3RDVA

Structure of the slain2c-clipcg1 complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
70
structure length
70
Chain Sequence
DFRVGERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTRPSKLTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SLAIN2 links microtubule plus end-tracking proteins and controls microtubule growth in interphase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords CAP-Gly domain-containing linker protein 1
total genus 15
structure length 70
sequence length 70
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 3rdvA00
1LPLA 3RDVA 2CP0A 2CP6A 1TXQA 1WHHA 1WHJA 2HQHA 2HKNA 2CP3A 2Z0WA 2HL5C 1WHGA 2QK0A 4B6MA 2M02A 1WHKA 3TQ7P 1WHMA 2COYA 3E2UA 1IXDA 2E3HA 2COZA 2HKQB 2E4HA 2COWA 2CP7A 2E3IA 2CP5A 2MPXC 1WHLA 2HL3A 1TOVA 2CP2A
chains in the Genus database with same CATH superfamily
2A7YA 1YITA 2CP0A 3CCMQ 4IKFA 2EPDA 4NL2A 1TUGB 2DL5A 2EYXA 4JRKA 3X20B 2LCSA 4C92G 1GCQC 4IUPA 1SPKA 1AEYA 1QLYA 3PNWC 1UHCA 4A4EA 4AFUC 4KULA 2BE7D 2K7AA 1IZ6A 4IUUA 3VKIA 1D0XA 4E2FB 2MCNA 2HQXA 1BI2A 4RCBA 3M9QA 3JCMe 2K2VA 3S3MA 1NJIU 2V1QA 3SD4A 2LX9A 3JSCA 2LQKA 1ZLMA 1LNXA 1M27C 1KC8U 3GLXA 2DRKA 2L5QA 4CRIA 1M90C 3JRZA 4XTZA 4GLMA 3FLGA 2RPNA 3PIOA 4C5IA 2J7IA 4JPBW 3PTAA 4RG8A 5J39A 1N6AA 2AKKA 1W70A 1VUBA 2GFUA 4PFPA 4P5NA 3VS2A 3M53A 5GANh 4C5GA 3OYLA 5KH6A 5GANd 1GBQA 4FYWB 5IT9E 2GCXA 2HNIA 4FT4A 1SRLA 2JM9A 1M3BA 1WX6A 2F2WA 4M7DG 2QGGA 2HEQA 4Z89A 2VB6A 4N0AA 3LH5A 2PU9B 2QA4A 2A28A 2RM4A 2K5IA 3QYHB 1YWOA 2WSEE 1TUCA 4M77E 1XJWB 2QDLA 4AMCA 1KG1A 2COWA 1WJRA 2L0AA 4PNOA 5GMKe 3QXEB 2GFAA 2YRDA 2DNUA 2PZ1A 3L2UA 5GJVB 2LCCA 1TOVA 4EMHA 5GMKi 4BE2A 1AWOA 1RAAB 5CIUA 1YJ9A 5HKCA 5AYFA 1V76A 4B6MA 1U06A 2AZVA 4YTLA 2ED1A 2VGNA 3LGFA 2Y90A 1ZQ1A 4F7UG 5IN1A 4PJOG 5HK0A 2VC8A 3EG9B 4HKEA 1SKUB 3ZBDA 2FZGB 3VU3C 4KGZB 1OPLA 1LOJA 2JVVA 1WDXA 2YRVA 3T9NA 1NM7A 2ABLA 1H3HA 2KMTA 3CXCA 3RNJA 2COZA 4HCKA 5DY9A 3HRUA 1IGUA 3VUZA 5FWBA 4CI0C 2KEAA 3TCJA 4BI4A 1JQQA 4K11A 4BDYA 1G8XA 4FW1A 3I56T 2K3BA 1KQSS 1HD3A 1UG1A 1WLPB 1IO6A 4C92B 5GANf 3CD6Q 1M1KR 3CCET 4M78C 2MOXA 1A0NB 3QSUA 1CKAA 3OYKA 5FW9A 2F1LA 2DERA 4RG2A 3TREA 1HJDA 2E41A 2JTFA 2WSCE 5LJ3e 3H9NA 8ATCB 3JCMd 3CCLA 2QAZA 3I5SA 3CPWP 4JJCA 5KE2A 4ZGDB 2BIVA 2DL7A 1ZA2B 1QVFA 1OULA 3V7CA 1UHFA 1NPPA 1VIFA 2R5MA 4C92C 3FEOA 2H3EB 4M7AC 3QJYA 4DBQA 2QQ9A 3LH0A 3I35A 3C12A 4F7UA 3UATA 2L89A 3I56A 2E5QA 1W4SA 1EZZB 1X69A 3A1PA 3JB9D 2XG8D 5IH2A 2EYZA 2I2LA 1PHTA 1BKBA 3M5AA 2OJ2A 4JDSA 2E12A 3G4ST 5GAN8 2DX1A 2HKQB 2DBKA 1VQ8A 3KBGA 4KH0B 1YJNQ 1FMWA 1I5OB 3H8ZA 4OVAA 1PRLC 2CS7A 3SWNC 2D6FA 5I2MA 3C0CA 1YJWQ 4E47A 1KHIA 3I55A 3C94A 4Z02A 4CC7A 2LQNA 2YDLA 3OA6A 1AWXA 1M2OA 2EQKA 2NWMA 4M75G 4HT9A 1U5SA 3AT1B 1ZA1B 4IIOA 4PJOF 1MNDA 5DLQE 4M7DD 1VQNA 4C0DC 4C0ZA 5I2SA 3UT1A 1Y57A 2BE9B 1OZ2A 2DLPA 1RI9A 3INZA 1AZEA 1Q95G 1ZX6A 4M7AB 1WHGA 1KD1R 2X4YA 1YP5A 2M02A 2WSFE 4NOYA 2LVMA 2O9VA 2YUOA 2LCLA 2XHCA 1OU8A 3DB3A 3VUBA 1MV0B 1VQOQ 4FSSA 2KT1A 2VUBA 4MMLA 3RKYA 3MEVA 4LN2A 4OMLA 1YHQA 3R6OA 5J3BA 1WHJA 3CCRA 3MKDA 1M1GA 4CC2A 2ZPIB 4M7DF 3X25B 5GANe 5KYYA 3U23A 2EBPA 3EFSA 1YJ9Q 2EQUA 1M90U 4OGCA 3KFVA 3L1AA 4OB1B 1VQLQ 1XNIA 2DD5A 2PNIA 4EMKC 2RQWA 3OYJA 5L8RE 5LL6S 2JT4A 1Q7YU 1Q7YR 3CCMT 1F1BB 4OGEA 3GBQA 1B34A 4L5GA 2CH4A 2RNAA 3M54A 1RLPC 1O9SA 4UC4A 1M3AA 4D8DA 2P4RA 3H41A 4RTYA 1VQLT 5CKHA 3FJ5A 1H3ZA 5GMKh 2DKGA 1G2BA 2EQMA 3A8OB 3J81E 3VS6A 3BFMA 5CQYA 2YLBA 2LDMA 2DXTA 1Y7XA 4KH1B 1N8RU 2NUPB 2JS0A 1NJIR 3L42A 3EGXA 3OW2S 5AT1B 5HCKA 5CQXA 1B34B 3S3NA 5FU6B 4HVWA 3OYFA 1B07A 2O88A 1VQ9Q 4CC3A 3UA6A 1BIAA 4C92F 3JCMP 1JO8A 1M30A 2CSQA 4ZN1A 2YRCA 1VQ4T 2DXUA 4BACA 1M8VA 3CD6A 2CYZB 3EGUA 2KYMA 3EFRA 3G4SQ 2AZSA 5I11A 1VQ9T 3VS5A 4M75F 1BI1A 2W0ZA 2ROTA 5A2QE 3CCSQ 1TTHB 2KXCA 1WGSA 1VQ4A 2EJGA 5CK9A 1VQ6A 2DJZA 1R0CB 4IIMA 3HHTB 4QQGA 4BB7A 2D1XA 1VQOA 4N4HA 4AG1C 2V8KA 2AKLA 3A8GB 3CMEA 6AT1B 1BBZA 4LXCA 1VQ6Q 4RTVA 2MI6A 2IG0A 3JCMV 1WFWA 4M7DE 5LJ3h 4R56A 4J5YA 2C0TA 2LP5A 2EFIA 1M4ZA 2BZYA 3DKMA 1WXUA 1B3QA 4C0FA 1N27A 2K2MA 2QYZA 3CC2Q 1M2VB 2ROLA 1M1KU 3CEYA 3NTIA 4MDWA 2KQWA 1Q81C 5GMKj 3E19A 2MMPA 2XDBA 4M77A 1M1FA 3PMTA 2GNCA 1Z9QA 2DILA 2DF6A 3HPWA 2RQUA 2NUTA 3VRZA 2P84A 4MZMA 2EJFA 3CBPA 4PLLA 1SF9A 3GNGA 2L2PA 1VQPQ 1K1ZA 4IUQA 1WI7A 4OMQA 4E6RA 1RADB 1I5LA 1M1KC 2V1RA 4TVRA 2L3RA 3EAEA 3O8VA 4JRIA 2AIRB 1JJ2A 2RK1A 4M75B 1VQ5Q 2J6OA 2QASA 1R0BG 1BK2A 3OMCA 2EYQA 2FPFA 1W2BA 2R58A 2GQVA 4WCIA 4Y92A 3PVLA 3HSBA 5A0DA 4MZPA 1YI2Q 2VASA 3CQTA 4M7AG 2KVQG 4CC4B 3I55T 2X4JA 3HFNA 1G3YA 2GTOA 2YSQA 2DEQA 2P0KA 1I81A 2XK0A 1AOJA 5GAMj 3C95A 2V8IA 4A4FA 3M4GA 2H8HA 3IQLA 3MP6A 1WZOA 2QQRA 2RJCA 4JUVA 5CKDA 2A08A 3LX7A 4M7AD 2HMAA 2X51A 3V8JA 1PKTA 3VS3A 3JCMJ 5LJ3j 2D8JA 2OTLA 4PFZA 4LDYA 1NG2A 1BB9A 3HRSA 3SWNB 1QKWA 3EH2A 3OYAA 3URGA 5FU6C 1I1JA 3VS0A 5GAN7 2F5KA 2CP3A 3SDZA 1AHJB 1Q7YC 4E7KA 2M16A 2QK0A 2DAQA 2BZ8A 1LVKA 1NYFA 2JMCA 2EYYA 1BI0A 3LYIA 4PJNA 3OYYA 3CMEQ 2FB7A 4DBHA 3BE3A 1VQKQ 2K4YA 3FC3A 4J9IA 3CCMA 3EGDB 2BTTA 1SG5A 1NBEB 1QVGP 2GF7A 1K9MC 2A36A 1QP3A 3HKSA 1UECA 2SEMA 2XD0A 2YUNA 2X35A 3CCQQ 4QVCA 3JB9J 1Q82C 4II1A 1MGQA 1KQ1A 4LUDA 1SHGA 1K0SA 4OMOA 3V7RA 3QBYA 1JB0E 3ZEHA 3JB9G 2EQIA 4PJOB 3FIFA 2QEXT 4HVUA 3CCQT 3EG9A 3WXMB 4RKUE 2A3LA 3L2WA 4J7FA 1VQ5T 1WPYA 2RO0A 1XTDA 3CC7Q 4M7AA 1ABQA 1UTIA 4Z88A 4FYXB 2JZ2A 2OTJA 2CZ0B 2QQAA 3TVTA 2IIMA 2D0NA 4N4IA 1IXDA 4J83A 3VS1A 5L23A 1X6OA 3SEMA 5CCAA 2RJFA 2DE0X 5GAMg 1YCSB 1UB4A 4XAXB 3E9GA 2HSEB 2OX7A 3JCMg 2FPDA 4C8QD 1D0YA 3I9QA 3M4YA 2Z0WA 3CCUA 1JXMA 1OOTA 3N5BB 3JCMh 2ATCB 1WHKA 1FMVA 3I5RA 5IXBA 4A54A 2DBMA 5M9OA 2FL7A 4XTUA 2VKNA 4C0GA 2X9HA 2ECZA 5CR2A 2MWPA 3SHWA 5GAMf 1WA7A 3E2UA 1K8AR 4C92E 1H641 2DVJA 5GAOp 3OYMA 1UGPB 3A8LB 3FDRA 2QGFB 3CBOA 5D6YA 4E7HA 3LWHA 1W2BP 2D9TA 5IHIA 1SEMA 1X2QA 2O2OA 2XU8A 3OB9A 1KC8C 3P8DA 2J05A 4Y91A 1VIEA 1RL2A 2YHTA 5GAMe 4A4GA 2DXCA 1AWJA 3E9FA 4JS4A 1Y07A 5KYYB 3GNFB 3MPUB 2M1HA 2RHUA 4NS5A 1QKXA 4M7AE 1RAHB 1GFCA 3MP8A 1TWBA 2DYIA 2L8DA 2HL5C 1M3CA 3RUXA 3CC4T 4MDXA 2LJ1A 4GY5A 4MMKA 5GAMd 1S1NA 1LJOA 5EG2A 4PLIA 2CZ1B 3CCST 3DLMA 2KY9A 2D0QB 2OTLQ 2B86A 3UPUA 5IXFA 2NUPA 1BU1A 1GCPA 1NYGA 2VV5A 1UGSB 4AFZC 5FLXE 3I55Q 1VQMT 3CC7A 4DOVA 3ZL7C 2J6FA 4LE9A 4M77G 4JRPA 4LD6A 3OSSC 4XQ3A 3CC2T 1NLPC 3P8BB 2XKOC 4J6XA 4HXJA 2P0PA 4OB0B 5J26A 2RB6A 3CMAA 2ZAEA 3QDFA 5KCHA 1VQ7Q 4BI3A 1RAEB 1JJ2P 2E70A 1ZSGA 4BE1A 5A0LA 5CVIA 1G83A 2CP2A 2JUFA 2EWNA 1JU5C 4GBQA 2KRMA 2C0IA 2OAWA 4LDXA 3JCMc 3QO3A 1VQMA 3G7ZA 2DL3A 3GOXA 4AG2C 1SHFA 5CKBA 1S72A 3ASKA 4E7IA 2MF2A 3M0TA 5GJWB 4E7LA 5DM7R 3OYBA 4M7DC 4ME7A 3OS0A 3OYGA 2CP7A 2MWOA 1PKSA 3TU4K 1S72Q 1Q82U 3MCAB 3UWNA 1VQ4Q 1SRMA 4RCCA 2K5LA 4M78E 3CC2A 1YJWA 2FG0A 3WVEB 2E6ZA 2EIFA 2CGHA 1I07A 4M78G 1FWZA 2P4TA 1QVFS 3GIBA 2YUQA 5ECAA 2F5TX 3OQ5A 1FMKA 1X75C 1YNZA 2E4HA 2DJQA 4J9BA 4FT2A 5KYUA 4N0AC 1JBMA 4C8QG 1YJWT 1OYXA 4XTYA 5FRNA 3PE0A 3RKXA 2JW4A 3MP1A 1ZSZB 4QQDA 2RI2A 1GXIE 1ZUKA 2HQHA 3O5ZA 1O75A 4OB3B 4R0KA 1YITT 3VRYA 1MNEA 2YUPA 2DETA 4OP0A 1D0ZA 1OI1A 1PRMC 1T3LA 2KSSA 3CC7T 1QCNA 3THKA 5LJ3g 4OF1A 3JCMb 4BDZA 3Q1JA 5FU7B 5D7UA 1NJIC 4QW2A 1AZGB 2FRWA 3BY7A 3X28B 2HBWA 3REAB 1Z9ZA 4OMMA 3CXCS 1VQ6T 1U8RA 3CCJA 1YJNT 3CCJQ 2DPPB 2O4XA 2RK2A 1YN8A 4BI8B 1RAIB 4BE0A 5EC7A 3GPLA 3M55A 1E7OA 2DZCA 4ELZC 2W10A 1VYUA 4XTXA 2KR3A 3QIIA 1M2VA 1RUWA 2KAFA 2JM8A 3QWYA 1VQNT 2HDAA 1IRXA 3EG0A 3OY9A 4J9HA 1QCOA 1HSQA 1UJYA 3M0SA 2ESWA 4J8OA 3KXTA 3QZ5B 2FEIA 1Y0MA 2QQSA 1MMGA 2QEXQ 4GLKA 2LT4A 2ZGWA 4M75A 2QA4T 1D09B 3KUFA 4BUGA 5GAOm 2SRCA 2GTJA 4ESRA 1YCYA 5A0GA 1G3TA 1NE8A 4L59A 2EVRA 1MV3A 2AK5A 2RQTA 1W1FA 1VQ7T 1ABOA 3NMZC 2DEUA 4NL3A 2IPOB 1W2BS 1K73R 3RR6A 4RTZA 1M90R 2KK4A 3CCSA 4RUGA 3QWXX 1ZSZC 1ZBXA 2LT1A 2O9SA 1VQKT 1QVFP 1WXBA 2DTOA 1R8OB 5I21A 5KYXA 3PGGA 1ZSZA 2EYWA 4F7UE 2L3SA 2M0OA 2ZCFB 2K5FA 1JEGA 1TUDA 3VYGA 5KYUB 3NTKA 2FZCB 2RHZA 1T0HA 4VUBA 1V29B 1X6BA 2XIDA 2M9UA 4ZNXA 2KGTA 3RDVA 2CH4W 2YXYA 4C8QB 1WHHA 2VVKA 2VYTA 2HD0A 1WQ7A 2R57A 4XU3A 3V8KA 1T3SA 2FO0A 2RD1A 5IHKA 5LJ5d 4X1VA 3FJPA 2DM1A 1R77A 1UE9A 5GAMh 2XICA 3M0RA 5CO7A 1TSFA 4O6JA 1QVGA 1QVGS 1PSEA 1EIFA 4ZGJB 2RQVA 2GBQA 3TSZA 1T0JA 5LJ5j 1K8AC 4F7UF 4C92D 3EGDA 3VS4A 2DRMA 1RI0A 3OS2A 4C5EA 1RAFB 3PIPA 2NLUA 2LRQA 4DEXA 2NUZA 4Q5WA 1Q86C 2PTKA 1ACMB 2RA2A 4RTWA 2DL8A 2DYBA 1K73C 3EH1A 4F14A 1KFZA 2J6KA 3A5ZB 2RI3A 3JCMf 1I0CA 1WQWA 3GF5A 1VQPT 2DFUA 5GAN5 3L2RA 4PL6A 1K8AU 2P0QA 2LQ8A 2VXFA 3HRTA 4DBFA 1YWPA 4RTTA 2HZYA 1IHWA 3L2QA 4B9WA 3M0UA 1Y96B 3OBYA 4EMKA 1YIJA 2EQJA 4PJOA 3TEEA 5GAN4 5D6XA 3C4SA 3EHRA 4F7UB 4XU2A 2FZKB 2KXDA 4A4KA 1AD5A 2G3RA 4KGVB 5CKEA 1NLOC 4C8QF 3WVDB 2E5KA 2LNVA 3JAME 2RHXA 3EFOB 1VOMA 4DQ2A 2ENMA 2DXBA 5LJ5e 3OMGA 2DZ9A 1Y96A 2RJEA 2MPXC 1X43A 1YHQT 4J7IA 4JJNK 1RAGB 4M7DA 1PD0A 4FSXA 1UGQB 2JTEA 2K3YA 4PJOE 1C6VX 3MO8A 2X3WD 2QA4Q 1MMDA 2MYSA 1OX8A 5IHNA 2KRNA 3PVQA 3FB9A 3CCVQ 2DIQA 3A8HB 3CCJT 1YJNA 2LTOA 1VYVA 3RIRA 1PCXA 3AHUA 1U1TA 1PNJA 3EGXB 2OTJQ 1KD1U 2EKHA 4C8QA 1H8KA 2HAXA 2K9GA 3OBWA 1YBYA 3QDRB 3JCMW 1YI2A 5LJ5g 2K79A 3OYEA 2YWWA 3S6WA 2EW3A 3MEWA 3BDUA 3CCVA 1UGRB 1I4K1 2JNGA 2PUOB 1OZ3A 2VGMA 4M78A 1OPKA 4ZTJA 1M9SA 2E1HA 2QQBA 1KJWA 2RQRA 1VQ5A 2DL4A 2RH2A 1Q81R 1VYTA 4RTUA 2F69A 3QG1A 3G1JA 1P92A 3X24B 4XU0A 4ATOA 3HL8A 1OU9A 2KYBA 3CCLQ 4J9GA 1K4US 2V8JA 3H0HA 3A8MB 4C92A 1V1CA 4FM4B 1RABB 4M77C 4R55A 3CC4A 3HTRA 3M58A 4KGXB 3OW2P 3P8HA 4FW2A 1RLQC 3LLRA 2LX7A 1EFNA 2ZZDA 3CC4Q 3FRNA 2RJDA 4Z8AA 1WYXA 1ZUYA 2HL3A 2OAUA 1N9RA 2CT3A 4PJJA 5KE3A 5GAN2 2YLCA 4ZN3A 1KHCA 4FYVB 2XMFA 1TH7A 1OEBA 2OI3A 3F70A 3G6ET 2X3XD 1KQSP 2RHIA 3M59A 3CCUQ 2HCKA 1JXOA 4ORZA 5CKFA 2PVOB 2O01E 4XU1A 2QEXA 2A37A 2K3XA 4M4ZA 4J6YA 1UJ0A 3VV0A 3L2VA 4ZGEB 4LDUA 1QMCA 4HVVA 1D3BA 4QVDA 1VQ9A 3OW2A 1C0MA 2A0FB 1VQMQ 4M75E 3META 4E7SA 3D7SB 4M78B 3M0PA 2K57A 4B9XA 3JV3A 1ZHIA 4QVZA 3QPHA 2EGCA 1U3OA 2O4XB 1WJQA 4AT1B 4ELYC 5LJ3f 2RN8A 1AVZC 1MMAA 3JB9H 1MHNA 1QWFA 2I0NA 1VQ7A 1FXXA 2CP6A 2XDPA 5GMKm 5GAOn 1S72T 2JOYA 4PJLA 1N8RR 1AT1B 4A4HA 1YIJT 5LJ5f 3ZFJA 2CZ7B 3BDLA 3J80E 4XTWA 2KBTA 5D6WA 1UGVA 1SSHA 4JJBA 4FYYB 1BIBA 4C0DB 2CP5A 5KYWB 2ZPHB 1U1SA 2M51A 2V26A 2DTHA 2KROA 4M78F 3CCUT 2F2VA 4PJOD 2O31A 3H0IA 2E10A 4DA4A 2IVWA 3CCEQ 3RBBB 4OMNA 3RMQA 4JRQA 3H0FA 4WF2A 5GANj 2PVGB 2DIGA 4M77B 4HCZA 1GCQA 1K76A 4F17A 2PQWA 3BW1A 2ZPGB 9ATCB 5HK3A 3MHXA 2DTIA 5FU7C 4IURA 3RMSA 5IAYA 3CCRQ 2F2XA 2ZPBB 2E3IA 3JCMX 2YT6A 3NTHA 1BI3A 1BCMA 2EAYA 1DJ7B 4Y28E 4M75C 3UF4A 1N8RC 4C8QE 3LW5E 1PD1A 1G3SA 1TG0A 3VYHB 4M77F 2H3JA 3CCVT 1N9SA 2CKKA 1KQ2A 3G4SA 2JTMA 4HCBA 2Y4YA 2CUDA 4X34A 1VQ8Q 3REBB 1UFFA 1MUZA 2FVUA 3RKWA 2Y4XA 2C06A 2E6NA 2L3PA 1HXDA 1WIEA 3OS1A 2HBPA 5GAN3 1BYMA 2JS2A 3H6ZA 4QKUA 4JZ3A 1SSFA 4PK4A 4KT0E 1PSFA 4OMFB 3QYGB 2CREA 1Y71A 1FYNA 3NGPA 3HP9A 4J9CA 2X4XA 3TQ7P 4LDVA 1NZ9A 2LQWA 1E6HA 3HFOA 4RMOA 3V8LA 2M0YA 1K9AA 1GRIA 3CXCP 3I56Q 1WHLA 2DK3A 3PMIA 3RERA 1AWWA 4L6V5 1YFNA 4M75D 4EMGA 4ANJA 1M5Q1 5GMKl 3JCMQ 5GAN6 2BUDA 4FIBA 1KSWA 1CSKA 1UUEA 4WTOB 1OV3A 4X9CA 3E1SA 1TS9A 3EG2A 3NPFA 1WNLA 3MEAA 3CCQA 1IB8A 2G6FX 3EHQA 3M0QA 4C8QC 3CBMA 1C1AA 1MMNA 1G3WA 3X26B 4J9FA 4A63B 3G6EA 5FWCA 1CKBA 1X6GA 1YI2T 4QQ6A 1Q86R 4EDUA 1WHMA 5FROA 2D8HA 3LWIA 2HSPA 5LJ3d 4EIKA 3MEUA 1XOVA 1XQHA 1NEBA 2CZ6B 1VQNQ 4LNPA 4PJOC 3OYHA 1Q81U 1KD1C 4BY6B 3CPWA 3CD6T 1QQJA 5DLOA 1QVPA 4JS5A 1EX4A 1WXTA 2BKDN 3R6NA 4PKCC 1OQKA 2QXFA 2JN0A 1KK7A 4F04B 1QCFA 1QP2A 4HT8A 1BCOA 4A53A 2AT1B 4AFQC 2KRSA 3JB9F 1LPLA 3CPWS 2EGAA 5KYNA 4JZ4A 2CSIA 3CCEA 2EKOA 2RHYA 4C5HA 1GBRA 1NEGA 1HK9A 2QI2A 1K9MU 3UDCA 1G5VA 1WJSA 2DVEA 2KT8A 7AT1B 2VWFA 1HYOA 2KI7A 4E7ZA 2GQIA 2XDDA 2FYKA 3OYNA 2FHDA 3CPFA 3L2ZA 1UDLA 4LUEA 2QTVA 3SFMA 4FU6A 1PM3A 4HCCA 4KBMB 3OYIA 3SWNA 4O5VA 4KUIA 4LDWA 2EGEA 2QDYB 1JRIA 2LZ6B 4DBRA 1YJ9T 3CMET 1QWEA 1IHVA 4N4GA 1KQSA 4RTXA 2MAMA 3UA7A 4DEYA 2ZPFB 4KRTA 2LMJA 4OMPA 5CAIA 2JXBA 1Q86U 1GL5A 1ZUUA 4X9DA 2HQEA 4J9DA 1D3BB 2J06A 2GGRA 3RESA 4JLIA 4FL6A 2CDTA 1K9MR 2ZPEB 3QKJA 4QT7A 1VA7A 2DD4A 2K6DA 2VXEA 1VQOT 1KIKA 2JMAA 1H92A 4XTVA 1VQKA 2ED0A 4D6WA 3QHSA 4DOWA 1YITQ 5GAOr 2R5AA 3OS5A 2B8AA 3JB9I 2DA9A 1W6XA 4M77D 5GAOl 1YIJQ 2COYA 1D1AA 4F16A 1RACB 4LD9K 1NPRA 4IUVA 4J9EA 2XI9A 4V2SA 2FRYA 3OYDA 2DO3A 1J3TA 2LC4A 1B7TA 1TXQA 2E65A 4HA8A 2HKNA 3S3OA 3G6EQ 2KDSA 2QTXA 4E7JA 2AHJB 1IREB 2C0OA 3QZ9B 3DB4A 3EG3A 3PFSA 1QW1A 3LGLA 2JJ9A 1UEBA 2LNHB 2L3QA 1X27A 2FPEA 1D1CA 5C6SA 1TU0B 3CCRT 4M7DB 1VQ8T 5HY6A 1OX9A 3M56A 2EJ9A 2RI5A 1K0XA 5KYXB 3ME9A 3QUIA 4FCYA 2CT4A 3OYCA 2LJ3A 4XK8E 2PUKB 4PJMA 5GANg 3J7AF 4AFSC 2QG9B 2PVDB 2KNBB 8AT1B 4BY6C 3SB2A 2E3HA 3DLLA 2RF0A 4OB2B 3CMAQ 3VJPA 3CCLT 3G71Q 3G71A 4MZTA 1JJ2S 1E6GA 3OSVA 4M78D 1LCKA 1Q82R 4PFOA 4J6WA 2LJ0A 5GAOq 3VS7A 1X01A 3PT9A 4D8KA 1VQLA 1ZBJA 3CMAT 3ULRB 2RMOA 2X4WA 4EMKB 3G71T 3GP8A 4M7AF 5C0MA 5FRMA 2CUBA 3QJ6A 4EPCA 2MK5A 2NUTB 1D1BA 1YHQQ 4JLGA 1N5ZA 3NHNA 1VQPA 3M57A 2WACA 1X2KA 2OTLT 3MJXA 2E64A 4JJDA 2OTJT 5I22A 3ER0A 3TSWA 3EG1A 1IGQA 2DMOA 3A98A 1GFDA 1M8MA 4IUTA 1I8FA 4BD3A 4ZTFA 1KC8R 4KUDK 2BZXA 5KYWA 1PC0A 3EFOA 3NFCA 5KCOA 1K73U 2MIOA 3V7SA 1ARKA 1FX7A 5LJ5h 1PG5B 1PWTA 2KE9A 2NYSA
chains in the Genus database with same CATH topology
1LPLA 3RDVA 2CP0A 2CP6A 1TXQA 1WHHA 1WHJA 2HQHA 2HKNA 2CP3A 2Z0WA 2HL5C 1WHGA 2QK0A 4B6MA 2M02A 1WHKA 3TQ7P 1WHMA 2COYA 3E2UA 1IXDA 2E3HA 2COZA 2HKQB 2E4HA 2COWA 2CP7A 2E3IA 2CP5A 2MPXC 1WHLA 2HL3A 1TOVA 2CP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LPL A;  3RDV A;  2CP0 A;  2CP6 A;  1TXQ A;  1WHH A;  1WHJ A;  2HQH A;  2HKN A;  2CP3 A;  2Z0W A;  2HL5 C;  1WHG A;  2QK0 A;  4B6M A;  2M02 A;  1WHK A;  3TQ7 P;  1WHM A;  2COY A;  3E2U A;  1IXD A;  2E3H A;  2COZ A;  2HKQ B;  2E4H A;  2COW A;  2CP7 A;  2E3I A;  2CP5 A;  2MPX C;  1WHL A;  2HL3 A;  1TOV A;  2CP2 A; 
#chains in the Genus database with same CATH topology
 2A7Y A;  1YIT A;  2CP0 A;  3CCM Q;  4IKF A;  2EPD A;  4NL2 A;  1TUG B;  2DL5 A;  2EYX A;  4JRK A;  3X20 B;  2LCS A;  4C92 G;  1GCQ C;  4IUP A;  1SPK A;  1AEY A;  1QLY A;  3PNW C;  1UHC A;  4A4E A;  4AFU C;  4KUL A;  2BE7 D;  2K7A A;  1IZ6 A;  4IUU A;  3VKI A;  1D0X A;  4E2F B;  2MCN A;  2HQX A;  1BI2 A;  4RCB A;  3M9Q A;  3JCM e;  2K2V A;  3S3M A;  1NJI U;  2V1Q A;  3SD4 A;  2LX9 A;  3JSC A;  2LQK A;  1ZLM A;  1LNX A;  1M27 C;  1KC8 U;  3GLX A;  2DRK A;  2L5Q A;  4CRI A;  1M90 C;  3JRZ A;  4XTZ A;  4GLM A;  3FLG A;  2RPN A;  3PIO A;  4C5I A;  2J7I A;  4JPB W;  3PTA A;  4RG8 A;  5J39 A;  1N6A A;  2AKK A;  1W70 A;  1VUB A;  2GFU A;  4PFP A;  4P5N A;  3VS2 A;  3M53 A;  5GAN h;  4C5G A;  3OYL A;  5KH6 A;  5GAN d;  1GBQ A;  4FYW B;  5IT9 E;  2GCX A;  2HNI A;  4FT4 A;  1SRL A;  2JM9 A;  1M3B A;  1WX6 A;  2F2W A;  4M7D G;  2QGG A;  2HEQ A;  4Z89 A;  2VB6 A;  4N0A A;  3LH5 A;  2PU9 B;  2QA4 A;  2A28 A;  2RM4 A;  2K5I A;  3QYH B;  1YWO A;  2WSE E;  1TUC A;  4M77 E;  1XJW B;  2QDL A;  4AMC A;  1KG1 A;  2COW A;  1WJR A;  2L0A A;  4PNO A;  5GMK e;  3QXE B;  2GFA A;  2YRD A;  2DNU A;  2PZ1 A;  3L2U A;  5GJV B;  2LCC A;  1TOV A;  4EMH A;  5GMK i;  4BE2 A;  1AWO A;  1RAA B;  5CIU A;  1YJ9 A;  5HKC A;  5AYF A;  1V76 A;  4B6M A;  1U06 A;  2AZV A;  4YTL A;  2ED1 A;  2VGN A;  3LGF A;  2Y90 A;  1ZQ1 A;  4F7U G;  5IN1 A;  4PJO G;  5HK0 A;  2VC8 A;  3EG9 B;  4HKE A;  1SKU B;  3ZBD A;  2FZG B;  3VU3 C;  4KGZ B;  1OPL A;  1LOJ A;  2JVV A;  1WDX A;  2YRV A;  3T9N A;  1NM7 A;  2ABL A;  1H3H A;  2KMT A;  3CXC A;  3RNJ A;  2COZ A;  4HCK A;  5DY9 A;  3HRU A;  1IGU A;  3VUZ A;  5FWB A;  4CI0 C;  2KEA A;  3TCJ A;  4BI4 A;  1JQQ A;  4K11 A;  4BDY A;  1G8X A;  4FW1 A;  3I56 T;  2K3B A;  1KQS S;  1HD3 A;  1UG1 A;  1WLP B;  1IO6 A;  4C92 B;  5GAN f;  3CD6 Q;  1M1K R;  3CCE T;  4M78 C;  2MOX A;  1A0N B;  3QSU A;  1CKA A;  3OYK A;  5FW9 A;  2F1L A;  2DER A;  4RG2 A;  3TRE A;  1HJD A;  2E41 A;  2JTF A;  2WSC E;  5LJ3 e;  3H9N A;  8ATC B;  3JCM d;  3CCL A;  2QAZ A;  3I5S A;  3CPW P;  4JJC A;  5KE2 A;  4ZGD B;  2BIV A;  2DL7 A;  1ZA2 B;  1QVF A;  1OUL A;  3V7C A;  1UHF A;  1NPP A;  1VIF A;  2R5M A;  4C92 C;  3FEO A;  2H3E B;  4M7A C;  3QJY A;  4DBQ A;  2QQ9 A;  3LH0 A;  3I35 A;  3C12 A;  4F7U A;  3UAT A;  2L89 A;  3I56 A;  2E5Q A;  1W4S A;  1EZZ B;  1X69 A;  3A1P A;  3JB9 D;  2XG8 D;  5IH2 A;  2EYZ A;  2I2L A;  1PHT A;  1BKB A;  3M5A A;  2OJ2 A;  4JDS A;  2E12 A;  3G4S T;  5GAN 8;  2DX1 A;  2HKQ B;  2DBK A;  1VQ8 A;  3KBG A;  4KH0 B;  1YJN Q;  1FMW A;  1I5O B;  3H8Z A;  4OVA A;  1PRL C;  2CS7 A;  3SWN C;  2D6F A;  5I2M A;  3C0C A;  1YJW Q;  4E47 A;  1KHI A;  3I55 A;  3C94 A;  4Z02 A;  4CC7 A;  2LQN A;  2YDL A;  3OA6 A;  1AWX A;  1M2O A;  2EQK A;  2NWM A;  4M75 G;  4HT9 A;  1U5S A;  3AT1 B;  1ZA1 B;  4IIO A;  4PJO F;  1MND A;  5DLQ E;  4M7D D;  1VQN A;  4C0D C;  4C0Z A;  5I2S A;  3UT1 A;  1Y57 A;  2BE9 B;  1OZ2 A;  2DLP A;  1RI9 A;  3INZ A;  1AZE A;  1Q95 G;  1ZX6 A;  4M7A B;  1WHG A;  1KD1 R;  2X4Y A;  1YP5 A;  2M02 A;  2WSF E;  4NOY A;  2LVM A;  2O9V A;  2YUO A;  2LCL A;  2XHC A;  1OU8 A;  3DB3 A;  3VUB A;  1MV0 B;  1VQO Q;  4FSS A;  2KT1 A;  2VUB A;  4MML A;  3RKY A;  3MEV A;  4LN2 A;  4OML A;  1YHQ A;  3R6O A;  5J3B A;  1WHJ A;  3CCR A;  3MKD A;  1M1G A;  4CC2 A;  2ZPI B;  4M7D F;  3X25 B;  5GAN e;  5KYY A;  3U23 A;  2EBP A;  3EFS A;  1YJ9 Q;  2EQU A;  1M90 U;  4OGC A;  3KFV A;  3L1A A;  4OB1 B;  1VQL Q;  1XNI A;  2DD5 A;  2PNI A;  4EMK C;  2RQW A;  3OYJ A;  5L8R E;  5LL6 S;  2JT4 A;  1Q7Y U;  1Q7Y R;  3CCM T;  1F1B B;  4OGE A;  3GBQ A;  1B34 A;  4L5G A;  2CH4 A;  2RNA A;  3M54 A;  1RLP C;  1O9S A;  4UC4 A;  1M3A A;  4D8D A;  2P4R A;  3H41 A;  4RTY A;  1VQL T;  5CKH A;  3FJ5 A;  1H3Z A;  5GMK h;  2DKG A;  1G2B A;  2EQM A;  3A8O B;  3J81 E;  3VS6 A;  3BFM A;  5CQY A;  2YLB A;  2LDM A;  2DXT A;  1Y7X A;  4KH1 B;  1N8R U;  2NUP B;  2JS0 A;  1NJI R;  3L42 A;  3EGX A;  3OW2 S;  5AT1 B;  5HCK A;  5CQX A;  1B34 B;  3S3N A;  5FU6 B;  4HVW A;  3OYF A;  1B07 A;  2O88 A;  1VQ9 Q;  4CC3 A;  3UA6 A;  1BIA A;  4C92 F;  3JCM P;  1JO8 A;  1M30 A;  2CSQ A;  4ZN1 A;  2YRC A;  1VQ4 T;  2DXU A;  4BAC A;  1M8V A;  3CD6 A;  2CYZ B;  3EGU A;  2KYM A;  3EFR A;  3G4S Q;  2AZS A;  5I11 A;  1VQ9 T;  3VS5 A;  4M75 F;  1BI1 A;  2W0Z A;  2ROT A;  5A2Q E;  3CCS Q;  1TTH B;  2KXC A;  1WGS A;  1VQ4 A;  2EJG A;  5CK9 A;  1VQ6 A;  2DJZ A;  1R0C B;  4IIM A;  3HHT B;  4QQG A;  4BB7 A;  2D1X A;  1VQO A;  4N4H A;  4AG1 C;  2V8K A;  2AKL A;  3A8G B;  3CME A;  6AT1 B;  1BBZ A;  4LXC A;  1VQ6 Q;  4RTV A;  2MI6 A;  2IG0 A;  3JCM V;  1WFW A;  4M7D E;  5LJ3 h;  4R56 A;  4J5Y A;  2C0T A;  2LP5 A;  2EFI A;  1M4Z A;  2BZY A;  3DKM A;  1WXU A;  1B3Q A;  4C0F A;  1N27 A;  2K2M A;  2QYZ A;  3CC2 Q;  1M2V B;  2ROL A;  1M1K U;  3CEY A;  3NTI A;  4MDW A;  2KQW A;  1Q81 C;  5GMK j;  3E19 A;  2MMP A;  2XDB A;  4M77 A;  1M1F A;  3PMT A;  2GNC A;  1Z9Q A;  2DIL A;  2DF6 A;  3HPW A;  2RQU A;  2NUT A;  3VRZ A;  2P84 A;  4MZM A;  2EJF A;  3CBP A;  4PLL A;  1SF9 A;  3GNG A;  2L2P A;  1VQP Q;  1K1Z A;  4IUQ A;  1WI7 A;  4OMQ A;  4E6R A;  1RAD B;  1I5L A;  1M1K C;  2V1R A;  4TVR A;  2L3R A;  3EAE A;  3O8V A;  4JRI A;  2AIR B;  1JJ2 A;  2RK1 A;  4M75 B;  1VQ5 Q;  2J6O A;  2QAS A;  1R0B G;  1BK2 A;  3OMC A;  2EYQ A;  2FPF A;  1W2B A;  2R58 A;  2GQV A;  4WCI A;  4Y92 A;  3PVL A;  3HSB A;  5A0D A;  4MZP A;  1YI2 Q;  2VAS A;  3CQT A;  4M7A G;  2KVQ G;  4CC4 B;  3I55 T;  2X4J A;  3HFN A;  1G3Y A;  2GTO A;  2YSQ A;  2DEQ A;  2P0K A;  1I81 A;  2XK0 A;  1AOJ A;  5GAM j;  3C95 A;  2V8I A;  4A4F A;  3M4G A;  2H8H A;  3IQL A;  3MP6 A;  1WZO A;  2QQR A;  2RJC A;  4JUV A;  5CKD A;  2A08 A;  3LX7 A;  4M7A D;  2HMA A;  2X51 A;  3V8J A;  1PKT A;  3VS3 A;  3JCM J;  5LJ3 j;  2D8J A;  2OTL A;  4PFZ A;  4LDY A;  1NG2 A;  1BB9 A;  3HRS A;  3SWN B;  1QKW A;  3EH2 A;  3OYA A;  3URG A;  5FU6 C;  1I1J A;  3VS0 A;  5GAN 7;  2F5K A;  2CP3 A;  3SDZ A;  1AHJ B;  1Q7Y C;  4E7K A;  2M16 A;  2QK0 A;  2DAQ A;  2BZ8 A;  1LVK A;  1NYF A;  2JMC A;  2EYY A;  1BI0 A;  3LYI A;  4PJN A;  3OYY A;  3CME Q;  2FB7 A;  4DBH A;  3BE3 A;  1VQK Q;  2K4Y A;  3FC3 A;  4J9I A;  3CCM A;  3EGD B;  2BTT A;  1SG5 A;  1NBE B;  1QVG P;  2GF7 A;  1K9M C;  2A36 A;  1QP3 A;  3HKS A;  1UEC A;  2SEM A;  2XD0 A;  2YUN A;  2X35 A;  3CCQ Q;  4QVC A;  3JB9 J;  1Q82 C;  4II1 A;  1MGQ A;  1KQ1 A;  4LUD A;  1SHG A;  1K0S A;  4OMO A;  3V7R A;  3QBY A;  1JB0 E;  3ZEH A;  3JB9 G;  2EQI A;  4PJO B;  3FIF A;  2QEX T;  4HVU A;  3CCQ T;  3EG9 A;  3WXM B;  4RKU E;  2A3L A;  3L2W A;  4J7F A;  1VQ5 T;  1WPY A;  2RO0 A;  1XTD A;  3CC7 Q;  4M7A A;  1ABQ A;  1UTI A;  4Z88 A;  4FYX B;  2JZ2 A;  2OTJ A;  2CZ0 B;  2QQA A;  3TVT A;  2IIM A;  2D0N A;  4N4I A;  1IXD A;  4J83 A;  3VS1 A;  5L23 A;  1X6O A;  3SEM A;  5CCA A;  2RJF A;  2DE0 X;  5GAM g;  1YCS B;  1UB4 A;  4XAX B;  3E9G A;  2HSE B;  2OX7 A;  3JCM g;  2FPD A;  4C8Q D;  1D0Y A;  3I9Q A;  3M4Y A;  2Z0W A;  3CCU A;  1JXM A;  1OOT A;  3N5B B;  3JCM h;  2ATC B;  1WHK A;  1FMV A;  3I5R A;  5IXB A;  4A54 A;  2DBM A;  5M9O A;  2FL7 A;  4XTU A;  2VKN A;  4C0G A;  2X9H A;  2ECZ A;  5CR2 A;  2MWP A;  3SHW A;  5GAM f;  1WA7 A;  3E2U A;  1K8A R;  4C92 E;  1H64 1;  2DVJ A;  5GAO p;  3OYM A;  1UGP B;  3A8L B;  3FDR A;  2QGF B;  3CBO A;  5D6Y A;  4E7H A;  3LWH A;  1W2B P;  2D9T A;  5IHI A;  1SEM A;  1X2Q A;  2O2O A;  2XU8 A;  3OB9 A;  1KC8 C;  3P8D A;  2J05 A;  4Y91 A;  1VIE A;  1RL2 A;  2YHT A;  5GAM e;  4A4G A;  2DXC A;  1AWJ A;  3E9F A;  4JS4 A;  1Y07 A;  5KYY B;  3GNF B;  3MPU B;  2M1H A;  2RHU A;  4NS5 A;  1QKX A;  4M7A E;  1RAH B;  1GFC A;  3MP8 A;  1TWB A;  2DYI A;  2L8D A;  2HL5 C;  1M3C A;  3RUX A;  3CC4 T;  4MDX A;  2LJ1 A;  4GY5 A;  4MMK A;  5GAM d;  1S1N A;  1LJO A;  5EG2 A;  4PLI A;  2CZ1 B;  3CCS T;  3DLM A;  2KY9 A;  2D0Q B;  2OTL Q;  2B86 A;  3UPU A;  5IXF A;  2NUP A;  1BU1 A;  1GCP A;  1NYG A;  2VV5 A;  1UGS B;  4AFZ C;  5FLX E;  3I55 Q;  1VQM T;  3CC7 A;  4DOV A;  3ZL7 C;  2J6F A;  4LE9 A;  4M77 G;  4JRP A;  4LD6 A;  3OSS C;  4XQ3 A;  3CC2 T;  1NLP C;  3P8B B;  2XKO C;  4J6X A;  4HXJ A;  2P0P A;  4OB0 B;  5J26 A;  2RB6 A;  3CMA A;  2ZAE A;  3QDF A;  5KCH A;  1VQ7 Q;  4BI3 A;  1RAE B;  1JJ2 P;  2E70 A;  1ZSG A;  4BE1 A;  5A0L A;  5CVI A;  1G83 A;  2CP2 A;  2JUF A;  2EWN A;  1JU5 C;  4GBQ A;  2KRM A;  2C0I A;  2OAW A;  4LDX A;  3JCM c;  3QO3 A;  1VQM A;  3G7Z A;  2DL3 A;  3GOX A;  4AG2 C;  1SHF A;  5CKB A;  1S72 A;  3ASK A;  4E7I A;  2MF2 A;  3M0T A;  5GJW B;  4E7L A;  5DM7 R;  3OYB A;  4M7D C;  4ME7 A;  3OS0 A;  3OYG A;  2CP7 A;  2MWO A;  1PKS A;  3TU4 K;  1S72 Q;  1Q82 U;  3MCA B;  3UWN A;  1VQ4 Q;  1SRM A;  4RCC A;  2K5L A;  4M78 E;  3CC2 A;  1YJW A;  2FG0 A;  3WVE B;  2E6Z A;  2EIF A;  2CGH A;  1I07 A;  4M78 G;  1FWZ A;  2P4T A;  1QVF S;  3GIB A;  2YUQ A;  5ECA A;  2F5T X;  3OQ5 A;  1FMK A;  1X75 C;  1YNZ A;  2E4H A;  2DJQ A;  4J9B A;  4FT2 A;  5KYU A;  4N0A C;  1JBM A;  4C8Q G;  1YJW T;  1OYX A;  4XTY A;  5FRN A;  3PE0 A;  3RKX A;  2JW4 A;  3MP1 A;  1ZSZ B;  4QQD A;  2RI2 A;  1GXI E;  1ZUK A;  2HQH A;  3O5Z A;  1O75 A;  4OB3 B;  4R0K A;  1YIT T;  3VRY A;  1MNE A;  2YUP A;  2DET A;  4OP0 A;  1D0Z A;  1OI1 A;  1PRM C;  1T3L A;  2KSS A;  3CC7 T;  1QCN A;  3THK A;  5LJ3 g;  4OF1 A;  3JCM b;  4BDZ A;  3Q1J A;  5FU7 B;  5D7U A;  1NJI C;  4QW2 A;  1AZG B;  2FRW A;  3BY7 A;  3X28 B;  2HBW A;  3REA B;  1Z9Z A;  4OMM A;  3CXC S;  1VQ6 T;  1U8R A;  3CCJ A;  1YJN T;  3CCJ Q;  2DPP B;  2O4X A;  2RK2 A;  1YN8 A;  4BI8 B;  1RAI B;  4BE0 A;  5EC7 A;  3GPL A;  3M55 A;  1E7O A;  2DZC A;  4ELZ C;  2W10 A;  1VYU A;  4XTX A;  2KR3 A;  3QII A;  1M2V A;  1RUW A;  2KAF A;  2JM8 A;  3QWY A;  1VQN T;  2HDA A;  1IRX A;  3EG0 A;  3OY9 A;  4J9H A;  1QCO A;  1HSQ A;  1UJY A;  3M0S A;  2ESW A;  4J8O A;  3KXT A;  3QZ5 B;  2FEI A;  1Y0M A;  2QQS A;  1MMG A;  2QEX Q;  4GLK A;  2LT4 A;  2ZGW A;  4M75 A;  2QA4 T;  1D09 B;  3KUF A;  4BUG A;  5GAO m;  2SRC A;  2GTJ A;  4ESR A;  1YCY A;  5A0G A;  1G3T A;  1NE8 A;  4L59 A;  2EVR A;  1MV3 A;  2AK5 A;  2RQT A;  1W1F A;  1VQ7 T;  1ABO A;  3NMZ C;  2DEU A;  4NL3 A;  2IPO B;  1W2B S;  1K73 R;  3RR6 A;  4RTZ A;  1M90 R;  2KK4 A;  3CCS A;  4RUG A;  3QWX X;  1ZSZ C;  1ZBX A;  2LT1 A;  2O9S A;  1VQK T;  1QVF P;  1WXB A;  2DTO A;  1R8O B;  5I21 A;  5KYX A;  3PGG A;  1ZSZ A;  2EYW A;  4F7U E;  2L3S A;  2M0O A;  2ZCF B;  2K5F A;  1JEG A;  1TUD A;  3VYG A;  5KYU B;  3NTK A;  2FZC B;  2RHZ A;  1T0H A;  4VUB A;  1V29 B;  1X6B A;  2XID A;  2M9U A;  4ZNX A;  2KGT A;  3RDV A;  2CH4 W;  2YXY A;  4C8Q B;  1WHH A;  2VVK A;  2VYT A;  2HD0 A;  1WQ7 A;  2R57 A;  4XU3 A;  3V8K A;  1T3S A;  2FO0 A;  2RD1 A;  5IHK A;  5LJ5 d;  4X1V A;  3FJP A;  2DM1 A;  1R77 A;  1UE9 A;  5GAM h;  2XIC A;  3M0R A;  5CO7 A;  1TSF A;  4O6J A;  1QVG A;  1QVG S;  1PSE A;  1EIF A;  4ZGJ B;  2RQV A;  2GBQ A;  3TSZ A;  1T0J A;  5LJ5 j;  1K8A C;  4F7U F;  4C92 D;  3EGD A;  3VS4 A;  2DRM A;  1RI0 A;  3OS2 A;  4C5E A;  1RAF B;  3PIP A;  2NLU A;  2LRQ A;  4DEX A;  2NUZ A;  4Q5W A;  1Q86 C;  2PTK A;  1ACM B;  2RA2 A;  4RTW A;  2DL8 A;  2DYB A;  1K73 C;  3EH1 A;  4F14 A;  1KFZ A;  2J6K A;  3A5Z B;  2RI3 A;  3JCM f;  1I0C A;  1WQW A;  3GF5 A;  1VQP T;  2DFU A;  5GAN 5;  3L2R A;  4PL6 A;  1K8A U;  2P0Q A;  2LQ8 A;  2VXF A;  3HRT A;  4DBF A;  1YWP A;  4RTT A;  2HZY A;  1IHW A;  3L2Q A;  4B9W A;  3M0U A;  1Y96 B;  3OBY A;  4EMK A;  1YIJ A;  2EQJ A;  4PJO A;  3TEE A;  5GAN 4;  5D6X A;  3C4S A;  3EHR A;  4F7U B;  4XU2 A;  2FZK B;  2KXD A;  4A4K A;  1AD5 A;  2G3R A;  4KGV B;  5CKE A;  1NLO C;  4C8Q F;  3WVD B;  2E5K A;  2LNV A;  3JAM E;  2RHX A;  3EFO B;  1VOM A;  4DQ2 A;  2ENM A;  2DXB A;  5LJ5 e;  3OMG A;  2DZ9 A;  1Y96 A;  2RJE A;  2MPX C;  1X43 A;  1YHQ T;  4J7I A;  4JJN K;  1RAG B;  4M7D A;  1PD0 A;  4FSX A;  1UGQ B;  2JTE A;  2K3Y A;  4PJO E;  1C6V X;  3MO8 A;  2X3W D;  2QA4 Q;  1MMD A;  2MYS A;  1OX8 A;  5IHN A;  2KRN A;  3PVQ A;  3FB9 A;  3CCV Q;  2DIQ A;  3A8H B;  3CCJ T;  1YJN A;  2LTO A;  1VYV A;  3RIR A;  1PCX A;  3AHU A;  1U1T A;  1PNJ A;  3EGX B;  2OTJ Q;  1KD1 U;  2EKH A;  4C8Q A;  1H8K A;  2HAX A;  2K9G A;  3OBW A;  1YBY A;  3QDR B;  3JCM W;  1YI2 A;  5LJ5 g;  2K79 A;  3OYE A;  2YWW A;  3S6W A;  2EW3 A;  3MEW A;  3BDU A;  3CCV A;  1UGR B;  1I4K 1;  2JNG A;  2PUO B;  1OZ3 A;  2VGM A;  4M78 A;  1OPK A;  4ZTJ A;  1M9S A;  2E1H A;  2QQB A;  1KJW A;  2RQR A;  1VQ5 A;  2DL4 A;  2RH2 A;  1Q81 R;  1VYT A;  4RTU A;  2F69 A;  3QG1 A;  3G1J A;  1P92 A;  3X24 B;  4XU0 A;  4ATO A;  3HL8 A;  1OU9 A;  2KYB A;  3CCL Q;  4J9G A;  1K4U S;  2V8J A;  3H0H A;  3A8M B;  4C92 A;  1V1C A;  4FM4 B;  1RAB B;  4M77 C;  4R55 A;  3CC4 A;  3HTR A;  3M58 A;  4KGX B;  3OW2 P;  3P8H A;  4FW2 A;  1RLQ C;  3LLR A;  2LX7 A;  1EFN A;  2ZZD A;  3CC4 Q;  3FRN A;  2RJD A;  4Z8A A;  1WYX A;  1ZUY A;  2HL3 A;  2OAU A;  1N9R A;  2CT3 A;  4PJJ A;  5KE3 A;  5GAN 2;  2YLC A;  4ZN3 A;  1KHC A;  4FYV B;  2XMF A;  1TH7 A;  1OEB A;  2OI3 A;  3F70 A;  3G6E T;  2X3X D;  1KQS P;  2RHI A;  3M59 A;  3CCU Q;  2HCK A;  1JXO A;  4ORZ A;  5CKF A;  2PVO B;  2O01 E;  4XU1 A;  2QEX A;  2A37 A;  2K3X A;  4M4Z A;  4J6Y A;  1UJ0 A;  3VV0 A;  3L2V A;  4ZGE B;  4LDU A;  1QMC A;  4HVV A;  1D3B A;  4QVD A;  1VQ9 A;  3OW2 A;  1C0M A;  2A0F B;  1VQM Q;  4M75 E;  3MET A;  4E7S A;  3D7S B;  4M78 B;  3M0P A;  2K57 A;  4B9X A;  3JV3 A;  1ZHI A;  4QVZ A;  3QPH A;  2EGC A;  1U3O A;  2O4X B;  1WJQ A;  4AT1 B;  4ELY C;  5LJ3 f;  2RN8 A;  1AVZ C;  1MMA A;  3JB9 H;  1MHN A;  1QWF A;  2I0N A;  1VQ7 A;  1FXX A;  2CP6 A;  2XDP A;  5GMK m;  5GAO n;  1S72 T;  2JOY A;  4PJL A;  1N8R R;  1AT1 B;  4A4H A;  1YIJ T;  5LJ5 f;  3ZFJ A;  2CZ7 B;  3BDL A;  3J80 E;  4XTW A;  2KBT A;  5D6W A;  1UGV A;  1SSH A;  4JJB A;  4FYY B;  1BIB A;  4C0D B;  2CP5 A;  5KYW B;  2ZPH B;  1U1S A;  2M51 A;  2V26 A;  2DTH A;  2KRO A;  4M78 F;  3CCU T;  2F2V A;  4PJO D;  2O31 A;  3H0I A;  2E10 A;  4DA4 A;  2IVW A;  3CCE Q;  3RBB B;  4OMN A;  3RMQ A;  4JRQ A;  3H0F A;  4WF2 A;  5GAN j;  2PVG B;  2DIG A;  4M77 B;  4HCZ A;  1GCQ A;  1K76 A;  4F17 A;  2PQW A;  3BW1 A;  2ZPG B;  9ATC B;  5HK3 A;  3MHX A;  2DTI A;  5FU7 C;  4IUR A;  3RMS A;  5IAY A;  3CCR Q;  2F2X A;  2ZPB B;  2E3I A;  3JCM X;  2YT6 A;  3NTH A;  1BI3 A;  1BCM A;  2EAY A;  1DJ7 B;  4Y28 E;  4M75 C;  3UF4 A;  1N8R C;  4C8Q E;  3LW5 E;  1PD1 A;  1G3S A;  1TG0 A;  3VYH B;  4M77 F;  2H3J A;  3CCV T;  1N9S A;  2CKK A;  1KQ2 A;  3G4S A;  2JTM A;  4HCB A;  2Y4Y A;  2CUD A;  4X34 A;  1VQ8 Q;  3REB B;  1UFF A;  1MUZ A;  2FVU A;  3RKW A;  2Y4X A;  2C06 A;  2E6N A;  2L3P A;  1HXD A;  1WIE A;  3OS1 A;  2HBP A;  5GAN 3;  1BYM A;  2JS2 A;  3H6Z A;  4QKU A;  4JZ3 A;  1SSF A;  4PK4 A;  4KT0 E;  1PSF A;  4OMF B;  3QYG B;  2CRE A;  1Y71 A;  1FYN A;  3NGP A;  3HP9 A;  4J9C A;  2X4X A;  3TQ7 P;  4LDV A;  1NZ9 A;  2LQW A;  1E6H A;  3HFO A;  4RMO A;  3V8L A;  2M0Y A;  1K9A A;  1GRI A;  3CXC P;  3I56 Q;  1WHL A;  2DK3 A;  3PMI A;  3RER A;  1AWW A;  4L6V 5;  1YFN A;  4M75 D;  4EMG A;  4ANJ A;  1M5Q 1;  5GMK l;  3JCM Q;  5GAN 6;  2BUD A;  4FIB A;  1KSW A;  1CSK A;  1UUE A;  4WTO B;  1OV3 A;  4X9C A;  3E1S A;  1TS9 A;  3EG2 A;  3NPF A;  1WNL A;  3MEA A;  3CCQ A;  1IB8 A;  2G6F X;  3EHQ A;  3M0Q A;  4C8Q C;  3CBM A;  1C1A A;  1MMN A;  1G3W A;  3X26 B;  4J9F A;  4A63 B;  3G6E A;  5FWC A;  1CKB A;  1X6G A;  1YI2 T;  4QQ6 A;  1Q86 R;  4EDU A;  1WHM A;  5FRO A;  2D8H A;  3LWI A;  2HSP A;  5LJ3 d;  4EIK A;  3MEU A;  1XOV A;  1XQH A;  1NEB A;  2CZ6 B;  1VQN Q;  4LNP A;  4PJO C;  3OYH A;  1Q81 U;  1KD1 C;  4BY6 B;  3CPW A;  3CD6 T;  1QQJ A;  5DLO A;  1QVP A;  4JS5 A;  1EX4 A;  1WXT A;  2BKD N;  3R6N A;  4PKC C;  1OQK A;  2QXF A;  2JN0 A;  1KK7 A;  4F04 B;  1QCF A;  1QP2 A;  4HT8 A;  1BCO A;  4A53 A;  2AT1 B;  4AFQ C;  2KRS A;  3JB9 F;  1LPL A;  3CPW S;  2EGA A;  5KYN A;  4JZ4 A;  2CSI A;  3CCE A;  2EKO A;  2RHY A;  4C5H A;  1GBR A;  1NEG A;  1HK9 A;  2QI2 A;  1K9M U;  3UDC A;  1G5V A;  1WJS A;  2DVE A;  2KT8 A;  7AT1 B;  2VWF A;  1HYO A;  2KI7 A;  4E7Z A;  2GQI A;  2XDD A;  2FYK A;  3OYN A;  2FHD A;  3CPF A;  3L2Z A;  1UDL A;  4LUE A;  2QTV A;  3SFM A;  4FU6 A;  1PM3 A;  4HCC A;  4KBM B;  3OYI A;  3SWN A;  4O5V A;  4KUI A;  4LDW A;  2EGE A;  2QDY B;  1JRI A;  2LZ6 B;  4DBR A;  1YJ9 T;  3CME T;  1QWE A;  1IHV A;  4N4G A;  1KQS A;  4RTX A;  2MAM A;  3UA7 A;  4DEY A;  2ZPF B;  4KRT A;  2LMJ A;  4OMP A;  5CAI A;  2JXB A;  1Q86 U;  1GL5 A;  1ZUU A;  4X9D A;  2HQE A;  4J9D A;  1D3B B;  2J06 A;  2GGR A;  3RES A;  4JLI A;  4FL6 A;  2CDT A;  1K9M R;  2ZPE B;  3QKJ A;  4QT7 A;  1VA7 A;  2DD4 A;  2K6D A;  2VXE A;  1VQO T;  1KIK A;  2JMA A;  1H92 A;  4XTV A;  1VQK A;  2ED0 A;  4D6W A;  3QHS A;  4DOW A;  1YIT Q;  5GAO r;  2R5A A;  3OS5 A;  2B8A A;  3JB9 I;  2DA9 A;  1W6X A;  4M77 D;  5GAO l;  1YIJ Q;  2COY A;  1D1A A;  4F16 A;  1RAC B;  4LD9 K;  1NPR A;  4IUV A;  4J9E A;  2XI9 A;  4V2S A;  2FRY A;  3OYD A;  2DO3 A;  1J3T A;  2LC4 A;  1B7T A;  1TXQ A;  2E65 A;  4HA8 A;  2HKN A;  3S3O A;  3G6E Q;  2KDS A;  2QTX A;  4E7J A;  2AHJ B;  1IRE B;  2C0O A;  3QZ9 B;  3DB4 A;  3EG3 A;  3PFS A;  1QW1 A;  3LGL A;  2JJ9 A;  1UEB A;  2LNH B;  2L3Q A;  1X27 A;  2FPE A;  1D1C A;  5C6S A;  1TU0 B;  3CCR T;  4M7D B;  1VQ8 T;  5HY6 A;  1OX9 A;  3M56 A;  2EJ9 A;  2RI5 A;  1K0X A;  5KYX B;  3ME9 A;  3QUI A;  4FCY A;  2CT4 A;  3OYC A;  2LJ3 A;  4XK8 E;  2PUK B;  4PJM A;  5GAN g;  3J7A F;  4AFS C;  2QG9 B;  2PVD B;  2KNB B;  8AT1 B;  4BY6 C;  3SB2 A;  2E3H A;  3DLL A;  2RF0 A;  4OB2 B;  3CMA Q;  3VJP A;  3CCL T;  3G71 Q;  3G71 A;  4MZT A;  1JJ2 S;  1E6G A;  3OSV A;  4M78 D;  1LCK A;  1Q82 R;  4PFO A;  4J6W A;  2LJ0 A;  5GAO q;  3VS7 A;  1X01 A;  3PT9 A;  4D8K A;  1VQL A;  1ZBJ A;  3CMA T;  3ULR B;  2RMO A;  2X4W A;  4EMK B;  3G71 T;  3GP8 A;  4M7A F;  5C0M A;  5FRM A;  2CUB A;  3QJ6 A;  4EPC A;  2MK5 A;  2NUT B;  1D1B A;  1YHQ Q;  4JLG A;  1N5Z A;  3NHN A;  1VQP A;  3M57 A;  2WAC A;  1X2K A;  2OTL T;  3MJX A;  2E64 A;  4JJD A;  2OTJ T;  5I22 A;  3ER0 A;  3TSW A;  3EG1 A;  1IGQ A;  2DMO A;  3A98 A;  1GFD A;  1M8M A;  4IUT A;  1I8F A;  4BD3 A;  4ZTF A;  1KC8 R;  4KUD K;  2BZX A;  5KYW A;  1PC0 A;  3EFO A;  3NFC A;  5KCO A;  1K73 U;  2MIO A;  3V7S A;  1ARK A;  1FX7 A;  5LJ5 h;  1PG5 B;  1PWT A;  2KE9 A;  2NYS A; 
#chains in the Genus database with same CATH homology
 1LPL A;  3RDV A;  2CP0 A;  2CP6 A;  1TXQ A;  1WHH A;  1WHJ A;  2HQH A;  2HKN A;  2CP3 A;  2Z0W A;  2HL5 C;  1WHG A;  2QK0 A;  4B6M A;  2M02 A;  1WHK A;  3TQ7 P;  1WHM A;  2COY A;  3E2U A;  1IXD A;  2E3H A;  2COZ A;  2HKQ B;  2E4H A;  2COW A;  2CP7 A;  2E3I A;  2CP5 A;  2MPX C;  1WHL A;  2HL3 A;  1TOV A;  2CP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...