3RDVA

Structure of the slain2c-clipcg1 complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
70
structure length
70
Chain Sequence
DFRVGERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTRPSKLTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAP-Gly domain-containing linker protein 1
publication title SLAIN2 links microtubule plus end-tracking proteins and controls microtubule growth in interphase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 15
structure length 70
sequence length 70
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 3rdvA00
2E3IA 1WHLA 1WHKA 2E4HA 2HKNA 2M02A 1LPLA 2CP3A 2COYA 2HQHA 2HL3A 2Z0WA 2CP5A 1TOVA 1WHHA 2CP6A 2CP7A 2HL5C 2HKQB 1TXQA 2MPXC 2E3HA 1WHJA 2COWA 2CP0A 1IXDA 1WHMA 3RDVA 2QK0A 4B6MA 2CP2A 2COZA 3E2UA 1WHGA 3TQ7P
chains in the Genus database with same CATH superfamily
4PJOD 4HCZA 3OYKA 1VQ7T 3H8ZA 3CCST 2M51A 1GCPA 4F7UA 1M1FA 4BUGA 2NWMA 3S6WA 4E2FB 4Y91A 4ORZA 1SEMA 4LN2A 4Z8AA 4OMOA 3CCJT 4C0ZA 4XU2A 2GGRA 1FX7A 2ROLA 1M3AA 3OYJA 1Q82R 5L23A 2LRQA 4N4HA 3OYIA 3TEEA 1VQOQ 2RHYA 1G3TA 2O01E 4WF2A 3UDCA 3OS1A 3CMEQ 3RBBB 2ZCFB 1WFWA 4C8QE 1FMKA 1ZUYA 2QAZA 1X01A 4EPCA 4ZTJA 1BIBA 1K8AR 2DERA 3UT1A 2DBMA 1WHJA 4ZN3A 1DJ7B 2MYSA 4IUUA 4MMKA 2AIRB 3EFSA 2F2VA 3FRNA 2DILA 2H3EB 5FRNA 3N5BB 3CCQT 2YRVA 4LDWA 1VQ7Q 1NLOC 3PT9A 3CCSQ 3A1PA 4B9XA 1K0SA 1GFDA 1KG1A 2G6FX 2YDLA 4L6V5 3VS2A 1YCYA 2JT4A 3M0SA 2HL5C 2DF6A 4HCKA 2DBKA 1ARKA 4ANJA 1VYTA 2RPNA 3RKWA 5KYUB 2VB6A 3LGFA 1ZBJA 4M78C 2DXBA 2DL3A 4DEXA 3G6ET 3H41A 1NEGA 1H3ZA 2KY9A 3C95A 2JM8A 2JUFA 2P4RA 2YUPA 4Z02A 3PGGA 2LCCA 2FB7A 1KJWA 4FYVB 4M78B 4IURA 5DLOA 1VQ9Q 3VS0A 2EQUA 5GAN4 2GTOA 1YITA 3GP8A 3NMZC 1ZA2B 2K4YA 4A63B 4ELZC 2P84A 5EC7A 3BFMA 5I22A 1I8FA 3CCQQ 2PQWA 1EIFA 1UGSB 2EYXA 1LPLA 1J3TA 5GANf 3HSBA 1LNXA 2LJ1A 5FWBA 5IN1A 1HJDA 3CCUT 1ABOA 4C5IA 5GMKm 5GAOn 3OSVA 2DEUA 2JW4A 1IHWA 2I0NA 2O88A 2DVEA 4IUVA 3MP8A 2QI2A 3CXCP 5GMKi 5D6WA 5DY9A 3OYFA 1K0XA 2NYSA 1MHNA 4J8OA 2E65A 1VQ8T 4DA4A 2E70A 1GRIA 2HQHA 1K76A 4HT9A 2MOXA 2D8JA 2EYZA 3IQLA 4M7AC 2RMOA 1ZSZC 5CKDA 4AFQC 4CI0C 4BE2A 4BE0A 4AFUC 2DE0X 3I55A 2BE9B 1RABB 4C92E 2XU8A 1YN8A 1S1NA 1IRXA 4A4FA 4PJOC 1PKTA 4M7AB 1ZA1B 1TSFA 1OOTA 2L5QA 5CKEA 4C8QA 2VV5A 3CC7A 5KYNA 3CQTA 2CP5A 4FCYA 2MK5A 1QKWA 2QQSA 2DK3A 4PJOB 4LDXA 2KT1A 2KI7A 1KQ2A 2QYZA 1C0MA 1HXDA 1LOJA 5KYXA 2X35A 4FSXA 4LE9A 2NUPB 3L1AA 2QXFA 1QWEA 3KXTA 4M78G 4M77E 1MMAA 3FIFA 1IB8A 5D7UA 3VYHB 5IHIA 2LC4A 1TXQA 2E10A 2HEQA 2M0OA 1PSFA 2KRMA 2XHCA 1YI2A 4AMCA 2MWPA 3BY7A 3LLRA 3F70A 1VYUA 3QXEB 3CMAA 1BI1A 1VQPQ 1NBEB 3M58A 5LJ5f 1VQ6Q 4QVCA 3MP6A 2EQIA 3S3OA 2CH4W 2LCSA 4MDXA 4C92D 5GAOr 1N9RA 5HK0A 3UPUA 2ROTA 3L42A 1AD5A 3QKJA 4F17A 3HHTB 1N5ZA 1YITT 1NJIR 4OB2B 4ZTFA 3CC2A 1WI7A 2JS2A 3X25B 3WVDB 2L3SA 3AHUA 2SEMA 2X3XD 1Y07A 4DOWA 3A98A 1YJNQ 2WSEE 1H92A 3BDLA 1CKAA 3EHRA 5FROA 3PTAA 3PVLA 4FL6A 2CZ0B 3E9GA 3CEYA 3I35A 2VYTA 3C12A 5CKFA 2DYBA 1GBRA 2EYWA 5KYYB 2EVRA 3VYGA 4PJOG 1NG2A 3I5RA 2VGNA 4RTTA 4C0GA 1UG1A 2ABLA 2MF2A 3VS4A 4C92A 1PD1A 4EDUA 3CBPA 2DO3A 3HRTA 3QZ5B 3MO8A 5CCAA 1AZGB 4IIMA 3M57A 4QQDA 3I55T 1KD1U 2E6ZA 2FVUA 3JCMg 2F2WA 2AHJB 5GMKe 1B3QA 4GY5A 3NTHA 4M75D 3CC7T 1SF9A 2HKQB 2EYQA 2YHTA 2MPXC 1D1CA 1BCMA 1QWFA 2J7IA 1PC0A 1IGQA 2HQEA 5LJ3h 5LL6S 3JSCA 1VQ5A 3SFMA 3MJXA 1YJWT 4E7LA 2RJDA 5GAMd 3I9QA 1B34A 2JTFA 4RCCA 1U1TA 3REBB 4M77A 4J83A 3JCMQ 4K11A 3VS1A 4A4EA 4OMFB 1W2BP 1YWPA 4FIBA 3E19A 3URGA 5IHNA 1Y96A 3JB9F 1WHGA 4RG8A 1VOMA 1VIEA 3OSSC 2OTLT 1YI2T 2DM1A 3PMIA 2QQ9A 3VUZA 3MPUB 1M27C 1NYFA 2E64A 2LQNA 3VS5A 5KYWA 2X4JA 2Z0WA 2QQRA 3CMAT 2CP6A 1I81A 2CSQA 2DAQA 2PTKA 2KRSA 1CKBA 2K5IA 1YJWQ 3ZFJA 3VS6A 3M4GA 3V8KA 2YWWA 2WACA 1I5LA 3CCMQ 1K73U 5CQXA 5GMKl 1FMWA 1SHFA 2YUQA 4XU1A 4C5EA 2ENMA 4PJLA 1KD1C 3CC2T 2BKDN 2E5KA 2FRWA 1OI1A 5J26A 2HSPA 2D6FA 2XICA 4KH1B 1MNDA 3QDFA 1C6VX 2DZ9A 1UECA 1VQOA 1Q82U 1YFNA 2OTLQ 3CMEA 1K9MU 2HAXA 3A5ZB 3FB9A 3M0RA 4C92B 4M78E 3P8HA 4DBQA 1KQSS 1OZ2A 2DIGA 3L2WA 4LDYA 3X26B 4ZGEB 4M7DF 1HD3A 2NUTA 1FXXA 2VXEA 3TREA 2VVKA 2QGFB 1OEBA 2CT4A 2DKGA 2J6OA 2KNBB 1EX4A 4JRIA 1AOJA 2H8HA 2YSQA 1VQ7A 4MZMA 1KQSA 3CCSA 1YHQQ 3EG2A 3TU4K 4ZN1A 1I0CA 2EPDA 1AWOA 4PL6A 1B34B 3CPWA 1G3SA 4CC7A 1NZ9A 1TS9A 1HYOA 3J7AF 2YXYA 1TUCA 3CCVQ 1YJ9T 2QTXA 4E7KA 1E7OA 2QK0A 1TH7A 5I11A 2R58A 1W2BS 1BI0A 1VQ5T 4BY6C 2OTJT 1MGQA 3GBQA 2V8JA 4M75C 1VQ9A 4BI8B 1K73C 4QW2A 4BI3A 1UFFA 1VUBA 2J05A 4M7DG 5KYWB 4M7AE 1X6GA 1E6HA 2EQMA 4BY6B 1UUEA 3CCQA 1W2BA 3EGXB 5GJWB 4M75B 4LUDA 1UDLA 4CC4B 3QZ9B 1XQHA 2MMPA 1KD1R 4KT0E 4II1A 1Q82C 3SEMA 1Q86U 4J6XA 4PJOE 1M2OA 3RR6A 2XG8D 1OX9A 1Y7XA 1QCNA 1I1JA 1I4K1 2AZVA 1O9SA 1KSWA 4HVWA 5GANd 1YJ9Q 4C5GA 1NLPC 2NLUA 2JNGA 4MZTA 2LDMA 1VQ5Q 1TG0A 4KBMB 3H0IA 4X9DA 2OTJQ 2L3QA 2FEIA 4DOVA 1W1FA 2MCNA 3NTKA 2GNCA 4OMLA 1SG5A 2YUNA 2KR3A 4OB3B 1YNZA 1G8XA 1MV0B 2E3HA 5GAN6 2J6KA 1P92A 2JZ2A 2XDDA 3OYNA 2C0OA 1BB9A 5I2MA 5IXBA 1OZ3A 2CUDA 2VASA 2NUTB 1B7TA 5KE3A 1WJSA 1SHGA 3QJ6A 3V7SA 2KDSA 4M78A 1SSHA 2IG0A 2JM9A 3GNFB 5ECAA 1VQOT 4JJCA 2XDBA 1X6OA 2LJ0A 1MMNA 4C0FA 1X27A 1G3YA 3LGLA 1BBZA 4R0KA 5CK9A 4PFPA 1UGVA 2LX7A 2OAUA 3C94A 2QA4A 1JQQA 2QEXT 5LJ3f 3JAME 5HKCA 3M53A 2HKNA 4Z89A 1K4US 1K73R 2A3LA 2FRYA 4OP0A 2EFIA 4JLIA 3V8LA 1BKBA 2K7AA 3BDUA 1YIJT 3QYGB 2ZPBB 2LNHB 2P0PA 1Q86C 3JB9J 4M75G 2LP5A 1M1GA 5L8RE 3JCMe 4C5HA 4PK4A 2EKHA 5I21A 1VQPA 1K9MR 4J9BA 5GAMj 1VQ6A 1NE8A 1KQ1A 1XJWB 5AT1B 1WZOA 4PJNA 2BE7D 2IIMA 2XD0A 5EG2A 1K9AA 1QKXA 1VQ9T 2KVQG 5LJ5d 4JRPA 4M7AA 1IHVA 1GCQC 1ZSZA 2C0TA 3L2UA 2QEXQ 3VU3C 3OYMA 2AT1B 1NJIU 1BYMA 4ZNXA 3OYHA 5FRMA 2KGTA 4PJOA 3M4YA 2X3WD 1YJNA 2SRCA 1YIJQ 4GBQA 4C0DC 1JJ2A 3RERA 3QJYA 2LVMA 3T9NA 4A4HA 2BZYA 1SRLA 2NUPA 3VRZA 3GPLA 3VS7A 4M4ZA 4D6WA 2LQKA 2KEAA 4CC2A 1UGQB 3HRSA 2LQ8A 4OMNA 4RTWA 5CAIA 4C0DB 2P0KA 2AK5A 4J5YA 1KC8U 4E6RA 1YP5A 4L5GA 3G7ZA 3X20B 1ACMB 1M8VA 1ZBXA 2DRMA 1WGSA 2KBTA 2W10A 3S3NA 3NPFA 2JJ9A 4FYYB 3UA6A 1QVGA 1NEBA 3QIIA 4RMOA 2FL7A 4ZGDB 1V1CA 2DTOA 3OYEA 5GAMg 1Q86R 1JEGA 2JS0A 2QASA 4OB1B 5HK3A 4O5VA 1I07A 4NS5A 3JB9D 2DTHA 3OYDA 2YRCA 2L2PA 3LX7A 2QA4T 3EG1A 3A8HB 3OYBA 1FYNA 1NJIC 1VIFA 4D8KA 3DKMA 2M1HA 2HBWA 4BB7A 4N4IA 2PNIA 4OF1A 4XU0A 4KGVB 3OBYA 5HY6A 1NPRA 2JMCA 1JU5C 1QVPA 5KYYA 4N0AA 2DPPB 2ZPGB 1ZSZB 2CP3A 1VQPT 1GL5A 4PNOA 1VQ6T 1KC8C 4FT4A 3CD6T 2F5KA 1WXUA 5GMKh 2W0ZA 1S72Q 1YJWA 2FHDA 1IZ6A 4AFSC 3RESA 3LWIA 2A7YA 4DEYA 2O9VA 3H0HA 3CCMA 1W70A 4J9DA 3PNWC 2D1XA 2CYZB 2QA4Q 1RI9A 1H8KA 4IIOA 3EG0A 4M7DD 4F7UF 1W6XA 1MMGA 3NHNA 2ZZDA 3OYCA 4XTZA 1YJNT 1BI3A 3KUFA 2LQWA 4J6WA 2COWA 2OTLA 1D0ZA 5CQYA 5GANj 4IUTA 4E7ZA 4E7JA 2LCLA 1AVZC 4X9CA 2CREA 5GAN8 2H3JA 5A2QE 2D9TA 3CD6Q 2DYIA 2E12A 2CZ1B 2DTIA 2HDAA 5CKHA 1U8RA 4M75E 3CCEQ 2ED1A 3RIRA 4BDYA 1IXDA 2CZ7B 1QCFA 4QQ6A 1E6GA 4OGCA 1YHQA 4RTXA 4MZPA 2DL4A 1CSKA 4NL3A 4E7SA 3A8MB 3TVTA 3H0FA 4PJMA 4HA8A 2CP7A 4ATOA 1EZZB 2LTOA 1I5OB 2DXUA 4YTLA 3CCVA 2C0IA 1G5VA 2CT3A 3EG3A 2LX9A 2ZGWA 4N0AC 4E7IA 4FW1A 2O4XA 2RJEA 1QLYA 2E3IA 3V8JA 4WTOB 2F1LA 2KYBA 1KC8R 1KHCA 2KXDA 2MI6A 2A28A 3HRUA 4PKCC 5A0GA 3X24B 3CCLQ 2F69A 3FEOA 1M9SA 3OA6A 1ZHIA 3GNGA 1UB4A 5GAN7 1KQSP 4GLKA 2R57A 2PVDB 3CPFA 3I5SA 3A8LB 4JDSA 3M59A 3DLMA 1TTHB 5GANg 2GBQA 3SWNC 2JTEA 3CPWP 1C1AA 2I2LA 1UE9A 4V2SA 2QDYB 1GXIE 1OPLA 1YJ9A 1G3WA 1YWOA 3A8OB 1BU1A 2RQRA 5LJ5j 3SWNB 4JJNK 4KH0B 4KUIA 5KCHA 3TSWA 2DIQA 2KXCA 1QVFA 2EJ9A 3L2VA 4XTUA 4JS5A 2OTJA 2OI3A 2HQXA 2GQIA 1M90U 3QHSA 1QCOA 3CCMT 2DXCA 1K1ZA 3H6ZA 3EFRA 4QT7A 3JCMV 1KK7A 2MWOA 3MCAB 3DB3A 1D09B 5CVIA 4JPBW 2MIOA 3QYHB 7AT1B 3Q1JA 3NTIA 3MP1A 1RAIB 3PIOA 3MEUA 3QG1A 3D7SB 3L2ZA 1WX6A 1T0JA 4LNPA 4C8QF 3LYIA 3OYAA 1QMCA 4J9IA 4M7DC 1IO6A 1JBMA 2EIFA 2CKKA 3EAEA 3EGXA 2DETA 4M75A 1N9SA 3TSZA 4A4GA 1WA7A 5GAOp 2PU9B 4M7DB 2GTJA 2XDPA 4BI4A 2DRKA 1W4SA 1YCSB 3UA7A 2EAYA 2L0AA 2F2XA 1SKUB 1AEYA 1M30A 2KAFA 1YHQT 3MEVA 3PVQA 5GJVB 5KCOA 1WDXA 5LJ3d 2O4XB 2DMOA 1QP2A 2RQTA 1OX8A 1AWWA 4FSSA 2XIDA 2ZAEA 3ZL7C 4RKUE 2FG0A 1WIEA 2DL5A 5AYFA 3R6OA 1VQNQ 1UGRB 2DEQA 5KH6A 3ME9A 3CCVT 3FLGA 5LJ5g 2FPDA 5GAMe 2M16A 3JB9G 2HMAA 2DJZA 4C8QG 2V1RA 3JRZA 4FM4B 3ER0A 2DD4A 4N4GA 1M90C 2O9SA 2DFUA 4F04B 2HBPA 3U23A 2QEXA 3CPWS 1NM7A 1IREB 2AZSA 1Q81U 5GAN2 2K5FA 4XAXB 3S3MA 1TWBA 2K79A 1YIJA 4AT1B 3CBOA 4XTYA 3G4SQ 4JS4A 3RKXA 3OYGA 2DA9A 2IPOB 2NUZA 4WCIA 2QTVA 1AT1B 3VKIA 3UATA 2GQVA 2ED0A 3MEWA 2E4HA 2M02A 3JCMh 2YRDA 4NL2A 1Z9ZA 4XK8E 2ESWA 2EJGA 3EGDA 2PUOB 3TCJA 4XU3A 1AHJB 5A0LA 3RNJA 4C92F 1MUZA 4EMKC 2A37A 3C4SA 1XOVA 1OV3A 1RLQC 4DBRA 5IAYA 4J6YA 4JRQA 4FU6A 4P5NA 1JJ2P 1WHLA 2A0FB 8AT1B 1PNJA 2RI2A 1ZSGA 2B8AA 1N6AA 2K9GA 3OS0A 4IUQA 4EMKB 1K9MC 1U5SA 2EBPA 1X2KA 1SPKA 2QGGA 3SD4A 3CCRT 4J7IA 4PLLA 1GCQA 2YLBA 2HCKA 2K2VA 4QVZA 1PM3A 2CSIA 1Q81C 4M77F 1M90R 1MNEA 3RMSA 3VJPA 4A4KA 1NPPA 1QP3A 1HSQA 1XTDA 2RB6A 3G71Q 1ZX6A 3ULRB 3EH2A 5IXFA 3O8VA 1QVGP 3QUIA 4CRIA 2XMFA 3HTRA 3ZEHA 6AT1B 4J9EA 4MMLA 4O6JA 2RI3A 2PZ1A 1O75A 2AKKA 4BE1A 5GAN5 3UWNA 1S72A 4PLIA 3CCRQ 5IHKA 1M1KU 3GLXA 4JLGA 2XKOC 1BIAA 4HCCA 2AKLA 1G2BA 2BZ8A 2O2OA 3JCMP 2J6FA 1VQKQ 3FJPA 1WHKA 2D8HA 1PKSA 2QQBA 3C0CA 3OYLA 5GAOm 4UC4A 1WQ7A 2RK1A 1WHHA 4JRKA 2CS7A 1X69A 2PVOB 1UHFA 3EGDB 3OS5A 5DLQE 5GANe 1N8RU 2FZKB 2V8KA 3MHXA 1T3SA 4OGEA 4OMQA 3OQ5A 5FLXE 2KE9A 3CD6A 1KIKA 2FO0A 2V8IA 2JMAA 4X1VA 3OMGA 1JJ2S 1D1BA 3CCEA 4A54A 2OX7A 4Y92A 2RQUA 4BACA 4Z88A 4KRTA 2XI9A 1Q81R 2YUOA 3CC4A 4EMGA 1PHTA 4BD3A 3LW5E 4RTYA 1WLPB 2DVJA 4Q5WA 3L2RA 1F1BB 2EYYA 2RO0A 1WNLA 2KROA 2A36A 4RTVA 5GAN3 2P0QA 4CC3A 2D0NA 1PD0A 2DL7A 1M1KC 2WSCE 1OU8A 3GIBA 1TUGB 2QQAA 1QVGS 4RTZA 3CCLA 3RKYA 5LJ3j 2M9UA 3CCJQ 4AG2C 3P8BB 3VV0A 1HK9A 5FW9A 5J3BA 3QWYA 1RUWA 2R5AA 1R0BG 2RJFA 1KFZA 2X9HA 5CKBA 4FYXB 4OVAA 3OW2P 3EH1A 5KE2A 2O31A 1B07A 1BK2A 3QWXX 2VUBA 2X4YA 1N8RC 4KUDK 3OB9A 2FYKA 2LNVA 4XTXA 1BI2A 1R0CB 2BIVA 2FZCB 2ZPIB 2WSFE 3QBYA 2EGEA 4M7DE 3DB4A 4FW2A 1M3CA 1S72T 1Y57A 2FPFA 5LJ5e 3M0PA 1FWZA 2KRNA 3E2UA 4C8QD 4IKFA 4QQGA 1AWXA 2L3RA 1GFCA 2RD1A 4HKEA 4FYWB 3JCMf 3I56T 2L89A 4FT2A 3CBMA 2F5TX 4F7UB 3G6EQ 1LVKA 4TVRA 4X34A 1SRMA 4M78F 4LD6A 5I2SA 4MDWA 5D6YA 2RHUA 2COYA 3H9NA 4D8DA 4HVVA 2G3RA 4J9CA 1RACB 3OBWA 2RK2A 2CH4A 1QVFP 4LUEA 2VGMA 2DJQA 3EFOA 1M1KR 5LJ3g 1IGUA 1PRMC 1WYXA 2BTTA 3CCET 3VRYA 1D0YA 1MV3A 4KGZB 3JCMX 3M0QA 1ZQ1A 2LZ6B 2RQWA 1QQJA 4J9FA 3CC4T 1UJYA 3SDZA 3SWNA 3I56Q 2PUKB 1UEBA 1Y71A 2GCXA 2K3XA 3CCUQ 3M54A 1VQNA 1LJOA 5GAOq 4R56A 2OJ2A 3TQ7P 2DZCA 1N8RR 1VQ8Q 1UJ0A 2EW3A 3JCMW 2RNAA 2FZGB 2X4XA 1R8OB 1PCXA 2ECZA 8ATCB 2E5QA 1VA7A 1PG5B 3KBGA 4AFZC 3OW2S 3ZBDA 3CCLT 4M7AF 2YLCA 4B9WA 2CP0A 5HCKA 1PWTA 3QPHA 4HT8A 1MMDA 5CR2A 4F14A 1RI0A 5CO7A 4PJOF 2V26A 1A0NB 3PMTA 3J81E 4HVUA 3G4SA 3CC4Q 1JXOA 3OW2A 5IT9E 1JO8A 2HNIA 2DX1A 4M7DA 4F7UG 5GAOl 1VQLA 2DXTA 2YT6A 5D6XA 2RA2A 3NGPA 4EIKA 2DD5A 2EWNA 2DLPA 2RHXA 1RAGB 2CP2A 2C06A 1Q7YU 4E7HA 4OMMA 3M0TA 2RI5A 4RTUA 1M8MA 2CZ6B 3VUBA 5GAMh 1D0XA 1N27A 3CXCS 3PFSA 2PVGB 1FMVA 3QDRB 3AT1B 4BDZA 4M7AG 4E47A 2BUDA 4C8QC 1T3LA 2EGAA 2L8DA 4M77D 1WPYA 2RF0A 3FJ5A 2Y4YA 2V1QA 3EFOB 1QVFS 2K3YA 4GLMA 1GBQA 1AZEA 1H3HA 2HD0A 1M3BA 2VC8A 3M0UA 5CIUA 3CXCA 2CUBA 4EMHA 4C8QB 5C6SA 3SHWA 1Z9QA 2RHIA 1OULA 3WVEB 1VQMA 1YBYA 1RAHB 1M4ZA 1YITQ 2CGHA 2RM4A 1OU9A 4LDVA 3FC3A 4ME7A 1TUDA 1VQ4A 3RUXA 2KT8A 5KYXB 2IVWA 3P8DA 3OY9A 3G71A 4DBFA 2D0QB 4R55A 2E6NA 3HL8A 1XNIA 2L3PA 3RMQA 4ZGJB 4PFZA 3RDVA 4QKUA 1VQNT 1V76A 3REAB 3OYYA 1OYXA 1Q7YC 3M55A 2JTMA 3CCRA 2P4TA 2K6DA 2VXFA 1NYGA 4ELYC 3I55Q 1X43A 1R77A 1WXBA 2ZPFB 1VQKA 4JJDA 3OMCA 1M2VA 4EMKA 3LWHA 1ABQA 4OB0B 1ZUUA 3JCMb 5IH2A 2K2MA 4NOYA 2B86A 2HL3A 1RLPC 3CC7Q 2K57A 3EHQA 1T0HA 1D1AA 3HFOA 3G4ST 2Y4XA 3JB9H 4KGXB 1V29B 2OAWA 2LJ3A 1VQLT 2CDTA 1X75C 2COZA 3JB9I 5M9OA 4PFOA 1U3OA 2HSEB 5FU7C 1H641 3QSUA 2EKOA 2LT1A 1RADB 3PIPA 2JVVA 2JXBA 3GF5A 2RQVA 4C92C 3V7CA 5J39A 4JZ3A 5FU7B 1UHCA 2KQWA 2LT4A 4B6MA 1YI2Q 3E1SA 1JB0E 1RL2A 1U06A 2QDLA 4J9GA 1KHIA 2DNUA 1M5Q1 3CMAQ 2EJFA 2GFAA 1TOVA 1WXTA 1G83A 3OS2A 1K8AU 3J80E 3X28B 2LMJA 1VYVA 2RHZA 3BW1A 4J9HA 1VQLQ 3PE0A 1WHMA 3ASKA 1UGPB 2K3BA 1QW1A 2KSSA 4JZ4A 4M77C 3LH5A 1VQMT 1Q7YR 2BZXA 1D3BA 2EGCA 4VUBA 1OQKA 5GANh 4LXCA 3CC2Q 3EG9A 1VQ4T 5DM7R 3EGUA 2M0YA 3CCJA 4F7UE 4RUGA 3MEAA 4ESRA 4RCBA 5LJ3e 4DQ2A 3HFNA 3G71T 4M77B 4DBHA 3SB2A 3WXMB 2MAMA 4XQ3A 3HPWA 4OMPA 1X6BA 2DL8A 3E9FA 2X4WA 1LCKA 1Y96B 4A53A 1RAEB 4AG1C 3QO3A 3NFCA 4IUPA 1M2VB 3VS3A 4HCBA 1EFNA 3G1JA 3M56A 3JV3A 2FPEA 3O5ZA 2Y90A 4M78D 2JN0A 2JOYA 1VQMQ 1VQKT 2KYMA 4L59A 3A8GB 3M9QA 4JJBA 1VQ4Q 5GMKj 1JRIA 2GF7A 2VWFA 2EQKA 1OPKA 2X51A 5C0MA 3G6EA 5A0DA 5GAMf 4LD9K 3THKA 1JXMA 2ZPHB 1RAAB 2VKNA 3HP9A 4F16A 3JCMd 1Q95G 2ATCB 1PSEA 2RN8A 4C92G 1K8AC 2K5LA 3GOXA 2E41A 1TU0B 3LH0A 5FU6C 3R6NA 2XK0A 2E1HA 4PJJA 3L2QA 4XTVA 5KYUA 1U1SA 2R5MA 9ATCB 3BE3A 2KK4A 1Y0MA 4M75F 2ZPEB 3DLLA 2J06A 5FU6B 3JCMc 1WJQA 1ZLMA 1WJRA 2QG9B 2KMTA 2A08A 3MKDA 4LDUA 3JCMJ 1WQWA 1X2QA 5LJ5h 4KULA 1ZUKA 2HZYA 2RH2A 3CMET 1RAFB 3KFVA 4RG2A 4QVDA 1BCOA 2GFUA 4J7FA 3I56A 1PRLC 3META 5FWCA 4Y28E 1SSFA 3FDRA 3CCUA 4M7AD 4M77G 1D3BB 4XTWA 3M5AA 3V7RA 4JUVA 3EG9B 2RJCA 4HXJA 3UF4A 1AWJA 3INZA 1UTIA 3HKSA 1VQ8A 2EQJA
chains in the Genus database with same CATH topology
2E3IA 1WHLA 1WHKA 2E4HA 2HKNA 2M02A 1LPLA 2CP3A 2COYA 2HQHA 2HL3A 2Z0WA 2CP5A 1TOVA 1WHHA 2CP6A 2CP7A 2HL5C 2HKQB 1TXQA 2MPXC 2E3HA 1WHJA 2COWA 2CP0A 1IXDA 1WHMA 3RDVA 2QK0A 4B6MA 2CP2A 2COZA 3E2UA 1WHGA 3TQ7P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3I A;  1WHL A;  1WHK A;  2E4H A;  2HKN A;  2M02 A;  1LPL A;  2CP3 A;  2COY A;  2HQH A;  2HL3 A;  2Z0W A;  2CP5 A;  1TOV A;  1WHH A;  2CP6 A;  2CP7 A;  2HL5 C;  2HKQ B;  1TXQ A;  2MPX C;  2E3H A;  1WHJ A;  2COW A;  2CP0 A;  1IXD A;  1WHM A;  3RDV A;  2QK0 A;  4B6M A;  2CP2 A;  2COZ A;  3E2U A;  1WHG A;  3TQ7 P; 
#chains in the Genus database with same CATH topology
 4PJO D;  4HCZ A;  3OYK A;  1VQ7 T;  3H8Z A;  3CCS T;  2M51 A;  1GCP A;  4F7U A;  1M1F A;  4BUG A;  2NWM A;  3S6W A;  4E2F B;  4Y91 A;  4ORZ A;  1SEM A;  4LN2 A;  4Z8A A;  4OMO A;  3CCJ T;  4C0Z A;  4XU2 A;  2GGR A;  1FX7 A;  2ROL A;  1M3A A;  3OYJ A;  1Q82 R;  5L23 A;  2LRQ A;  4N4H A;  3OYI A;  3TEE A;  1VQO Q;  2RHY A;  1G3T A;  2O01 E;  4WF2 A;  3UDC A;  3OS1 A;  3CME Q;  3RBB B;  2ZCF B;  1WFW A;  4C8Q E;  1FMK A;  1ZUY A;  2QAZ A;  1X01 A;  4EPC A;  4ZTJ A;  1BIB A;  1K8A R;  2DER A;  3UT1 A;  2DBM A;  1WHJ A;  4ZN3 A;  1DJ7 B;  2MYS A;  4IUU A;  4MMK A;  2AIR B;  3EFS A;  2F2V A;  3FRN A;  2DIL A;  2H3E B;  5FRN A;  3N5B B;  3CCQ T;  2YRV A;  4LDW A;  1VQ7 Q;  1NLO C;  3PT9 A;  3CCS Q;  3A1P A;  4B9X A;  1K0S A;  1GFD A;  1KG1 A;  2G6F X;  2YDL A;  4L6V 5;  3VS2 A;  1YCY A;  2JT4 A;  3M0S A;  2HL5 C;  2DF6 A;  4HCK A;  2DBK A;  1ARK A;  4ANJ A;  1VYT A;  2RPN A;  3RKW A;  5KYU B;  2VB6 A;  3LGF A;  1ZBJ A;  4M78 C;  2DXB A;  2DL3 A;  4DEX A;  3G6E T;  3H41 A;  1NEG A;  1H3Z A;  2KY9 A;  3C95 A;  2JM8 A;  2JUF A;  2P4R A;  2YUP A;  4Z02 A;  3PGG A;  2LCC A;  2FB7 A;  1KJW A;  4FYV B;  4M78 B;  4IUR A;  5DLO A;  1VQ9 Q;  3VS0 A;  2EQU A;  5GAN 4;  2GTO A;  1YIT A;  3GP8 A;  3NMZ C;  1ZA2 B;  2K4Y A;  4A63 B;  4ELZ C;  2P84 A;  5EC7 A;  3BFM A;  5I22 A;  1I8F A;  3CCQ Q;  2PQW A;  1EIF A;  1UGS B;  2EYX A;  1LPL A;  1J3T A;  5GAN f;  3HSB A;  1LNX A;  2LJ1 A;  5FWB A;  5IN1 A;  1HJD A;  3CCU T;  1ABO A;  4C5I A;  5GMK m;  5GAO n;  3OSV A;  2DEU A;  2JW4 A;  1IHW A;  2I0N A;  2O88 A;  2DVE A;  4IUV A;  3MP8 A;  2QI2 A;  3CXC P;  5GMK i;  5D6W A;  5DY9 A;  3OYF A;  1K0X A;  2NYS A;  1MHN A;  4J8O A;  2E65 A;  1VQ8 T;  4DA4 A;  2E70 A;  1GRI A;  2HQH A;  1K76 A;  4HT9 A;  2MOX A;  2D8J A;  2EYZ A;  3IQL A;  4M7A C;  2RMO A;  1ZSZ C;  5CKD A;  4AFQ C;  4CI0 C;  4BE2 A;  4BE0 A;  4AFU C;  2DE0 X;  3I55 A;  2BE9 B;  1RAB B;  4C92 E;  2XU8 A;  1YN8 A;  1S1N A;  1IRX A;  4A4F A;  4PJO C;  1PKT A;  4M7A B;  1ZA1 B;  1TSF A;  1OOT A;  2L5Q A;  5CKE A;  4C8Q A;  2VV5 A;  3CC7 A;  5KYN A;  3CQT A;  2CP5 A;  4FCY A;  2MK5 A;  1QKW A;  2QQS A;  2DK3 A;  4PJO B;  4LDX A;  2KT1 A;  2KI7 A;  1KQ2 A;  2QYZ A;  1C0M A;  1HXD A;  1LOJ A;  5KYX A;  2X35 A;  4FSX A;  4LE9 A;  2NUP B;  3L1A A;  2QXF A;  1QWE A;  3KXT A;  4M78 G;  4M77 E;  1MMA A;  3FIF A;  1IB8 A;  5D7U A;  3VYH B;  5IHI A;  2LC4 A;  1TXQ A;  2E10 A;  2HEQ A;  2M0O A;  1PSF A;  2KRM A;  2XHC A;  1YI2 A;  4AMC A;  2MWP A;  3BY7 A;  3LLR A;  3F70 A;  1VYU A;  3QXE B;  3CMA A;  1BI1 A;  1VQP Q;  1NBE B;  3M58 A;  5LJ5 f;  1VQ6 Q;  4QVC A;  3MP6 A;  2EQI A;  3S3O A;  2CH4 W;  2LCS A;  4MDX A;  4C92 D;  5GAO r;  1N9R A;  5HK0 A;  3UPU A;  2ROT A;  3L42 A;  1AD5 A;  3QKJ A;  4F17 A;  3HHT B;  1N5Z A;  1YIT T;  1NJI R;  4OB2 B;  4ZTF A;  3CC2 A;  1WI7 A;  2JS2 A;  3X25 B;  3WVD B;  2L3S A;  3AHU A;  2SEM A;  2X3X D;  1Y07 A;  4DOW A;  3A98 A;  1YJN Q;  2WSE E;  1H92 A;  3BDL A;  1CKA A;  3EHR A;  5FRO A;  3PTA A;  3PVL A;  4FL6 A;  2CZ0 B;  3E9G A;  3CEY A;  3I35 A;  2VYT A;  3C12 A;  5CKF A;  2DYB A;  1GBR A;  2EYW A;  5KYY B;  2EVR A;  3VYG A;  4PJO G;  1NG2 A;  3I5R A;  2VGN A;  4RTT A;  4C0G A;  1UG1 A;  2ABL A;  2MF2 A;  3VS4 A;  4C92 A;  1PD1 A;  4EDU A;  3CBP A;  2DO3 A;  3HRT A;  3QZ5 B;  3MO8 A;  5CCA A;  1AZG B;  4IIM A;  3M57 A;  4QQD A;  3I55 T;  1KD1 U;  2E6Z A;  2FVU A;  3JCM g;  2F2W A;  2AHJ B;  5GMK e;  1B3Q A;  4GY5 A;  3NTH A;  4M75 D;  3CC7 T;  1SF9 A;  2HKQ B;  2EYQ A;  2YHT A;  2MPX C;  1D1C A;  1BCM A;  1QWF A;  2J7I A;  1PC0 A;  1IGQ A;  2HQE A;  5LJ3 h;  5LL6 S;  3JSC A;  1VQ5 A;  3SFM A;  3MJX A;  1YJW T;  4E7L A;  2RJD A;  5GAM d;  3I9Q A;  1B34 A;  2JTF A;  4RCC A;  1U1T A;  3REB B;  4M77 A;  4J83 A;  3JCM Q;  4K11 A;  3VS1 A;  4A4E A;  4OMF B;  1W2B P;  1YWP A;  4FIB A;  3E19 A;  3URG A;  5IHN A;  1Y96 A;  3JB9 F;  1WHG A;  4RG8 A;  1VOM A;  1VIE A;  3OSS C;  2OTL T;  1YI2 T;  2DM1 A;  3PMI A;  2QQ9 A;  3VUZ A;  3MPU B;  1M27 C;  1NYF A;  2E64 A;  2LQN A;  3VS5 A;  5KYW A;  2X4J A;  2Z0W A;  2QQR A;  3CMA T;  2CP6 A;  1I81 A;  2CSQ A;  2DAQ A;  2PTK A;  2KRS A;  1CKB A;  2K5I A;  1YJW Q;  3ZFJ A;  3VS6 A;  3M4G A;  3V8K A;  2YWW A;  2WAC A;  1I5L A;  3CCM Q;  1K73 U;  5CQX A;  5GMK l;  1FMW A;  1SHF A;  2YUQ A;  4XU1 A;  4C5E A;  2ENM A;  4PJL A;  1KD1 C;  3CC2 T;  2BKD N;  2E5K A;  2FRW A;  1OI1 A;  5J26 A;  2HSP A;  2D6F A;  2XIC A;  4KH1 B;  1MND A;  3QDF A;  1C6V X;  2DZ9 A;  1UEC A;  1VQO A;  1Q82 U;  1YFN A;  2OTL Q;  3CME A;  1K9M U;  2HAX A;  3A5Z B;  3FB9 A;  3M0R A;  4C92 B;  4M78 E;  3P8H A;  4DBQ A;  1KQS S;  1OZ2 A;  2DIG A;  3L2W A;  4LDY A;  3X26 B;  4ZGE B;  4M7D F;  1HD3 A;  2NUT A;  1FXX A;  2VXE A;  3TRE A;  2VVK A;  2QGF B;  1OEB A;  2CT4 A;  2DKG A;  2J6O A;  2KNB B;  1EX4 A;  4JRI A;  1AOJ A;  2H8H A;  2YSQ A;  1VQ7 A;  4MZM A;  1KQS A;  3CCS A;  1YHQ Q;  3EG2 A;  3TU4 K;  4ZN1 A;  1I0C A;  2EPD A;  1AWO A;  4PL6 A;  1B34 B;  3CPW A;  1G3S A;  4CC7 A;  1NZ9 A;  1TS9 A;  1HYO A;  3J7A F;  2YXY A;  1TUC A;  3CCV Q;  1YJ9 T;  2QTX A;  4E7K A;  1E7O A;  2QK0 A;  1TH7 A;  5I11 A;  2R58 A;  1W2B S;  1BI0 A;  1VQ5 T;  4BY6 C;  2OTJ T;  1MGQ A;  3GBQ A;  2V8J A;  4M75 C;  1VQ9 A;  4BI8 B;  1K73 C;  4QW2 A;  4BI3 A;  1UFF A;  1VUB A;  2J05 A;  4M7D G;  5KYW B;  4M7A E;  1X6G A;  1E6H A;  2EQM A;  4BY6 B;  1UUE A;  3CCQ A;  1W2B A;  3EGX B;  5GJW B;  4M75 B;  4LUD A;  1UDL A;  4CC4 B;  3QZ9 B;  1XQH A;  2MMP A;  1KD1 R;  4KT0 E;  4II1 A;  1Q82 C;  3SEM A;  1Q86 U;  4J6X A;  4PJO E;  1M2O A;  3RR6 A;  2XG8 D;  1OX9 A;  1Y7X A;  1QCN A;  1I1J A;  1I4K 1;  2AZV A;  1O9S A;  1KSW A;  4HVW A;  5GAN d;  1YJ9 Q;  4C5G A;  1NLP C;  2NLU A;  2JNG A;  4MZT A;  2LDM A;  1VQ5 Q;  1TG0 A;  4KBM B;  3H0I A;  4X9D A;  2OTJ Q;  2L3Q A;  2FEI A;  4DOV A;  1W1F A;  2MCN A;  3NTK A;  2GNC A;  4OML A;  1SG5 A;  2YUN A;  2KR3 A;  4OB3 B;  1YNZ A;  1G8X A;  1MV0 B;  2E3H A;  5GAN 6;  2J6K A;  1P92 A;  2JZ2 A;  2XDD A;  3OYN A;  2C0O A;  1BB9 A;  5I2M A;  5IXB A;  1OZ3 A;  2CUD A;  2VAS A;  2NUT B;  1B7T A;  5KE3 A;  1WJS A;  1SHG A;  3QJ6 A;  3V7S A;  2KDS A;  4M78 A;  1SSH A;  2IG0 A;  2JM9 A;  3GNF B;  5ECA A;  1VQO T;  4JJC A;  2XDB A;  1X6O A;  2LJ0 A;  1MMN A;  4C0F A;  1X27 A;  1G3Y A;  3LGL A;  1BBZ A;  4R0K A;  5CK9 A;  4PFP A;  1UGV A;  2LX7 A;  2OAU A;  3C94 A;  2QA4 A;  1JQQ A;  2QEX T;  5LJ3 f;  3JAM E;  5HKC A;  3M53 A;  2HKN A;  4Z89 A;  1K4U S;  1K73 R;  2A3L A;  2FRY A;  4OP0 A;  2EFI A;  4JLI A;  3V8L A;  1BKB A;  2K7A A;  3BDU A;  1YIJ T;  3QYG B;  2ZPB B;  2LNH B;  2P0P A;  1Q86 C;  3JB9 J;  4M75 G;  2LP5 A;  1M1G A;  5L8R E;  3JCM e;  4C5H A;  4PK4 A;  2EKH A;  5I21 A;  1VQP A;  1K9M R;  4J9B A;  5GAM j;  1VQ6 A;  1NE8 A;  1KQ1 A;  1XJW B;  5AT1 B;  1WZO A;  4PJN A;  2BE7 D;  2IIM A;  2XD0 A;  5EG2 A;  1K9A A;  1QKX A;  1VQ9 T;  2KVQ G;  5LJ5 d;  4JRP A;  4M7A A;  1IHV A;  1GCQ C;  1ZSZ A;  2C0T A;  3L2U A;  2QEX Q;  3VU3 C;  3OYM A;  2AT1 B;  1NJI U;  1BYM A;  4ZNX A;  3OYH A;  5FRM A;  2KGT A;  4PJO A;  3M4Y A;  2X3W D;  1YJN A;  2SRC A;  1YIJ Q;  4GBQ A;  4C0D C;  1JJ2 A;  3RER A;  3QJY A;  2LVM A;  3T9N A;  4A4H A;  2BZY A;  1SRL A;  2NUP A;  3VRZ A;  3GPL A;  3VS7 A;  4M4Z A;  4D6W A;  2LQK A;  2KEA A;  4CC2 A;  1UGQ B;  3HRS A;  2LQ8 A;  4OMN A;  4RTW A;  5CAI A;  4C0D B;  2P0K A;  2AK5 A;  4J5Y A;  1KC8 U;  4E6R A;  1YP5 A;  4L5G A;  3G7Z A;  3X20 B;  1ACM B;  1M8V A;  1ZBX A;  2DRM A;  1WGS A;  2KBT A;  2W10 A;  3S3N A;  3NPF A;  2JJ9 A;  4FYY B;  3UA6 A;  1QVG A;  1NEB A;  3QII A;  4RMO A;  2FL7 A;  4ZGD B;  1V1C A;  2DTO A;  3OYE A;  5GAM g;  1Q86 R;  1JEG A;  2JS0 A;  2QAS A;  4OB1 B;  5HK3 A;  4O5V A;  1I07 A;  4NS5 A;  3JB9 D;  2DTH A;  3OYD A;  2YRC A;  2L2P A;  3LX7 A;  2QA4 T;  3EG1 A;  3A8H B;  3OYB A;  1FYN A;  1NJI C;  1VIF A;  4D8K A;  3DKM A;  2M1H A;  2HBW A;  4BB7 A;  4N4I A;  2PNI A;  4OF1 A;  4XU0 A;  4KGV B;  3OBY A;  5HY6 A;  1NPR A;  2JMC A;  1JU5 C;  1QVP A;  5KYY A;  4N0A A;  2DPP B;  2ZPG B;  1ZSZ B;  2CP3 A;  1VQP T;  1GL5 A;  4PNO A;  1VQ6 T;  1KC8 C;  4FT4 A;  3CD6 T;  2F5K A;  1WXU A;  5GMK h;  2W0Z A;  1S72 Q;  1YJW A;  2FHD A;  1IZ6 A;  4AFS C;  3RES A;  3LWI A;  2A7Y A;  4DEY A;  2O9V A;  3H0H A;  3CCM A;  1W70 A;  4J9D A;  3PNW C;  2D1X A;  2CYZ B;  2QA4 Q;  1RI9 A;  1H8K A;  4IIO A;  3EG0 A;  4M7D D;  4F7U F;  1W6X A;  1MMG A;  3NHN A;  2ZZD A;  3OYC A;  4XTZ A;  1YJN T;  1BI3 A;  3KUF A;  2LQW A;  4J6W A;  2COW A;  2OTL A;  1D0Z A;  5CQY A;  5GAN j;  4IUT A;  4E7Z A;  4E7J A;  2LCL A;  1AVZ C;  4X9C A;  2CRE A;  5GAN 8;  2H3J A;  5A2Q E;  2D9T A;  3CD6 Q;  2DYI A;  2E12 A;  2CZ1 B;  2DTI A;  2HDA A;  5CKH A;  1U8R A;  4M75 E;  3CCE Q;  2ED1 A;  3RIR A;  4BDY A;  1IXD A;  2CZ7 B;  1QCF A;  4QQ6 A;  1E6G A;  4OGC A;  1YHQ A;  4RTX A;  4MZP A;  2DL4 A;  1CSK A;  4NL3 A;  4E7S A;  3A8M B;  3TVT A;  3H0F A;  4PJM A;  4HA8 A;  2CP7 A;  4ATO A;  1EZZ B;  2LTO A;  1I5O B;  2DXU A;  4YTL A;  3CCV A;  2C0I A;  1G5V A;  2CT3 A;  3EG3 A;  2LX9 A;  2ZGW A;  4N0A C;  4E7I A;  4FW1 A;  2O4X A;  2RJE A;  1QLY A;  2E3I A;  3V8J A;  4WTO B;  2F1L A;  2KYB A;  1KC8 R;  1KHC A;  2KXD A;  2MI6 A;  2A28 A;  3HRU A;  4PKC C;  5A0G A;  3X24 B;  3CCL Q;  2F69 A;  3FEO A;  1M9S A;  3OA6 A;  1ZHI A;  3GNG A;  1UB4 A;  5GAN 7;  1KQS P;  4GLK A;  2R57 A;  2PVD B;  3CPF A;  3I5S A;  3A8L B;  4JDS A;  3M59 A;  3DLM A;  1TTH B;  5GAN g;  2GBQ A;  3SWN C;  2JTE A;  3CPW P;  1C1A A;  2I2L A;  1UE9 A;  4V2S A;  2QDY B;  1GXI E;  1OPL A;  1YJ9 A;  1G3W A;  1YWO A;  3A8O B;  1BU1 A;  2RQR A;  5LJ5 j;  3SWN B;  4JJN K;  4KH0 B;  4KUI A;  5KCH A;  3TSW A;  2DIQ A;  2KXC A;  1QVF A;  2EJ9 A;  3L2V A;  4XTU A;  4JS5 A;  2OTJ A;  2OI3 A;  2HQX A;  2GQI A;  1M90 U;  3QHS A;  1QCO A;  3CCM T;  2DXC A;  1K1Z A;  3H6Z A;  3EFR A;  4QT7 A;  3JCM V;  1KK7 A;  2MWO A;  3MCA B;  3DB3 A;  1D09 B;  5CVI A;  4JPB W;  2MIO A;  3QYH B;  7AT1 B;  3Q1J A;  3NTI A;  3MP1 A;  1RAI B;  3PIO A;  3MEU A;  3QG1 A;  3D7S B;  3L2Z A;  1WX6 A;  1T0J A;  4LNP A;  4C8Q F;  3LYI A;  3OYA A;  1QMC A;  4J9I A;  4M7D C;  1IO6 A;  1JBM A;  2EIF A;  2CKK A;  3EAE A;  3EGX A;  2DET A;  4M75 A;  1N9S A;  3TSZ A;  4A4G A;  1WA7 A;  5GAO p;  2PU9 B;  4M7D B;  2GTJ A;  2XDP A;  4BI4 A;  2DRK A;  1W4S A;  1YCS B;  3UA7 A;  2EAY A;  2L0A A;  2F2X A;  1SKU B;  1AEY A;  1M30 A;  2KAF A;  1YHQ T;  3MEV A;  3PVQ A;  5GJV B;  5KCO A;  1WDX A;  5LJ3 d;  2O4X B;  2DMO A;  1QP2 A;  2RQT A;  1OX8 A;  1AWW A;  4FSS A;  2XID A;  2ZAE A;  3ZL7 C;  4RKU E;  2FG0 A;  1WIE A;  2DL5 A;  5AYF A;  3R6O A;  1VQN Q;  1UGR B;  2DEQ A;  5KH6 A;  3ME9 A;  3CCV T;  3FLG A;  5LJ5 g;  2FPD A;  5GAM e;  2M16 A;  3JB9 G;  2HMA A;  2DJZ A;  4C8Q G;  2V1R A;  3JRZ A;  4FM4 B;  3ER0 A;  2DD4 A;  4N4G A;  1M90 C;  2O9S A;  2DFU A;  4F04 B;  2HBP A;  3U23 A;  2QEX A;  3CPW S;  1NM7 A;  1IRE B;  2AZS A;  1Q81 U;  5GAN 2;  2K5F A;  4XAX B;  3S3M A;  1TWB A;  2K79 A;  1YIJ A;  4AT1 B;  3CBO A;  4XTY A;  3G4S Q;  4JS4 A;  3RKX A;  3OYG A;  2DA9 A;  2IPO B;  2NUZ A;  4WCI A;  2QTV A;  1AT1 B;  3VKI A;  3UAT A;  2GQV A;  2ED0 A;  3MEW A;  2E4H A;  2M02 A;  3JCM h;  2YRD A;  4NL2 A;  1Z9Z A;  4XK8 E;  2ESW A;  2EJG A;  3EGD A;  2PUO B;  3TCJ A;  4XU3 A;  1AHJ B;  5A0L A;  3RNJ A;  4C92 F;  1MUZ A;  4EMK C;  2A37 A;  3C4S A;  1XOV A;  1OV3 A;  1RLQ C;  4DBR A;  5IAY A;  4J6Y A;  4JRQ A;  4FU6 A;  4P5N A;  1JJ2 P;  1WHL A;  2A0F B;  8AT1 B;  1PNJ A;  2RI2 A;  1ZSG A;  2B8A A;  1N6A A;  2K9G A;  3OS0 A;  4IUQ A;  4EMK B;  1K9M C;  1U5S A;  2EBP A;  1X2K A;  1SPK A;  2QGG A;  3SD4 A;  3CCR T;  4J7I A;  4PLL A;  1GCQ A;  2YLB A;  2HCK A;  2K2V A;  4QVZ A;  1PM3 A;  2CSI A;  1Q81 C;  4M77 F;  1M90 R;  1MNE A;  3RMS A;  3VJP A;  4A4K A;  1NPP A;  1QP3 A;  1HSQ A;  1XTD A;  2RB6 A;  3G71 Q;  1ZX6 A;  3ULR B;  3EH2 A;  5IXF A;  3O8V A;  1QVG P;  3QUI A;  4CRI A;  2XMF A;  3HTR A;  3ZEH A;  6AT1 B;  4J9E A;  4MML A;  4O6J A;  2RI3 A;  2PZ1 A;  1O75 A;  2AKK A;  4BE1 A;  5GAN 5;  3UWN A;  1S72 A;  4PLI A;  3CCR Q;  5IHK A;  1M1K U;  3GLX A;  4JLG A;  2XKO C;  1BIA A;  4HCC A;  2AKL A;  1G2B A;  2BZ8 A;  2O2O A;  3JCM P;  2J6F A;  1VQK Q;  3FJP A;  1WHK A;  2D8H A;  1PKS A;  2QQB A;  3C0C A;  3OYL A;  5GAO m;  4UC4 A;  1WQ7 A;  2RK1 A;  1WHH A;  4JRK A;  2CS7 A;  1X69 A;  2PVO B;  1UHF A;  3EGD B;  3OS5 A;  5DLQ E;  5GAN e;  1N8R U;  2FZK B;  2V8K A;  3MHX A;  1T3S A;  4OGE A;  4OMQ A;  3OQ5 A;  5FLX E;  2KE9 A;  3CD6 A;  1KIK A;  2FO0 A;  2V8I A;  2JMA A;  4X1V A;  3OMG A;  1JJ2 S;  1D1B A;  3CCE A;  4A54 A;  2OX7 A;  4Y92 A;  2RQU A;  4BAC A;  4Z88 A;  4KRT A;  2XI9 A;  1Q81 R;  2YUO A;  3CC4 A;  4EMG A;  1PHT A;  4BD3 A;  3LW5 E;  4RTY A;  1WLP B;  2DVJ A;  4Q5W A;  3L2R A;  1F1B B;  2EYY A;  2RO0 A;  1WNL A;  2KRO A;  2A36 A;  4RTV A;  5GAN 3;  2P0Q A;  4CC3 A;  2D0N A;  1PD0 A;  2DL7 A;  1M1K C;  2WSC E;  1OU8 A;  3GIB A;  1TUG B;  2QQA A;  1QVG S;  4RTZ A;  3CCL A;  3RKY A;  5LJ3 j;  2M9U A;  3CCJ Q;  4AG2 C;  3P8B B;  3VV0 A;  1HK9 A;  5FW9 A;  5J3B A;  3QWY A;  1RUW A;  2R5A A;  1R0B G;  2RJF A;  1KFZ A;  2X9H A;  5CKB A;  4FYX B;  4OVA A;  3OW2 P;  3EH1 A;  5KE2 A;  2O31 A;  1B07 A;  1BK2 A;  3QWX X;  2VUB A;  2X4Y A;  1N8R C;  4KUD K;  3OB9 A;  2FYK A;  2LNV A;  4XTX A;  1BI2 A;  1R0C B;  2BIV A;  2FZC B;  2ZPI B;  2WSF E;  3QBY A;  2EGE A;  4M7D E;  3DB4 A;  4FW2 A;  1M3C A;  1S72 T;  1Y57 A;  2FPF A;  5LJ5 e;  3M0P A;  1FWZ A;  2KRN A;  3E2U A;  4C8Q D;  4IKF A;  4QQG A;  1AWX A;  2L3R A;  1GFC A;  2RD1 A;  4HKE A;  4FYW B;  3JCM f;  3I56 T;  2L89 A;  4FT2 A;  3CBM A;  2F5T X;  4F7U B;  3G6E Q;  1LVK A;  4TVR A;  4X34 A;  1SRM A;  4M78 F;  4LD6 A;  5I2S A;  4MDW A;  5D6Y A;  2RHU A;  2COY A;  3H9N A;  4D8D A;  4HVV A;  2G3R A;  4J9C A;  1RAC B;  3OBW A;  2RK2 A;  2CH4 A;  1QVF P;  4LUE A;  2VGM A;  2DJQ A;  3EFO A;  1M1K R;  5LJ3 g;  1IGU A;  1PRM C;  1WYX A;  2BTT A;  3CCE T;  3VRY A;  1D0Y A;  1MV3 A;  4KGZ B;  3JCM X;  3M0Q A;  1ZQ1 A;  2LZ6 B;  2RQW A;  1QQJ A;  4J9F A;  3CC4 T;  1UJY A;  3SDZ A;  3SWN A;  3I56 Q;  2PUK B;  1UEB A;  1Y71 A;  2GCX A;  2K3X A;  3CCU Q;  3M54 A;  1VQN A;  1LJO A;  5GAO q;  4R56 A;  2OJ2 A;  3TQ7 P;  2DZC A;  1N8R R;  1VQ8 Q;  1UJ0 A;  2EW3 A;  3JCM W;  2RNA A;  2FZG B;  2X4X A;  1R8O B;  1PCX A;  2ECZ A;  8ATC B;  2E5Q A;  1VA7 A;  1PG5 B;  3KBG A;  4AFZ C;  3OW2 S;  3ZBD A;  3CCL T;  4M7A F;  2YLC A;  4B9W A;  2CP0 A;  5HCK A;  1PWT A;  3QPH A;  4HT8 A;  1MMD A;  5CR2 A;  4F14 A;  1RI0 A;  5CO7 A;  4PJO F;  2V26 A;  1A0N B;  3PMT A;  3J81 E;  4HVU A;  3G4S A;  3CC4 Q;  1JXO A;  3OW2 A;  5IT9 E;  1JO8 A;  2HNI A;  2DX1 A;  4M7D A;  4F7U G;  5GAO l;  1VQL A;  2DXT A;  2YT6 A;  5D6X A;  2RA2 A;  3NGP A;  4EIK A;  2DD5 A;  2EWN A;  2DLP A;  2RHX A;  1RAG B;  2CP2 A;  2C06 A;  1Q7Y U;  4E7H A;  4OMM A;  3M0T A;  2RI5 A;  4RTU A;  1M8M A;  2CZ6 B;  3VUB A;  5GAM h;  1D0X A;  1N27 A;  3CXC S;  3PFS A;  2PVG B;  1FMV A;  3QDR B;  3AT1 B;  4BDZ A;  4M7A G;  4E47 A;  2BUD A;  4C8Q C;  1T3L A;  2EGA A;  2L8D A;  4M77 D;  1WPY A;  2RF0 A;  3FJ5 A;  2Y4Y A;  2V1Q A;  3EFO B;  1QVF S;  2K3Y A;  4GLM A;  1GBQ A;  1AZE A;  1H3H A;  2HD0 A;  1M3B A;  2VC8 A;  3M0U A;  5CIU A;  3CXC A;  2CUB A;  4EMH A;  4C8Q B;  5C6S A;  3SHW A;  1Z9Q A;  2RHI A;  1OUL A;  3WVE B;  1VQM A;  1YBY A;  1RAH B;  1M4Z A;  1YIT Q;  2CGH A;  2RM4 A;  1OU9 A;  4LDV A;  3FC3 A;  4ME7 A;  1TUD A;  1VQ4 A;  3RUX A;  2KT8 A;  5KYX B;  2IVW A;  3P8D A;  3OY9 A;  3G71 A;  4DBF A;  2D0Q B;  4R55 A;  2E6N A;  3HL8 A;  1XNI A;  2L3P A;  3RMQ A;  4ZGJ B;  4PFZ A;  3RDV A;  4QKU A;  1VQN T;  1V76 A;  3REA B;  3OYY A;  1OYX A;  1Q7Y C;  3M55 A;  2JTM A;  3CCR A;  2P4T A;  2K6D A;  2VXF A;  1NYG A;  4ELY C;  3I55 Q;  1X43 A;  1R77 A;  1WXB A;  2ZPF B;  1VQK A;  4JJD A;  3OMC A;  1M2V A;  4EMK A;  3LWH A;  1ABQ A;  4OB0 B;  1ZUU A;  3JCM b;  5IH2 A;  2K2M A;  4NOY A;  2B86 A;  2HL3 A;  1RLP C;  3CC7 Q;  2K57 A;  3EHQ A;  1T0H A;  1D1A A;  3HFO A;  3G4S T;  2Y4X A;  3JB9 H;  4KGX B;  1V29 B;  2OAW A;  2LJ3 A;  1VQL T;  2CDT A;  1X75 C;  2COZ A;  3JB9 I;  5M9O A;  4PFO A;  1U3O A;  2HSE B;  5FU7 C;  1H64 1;  3QSU A;  2EKO A;  2LT1 A;  1RAD B;  3PIP A;  2JVV A;  2JXB A;  3GF5 A;  2RQV A;  4C92 C;  3V7C A;  5J39 A;  4JZ3 A;  5FU7 B;  1UHC A;  2KQW A;  2LT4 A;  4B6M A;  1YI2 Q;  3E1S A;  1JB0 E;  1RL2 A;  1U06 A;  2QDL A;  4J9G A;  1KHI A;  2DNU A;  1M5Q 1;  3CMA Q;  2EJF A;  2GFA A;  1TOV A;  1WXT A;  1G83 A;  3OS2 A;  1K8A U;  3J80 E;  3X28 B;  2LMJ A;  1VYV A;  2RHZ A;  3BW1 A;  4J9H A;  1VQL Q;  3PE0 A;  1WHM A;  3ASK A;  1UGP B;  2K3B A;  1QW1 A;  2KSS A;  4JZ4 A;  4M77 C;  3LH5 A;  1VQM T;  1Q7Y R;  2BZX A;  1D3B A;  2EGC A;  4VUB A;  1OQK A;  5GAN h;  4LXC A;  3CC2 Q;  3EG9 A;  1VQ4 T;  5DM7 R;  3EGU A;  2M0Y A;  3CCJ A;  4F7U E;  4RUG A;  3MEA A;  4ESR A;  4RCB A;  5LJ3 e;  4DQ2 A;  3HFN A;  3G71 T;  4M77 B;  4DBH A;  3SB2 A;  3WXM B;  2MAM A;  4XQ3 A;  3HPW A;  4OMP A;  1X6B A;  2DL8 A;  3E9F A;  2X4W A;  1LCK A;  1Y96 B;  4A53 A;  1RAE B;  4AG1 C;  3QO3 A;  3NFC A;  4IUP A;  1M2V B;  3VS3 A;  4HCB A;  1EFN A;  3G1J A;  3M56 A;  3JV3 A;  2FPE A;  3O5Z A;  2Y90 A;  4M78 D;  2JN0 A;  2JOY A;  1VQM Q;  1VQK T;  2KYM A;  4L59 A;  3A8G B;  3M9Q A;  4JJB A;  1VQ4 Q;  5GMK j;  1JRI A;  2GF7 A;  2VWF A;  2EQK A;  1OPK A;  2X51 A;  5C0M A;  3G6E A;  5A0D A;  5GAM f;  4LD9 K;  3THK A;  1JXM A;  2ZPH B;  1RAA B;  2VKN A;  3HP9 A;  4F16 A;  3JCM d;  1Q95 G;  2ATC B;  1PSE A;  2RN8 A;  4C92 G;  1K8A C;  2K5L A;  3GOX A;  2E41 A;  1TU0 B;  3LH0 A;  5FU6 C;  3R6N A;  2XK0 A;  2E1H A;  4PJJ A;  3L2Q A;  4XTV A;  5KYU A;  1U1S A;  2R5M A;  9ATC B;  3BE3 A;  2KK4 A;  1Y0M A;  4M75 F;  2ZPE B;  3DLL A;  2J06 A;  5FU6 B;  3JCM c;  1WJQ A;  1ZLM A;  1WJR A;  2QG9 B;  2KMT A;  2A08 A;  3MKD A;  4LDU A;  3JCM J;  1WQW A;  1X2Q A;  5LJ5 h;  4KUL A;  1ZUK A;  2HZY A;  2RH2 A;  3CME T;  1RAF B;  3KFV A;  4RG2 A;  4QVD A;  1BCO A;  2GFU A;  4J7F A;  3I56 A;  1PRL C;  3MET A;  5FWC A;  4Y28 E;  1SSF A;  3FDR A;  3CCU A;  4M7A D;  4M77 G;  1D3B B;  4XTW A;  3M5A A;  3V7R A;  4JUV A;  3EG9 B;  2RJC A;  4HXJ A;  3UF4 A;  1AWJ A;  3INZ A;  1UTI A;  3HKS A;  1VQ8 A;  2EQJ A; 
#chains in the Genus database with same CATH homology
 2E3I A;  1WHL A;  1WHK A;  2E4H A;  2HKN A;  2M02 A;  1LPL A;  2CP3 A;  2COY A;  2HQH A;  2HL3 A;  2Z0W A;  2CP5 A;  1TOV A;  1WHH A;  2CP6 A;  2CP7 A;  2HL5 C;  2HKQ B;  1TXQ A;  2MPX C;  2E3H A;  1WHJ A;  2COW A;  2CP0 A;  1IXD A;  1WHM A;  3RDV A;  2QK0 A;  4B6M A;  2CP2 A;  2COZ A;  3E2U A;  1WHG A;  3TQ7 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...