JNJ A;  1LUQ A;  2RTM A;  4Y59 A;  1N43 A;  2A5B A;  2GH7 A;  2AVI A;  3VHI A;  2Y3E A;  1VYO A;  3EW2 A;  1VWD B;  5L3Y A;  2FHL A;  1SRG A;  3RDS A;  1Y55 X;  3RDQ A;  4Z6J A;  5IRU A;  2RTB B;  1KL5 A;  1SWJ A;  1RXK A;  1SWC A;  2MF6 A;  4U46 A;  1SLE B;  1VWC B;  3MG5 A;  4Z27 A;  1SWR A;  2RTL A;  1NDJ A;  1SWQ A;  4GDA A;  1VWO B;  5IRA A;  1N9M A;  2IZF B;  1RST B;  2RTQ B;  3RDO A;  3SZH A;  2RTN B;  4Z2P A;  3WZP A;  2UZ2 A;  3EW1 A;  3T6L A;  1LDO A;  1VWR B;  4BBO A;  4BCS A;  1HXZ A;  1N9Y A;  1SRI A;  4BX5 B;  5IRW A;  3T2W A;  2C4I A;  4Z2V A;  4IRW A;  1RSU B;  2RTG B;  3WYQ A;  4GD9 A;  2JGS A;  4GJV A;  2IZE B;  4BX7 A;  4CPH B;  2OF9 A;  4OKA A;  1LEL A;  1SRJ A;  2IZI A;  4GJS A;  2ZSC A;  4JHQ A;  4JO6 A;  1MOY A;  4BX5 A;  1KL3 A;  5K67 A;  3SZJ A;  1LCV A;  3X00 A;  4GGR A;  1LCZ A;  4CPH A;  1SWG A;  1RAV A;  3WZO A;  3FDC A;  1SWE A;  2RTF B;  3VHH A;  1N7Y A;  1STP A;  5K68 A;  1Y53 X;  1SLG B;  2IZK A;  1RXH A;  2RTJ A;  1PTS A;  5CHK A;  2FHN X;  4I60 A;  1SWD A;  1SWN A;  4BX7 B;  1DF8 A;  1VWI B;  4Z2O A;  3RY2 A;  3VGW A;  1VWJ B;  2OF8 A; 
#chains in the Genus database with same CATH topology
 3KZA A;  1K24 A;  3RZY A;  1SWP A;  4ZR2 A;  2AMM X;  4QZU A;  4UU3 A;  4YVB A;  3KFF A;  1L6M A;  2QO6 A;  3TGA A;  1GT3 A;  4NYR A;  3KFH A;  3FW4 A;  1ERX A;  1MX8 A;  2G79 A;  2L5P A;  1GX8 A;  3FA7 A;  4EKV A;  1WUB A;  1SWK A;  4M6S A;  3OJY C;  1SWA A;  2JOZ A;  4GGT A;  4L3R A;  4O3W A;  2G5L A;  3APX A;  2F01 A;  2X32 A;  3APV A;  2AT6 X;  2FGS A;  4O3X B;  1E5P A;  4I3B A;  5B3M O;  2DJG A;  5B11 O;  4TKJ A;  1OSP O;  1KL4 A;  2NNE A;  1AQB A;  5H9A A;  1I9H A;  5BYP A;  1O1V A;  2FWV A;  4NYQ A;  5B2A O;  2WEW A;  2RTR B;  2FS6 A;  2X56 A;  1TOU A;  2IZG B;  4DNE A;  4HWM A;  1G5W A;  3BSZ E;  1VWA B;  5EZ2 A;  3DTQ A;  2RTP B;  3KFG A;  2GTF X;  1HBQ A;  3C77 X;  3BRN A;  3FEP A;  2HZQ A;  2IFB A;  4NLI A;  5HTE A;  3STM X;  1STS B;  1ZNG A;  2IZJ A;  3B2L A;  5CSE A;  4ZJ0 A;  1N4J A;  3S26 A;  1BSQ A;  5D47 A;  1MEP A;  4IB6 A;  2M4L A;  1VWQ B;  2F09 A;  3RDM A;  4CPF A;  4K19 A;  5B5F A;  3MM0 A;  1KXO A;  3RE5 A;  5HCC C;  1NBX A;  1A18 A;  4MVI A;  4GGZ A;  5F6B A;  1GKA B;  4YCH A;  3S60 A;  4TKH A;  1NQN A;  4ZHH A;  2MWH A;  4R0B A;  2X8F A;  1JZU A;  2RTA A;  4OMX A;  1VWN B;  1VWL B;  5B29 A;  1YIV A;  2RTK A;  5LJB A;  1N43 A;  4EXZ A;  1I06 A;  4YFP A;  1JJJ A;  2Q39 A;  2RD7 C;  4FQB B;  3VG6 A;  3B2H A;  3N91 A;  1SXX A;  1EII A;  4TNN A;  5IRU A;  1VPR A;  2A13 A;  1GX9 A;  1P6P A;  2RN4 A;  1ZNE A;  1KL5 A;  2RTB B;  2VFB A;  2WWP A;  4KCA A;  5F1E A;  3MVF A;  1MDC A;  4MVL A;  4IBA A;  5EPQ A;  3P6D A;  1VWC B;  1JYJ A;  1CRB A;  2AH7 X;  1KT7 A;  3EMM A;  5HBS A;  4ALB A;  3HPE A;  4ZHF A;  4IMN A;  4ON1 A;  1ZND A;  3APW A;  1QY0 A;  2FTB A;  3BY0 A;  3D96 A;  4OEL A;  2IZF B;  4PSQ A;  4MEE A;  5HZQ A;  4C5P A;  1A2D A;  2I5Z O;  2YG2 A;  3I17 A;  5BVS A;  2AT8 X;  3WXQ A;  4U3Q A;  3KFI A;  1SXU A;  5HA0 A;  1LDO A;  3T6L A;  1BEB A;  4ZH6 A;  4BCS A;  1HXZ A;  4B55 A;  2OY7 A;  5DG4 A;  1DZM A;  4GU8 A;  2F73 A;  1X89 A;  3FA9 A;  5DPQ A;  1NP4 A;  1CBR A;  1RSU B;  2E4J A;  3SOT A;  1SY1 A;  2JGS A;  4U8U M;  3HWD A;  1OBP A;  3FA8 A;  1FEN A;  2XKL A;  4GJS A;  5FFH A;  2HNX A;  1I78 A;  4JHQ A;  2R56 A;  4JO6 A;  1YWA A;  2OL8 O;  1O1U A;  1KT6 A;  2OY1 O;  4M7M A;  3FR5 A;  2WQA E;  5HTD A;  1QFV A;  4O49 A;  4COT A;  1LCZ A;  1ICM A;  2HZR A;  4MVK A;  4N7D A;  1IIU A;  3FEN A;  1RAV A;  4YKM A;  4A1Y A;  3F6Z B;  4YGH A;  3RSW A;  4A60 A;  2OVA A;  3TF6 A;  2HLV A;  2NP1 A;  2RCQ A;  1GM6 A;  1QY2 A;  1STP A;  3FIQ A;  1Y53 X;  3PQU A;  4ID2 A;  4NNS A;  2G78 A;  2BS5 A;  2FHN X;  4I60 A;  4NP1 A;  2O62 A;  5HCD C;  3TGB A;  1SWN A;  4WFV A;  4BX7 B;  4ZHD A;  2JW1 A;  4QRL A;  4I3D A;  4LKP A;  5EEE A;  1ZNK A;  5IO6 A;  1T8V A;  5D8J A;  4YFQ A;  1LID A;  2IZA A;  2RTD B;  3EBW A;  3WJG A;  2HYS A;  1E06 A;  1B56 A;  3RE6 A;  3WJC A;  2HKD A;  5D4A A;  3U9P C;  3VG2 A;  2JU7 A;  2C1Q A;  2QM9 A;  3C78 X;  3BX8 A;  3FYF A;  1OBQ A;  1PBY A;  4HPA A;  1ML7 A;  4HPC A;  5KIC A;  4I3C A;  1WBI A;  1NC9 A;  2RTE B;  4I6S A;  2X34 A;  1LIC A;  5H9L A;  5LJC A;  2RTO B;  3FR4 A;  3T2X A;  4NV7 A;  2C1S A;  1JIW I;  4O4S A;  1LCW A;  1UYN X;  3EYC A;  1HMT A;  2W2A A;  3P6H A;  2R73 A;  4CDE A;  5HWZ A;  1SRF A;  1ZRY A;  3JQO A;  1BSY A;  2A2G A;  1GGL A;  2OYB O;  1BRQ A;  1SLD B;  2QOS C;  3FEK A;  3MBT A;  2JN3 A;  1VWP B;  4YBU A;  4CDD A;  3T6F A;  3VG3 A;  3ZW1 B;  1U18 A;  3ELZ A;  3LHN A;  5CYB A;  4CDC A;  1SWH A;  2IZB A;  5AQ6 A;  3AEH A;  4XMD A;  4YDA A;  1SWS A;  2LFO A;  4YCE A;  1VWF B;  3FW5 A;  1E02 A;  1MX7 A;  3MX7 A;  4BJ8 A;  4MIS A;  1LIE A;  4GUZ A;  1NGL A;  4Y5D A;  4ZHC A;  4ORW A;  1BM5 A;  3O22 A;  3ZW1 A;  2Z4I A;  3WZN A;  5IXG A;  4KC8 A;  1SLF B;  4Y0P A;  2BHV A;  1KT3 A;  1U17 A;  4GNW A;  4XMG A;  5LJG A;  3EBK A;  1QAB E;  2OZQ A;  1KFF A;  5FQ6 E;  1HXL A;  4ARH A;  4NV8 A;  4YGG A;  4CK4 A;  5L8N A;  5FEN A;  5L8O A;  3QQ2 A;  3APU A;  1ERB A;  1XCA A;  3B2K A;  1FDQ A;  1R0U A;  1X8N A;  2YMS A;  3PH5 A;  1EPA A;  4OS3 A;  5BVQ A;  1K3B A;  3P6C A;  3FID A;  4OS0 A;  2L68 A;  1VWM B;  4IAX A;  4QNI A;  1PM1 X;  3NAD A;  2LBV A;  2UYW A;  1ICN A;  5EDC A;  2A5B A;  2ZAI A;  4QQ1 A;  4WBK A;  3VHI A;  3QKG A;  5HA1 A;  5LJH A;  3LTW A;  1I04 A;  3IFB A;  3Q34 A;  2FHL A;  3V8U A;  1SRG A;  4ORS A;  1DZJ A;  4QGW A;  1MUP A;  2ALL X;  2XST A;  1GX3 A;  4AZN A;  4DQ4 A;  3NX2 A;  2LB6 A;  3WVM A;  4AZO A;  3E3C A;  1SLE B;  4TQ2 A;  4U8U O;  2A2U A;  5FAZ A;  3WBG A;  4AZM A;  2LA7 A;  1NDJ A;  1QFT A;  2JMB A;  4ZGU A;  1X8O A;  1EI5 A;  3CR6 A;  4GET A;  5IRA A;  1FEL A;  4YBP A;  1RST B;  4IMO A;  3RDO A;  3SZH A;  4GKC A;  4Z2P A;  1SY3 A;  3EW1 A;  1RLB E;  1VWR B;  4OS8 A;  3SLO A;  2JU3 A;  4BX5 B;  2FLJ A;  4NNT A;  1X71 A;  2W2B A;  3NQ3 A;  3NP1 A;  4O4O A;  4IRW A;  4QGV A;  4IB7 A;  3WYQ A;  4N7C A;  1HQP A;  4GD9 A;  4GJV A;  1ADL A;  3EC5 A;  2IZE B;  5EDB A;  1DZK A;  4OKA A;  1LIB A;  1LEL A;  2AL0 X;  2W2F A;  3HK1 A;  4HPB A;  3U0D A;  3FEL A;  4AYH A;  4BX5 A;  5IO5 A;  3RKG A;  5K67 A;  3AUM O;  2G8C O;  2CM4 A;  2NNQ A;  1G85 A;  4TJZ A;  1EAL A;  1QG5 A;  1LCV A;  3HTY A;  3D95 A;  4ORR A;  1FE3 A;  1OPB A;  1URE A;  5B27 A;  1JJU A;  1A57 A;  1FJ1 E;  1SWE A;  2RTF B;  3FA6 A;  4BVM A;  2FR3 A;  2X55 A;  1SLG B;  2RTJ A;  1RXH A;  1NP1 A;  2GTL O;  2R74 A;  4U9C A;  4AZR A;  1KT4 A;  3OE3 A;  3L4R A;  1PBO A;  1X8P A;  3D97 A;  2X4M A;  4YH0 A;  3ELX A;  3RY2 A;  2A0A A;  3IA8 A;  1VWJ B;  2OF8 A;  2ZAG A;  1MM9 A;  1LNM A;  4AW8 A;  1HN2 A;  1D3S A;  1LFO A;  3T1D A;  2VDF A;  4BOE A;  2IZL B;  2OFA A;  1SRH A;  1SXY A;  4YMY A;  5JD2 A;  4EFG A;  1SWO A;  3SLT A;  2KT4 B;  1LIF A;  4IB8 A;  3SZI A;  1RBP A;  4ALO A;  1MVG A;  3BS2 A;  5H9K A;  2QOM A;  2X8S A;  1GT4 A;  2AF5 A;  3PQS A;  4WHI A;  2RA6 A;  4LQZ A;  5C0N A;  3CWK A;  1IFB A;  5EED A;  3ZW2 A;  4TKB A;  1JV4 A;  3BLG A;  4A1H A;  1E2T A;  3PPT A;  4QZT A;  1ACD A;  1IJ8 A;  1KQW A;  2ANS A;  4ZHG A;  3P6G A;  5HCE C;  2LKK A;  2WPU A;  1LDQ A;  3FLL A;  2X46 A;  3VG7 A;  1IKE A;  3LV4 A;  2HMB A;  2PY1 A;  2A8G A;  3WZQ A;  1I05 A;  1D2U A;  1SMP I;  4Z28 A;  3O2Y A;  4YKO A;  1VWB B;  2IZH B;  1JQP A;  5FQ8 E;  4IAW A;  3P02 A;  1KQX A;  4I9R A;  4Y0S A;  3UEU A;  3WJB A;  4BX6 B;  4CDF A;  2BSZ A;  5AEO A;  4GRJ A;  2GTL M;  3DSZ A;  2CBS A;  1SWU A;  1LKE A;  5F2B A;  3WYP A;  4CPI A;  3ZZV A;  4MIR A;  4QAE A;  3HWG A;  2RTC B;  2ACP X;  4BX6 A;  1VWH B;  3NQK A;  2WR6 A;  2ACO A;  1A3Y A;  1HQQ A;  2BS6 A;  3BU1 A;  1SRE A;  5KHP A;  4LZV A;  3BDR A;  4OMW A;  2AT0 X;  3NR3 A;  1EIO A;  3Q6L A;  2CAM A;  3CKF A;  4JNJ A;  3BU9 A;  4L1N A;  3HWF A;  1YP7 A;  4Y59 A;  3SLJ A;  2GH7 A;  2AVI A;  3VU1 A;  4YFR A;  1VYO A;  1VWD B;  1YWC A;  3F9D A;  4LKT A;  5L3Y A;  3VE1 A;  4A8Z A;  1W4T A;  3RDS A;  3RDQ A;  1Y55 X;  4XMH A;  2WQ9 A;  2RQ0 A;  2LBA A;  1PMP A;  3GE2 A;  1T68 X;  3NBX X;  3UEX A;  1QY1 A;  4ML7 B;  3UAQ A;  4GH7 A;  5K06 A;  1JJX A;  1SWC A;  4XMF A;  4INN A;  4ZH9 A;  4MVE A;  1Y9T A;  1DF3 A;  3S5V A;  2MF6 A;  2CZU A;  3KQ0 A;  4GZV A;  4U46 A;  2FKJ A;  2OFM X;  2FR2 A;  3MG5 A;  4AZP A;  1I4U A;  2FS7 A;  1HMR A;  1SWQ A;  4GDA A;  3ZI8 A;  4CV7 A;  1YWB A;  1N9M A;  2RTQ B;  1T0V A;  1SA8 A;  4QGX A;  5LKF A;  1O8V A;  1TW4 A;  2Q2P A;  3ZW0 A;  5L8I A;  1B0O A;  1E00 A;  2I5V O;  1S44 A;  2C4I A;  3CBS A;  1BJ7 A;  5D48 A;  3RBY A;  2RTG B;  3T2W A;  3AKM A;  2MM3 A;  5AJC A;  1KZW A;  2DJF A;  2MJI A;  3OD9 A;  2OF9 A;  1Y0G A;  4Y0Q A;  1OBU A;  1HMS A;  3U03 A;  1W5R A;  3KVN A;  1MOY A;  1ZNH A;  2Q2M A;  3B2J A;  1Y9L A;  2BLG A;  4FGI B;  4KII A;  4O9S A;  4Y0R A;  3BX7 A;  4FBR A;  2OL7 A;  2AT5 X;  1ZNL A;  1SWG A;  1S2P A;  2KW1 A;  2Z4H A;  1EUO A;  2POA A;  3NX1 A;  3UEV A;  3WZO A;  5BVT A;  4DCB A;  3VHH A;  3H3I A;  1N7Y A;  1EPB A;  1PEE A;  1FEM A;  2QMI A;  4BQU A;  4HFO A;  2KD2 A;  2OL6 O;  1JBH A;  2EU7 X;  4ZFX A;  1JMZ A;  1SWD A;  2MO5 A;  1DF8 A;  4Z2O A;  2N93 A;  2K23 A;  3VGW A;  3WOV A;  3WJE A;  1QQS A;  1TOW A;  2BC3 A;  1B8E A;  3FR2 A;  3TGC A;  4HPD A;  4U8U N;  5LJE A;  4IB9 A;  1SY2 A;  1AEL A;  1STR B;  2RTH B;  3D9W A;  2A3F X;  3HOL A;  4YDB A;  1JMX A;  3EM0 A;  1LF7 A;  3VHM A;  2QO5 A;  1AB0 A;  4FBO A;  5AJB A;  1W6F A;  5HZ9 A;  2A5C A;  3PEC A;  1MK5 A;  3RDX A;  5HZ6 A;  2OFR X;  4LZU A;  1SXW A;  1UZ2 X;  5B5G A;  2QCB A;  5CE4 A;  2RTI B;  4IAB A;  1SWT A;  2Y32 A;  2FRS A;  4ZGF A;  4AZQ A;  1BRP A;  3HWE A;  2K62 A;  1SWF A;  3VE2 A;  3RY1 A;  1TXL A;  3PK2 A;  2L9C A;  1VWG B;  1VWE B;  1Y52 X;  2RCT A;  2X45 A;  4O4U A;  5D45 A;  3K3L A;  4NW4 A;  1XKI A;  1BSO A;  4RUU A;  1GKA A;  3ZUI A;  1DV9 A;  4ES7 A;  3STK A;  3PDF A;  1VYG A;  1IFC A;  1CBI A;  1RXJ A;  1OEE A;  1VYF A;  2GJ5 A;  1HBP A;  2QO4 A;  2OY5 O;  1KZX A;  4I95 A;  3CKG A;  1TVQ A;  4DQ3 A;  4EEJ A;  2FKG A;  1S7D A;  2OFB A;  1AVG I;  5LJD A;  3RDU A;  2IZD B;  2MHD A;  1KGL A;  2IZC B;  3WJF A;  5B10 O;  2GTL N;  2WSJ A;  3P24 A;  1BBP A;  5HZ5 A;  4CPE A;  3C76 X;  3B2I A;  2CM9 A;  1NQM A;  1DFV A;  2Q4N A;  4ORX A;  2Q9S A;  2DM5 A;  3PH6 A;  2AKQ A;  2P8G A;  1YUP A;  1LPJ A;  3ZQ3 A;  1SWB A;  1QWD A;  3JS1 A;  3NPO A;  4D6A A;  3S5X A;  1HY2 A;  1AVD A;  1SWL A;  1IKJ A;  4YGZ A;  2L67 A;  3RWX A;  4BGF A;  4ODD A;  4XMC A;  3GAQ A;  1CBQ A;  2Y3F A;  1FTP A;  3HOE A;  1VWK B;  1AVE A;  4QYN A;  1N0S A;  1BLR A;  3OBL A;  3ZUO A;  1LUQ A;  2RTM A;  1U0X A;  3CMP A;  4PJ2 A;  2WEX A;  3FMZ A;  3PED A;  5LJK A;  2ASN X;  2Y3E A;  3EW2 A;  1BWY A;  5HAE A;  3I0A A;  5F6Z A;  5IO7 A;  3P6E A;  4KT5 A;  1EQD A;  4GDZ A;  3VPJ E;  1GT5 A;  1DZP A;  1YWD A;  3CQR A;  1YP6 A;  2GC9 A;  4O3Y A;  3WJD A;  3PP6 A;  4Z6J A;  1ALB A;  2KTS A;  1SWJ A;  1RXK A;  4ORY A;  5HZ8 A;  5KID A;  3ZWE A;  4OEM A;  3TZS A;  1JYD A;  3STN A;  4NLJ A;  1GXA A;  1OEJ A;  2OVD A;  2AT3 X;  4ZCB A;  4I9S A;  2OVE A;  3P6F A;  4Z27 A;  4GE1 A;  1SWR A;  1EXS A;  2RTL A;  2VFC A;  2CZT A;  1G7N A;  2CBR A;  2NND A;  1OEK A;  4D6B A;  1X8U A;  3CQN A;  4CSB A;  4TLJ A;  4KC7 A;  1VWO B;  4EDE A;  3SAO A;  4EQA C;  5FQ7 E;  1KT5 A;  2RTN B;  3AKN A;  5LKE A;  1Z24 A;  1EW3 A;  4JGL A;  2UZ2 A;  2OVS A;  4KH8 A;  3WZP A;  4BBO A;  1CBS A;  2G7B A;  3NQ9 A;  3O19 A;  1N9Y A;  1SRI A;  3D4R A;  5IRW A;  4Z2V A;  5H9N A;  1UYO X;  4QYP A;  5JR8 A;  4GNY A;  1X8Q A;  1IW2 A;  3G7X A;  4BX7 A;  3CBC A;  4CPH B;  1SRJ A;  2IZI A;  4O3Z A;  3VG4 A;  2ZSC A;  3UEW A;  1KOI A;  1KL3 A;  3JSQ A;  5F58 A;  1B4M A;  5H8T A;  3SZJ A;  3X00 A;  4XME A;  4GGR A;  2PI3 O;  1H91 A;  2BT9 A;  4CPH A;  1SY0 A;  1DC9 A;  2WUT A;  4ORU A;  4UU2 A;  3ZW0 B;  3FDC A;  4GK9 A;  1G74 A;  2JU8 A;  4WFU A;  1CJ5 A;  5K68 A;  4FBV A;  1OPA A;  2FT9 A;  2IZK A;  4RUN A;  1PTS A;  3VG5 A;  5CHK A;  4O4X A;  1VWI B;  2OY8 A;  3F8A A;  5F7G A;  2KTD A;  2X8T A;  1GT1 A; 
#chains in the Genus database with same CATH homology
 1MM9 A;  2BC3 A;  1SWP A;  2RTD B;  2IZA A;  4YVB A;  2IZL B;  2OFA A;  1STR B;  1SRH A;  2RTH B;  3RE6 A;  5JD2 A;  4EKV A;  1SWO A;  2C1Q A;  1SWK A;  3SZI A;  3VHM A;  1SWA A;  1WBI A;  1NC9 A;  2RTE B;  4GGT A;  2G5L A;  2F01 A;  2A5C A;  2RTO B;  1MK5 A;  3RDX A;  3T2X A;  5B5G A;  2C1S A;  2QCB A;  1LCW A;  2RTI B;  1KL4 A;  1SWT A;  2Y32 A;  1SRF A;  1I9H A;  1SWF A;  3RY1 A;  3PK2 A;  2RTR B;  1SLD B;  1IJ8 A;  1VWG B;  1VWP B;  1VWE B;  1Y52 X;  2IZG B;  4DNE A;  3T6F A;  2WPU A;  1LDQ A;  1SWH A;  1VWA B;  2IZB A;  1SWS A;  2RTP B;  4BJ8 A;  1VWF B;  2A8G A;  3WZQ A;  1RXJ A;  4Z28 A;  1VWB B;  2IZH B;  4Y5D A;  2OFB A;  3WZN A;  3RDU A;  1STS B;  1SLF B;  2IZJ A;  2IZD B;  2IZC B;  5CSE A;  1N4J A;  4BX6 B;  1MEP A;  1VWQ B;  4CPE A;  1NQM A;  3RDM A;  5B5F A;  4CPF A;  1KFF A;  1SWU A;  1HXL A;  3MM0 A;  5F2B A;  3WYP A;  4CPI A;  3RE5 A;  1SWB A;  1NBX A;  1HY2 A;  1AVD A;  1SWL A;  2RTC B;  4GGZ A;  4BX6 A;  1NQN A;  1VWH B;  1HQQ A;  1SRE A;  2RTA A;  1VWM B;  2Y3F A;  1VWN B;  1VWL B;  1VWK B;  1AVE A;  2UYW A;  2RTK A;  2CAM A;  4JNJ A;  1LUQ A;  2RTM A;  4Y59 A;  1N43 A;  2A5B A;  2GH7 A;  2AVI A;  3VHI A;  2Y3E A;  1VYO A;  3EW2 A;  1VWD B;  5L3Y A;  2FHL A;  1SRG A;  3RDS A;  1Y55 X;  3RDQ A;  4Z6J A;  5IRU A;  2RTB B;  1KL5 A;  1SWJ A;  1RXK A;  1SWC A;  2MF6 A;  4U46 A;  1SLE B;  1VWC B;  3MG5 A;  4Z27 A;  1SWR A;  2RTL A;  1NDJ A;  1SWQ A;  4GDA A;  1VWO B;  5IRA A;  1N9M A;  2IZF B;  1RST B;  2RTQ B;  3RDO A;  3SZH A;  2RTN B;  4Z2P A;  3WZP A;  2UZ2 A;  3EW1 A;  3T6L A;  1LDO A;  1VWR B;  4BBO A;  4BCS A;  1HXZ A;  1N9Y A;  1SRI A;  4BX5 B;  5IRW A;  3T2W A;  2C4I A;  4Z2V A;  4IRW A;  1RSU B;  2RTG B;  3WYQ A;  4GD9 A;  2JGS A;  4GJV A;  2IZE B;  4BX7 A;  4CPH B;  2OF9 A;  4OKA A;  1LEL A;  1SRJ A;  2IZI A;  4GJS A;  2ZSC A;  4JHQ A;  4JO6 A;  1MOY A;  4BX5 A;  1KL3 A;  5K67 A;  3SZJ A;  1LCV A;  3X00 A;  4GGR A;  1LCZ A;  4CPH A;  1SWG A;  1RAV A;  3WZO A;  3FDC A;  1SWE A;  2RTF B;  3VHH A;  1N7Y A;  1STP A;  5K68 A;  1Y53 X;  1SLG B;  2IZK A;  1RXH A;  2RTJ A;  1PTS A;  5CHK A;  2FHN X;  4I60 A;  1SWD A;  1SWN A;  4BX7 B;  1DF8 A;  1VWI B;  4Z2O A;  3RY2 A;  3VGW A;  1VWJ B;  2OF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...