3REAB

Hiv-1 nef protein in complex with engineered hck-sh3 domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
EDIIVVALYDYVSWSPDDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular design, functional characterization and structural basis of a protein inhibitor against the HIV-1 pathogenicity factor Nef.
pubmed doi rcsb
source organism Hiv-1 m:b_arv2/sf2
molecule tags Protein binding
molecule keywords Protein Nef
total genus 11
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3reaB00
1JQQA 3THKA 1K76A 2DM1A 4J9BA 2PTKA 2ENMA 2KYBA 1OV3A 2DNUA 1NG2A 4OMNA 2K7AA 2J6FA 2L0AA 1ZBJA 3QWYA 3PVQA 2LJ1A 3M0PA 1RI9A 2DL5A 4CC4B 3TSWA 3SHWA 2GBQA 2EYWA 1JO8A 4IIMA 2LJ3A 2GQIA 2J06A 1H92A 1S1NA 3EG1A 4LUDA 4RTYA 2MOXA 2DA9A 1BU1A 2ED1A 2HSPA 2JMAA 2EPDA 2HEQA 5GJWB 1NYFA 1AD5A 1PNJA 3VS7A 2DF6A 2ED0A 2HDAA 4GLMA 1AEYA 1UHCA 1PKSA 1WYXA 2DL3A 5ECAA 1OEBA 1WFWA 2VVKA 1E7OA 4HVUA 2PNIA 2RF0A 3REBB 2DX1A 1X43A 2DMOA 5IXBA 4D8KA 2D0NA 4K11A 4RTZA 2W10A 1GL5A 2BZ8A 1FYNA 1I07A 2AK5A 1FMKA 1HD3A 2EBPA 1SRLA 2EYXA 1IO6A 1NLPC 2J05A 2FEIA 1U06A 1AVZC 2A36A 2A08A 2EYZA 2YUQA 2D1XA 3EG3A 1QWEA 2BZYA 3VS6A 1NLOC 2RNAA 1ZUUA 2O2OA 4OMQA 2JT4A 1K9AA 2OAWA 1ABQA 1NEGA 1SSHA 5IXFA 1E6GA 2FG0A 3UA6A 1GFCA 4FSSA 2KYMA 4LE9A 3R6NA 1JXMA 3RNJA 2ROLA 1KJWA 1T0HA 1AWOA 3TVTA 1SHFA 1YCSB 1YNZA 3FJ5A 3UATA 1NEBA 2A37A 3NMZC 3I9QA 4GBQA 3I5SA 2KXDA 2KROA 3NGPA 4OMOA 1QKXA 2O88A 1CKAA 1UJYA 1AOJA 2ECZA 2KGTA 4J9GA 1Z9QA 1WX6A 2KRMA 1VYTA 2QDLA 3KFVA 2MIOA 2JTEA 1UJ0A 1BK2A 2OJ2A 5IHNA 2JS2A 2LX7A 2V1QA 5FW9A 2KE9A 3I5RA 2L2PA 4OMMA 3EGUA 1Y0MA 1YP5A 1OPKA 1GRIA 1JU5C 3NHNA 1EFNA 4DEYA 2FO0A 3O5ZA 1B07A 1AWJA 2G6FX 1V1CA 2KT8A 2CSQA 2DJQA 5IH2A 4Z89A 1T3SA 2AKKA 1J3TA 2K3BA 1UECA 1UE9A 2LQWA 2DVJA 1I0CA 1GBRA 1GFDA 2OI3A 4IIOA 1ZLMA 2GNCA 4Z88A 1ZUYA 2IIMA 2ROTA 2RQVA 4DEXA 1YN8A 2GTOA 2HCKA 2RN8A 3ULRB 1WXUA 2KRNA 3GBQA 2B86A 2DBKA 3VRZA 1QCFA 5HCKA 4RTVA 2C0OA 2XMFA 3EHRA 1X6GA 1KIKA 2CT3A 2KXCA 2LJ0A 1MV0B 1W6XA 3VS3A 4J9HA 4CC7A 2EKHA 3H41A 1GCQA 4QT7A 4RTTA 4AG2C 2H8HA 3EHQA 1RLPC 2EYYA 4Y92A 2X3XD 4HVVA 4J9DA 2KT1A 3UA7A 1SHGA 4JPBW 3VS4A 3U23A 2YUPA 1UFFA 2KRSA 2J6OA 2CH4A 4M4ZA 4J9FA 2KNBB 1VYUA 2GTJA 2YSQA 1UGVA 1VYVA 4LNPA 1TUCA 2X3WD 3M0QA 2CUBA 2EW3A 1ZUKA 1JXOA 3M0SA 1OOTA 2D8HA 1SPKA 2RQRA 2M0YA 5GJVB 2O9VA 4LN2A 4X1VA 2YUOA 2NUZA 2K79A 2J6KA 2FPDA 2KEAA 1QLYA 1K0XA 2W0ZA 4JZ4A 2I0NA 2L3PA 1H8KA 3IQLA 2FRWA 1HJDA 1X2QA 1KSWA 1Z9ZA 3SEMA 5FWBA 1K1ZA 4A63B 1GBQA 2FPEA 1X6BA 5IHIA 2YDLA 5I11A 1X69A 5FWCA 2GGRA 1PRLC 3EG2A 1TG0A 2AZSA 1QWFA 1M30A 3RBBB 1UG1A 1PKTA 1LCKA 1KFZA 1SRMA 1X27A 3ZL7C 1BBZA 1NYGA 4JJCA 1T3LA 4WCIA 4EIKA 4D8DA 4ORZA 2EGEA 2SEMA 2AZVA 4HXJA 3VS2A 2LMJA 2DL7A 4E6RA 2L3QA 2RQTA 3PVLA 1M3CA 1Y57A 2RQUA 4ZNXA 2DE0X 2K2MA 2DILA 1AZGB 2FPFA 2L3SA 1YWOA 2O9SA 2CH4W 2ESWA 1UDLA 4J9EA 1H3HA 4R0KA 2NWMA 2CT4A 1UTIA 1ARKA 1ZSGA 2F2VA 2LNHB 1U5SA 3H0HA 1K0SA 1QKWA 1PHTA 1XOVA 4F14A 2YT6A 5I22A 1W1FA 2E5KA 1PWTA 4OMPA 1GCQC 2M51A 4ESRA 2JW4A 2DLPA 2RQWA 3VS1A 1SEMA 5EC7A 4AFQC 4RTWA 1YWPA 4CC3A 1G2BA 1CKBA 2P4RA 1E6HA 1UHFA 1X2KA 2A28A 3LH5A 2RPNA 2C0TA 1M8MA 1AWXA 2F2XA 3M0UA 1M3AA 1AWWA 1NM7A 1ZX6A 1G83A 2BTTA 2CUDA 5L23A 1WA7A 1B3QA 2JM9A 4AFZC 3VS5A 2DRMA 3VRYA 2EGAA 2RMOA 2DBMA 1N5ZA 1WI7A 3NPFA 1WLPB 3QWXX 2CDTA 2K9GA 2FRYA 5IHKA 1PRMC 2LZ6B 2LCSA 3TSZA 2JXBA 2EGCA 2DL8A 1OPLA 1CSKA 4JZ3A 2KR3A 1MV3A 2DRKA 2K6DA 2YUNA 4AG1C 3JV3A 1GCPA 4RTUA 4RUGA 3PE0A 2PZ1A 3REAB 1U3OA 2LP5A 2MCNA 3EG0A 1WXTA 3CQTA 4F16A 4HCKA 4Z8AA 4AFUC 2KBTA 1WDXA 2EQIA 4J9IA 1WIEA 4J9CA 2SRCA 2CREA 3H0IA 4F17A 1MUZA 4HVWA 2C0IA 3UF4A 4JJBA 2VWFA 2JM8A 1AZEA 1HSQA 1VA7A 2AKLA 3I35A 3VS0A 3A98A 4AFSC 4JJDA 2BZXA 1RUWA 2JMCA 2V1RA 2JS0A 1WXBA 2VKNA 2LQNA 1K4US 1W70A 1T0JA 1JEGA 4KRTA 2ABLA 3M0TA 2EVRA 3M0RA 1ABOA 2CSIA 2DL4A 1I1JA 4RTXA 2HBWA 1A0NB 2DYBA 4LUEA 3H0FA 1TUDA 2D8JA 4OMLA 1BB9A 4CC2A 1M27C 1RLQC 1UUEA 1M3BA 2F2WA 2J7IA 3C0CA 2O31A
chains in the Genus database with same CATH superfamily
4QQDA 4R55A 3FEOA 2K7AA 4J5YA 3CCSQ 4M75A 2LJ1A 2CP6A 3M0PA 1NE8A 2F1LA 3CMAA 2LJ3A 3JCMV 3MEUA 1H92A 1S1NA 3CXCP 2JN0A 2PUKB 4RTYA 4C92F 4HCZA 4JRIA 1BU1A 2JMAA 3CC7T 3CC4A 5GJWB 1RAEB 3JCMW 4D6WA 2DKGA 1UHCA 1PKSA 1ZA1B 5GANe 2LRQA 5ECAA 2DIGA 2QQ9A 2RF0A 2QTXA 1YHQA 2QI2A 2D0QB 4XK8E 4RMOA 1M1FA 2RHZA 4N0AC 1K73C 4NL2A 1GL5A 2AK5A 4A53A 1M1KR 5CKEA 2J05A 4EMHA 1U06A 1Q81R 2EYZA 3H9NA 2YUQA 2O01E 4HCCA 3EG3A 2ZAEA 2BZYA 1TOVA 1G3SA 1V29B 1D1CA 4GLKA 1ZUUA 2O2OA 4OMQA 2YLBA 1ABQA 3DKMA 3NTIA 2HSEB 1E6GA 1UGPB 1LJOA 9ATCB 1GFCA 3CPFA 1JXMA 3CMAT 4M78F 4E7LA 4PNOA 1AWOA 3OSSC 1SHFA 3TVTA 1X01A 2X4XA 3FJ5A 1N8RU 3UATA 3OBYA 2KVQG 1YI2A 4PK4A 4NOYA 1JB0E 3CCUT 1VQLT 3JCMc 5KYNA 3UT1A 4C0DB 2O88A 1CKAA 3RERA 2ECZA 1ZHIA 3E19A 1VQ8T 1WGSA 2MIOA 1ZA2B 2OJ2A 2DTIA 1YIJA 1UB4A 2XD0A 4RG8A 1IZ6A 4Y28E 2V1QA 1XNIA 4OMMA 1GRIA 3FRNA 3NHNA 3VYGA 2E12A 1VQNQ 2V26A 2FO0A 5CR2A 3O5ZA 1QW1A 2MMPA 3UWNA 3RR6A 3CPWP 1B07A 1AWJA 2FHDA 2XDBA 4OVAA 2CP0A 3LW5E 5GMKl 2AKKA 5KYYB 3V8JA 2LQWA 2DZCA 1KQ2A 4ZN1A 5A2QE 4M77B 1GFDA 4F7UE 1TUGB 1ZLMA 4Z88A 5GMKj 1ZUYA 2RQVA 1YN8A 3C12A 3JCMP 2KRNA 2X9HA 5A0GA 4PJLA 2L3RA 2NLUA 1JJ2P 4BDYA 2LJ0A 1MV0B 2ZPFB 3OS2A 5GANd 4LD6A 1WZOA 3BW1A 2DERA 4QT7A 4RTTA 1B34B 2H8HA 1YBYA 3QHSA 4WF2A 4ELYC 2X3XD 4DBFA 3SWNB 2KT1A 3MJXA 1SHGA 3VS4A 3U23A 3CCVT 2XU8A 1UFFA 1K9MR 3PNWC 2RK2A 2Y4XA 3LYIA 1VYUA 4M7DA 3SDZA 3CCMT 2JJ9A 2X3WD 2IG0A 3M0QA 3CC7A 2CUBA 5FU7B 2O4XA 1JXOA 3OB9A 3RIRA 4BI4A 2LDMA 2BE9B 3CCJA 2M0YA 3QDFA 7AT1B 4LN2A 3HRTA 3E1SA 2GF7A 4DBRA 1OI1A 4YTLA 2FPDA 2RJFA 2IPOB 1PSFA 3OQ5A 2BUDA 4EMGA 2Y90A 1VQ5A 1H8KA 1TSFA 3OYLA 2P84A 4M78G 4ATOA 2FRWA 1X2QA 1KSWA 1K1ZA 2DETA 3UDCA 3KXTA 4BDZA 5FWCA 3EH2A 3C4SA 3QXEB 3CCVA 3JSCA 1PRLC 3EG2A 4M7AE 1M90C 1QWFA 2EFIA 1PKTA 2NUPB 2QEXA 1KFZA 1SRMA 1NYGA 5GMKh 2NUPA 3URGA 4DOWA 5KYYA 4ORZA 4FM4B 2LMJA 2DL7A 1QVGS 2L3QA 1XTDA 2RQTA 4PJOF 1VQOA 1NZ9A 1Y57A 1M1KU 1ACMB 2K2MA 3Q1JA 3MP8A 1YWOA 3BFMA 4IUUA 4F7UG 3JCMf 3OYIA 1ARKA 1ZSGA 2LNHB 2QQSA 2DZ9A 4L5GA 1QKWA 4J8OA 5KCOA 3D7SB 2EQKA 2YT6A 5LL6S 5I22A 1VQ6Q 1B34A 2E5KA 4E7JA 2WSCE 5J39A 2RQWA 4PJOC 3LH0A 5GMKe 3EG9B 1SEMA 1N8RR 4AFQC 3HP9A 3BY7A 5I2SA 2JTFA 1X2KA 3LH5A 4C8QF 2RPNA 3META 4XTYA 1AWXA 2F2XA 3M0UA 5LJ5e 3JB9F 3QG1A 1M3AA 1AWWA 2ZPHB 1W2BA 2CKKA 2BTTA 1G83A 2CUDA 8ATCB 2JM9A 3L2VA 3VRYA 5GAMd 3RKYA 5D7UA 1N5ZA 1WLPB 3MP6A 2JTMA 1EIFA 1OPLA 1CSKA 4N4HA 1G8XA 1MV3A 2DRKA 3G71T 2CP2A 4C92G 4ZGDB 4RUGA 2LX9A 4OF1A 8AT1B 4F7UB 2QA4Q 1WJSA 4LDVA 1PG5B 4Z8AA 2KBTA 3CC4Q 3CCLQ 4KH1B 2EQIA 3JCMe 4J9IA 1TU0B 1SG5A 4J9CA 2CREA 2EQJA 3H0IA 1D0ZA 5LJ5h 3EFOB 3OYGA 2EJFA 1S72T 1MMGA 2I2LA 2QEXQ 2QEXT 1HSQA 3P8BB 2KDSA 4DA4A 4JJDA 3I56T 4EMKA 1K4US 3R6OA 1TWBA 4KRTA 2E65A 3M0TA 5GAOq 2DYBA 4QKUA 3M54A 1TUDA 2D8JA 5GAMg 1RI0A 3CC2A 1M27C 1RLQC 3S3NA 3HSBA 5I2MA 1PC0A 4BACA 1H641 3EGXA 2HAXA 4D8DA 4X9DA 2HQEA 1VQOT 2FZGB 3JCMh 3QO3A 3PFSA 4FYYB 2PTKA 4FU6A 4LDXA 2COWA 1OV3A 3OS1A 1VQNA 2J6FA 1ZBJA 3PIPA 3OYNA 2DL5A 3MEWA 3TSWA 2WSEE 3VUZA 4IIMA 4DBHA 5LJ3d 3RMQA 3CCMA 3GNFB 4C8QC 2E64A 2FVUA 4C0ZA 5HK0A 2MOXA 1M2VA 3M4GA 4IKFA 1U1SA 2DYIA 2EJ9A 1NYFA 2DD5A 1AD5A 1PNJA 3CCJQ 4MZMA 2HDAA 2OTJA 1KD1U 1VQMT 4XTWA 1WYXA 2ZPGB 5KH6A 4XTVA 3CBOA 1TS9A 3M5AA 4LDWA 5IT9E 3L2WA 2DMOA 5IXBA 1D0XA 2D6FA 2RO0A 2FL7A 2W10A 3JCMQ 1FYNA 5EG2A 2EYXA 1NLPC 1C0MA 4OGCA 3ZEHA 1YJNT 4C92E 1AVZC 3VKIA 4C92C 2E3IA 4LXCA 3MEAA 3VS6A 1NLOC 2LCLA 5GAN4 3L2RA 3FIFA 2QA4A 1NPPA 1SSHA 2FG0A 3QDRB 5CKDA 1VIFA 4LE9A 5LJ5g 2G3RA 1K8AU 2ROLA 1YITT 4M7AF 1I81A 1YNZA 2VXFA 4C92D 1NEBA 2A37A 3NMZC 3I9QA 4B6MA 4GBQA 1WQWA 3VUBA 4PJOG 5CKBA 1IGQA 4OMOA 1UJYA 2QA4T 4PJJA 4J9GA 3MEVA 1M9SA 1VYTA 4FIBA 2QDLA 1D09B 4AT1B 3CCRT 3I55A 1VQ4Q 2ATCB 4C0GA 2RHUA 1Y0MA 1OPKA 4FT2A 3CCVQ 4M77G 1K8AC 1BCMA 5LJ3j 2FZCB 2RA2A 1V1CA 3DB3A 3L42A 5GAN7 3I55Q 2KT8A 3FB9A 2A0FB 4N4IA 3C94A 2HL3A 3OYYA 1G3YA 3SD4A 4C92A 2RHXA 1I0CA 1IGUA 5GANg 1HYOA 5CCAA 2E4HA 4C8QB 3JAME 4IIOA 2MAMA 2GNCA 2IIMA 2ROTA 3NTHA 4DEXA 3OYDA 1Q86C 2GTOA 3SWNC 2RN8A 4KGZB 3ULRB 1WXUA 3P8HA 2DBKA 3C95A 1QCFA 3CMEA 1RL2A 3LX7A 3PMIA 3QUIA 1MNEA 4PJOD 2VV5A 1KC8C 4CI0C 1TH7A 4X34A 5KYWA 2QQRA 2CT3A 1MNDA 2KXCA 3SFMA 1Q82R 1W6XA 3VS3A 4J9HA 3H41A 1RLPC 2EYYA 4Y92A 4HVVA 1KQSP 1UGSB 4J9DA 1VQOQ 3UA7A 1VQMA 2AT1B 2KRSA 2J6OA 4M4ZA 4C92B 4J9FA 1OQKA 4KULA 4M7AB 4LNPA 3HTRA 3CCRA 2F69A 4QVDA 2EW3A 3M0SA 3OW2S 3M53A 2D8HA 1SPKA 4MDXA 4A4EA 1Y71A 1I5LA 2YRDA 3L1AA 3TCJA 5KYWB 3MKDA 5GAN2 2RHIA 2YUOA 1U8RA 1VQNT 3CC2Q 1YJWT 2K79A 2J6KA 5IN1A 2MYSA 4RCCA 5GAN8 1WHKA 3M9QA 1OU8A 2R57A 5KCHA 1QVGP 1F1BB 4JZ4A 2MWOA 4IUTA 2MWPA 2I0NA 2XHCA 2L3PA 1Y96A 2EQUA 1N27A 1G3WA 4PJOB 1Z9ZA 2QGFB 3SEMA 5FWBA 1YJ9T 4A63B 3SB2A 2R5AA 1WHJA 4FW1A 5IHIA 1VQKT 1TG0A 1YITQ 1UG1A 3G7ZA 3G4ST 1KD1R 1LCKA 5DLOA 3ASKA 4JJCA 5DLQE 1T3LA 3J81E 1JBMA 2H3EB 2EGEA 2SEMA 3CCEQ 2AZVA 4HXJA 1QP2A 1X6OA 1YITA 3EH1A 4JJNK 5L8RE 1YHQQ 2DK3A 2DE0X 1QMCA 1IHWA 4QW2A 1S72Q 2DO3A 3F70A 4OB1B 2DPPB 2O9SA 2VGNA 1VQPQ 4ZGJB 5LJ3f 2K2VA 4R0KA 1JJ2S 2CT4A 4FYVB 2RJCA 2VGMA 3N5BB 5KYUB 1U5SA 3JCMd 1IB8A 1PHTA 4F14A 1W1FA 3OY9A 1PWTA 1VQPA 1XJWB 4ESRA 3E9FA 4XU0A 5HY6A 1W2BS 1VQ9A 2C06A 1K73R 3QBYA 4J7FA 4JRPA 4F7UA 3OYHA 5AYFA 1CKBA 2RJEA 2DTHA 4PFPA 5GMKm 3L2QA 5CK9A 1WHMA 2LT1A 2C0TA 1M8MA 3E2UA 2RB6A 2COZA 3LWHA 3CD6Q 2JUFA 1KQSA 3E9GA 4AFZC 3VS5A 2EGAA 2RMOA 3X24B 1WI7A 3PTAA 2CDTA 2K9GA 1KD1C 2FRYA 4M75C 5GAOm 3G6ET 2EGCA 4XAXB 4ZTJA 3CMAQ 4JZ3A 2RI3A 4M7AD 3TEEA 4AG1C 2HNIA 3JV3A 1GCPA 4RTUA 1Q7YR 3OSVA 4A4KA 1U3OA 3FLGA 2MCNA 4C8QE 4F16A 1PCXA 4BY6B 4M77F 3GOXA 2LNVA 3OW2A 1VQ6T 2DFUA 1WDXA 2E6ZA 2CZ7B 2SRCA 3V8LA 2F5TX 1M1GA 1VQ6A 3JB9H 2QASA 2E3HA 2PU9B 3J80E 2JM8A 2CGHA 4M78A 3VS0A 1C6VX 2BZXA 1PD1A 1RUWA 1QCNA 1BI1A 2V1RA 1VUBA 1SKUB 1WXBA 4ANJA 2HBPA 4C8QD 4IURA 3BE3A 1T0JA 1RAIB 2ABLA 1K9MC 3M0RA 1KQSS 1ZSZC 3EG9A 1Q95G 4OMLA 2K3XA 1BB9A 2EQMA 1S72A 2BE7D 4ME7A 4OMFB 2F2WA 3QIIA 2J7IA 5CQXA 3C0CA 2NYSA 2VC8A 2RI2A 2CYZB 1JQQA 2XG8D 3THKA 2DM1A 5KYXB 4J9BA 1Q82C 2ENMA 2PVOB 2NUTB 2L0AA 3PVQA 1RADB 2E6NA 1RAHB 2L89A 4CC4B 3OBWA 3SHWA 3CCET 2GBQA 4B9XA 4PJOA 4M78D 1ZSZB 2GCXA 3CCRQ 4ZN3A 5C0MA 2GQIA 4MZTA 3M55A 1N6AA 2EAYA 1QVGA 2BKDN 1RAGB 5LJ3e 2DXUA 4BI8B 4V2SA 4F04B 1BI0A 2ED1A 1R8OB 1W2BP 1M4ZA 2HSPA 2EPDA 2WACA 3GP8A 2HEQA 1I5OB 4IUQA 2DF6A 4GLMA 4PFZA 5J3BA 3CCMQ 4J6WA 3V7CA 5GAOp 2DL3A 2JOYA 2QAZA 3OYBA 3EAEA 1WNLA 2VVKA 1QQJA 4HVUA 2PNIA 2CZ0B 3REBB 4M78C 2DX1A 1X43A 3HRUA 1M1KC 3X26B 4K11A 3VU3C 4RTZA 2BZ8A 3V7SA 1I07A 4FSXA 5GAMj 4NL3A 5KYXA 1SRLA 4M7DD 2V8JA 2QQBA 2JNGA 2FEIA 2P0KA 2ZZDA 2A36A 2L8DA 1QWEA 3X25B 3G4SA 1M2OA 4II1A 3TREA 4E7HA 3CPWS 1R0BG 4M75G 1K9AA 2OAWA 1WPYA 4PKCC 3RESA 1VQ5T 4OB2B 5LJ3h 2KAFA 1VQ8Q 3UA6A 2KK4A 1VIEA 4FSSA 1R0CB 2KYMA 1UGQB 1G5VA 3CCEA 2FZKB 3RNJA 1YIJQ 1KJWA 1T0HA 2V8IA 1PD0A 1YCSB 4M7DE 3RMSA 3VYHB 2MI6A 3RKWA 3CCJT 1X75C 3WVDB 3I5SA 2M02A 2KROA 1TXQA 2OTJT 1VQMQ 2WSFE 5GAN6 1ZQ1A 3L2ZA 5GAN3 1AOJA 3OYKA 2KRMA 1WX6A 4PJOE 3WVEB 3H8ZA 2LVMA 3KFVA 2DTOA 2JTEA 3BDLA 1BK2A 1DJ7B 2H3JA 4C0FA 5IHNA 3QYHB 4MZPA 3CCQQ 1M8VA 1IRXA 2LX7A 1KG1A 2XI9A 4OB3B 2KE9A 3I5RA 2VASA 5DY9A 2L2PA 1OULA 4EPCA 5HK3A 4JRKA 1EFNA 4E7ZA 4DEYA 4C5GA 4ZGEB 3HL8A 2KY9A 3JCMJ 4RCBA 2G6FX 3LGFA 2HL5C 2CSQA 2DJQA 3HKSA 5IH2A 1T3SA 1Q81C 4J7IA 3PGGA 5CAIA 4XTZA 1GBRA 2Y4YA 2DXCA 5LJ5j 3G1JA 2XDDA 4ELZC 3PT9A 2QG9B 3GF5A 1FMWA 5HCKA 5A0LA 2XDPA 3H6ZA 2C0OA 3M56A 4E2FB 2VB6A 4A4HA 3EHRA 3HPWA 2BIVA 1KIKA 4JS4A 2X4JA 3OMCA 2OTLA 1EZZB 4CC7A 1YHQT 5KYUA 1GCQA 1H3ZA 3EHQA 4LDUA 4AMCA 4Q5WA 1VOMA 1EX4A 1HK9A 6AT1B 3LLRA 4E47A 1BKBA 1QP3A 2YUPA 5J26A 2CP5A 1Q7YU 2KNBB 2GTJA 1UGVA 1VQ8A 4N4GA 2DAQA 4CRIA 1N9SA 2DVEA 2A7YA 2AHJB 5GANj 1VQ9T 3KUFA 2RQRA 4DOVA 2O9VA 4X1VA 3EFOA 2K5IA 1BCOA 3CPWA 3JCMb 2EKOA 1NJIU 3I55T 2KEAA 1QLYA 2DIQA 4QVZA 1Q7YC 1K0XA 2W0ZA 3L2UA 4HT8A 1ZBXA 3CBPA 2E70A 3OS0A 2FYKA 4JRQA 3IQLA 4XU3A 4L59A 3MO8A 3HHTB 4A4GA 1GBQA 2FPEA 1X6BA 1X69A 4HT9A 3G6EQ 2E1HA 2RH2A 1Y96B 1FXXA 3RBBB 3LGLA 3FC3A 1X27A 3ZL7C 4KT0E 3CCUQ 1BBZA 1Y7XA 4KH0B 4E7IA 1VQLQ 4KBMB 4XU2A 2P0QA 3VS2A 4E6RA 3PVLA 1YJ9A 1ZSZA 3CCQT 1HXDA 4ZNXA 4M75E 2ZPBB 1G3TA 1AZGB 2GQVA 3SWNA 2CH4W 5IAYA 3CC2T 3OS5A 2NWMA 1QCOA 2F2VA 2X51A 1KC8R 2VXEA 3RDVA 1V76A 2XIDA 4X9CA 5LJ3g 2K5LA 2KQWA 4BE1A 3LWIA 3HRSA 3A8OB 4OMPA 4M75F 4VUBA 1K8AR 3EGDA 2M51A 4RKUE 4RG2A 2JW4A 2QK0A 2DLPA 3S3MA 1R77A 2E5QA 4RTWA 4E7SA 4CC3A 1G2BA 2QYZA 2YXYA 2QQAA 5FRMA 1N8RC 3MHXA 4M7DF 4JLGA 1NPRA 1SSFA 2A28A 5CKHA 1C1AA 2GFUA 1ZX6A 5GANf 2D9TA 1WA7A 4R56A 1B3QA 1UEBA 4OP0A 1Q86R 2DRMA 3OMGA 2DBMA 4PL6A 4C5HA 1M90R 3T9NA 1VQ7Q 1OU9A 3J7AF 4KUDK 5I21A 4QQGA 3RUXA 5IHKA 1MHNA 1PRMC 2LCSA 3TSZA 2JXBA 4JDSA 1JJ2A 2M0OA 4N0AA 1VQPT 2KR3A 4ZTFA 1LOJA 3I56Q 3PE0A 5GAOn 3REAB 2K4YA 2LP5A 1K73U 4MMKA 3GLXA 1WXTA 3HFNA 4Z02A 2DXBA 4AFUC 1IHVA 1NBEB 2RD1A 2XKOC 3TU4K 2E41A 2LQ8A 1KHIA 1VQ4T 1NJIC 1U1TA 4F17A 4L6V5 3QJYA 2CP3A 4OGEA 3UF4A 4JJBA 2VWFA 1AZEA 3I35A 5HKCA 2AKLA 2E10A 4HKEA 1OZ3A 4AFSC 3P8DA 2JMCA 4A54A 2VKNA 2LQNA 5CIUA 5D6YA 2CS7A 3CMEQ 2EVRA 1ABOA 2HZYA 3JCMg 3DLMA 2CSIA 2DL4A 1I1JA 4RTXA 1A0NB 4LUEA 1BI2A 3PMTA 3CD6A 4CC2A 1UUEA 1M3BA 4PJMA 5FU6B 4M75B 3CCQA 4KGVB 3G71A 4PLLA 1K76A 4WTOB 1RAFB 2HQHA 2LCCA 1AT1B 2KYBA 2DNUA 1Q81U 1NG2A 4OMNA 3QZ9B 2CZ1B 1TTHB 2OTJQ 3QWYA 1VQ5Q 2YRCA 1RI9A 1WHGA 1BIAA 2NUTA 3M59A 5DM7R 2EYWA 1JO8A 4JS5A 3V7RA 2X4YA 2J06A 3EG1A 5KE3A 4LUDA 1YIJT 4BE0A 2ZCFB 3ZFJA 1IREB 2DA9A 2ZGWA 1VQ4A 3FJPA 1WHHA 4FYXB 3QPHA 5LJ5f 3ME9A 1YJWQ 3VS7A 2ED0A 4BUGA 1OX8A 1K9MU 1BIBA 5AT1B 1YJNA 1AEYA 1RACB 3EFSA 1OEBA 1WFWA 4J83A 1M2VB 1E7OA 3CBMA 1QVFP 2QGGA 3GPLA 4D8KA 2D0NA 3WXMB 4A4FA 4O5VA 4MDWA 1FMKA 1HD3A 2EBPA 5GAMh 4EMKC 3V8KA 2KMTA 1IO6A 3QYGB 5FU6C 1YJNQ 3CXCS 3KBGA 3RKXA 2A08A 2D1XA 2HMAA 1OX9A 3CCST 4M7DC 2RNAA 2JT4A 1YCYA 1NEGA 4LDYA 1FX7A 2RJDA 5IXFA 1XQHA 3CEYA 2O4XB 1QVFS 1JRIA 2M1HA 4EMKB 4BD3A 3R6NA 3X20B 1I4K1 2YLCA 3ZBDA 1QVPA 1Y07A 2OTLQ 2YRVA 2OTLT 1VQKQ 1MMNA 2EIFA 2MK5A 2KXDA 4C8QG 3NGPA 1LPLA 2K3YA 4M77A 5D6WA 1QKXA 3CC4T 2KGTA 3A8GB 4NS5A 1Z9QA 2QTVA 1VQ7T 2EWNA 4FYWB 2OX7A 5KE2A 1FWZA 1UJ0A 4M78E 4P5NA 2JS2A 2PQWA 4JLIA 1VQ9Q 5FW9A 3G71Q 1Q82U 3EGUA 1YP5A 4M7AG 1D0YA 3PIOA 1JU5C 3CC7Q 4M7AC 5GAN5 4BB7A 4PFOA 4DQ2A 1QVFA 4GY5A 1PM3A 3CCLT 2MF2A 1M90U 4IUPA 1D1BA 1MGQA 4KGXB 3CMET 4Z89A 1WJQA 4C0DC 1PSEA 4XTUA 2K3BA 1J3TA 2JZ2A 3A8MB 2RK1A 1UECA 4Y91A 1UE9A 2PVDB 2VYTA 2R58A 3GIBA 2DVJA 3QKJA 3FDRA 2OI3A 1BI3A 4QVCA 3AHUA 3X28B 3JB9G 4C5IA 2HD0A 2HCKA 5CQYA 5C6SA 4BI3A 1D3BA 3GBQA 2B86A 3VRZA 4FW2A 3OYEA 1P92A 5FRNA 1I8FA 4RTVA 1RAAB 3OYAA 2XMFA 1X6GA 1N9RA 2HQXA 3CCUA 1VQLA 4XU1A 3OYJA 3CCLA 4E7KA 2LT4A 1WQ7A 1B7TA 2EKHA 4AG2C 3A5ZB 3GNGA 4PJNA 2ZPEB 4JPBW 2YWWA 4M77C 3QZ5B 4BE2A 2CH4A 3MPUB 2YSQA 1VYVA 3UPUA 3AT1B 1TUCA 3HFOA 5A0DA 2QDYB 3OYMA 1ZUKA 3BDUA 5CKFA 1OOTA 1BYMA 3TQ7P 4HCBA 4M7AA 1O9SA 3VJPA 3DB4A 1YJWA 5GJVB 4M7DG 2P4TA 3QSUA 5FROA 2NUZA 1UGRB 4FL6A 5FLXE 4M77E 2MPXC 1WJRA 2K57A 3CXCA 3JB9J 2JVVA 1YFNA 2LQKA 4OB0B 2HKQB 2VUBA 4QQ6A 1HJDA 1YJ9Q 2M9UA 2Z0WA 1D3BB 1YI2T 5I11A 2YDLA 2AIRB 2GGRA 3QJ6A 4HA8A 2AZSA 1VQ7A 4TVRA 4PLIA 1M30A 3JB9I 4C5EA 3OA6A 2RI5A 2XK0A 3G4SQ 3M57A 4WCIA 4EIKA 3INZA 1LVKA 5GAMe 4UC4A 2M16A 3I56A 3G6EA 2QXFA 5FU7C 1OZ2A 2YHTA 1KHCA 1M3CA 2RQUA 4DBQA 2B8AA 2DILA 1YI2Q 2FPFA 2L3SA 3JRZA 1AHJB 2DJZA 2LC4A 2KI7A 2PUOB 2ESWA 1UDLA 3A1PA 3EGXB 2COYA 4J9EA 1H3HA 1MMAA 1UTIA 3NFCA 3CCSA 3DLLA 4JUVA 3H0HA 3OYCA 4M75D 1M5Q1 2PVGB 1K0SA 5GAOr 1XOVA 3M4YA 2EJGA 1GCQC 5GMKi 4XTXA 3VV0A 3VS1A 3A8LB 5EC7A 2EYQA 3S6WA 1D1AA 3A8HB 1YWPA 2GFAA 2FB7A 2P4RA 1E6HA 1UHFA 4C8QA 3JB9D 2RM4A 1IXDA 4XQ3A 4LD9K 2V8KA 1FMVA 2LTOA 2DXTA 1NJIR 3CD6T 1NM7A 5L23A 1KK7A 4J6YA 2P0PA 4BY6C 1O75A 2X35A 3MP1A 1W4SA 3NPFA 2CP7A 3QWXX 3OW2P 2DD4A 4FCYA 3M58A 2LZ6B 4F7UF 2DL8A 2DEUA 4B9WA 2YUNA 2K6DA 1LNXA 2OAUA 2F5KA 4M77D 2K5FA 2X4WA 2PZ1A 4M7DB 3EG0A 3CQTA 3MCAB 4O6JA 4HCKA 2CZ6B 2RHYA 2DEQA 1GXIE 1WIEA 3ER0A 1MMDA 4MMLA 1MUZA 4HVWA 2L5QA 2A3LA 5GAOl 2C0IA 4FT4A 1VA7A 1Q86U 1OYXA 3A98A 2XICA 5CO7A 4KUIA 3OYFA 1RABB 1WHLA 2HKNA 1VQKA 2JS0A 4J6XA 3EFRA 1KC8U 1KQ1A 3NTKA 2R5MA 1W70A 5GAMf 3EGDB 1JEGA 2KSSA 4IUVA 5LJ5d 5M9OA 4M78B 2ZPIB 2HBWA 3H0FA 1SF9A 5CVIA 4EDUA 5D6XA 3O8VA 3JCMX 5GANh 2O31A 3S3OA 2IVWA
chains in the Genus database with same CATH topology
1JQQA 3THKA 1K76A 2DM1A 4J9BA 2PTKA 2ENMA 2KYBA 1OV3A 2DNUA 1NG2A 4OMNA 2K7AA 2J6FA 2L0AA 1ZBJA 3QWYA 3PVQA 2LJ1A 3M0PA 1RI9A 2DL5A 4CC4B 3TSWA 3SHWA 2GBQA 2EYWA 1JO8A 4IIMA 2LJ3A 2GQIA 2J06A 1H92A 1S1NA 3EG1A 4LUDA 4RTYA 2MOXA 2DA9A 1BU1A 2ED1A 2HSPA 2JMAA 2EPDA 2HEQA 5GJWB 1NYFA 1AD5A 1PNJA 3VS7A 2DF6A 2ED0A 2HDAA 4GLMA 1AEYA 1UHCA 1PKSA 1WYXA 2DL3A 5ECAA 1OEBA 1WFWA 2VVKA 1E7OA 4HVUA 2PNIA 2RF0A 3REBB 2DX1A 1X43A 2DMOA 5IXBA 4D8KA 2D0NA 4K11A 4RTZA 2W10A 1GL5A 2BZ8A 1FYNA 1I07A 2AK5A 1FMKA 1HD3A 2EBPA 1SRLA 2EYXA 1IO6A 1NLPC 2J05A 2FEIA 1U06A 1AVZC 2A36A 2A08A 2EYZA 2YUQA 2D1XA 3EG3A 1QWEA 2BZYA 3VS6A 1NLOC 2RNAA 1ZUUA 2O2OA 4OMQA 2JT4A 1K9AA 2OAWA 1ABQA 1NEGA 1SSHA 5IXFA 1E6GA 2FG0A 3UA6A 1GFCA 4FSSA 2KYMA 4LE9A 3R6NA 1JXMA 3RNJA 2ROLA 1KJWA 1T0HA 1AWOA 3TVTA 1SHFA 1YCSB 1YNZA 3FJ5A 3UATA 1NEBA 2A37A 3NMZC 3I9QA 4GBQA 3I5SA 2KXDA 2KROA 3NGPA 4OMOA 1QKXA 2O88A 1CKAA 1UJYA 1AOJA 2ECZA 2KGTA 4J9GA 1Z9QA 1WX6A 2KRMA 1VYTA 2QDLA 3KFVA 2MIOA 2JTEA 1UJ0A 1BK2A 2OJ2A 5IHNA 2JS2A 2LX7A 2V1QA 5FW9A 2KE9A 3I5RA 2L2PA 4OMMA 3EGUA 1Y0MA 1YP5A 1OPKA 1GRIA 1JU5C 3NHNA 1EFNA 4DEYA 2FO0A 3O5ZA 1B07A 1AWJA 2G6FX 1V1CA 2KT8A 2CSQA 2DJQA 5IH2A 4Z89A 1T3SA 2AKKA 1J3TA 2K3BA 1UECA 1UE9A 2LQWA 2DVJA 1I0CA 1GBRA 1GFDA 2OI3A 4IIOA 1ZLMA 2GNCA 4Z88A 1ZUYA 2IIMA 2ROTA 2RQVA 4DEXA 1YN8A 2GTOA 2HCKA 2RN8A 3ULRB 1WXUA 2KRNA 3GBQA 2B86A 2DBKA 3VRZA 1QCFA 5HCKA 4RTVA 2C0OA 2XMFA 3EHRA 1X6GA 1KIKA 2CT3A 2KXCA 2LJ0A 1MV0B 1W6XA 3VS3A 4J9HA 4CC7A 2EKHA 3H41A 1GCQA 4QT7A 4RTTA 4AG2C 2H8HA 3EHQA 1RLPC 2EYYA 4Y92A 2X3XD 4HVVA 4J9DA 2KT1A 3UA7A 1SHGA 4JPBW 3VS4A 3U23A 2YUPA 1UFFA 2KRSA 2J6OA 2CH4A 4M4ZA 4J9FA 2KNBB 1VYUA 2GTJA 2YSQA 1UGVA 1VYVA 4LNPA 1TUCA 2X3WD 3M0QA 2CUBA 2EW3A 1ZUKA 1JXOA 3M0SA 1OOTA 2D8HA 1SPKA 2RQRA 2M0YA 5GJVB 2O9VA 4LN2A 4X1VA 2YUOA 2NUZA 2K79A 2J6KA 2FPDA 2KEAA 1QLYA 1K0XA 2W0ZA 4JZ4A 2I0NA 2L3PA 1H8KA 3IQLA 2FRWA 1HJDA 1X2QA 1KSWA 1Z9ZA 3SEMA 5FWBA 1K1ZA 4A63B 1GBQA 2FPEA 1X6BA 5IHIA 2YDLA 5I11A 1X69A 5FWCA 2GGRA 1PRLC 3EG2A 1TG0A 2AZSA 1QWFA 1M30A 3RBBB 1UG1A 1PKTA 1LCKA 1KFZA 1SRMA 1X27A 3ZL7C 1BBZA 1NYGA 4JJCA 1T3LA 4WCIA 4EIKA 4D8DA 4ORZA 2EGEA 2SEMA 2AZVA 4HXJA 3VS2A 2LMJA 2DL7A 4E6RA 2L3QA 2RQTA 3PVLA 1M3CA 1Y57A 2RQUA 4ZNXA 2DE0X 2K2MA 2DILA 1AZGB 2FPFA 2L3SA 1YWOA 2O9SA 2CH4W 2ESWA 1UDLA 4J9EA 1H3HA 4R0KA 2NWMA 2CT4A 1UTIA 1ARKA 1ZSGA 2F2VA 2LNHB 1U5SA 3H0HA 1K0SA 1QKWA 1PHTA 1XOVA 4F14A 2YT6A 5I22A 1W1FA 2E5KA 1PWTA 4OMPA 1GCQC 2M51A 4ESRA 2JW4A 2DLPA 2RQWA 3VS1A 1SEMA 5EC7A 4AFQC 4RTWA 1YWPA 4CC3A 1G2BA 1CKBA 2P4RA 1E6HA 1UHFA 1X2KA 2A28A 3LH5A 2RPNA 2C0TA 1M8MA 1AWXA 2F2XA 3M0UA 1M3AA 1AWWA 1NM7A 1ZX6A 1G83A 2BTTA 2CUDA 5L23A 1WA7A 1B3QA 2JM9A 4AFZC 3VS5A 2DRMA 3VRYA 2EGAA 2RMOA 2DBMA 1N5ZA 1WI7A 3NPFA 1WLPB 3QWXX 2CDTA 2K9GA 2FRYA 5IHKA 1PRMC 2LZ6B 2LCSA 3TSZA 2JXBA 2EGCA 2DL8A 1OPLA 1CSKA 4JZ3A 2KR3A 1MV3A 2DRKA 2K6DA 2YUNA 4AG1C 3JV3A 1GCPA 4RTUA 4RUGA 3PE0A 2PZ1A 3REAB 1U3OA 2LP5A 2MCNA 3EG0A 1WXTA 3CQTA 4F16A 4HCKA 4Z8AA 4AFUC 2KBTA 1WDXA 2EQIA 4J9IA 1WIEA 4J9CA 2SRCA 2CREA 3H0IA 4F17A 1MUZA 4HVWA 2C0IA 3UF4A 4JJBA 2VWFA 2JM8A 1AZEA 1HSQA 1VA7A 2AKLA 3I35A 3VS0A 3A98A 4AFSC 4JJDA 2BZXA 1RUWA 2JMCA 2V1RA 2JS0A 1WXBA 2VKNA 2LQNA 1K4US 1W70A 1T0JA 1JEGA 4KRTA 2ABLA 3M0TA 2EVRA 3M0RA 1ABOA 2CSIA 2DL4A 1I1JA 4RTXA 2HBWA 1A0NB 2DYBA 4LUEA 3H0FA 1TUDA 2D8JA 4OMLA 1BB9A 4CC2A 1M27C 1RLQC 1UUEA 1M3BA 2F2WA 2J7IA 3C0CA 2O31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQQ A;  3THK A;  1K76 A;  2DM1 A;  4J9B A;  2PTK A;  2ENM A;  2KYB A;  1OV3 A;  2DNU A;  1NG2 A;  4OMN A;  2K7A A;  2J6F A;  2L0A A;  1ZBJ A;  3QWY A;  3PVQ A;  2LJ1 A;  3M0P A;  1RI9 A;  2DL5 A;  4CC4 B;  3TSW A;  3SHW A;  2GBQ A;  2EYW A;  1JO8 A;  4IIM A;  2LJ3 A;  2GQI A;  2J06 A;  1H92 A;  1S1N A;  3EG1 A;  4LUD A;  4RTY A;  2MOX A;  2DA9 A;  1BU1 A;  2ED1 A;  2HSP A;  2JMA A;  2EPD A;  2HEQ A;  5GJW B;  1NYF A;  1AD5 A;  1PNJ A;  3VS7 A;  2DF6 A;  2ED0 A;  2HDA A;  4GLM A;  1AEY A;  1UHC A;  1PKS A;  1WYX A;  2DL3 A;  5ECA A;  1OEB A;  1WFW A;  2VVK A;  1E7O A;  4HVU A;  2PNI A;  2RF0 A;  3REB B;  2DX1 A;  1X43 A;  2DMO A;  5IXB A;  4D8K A;  2D0N A;  4K11 A;  4RTZ A;  2W10 A;  1GL5 A;  2BZ8 A;  1FYN A;  1I07 A;  2AK5 A;  1FMK A;  1HD3 A;  2EBP A;  1SRL A;  2EYX A;  1IO6 A;  1NLP C;  2J05 A;  2FEI A;  1U06 A;  1AVZ C;  2A36 A;  2A08 A;  2EYZ A;  2YUQ A;  2D1X A;  3EG3 A;  1QWE A;  2BZY A;  3VS6 A;  1NLO C;  2RNA A;  1ZUU A;  2O2O A;  4OMQ A;  2JT4 A;  1K9A A;  2OAW A;  1ABQ A;  1NEG A;  1SSH A;  5IXF A;  1E6G A;  2FG0 A;  3UA6 A;  1GFC A;  4FSS A;  2KYM A;  4LE9 A;  3R6N A;  1JXM A;  3RNJ A;  2ROL A;  1KJW A;  1T0H A;  1AWO A;  3TVT A;  1SHF A;  1YCS B;  1YNZ A;  3FJ5 A;  3UAT A;  1NEB A;  2A37 A;  3NMZ C;  3I9Q A;  4GBQ A;  3I5S A;  2KXD A;  2KRO A;  3NGP A;  4OMO A;  1QKX A;  2O88 A;  1CKA A;  1UJY A;  1AOJ A;  2ECZ A;  2KGT A;  4J9G A;  1Z9Q A;  1WX6 A;  2KRM A;  1VYT A;  2QDL A;  3KFV A;  2MIO A;  2JTE A;  1UJ0 A;  1BK2 A;  2OJ2 A;  5IHN A;  2JS2 A;  2LX7 A;  2V1Q A;  5FW9 A;  2KE9 A;  3I5R A;  2L2P A;  4OMM A;  3EGU A;  1Y0M A;  1YP5 A;  1OPK A;  1GRI A;  1JU5 C;  3NHN A;  1EFN A;  4DEY A;  2FO0 A;  3O5Z A;  1B07 A;  1AWJ A;  2G6F X;  1V1C A;  2KT8 A;  2CSQ A;  2DJQ A;  5IH2 A;  4Z89 A;  1T3S A;  2AKK A;  1J3T A;  2K3B A;  1UEC A;  1UE9 A;  2LQW A;  2DVJ A;  1I0C A;  1GBR A;  1GFD A;  2OI3 A;  4IIO A;  1ZLM A;  2GNC A;  4Z88 A;  1ZUY A;  2IIM A;  2ROT A;  2RQV A;  4DEX A;  1YN8 A;  2GTO A;  2HCK A;  2RN8 A;  3ULR B;  1WXU A;  2KRN A;  3GBQ A;  2B86 A;  2DBK A;  3VRZ A;  1QCF A;  5HCK A;  4RTV A;  2C0O A;  2XMF A;  3EHR A;  1X6G A;  1KIK A;  2CT3 A;  2KXC A;  2LJ0 A;  1MV0 B;  1W6X A;  3VS3 A;  4J9H A;  4CC7 A;  2EKH A;  3H41 A;  1GCQ A;  4QT7 A;  4RTT A;  4AG2 C;  2H8H A;  3EHQ A;  1RLP C;  2EYY A;  4Y92 A;  2X3X D;  4HVV A;  4J9D A;  2KT1 A;  3UA7 A;  1SHG A;  4JPB W;  3VS4 A;  3U23 A;  2YUP A;  1UFF A;  2KRS A;  2J6O A;  2CH4 A;  4M4Z A;  4J9F A;  2KNB B;  1VYU A;  2GTJ A;  2YSQ A;  1UGV A;  1VYV A;  4LNP A;  1TUC A;  2X3W D;  3M0Q A;  2CUB A;  2EW3 A;  1ZUK A;  1JXO A;  3M0S A;  1OOT A;  2D8H A;  1SPK A;  2RQR A;  2M0Y A;  5GJV B;  2O9V A;  4LN2 A;  4X1V A;  2YUO A;  2NUZ A;  2K79 A;  2J6K A;  2FPD A;  2KEA A;  1QLY A;  1K0X A;  2W0Z A;  4JZ4 A;  2I0N A;  2L3P A;  1H8K A;  3IQL A;  2FRW A;  1HJD A;  1X2Q A;  1KSW A;  1Z9Z A;  3SEM A;  5FWB A;  1K1Z A;  4A63 B;  1GBQ A;  2FPE A;  1X6B A;  5IHI A;  2YDL A;  5I11 A;  1X69 A;  5FWC A;  2GGR A;  1PRL C;  3EG2 A;  1TG0 A;  2AZS A;  1QWF A;  1M30 A;  3RBB B;  1UG1 A;  1PKT A;  1LCK A;  1KFZ A;  1SRM A;  1X27 A;  3ZL7 C;  1BBZ A;  1NYG A;  4JJC A;  1T3L A;  4WCI A;  4EIK A;  4D8D A;  4ORZ A;  2EGE A;  2SEM A;  2AZV A;  4HXJ A;  3VS2 A;  2LMJ A;  2DL7 A;  4E6R A;  2L3Q A;  2RQT A;  3PVL A;  1M3C A;  1Y57 A;  2RQU A;  4ZNX A;  2DE0 X;  2K2M A;  2DIL A;  1AZG B;  2FPF A;  2L3S A;  1YWO A;  2O9S A;  2CH4 W;  2ESW A;  1UDL A;  4J9E A;  1H3H A;  4R0K A;  2NWM A;  2CT4 A;  1UTI A;  1ARK A;  1ZSG A;  2F2V A;  2LNH B;  1U5S A;  3H0H A;  1K0S A;  1QKW A;  1PHT A;  1XOV A;  4F14 A;  2YT6 A;  5I22 A;  1W1F A;  2E5K A;  1PWT A;  4OMP A;  1GCQ C;  2M51 A;  4ESR A;  2JW4 A;  2DLP A;  2RQW A;  3VS1 A;  1SEM A;  5EC7 A;  4AFQ C;  4RTW A;  1YWP A;  4CC3 A;  1G2B A;  1CKB A;  2P4R A;  1E6H A;  1UHF A;  1X2K A;  2A28 A;  3LH5 A;  2RPN A;  2C0T A;  1M8M A;  1AWX A;  2F2X A;  3M0U A;  1M3A A;  1AWW A;  1NM7 A;  1ZX6 A;  1G83 A;  2BTT A;  2CUD A;  5L23 A;  1WA7 A;  1B3Q A;  2JM9 A;  4AFZ C;  3VS5 A;  2DRM A;  3VRY A;  2EGA A;  2RMO A;  2DBM A;  1N5Z A;  1WI7 A;  3NPF A;  1WLP B;  3QWX X;  2CDT A;  2K9G A;  2FRY A;  5IHK A;  1PRM C;  2LZ6 B;  2LCS A;  3TSZ A;  2JXB A;  2EGC A;  2DL8 A;  1OPL A;  1CSK A;  4JZ3 A;  2KR3 A;  1MV3 A;  2DRK A;  2K6D A;  2YUN A;  4AG1 C;  3JV3 A;  1GCP A;  4RTU A;  4RUG A;  3PE0 A;  2PZ1 A;  3REA B;  1U3O A;  2LP5 A;  2MCN A;  3EG0 A;  1WXT A;  3CQT A;  4F16 A;  4HCK A;  4Z8A A;  4AFU C;  2KBT A;  1WDX A;  2EQI A;  4J9I A;  1WIE A;  4J9C A;  2SRC A;  2CRE A;  3H0I A;  4F17 A;  1MUZ A;  4HVW A;  2C0I A;  3UF4 A;  4JJB A;  2VWF A;  2JM8 A;  1AZE A;  1HSQ A;  1VA7 A;  2AKL A;  3I35 A;  3VS0 A;  3A98 A;  4AFS C;  4JJD A;  2BZX A;  1RUW A;  2JMC A;  2V1R A;  2JS0 A;  1WXB A;  2VKN A;  2LQN A;  1K4U S;  1W70 A;  1T0J A;  1JEG A;  4KRT A;  2ABL A;  3M0T A;  2EVR A;  3M0R A;  1ABO A;  2CSI A;  2DL4 A;  1I1J A;  4RTX A;  2HBW A;  1A0N B;  2DYB A;  4LUE A;  3H0F A;  1TUD A;  2D8J A;  4OML A;  1BB9 A;  4CC2 A;  1M27 C;  1RLQ C;  1UUE A;  1M3B A;  2F2W A;  2J7I A;  3C0C A;  2O31 A; 
#chains in the Genus database with same CATH topology
 4QQD A;  4R55 A;  3FEO A;  2K7A A;  4J5Y A;  3CCS Q;  4M75 A;  2LJ1 A;  2CP6 A;  3M0P A;  1NE8 A;  2F1L A;  3CMA A;  2LJ3 A;  3JCM V;  3MEU A;  1H92 A;  1S1N A;  3CXC P;  2JN0 A;  2PUK B;  4RTY A;  4C92 F;  4HCZ A;  4JRI A;  1BU1 A;  2JMA A;  3CC7 T;  3CC4 A;  5GJW B;  1RAE B;  3JCM W;  4D6W A;  2DKG A;  1UHC A;  1PKS A;  1ZA1 B;  5GAN e;  2LRQ A;  5ECA A;  2DIG A;  2QQ9 A;  2RF0 A;  2QTX A;  1YHQ A;  2QI2 A;  2D0Q B;  4XK8 E;  4RMO A;  1M1F A;  2RHZ A;  4N0A C;  1K73 C;  4NL2 A;  1GL5 A;  2AK5 A;  4A53 A;  1M1K R;  5CKE A;  2J05 A;  4EMH A;  1U06 A;  1Q81 R;  2EYZ A;  3H9N A;  2YUQ A;  2O01 E;  4HCC A;  3EG3 A;  2ZAE A;  2BZY A;  1TOV A;  1G3S A;  1V29 B;  1D1C A;  4GLK A;  1ZUU A;  2O2O A;  4OMQ A;  2YLB A;  1ABQ A;  3DKM A;  3NTI A;  2HSE B;  1E6G A;  1UGP B;  1LJO A;  9ATC B;  1GFC A;  3CPF A;  1JXM A;  3CMA T;  4M78 F;  4E7L A;  4PNO A;  1AWO A;  3OSS C;  1SHF A;  3TVT A;  1X01 A;  2X4X A;  3FJ5 A;  1N8R U;  3UAT A;  3OBY A;  2KVQ G;  1YI2 A;  4PK4 A;  4NOY A;  1JB0 E;  3CCU T;  1VQL T;  3JCM c;  5KYN A;  3UT1 A;  4C0D B;  2O88 A;  1CKA A;  3RER A;  2ECZ A;  1ZHI A;  3E19 A;  1VQ8 T;  1WGS A;  2MIO A;  1ZA2 B;  2OJ2 A;  2DTI A;  1YIJ A;  1UB4 A;  2XD0 A;  4RG8 A;  1IZ6 A;  4Y28 E;  2V1Q A;  1XNI A;  4OMM A;  1GRI A;  3FRN A;  3NHN A;  3VYG A;  2E12 A;  1VQN Q;  2V26 A;  2FO0 A;  5CR2 A;  3O5Z A;  1QW1 A;  2MMP A;  3UWN A;  3RR6 A;  3CPW P;  1B07 A;  1AWJ A;  2FHD A;  2XDB A;  4OVA A;  2CP0 A;  3LW5 E;  5GMK l;  2AKK A;  5KYY B;  3V8J A;  2LQW A;  2DZC A;  1KQ2 A;  4ZN1 A;  5A2Q E;  4M77 B;  1GFD A;  4F7U E;  1TUG B;  1ZLM A;  4Z88 A;  5GMK j;  1ZUY A;  2RQV A;  1YN8 A;  3C12 A;  3JCM P;  2KRN A;  2X9H A;  5A0G A;  4PJL A;  2L3R A;  2NLU A;  1JJ2 P;  4BDY A;  2LJ0 A;  1MV0 B;  2ZPF B;  3OS2 A;  5GAN d;  4LD6 A;  1WZO A;  3BW1 A;  2DER A;  4QT7 A;  4RTT A;  1B34 B;  2H8H A;  1YBY A;  3QHS A;  4WF2 A;  4ELY C;  2X3X D;  4DBF A;  3SWN B;  2KT1 A;  3MJX A;  1SHG A;  3VS4 A;  3U23 A;  3CCV T;  2XU8 A;  1UFF A;  1K9M R;  3PNW C;  2RK2 A;  2Y4X A;  3LYI A;  1VYU A;  4M7D A;  3SDZ A;  3CCM T;  2JJ9 A;  2X3W D;  2IG0 A;  3M0Q A;  3CC7 A;  2CUB A;  5FU7 B;  2O4X A;  1JXO A;  3OB9 A;  3RIR A;  4BI4 A;  2LDM A;  2BE9 B;  3CCJ A;  2M0Y A;  3QDF A;  7AT1 B;  4LN2 A;  3HRT A;  3E1S A;  2GF7 A;  4DBR A;  1OI1 A;  4YTL A;  2FPD A;  2RJF A;  2IPO B;  1PSF A;  3OQ5 A;  2BUD A;  4EMG A;  2Y90 A;  1VQ5 A;  1H8K A;  1TSF A;  3OYL A;  2P84 A;  4M78 G;  4ATO A;  2FRW A;  1X2Q A;  1KSW A;  1K1Z A;  2DET A;  3UDC A;  3KXT A;  4BDZ A;  5FWC A;  3EH2 A;  3C4S A;  3QXE B;  3CCV A;  3JSC A;  1PRL C;  3EG2 A;  4M7A E;  1M90 C;  1QWF A;  2EFI A;  1PKT A;  2NUP B;  2QEX A;  1KFZ A;  1SRM A;  1NYG A;  5GMK h;  2NUP A;  3URG A;  4DOW A;  5KYY A;  4ORZ A;  4FM4 B;  2LMJ A;  2DL7 A;  1QVG S;  2L3Q A;  1XTD A;  2RQT A;  4PJO F;  1VQO A;  1NZ9 A;  1Y57 A;  1M1K U;  1ACM B;  2K2M A;  3Q1J A;  3MP8 A;  1YWO A;  3BFM A;  4IUU A;  4F7U G;  3JCM f;  3OYI A;  1ARK A;  1ZSG A;  2LNH B;  2QQS A;  2DZ9 A;  4L5G A;  1QKW A;  4J8O A;  5KCO A;  3D7S B;  2EQK A;  2YT6 A;  5LL6 S;  5I22 A;  1VQ6 Q;  1B34 A;  2E5K A;  4E7J A;  2WSC E;  5J39 A;  2RQW A;  4PJO C;  3LH0 A;  5GMK e;  3EG9 B;  1SEM A;  1N8R R;  4AFQ C;  3HP9 A;  3BY7 A;  5I2S A;  2JTF A;  1X2K A;  3LH5 A;  4C8Q F;  2RPN A;  3MET A;  4XTY A;  1AWX A;  2F2X A;  3M0U A;  5LJ5 e;  3JB9 F;  3QG1 A;  1M3A A;  1AWW A;  2ZPH B;  1W2B A;  2CKK A;  2BTT A;  1G83 A;  2CUD A;  8ATC B;  2JM9 A;  3L2V A;  3VRY A;  5GAM d;  3RKY A;  5D7U A;  1N5Z A;  1WLP B;  3MP6 A;  2JTM A;  1EIF A;  1OPL A;  1CSK A;  4N4H A;  1G8X A;  1MV3 A;  2DRK A;  3G71 T;  2CP2 A;  4C92 G;  4ZGD B;  4RUG A;  2LX9 A;  4OF1 A;  8AT1 B;  4F7U B;  2QA4 Q;  1WJS A;  4LDV A;  1PG5 B;  4Z8A A;  2KBT A;  3CC4 Q;  3CCL Q;  4KH1 B;  2EQI A;  3JCM e;  4J9I A;  1TU0 B;  1SG5 A;  4J9C A;  2CRE A;  2EQJ A;  3H0I A;  1D0Z A;  5LJ5 h;  3EFO B;  3OYG A;  2EJF A;  1S72 T;  1MMG A;  2I2L A;  2QEX Q;  2QEX T;  1HSQ A;  3P8B B;  2KDS A;  4DA4 A;  4JJD A;  3I56 T;  4EMK A;  1K4U S;  3R6O A;  1TWB A;  4KRT A;  2E65 A;  3M0T A;  5GAO q;  2DYB A;  4QKU A;  3M54 A;  1TUD A;  2D8J A;  5GAM g;  1RI0 A;  3CC2 A;  1M27 C;  1RLQ C;  3S3N A;  3HSB A;  5I2M A;  1PC0 A;  4BAC A;  1H64 1;  3EGX A;  2HAX A;  4D8D A;  4X9D A;  2HQE A;  1VQO T;  2FZG B;  3JCM h;  3QO3 A;  3PFS A;  4FYY B;  2PTK A;  4FU6 A;  4LDX A;  2COW A;  1OV3 A;  3OS1 A;  1VQN A;  2J6F A;  1ZBJ A;  3PIP A;  3OYN A;  2DL5 A;  3MEW A;  3TSW A;  2WSE E;  3VUZ A;  4IIM A;  4DBH A;  5LJ3 d;  3RMQ A;  3CCM A;  3GNF B;  4C8Q C;  2E64 A;  2FVU A;  4C0Z A;  5HK0 A;  2MOX A;  1M2V A;  3M4G A;  4IKF A;  1U1S A;  2DYI A;  2EJ9 A;  1NYF A;  2DD5 A;  1AD5 A;  1PNJ A;  3CCJ Q;  4MZM A;  2HDA A;  2OTJ A;  1KD1 U;  1VQM T;  4XTW A;  1WYX A;  2ZPG B;  5KH6 A;  4XTV A;  3CBO A;  1TS9 A;  3M5A A;  4LDW A;  5IT9 E;  3L2W A;  2DMO A;  5IXB A;  1D0X A;  2D6F A;  2RO0 A;  2FL7 A;  2W10 A;  3JCM Q;  1FYN A;  5EG2 A;  2EYX A;  1NLP C;  1C0M A;  4OGC A;  3ZEH A;  1YJN T;  4C92 E;  1AVZ C;  3VKI A;  4C92 C;  2E3I A;  4LXC A;  3MEA A;  3VS6 A;  1NLO C;  2LCL A;  5GAN 4;  3L2R A;  3FIF A;  2QA4 A;  1NPP A;  1SSH A;  2FG0 A;  3QDR B;  5CKD A;  1VIF A;  4LE9 A;  5LJ5 g;  2G3R A;  1K8A U;  2ROL A;  1YIT T;  4M7A F;  1I81 A;  1YNZ A;  2VXF A;  4C92 D;  1NEB A;  2A37 A;  3NMZ C;  3I9Q A;  4B6M A;  4GBQ A;  1WQW A;  3VUB A;  4PJO G;  5CKB A;  1IGQ A;  4OMO A;  1UJY A;  2QA4 T;  4PJJ A;  4J9G A;  3MEV A;  1M9S A;  1VYT A;  4FIB A;  2QDL A;  1D09 B;  4AT1 B;  3CCR T;  3I55 A;  1VQ4 Q;  2ATC B;  4C0G A;  2RHU A;  1Y0M A;  1OPK A;  4FT2 A;  3CCV Q;  4M77 G;  1K8A C;  1BCM A;  5LJ3 j;  2FZC B;  2RA2 A;  1V1C A;  3DB3 A;  3L42 A;  5GAN 7;  3I55 Q;  2KT8 A;  3FB9 A;  2A0F B;  4N4I A;  3C94 A;  2HL3 A;  3OYY A;  1G3Y A;  3SD4 A;  4C92 A;  2RHX A;  1I0C A;  1IGU A;  5GAN g;  1HYO A;  5CCA A;  2E4H A;  4C8Q B;  3JAM E;  4IIO A;  2MAM A;  2GNC A;  2IIM A;  2ROT A;  3NTH A;  4DEX A;  3OYD A;  1Q86 C;  2GTO A;  3SWN C;  2RN8 A;  4KGZ B;  3ULR B;  1WXU A;  3P8H A;  2DBK A;  3C95 A;  1QCF A;  3CME A;  1RL2 A;  3LX7 A;  3PMI A;  3QUI A;  1MNE A;  4PJO D;  2VV5 A;  1KC8 C;  4CI0 C;  1TH7 A;  4X34 A;  5KYW A;  2QQR A;  2CT3 A;  1MND A;  2KXC A;  3SFM A;  1Q82 R;  1W6X A;  3VS3 A;  4J9H A;  3H41 A;  1RLP C;  2EYY A;  4Y92 A;  4HVV A;  1KQS P;  1UGS B;  4J9D A;  1VQO Q;  3UA7 A;  1VQM A;  2AT1 B;  2KRS A;  2J6O A;  4M4Z A;  4C92 B;  4J9F A;  1OQK A;  4KUL A;  4M7A B;  4LNP A;  3HTR A;  3CCR A;  2F69 A;  4QVD A;  2EW3 A;  3M0S A;  3OW2 S;  3M53 A;  2D8H A;  1SPK A;  4MDX A;  4A4E A;  1Y71 A;  1I5L A;  2YRD A;  3L1A A;  3TCJ A;  5KYW B;  3MKD A;  5GAN 2;  2RHI A;  2YUO A;  1U8R A;  1VQN T;  3CC2 Q;  1YJW T;  2K79 A;  2J6K A;  5IN1 A;  2MYS A;  4RCC A;  5GAN 8;  1WHK A;  3M9Q A;  1OU8 A;  2R57 A;  5KCH A;  1QVG P;  1F1B B;  4JZ4 A;  2MWO A;  4IUT A;  2MWP A;  2I0N A;  2XHC A;  2L3P A;  1Y96 A;  2EQU A;  1N27 A;  1G3W A;  4PJO B;  1Z9Z A;  2QGF B;  3SEM A;  5FWB A;  1YJ9 T;  4A63 B;  3SB2 A;  2R5A A;  1WHJ A;  4FW1 A;  5IHI A;  1VQK T;  1TG0 A;  1YIT Q;  1UG1 A;  3G7Z A;  3G4S T;  1KD1 R;  1LCK A;  5DLO A;  3ASK A;  4JJC A;  5DLQ E;  1T3L A;  3J81 E;  1JBM A;  2H3E B;  2EGE A;  2SEM A;  3CCE Q;  2AZV A;  4HXJ A;  1QP2 A;  1X6O A;  1YIT A;  3EH1 A;  4JJN K;  5L8R E;  1YHQ Q;  2DK3 A;  2DE0 X;  1QMC A;  1IHW A;  4QW2 A;  1S72 Q;  2DO3 A;  3F70 A;  4OB1 B;  2DPP B;  2O9S A;  2VGN A;  1VQP Q;  4ZGJ B;  5LJ3 f;  2K2V A;  4R0K A;  1JJ2 S;  2CT4 A;  4FYV B;  2RJC A;  2VGM A;  3N5B B;  5KYU B;  1U5S A;  3JCM d;  1IB8 A;  1PHT A;  4F14 A;  1W1F A;  3OY9 A;  1PWT A;  1VQP A;  1XJW B;  4ESR A;  3E9F A;  4XU0 A;  5HY6 A;  1W2B S;  1VQ9 A;  2C06 A;  1K73 R;  3QBY A;  4J7F A;  4JRP A;  4F7U A;  3OYH A;  5AYF A;  1CKB A;  2RJE A;  2DTH A;  4PFP A;  5GMK m;  3L2Q A;  5CK9 A;  1WHM A;  2LT1 A;  2C0T A;  1M8M A;  3E2U A;  2RB6 A;  2COZ A;  3LWH A;  3CD6 Q;  2JUF A;  1KQS A;  3E9G A;  4AFZ C;  3VS5 A;  2EGA A;  2RMO A;  3X24 B;  1WI7 A;  3PTA A;  2CDT A;  2K9G A;  1KD1 C;  2FRY A;  4M75 C;  5GAO m;  3G6E T;  2EGC A;  4XAX B;  4ZTJ A;  3CMA Q;  4JZ3 A;  2RI3 A;  4M7A D;  3TEE A;  4AG1 C;  2HNI A;  3JV3 A;  1GCP A;  4RTU A;  1Q7Y R;  3OSV A;  4A4K A;  1U3O A;  3FLG A;  2MCN A;  4C8Q E;  4F16 A;  1PCX A;  4BY6 B;  4M77 F;  3GOX A;  2LNV A;  3OW2 A;  1VQ6 T;  2DFU A;  1WDX A;  2E6Z A;  2CZ7 B;  2SRC A;  3V8L A;  2F5T X;  1M1G A;  1VQ6 A;  3JB9 H;  2QAS A;  2E3H A;  2PU9 B;  3J80 E;  2JM8 A;  2CGH A;  4M78 A;  3VS0 A;  1C6V X;  2BZX A;  1PD1 A;  1RUW A;  1QCN A;  1BI1 A;  2V1R A;  1VUB A;  1SKU B;  1WXB A;  4ANJ A;  2HBP A;  4C8Q D;  4IUR A;  3BE3 A;  1T0J A;  1RAI B;  2ABL A;  1K9M C;  3M0R A;  1KQS S;  1ZSZ C;  3EG9 A;  1Q95 G;  4OML A;  2K3X A;  1BB9 A;  2EQM A;  1S72 A;  2BE7 D;  4ME7 A;  4OMF B;  2F2W A;  3QII A;  2J7I A;  5CQX A;  3C0C A;  2NYS A;  2VC8 A;  2RI2 A;  2CYZ B;  1JQQ A;  2XG8 D;  3THK A;  2DM1 A;  5KYX B;  4J9B A;  1Q82 C;  2ENM A;  2PVO B;  2NUT B;  2L0A A;  3PVQ A;  1RAD B;  2E6N A;  1RAH B;  2L89 A;  4CC4 B;  3OBW A;  3SHW A;  3CCE T;  2GBQ A;  4B9X A;  4PJO A;  4M78 D;  1ZSZ B;  2GCX A;  3CCR Q;  4ZN3 A;  5C0M A;  2GQI A;  4MZT A;  3M55 A;  1N6A A;  2EAY A;  1QVG A;  2BKD N;  1RAG B;  5LJ3 e;  2DXU A;  4BI8 B;  4V2S A;  4F04 B;  1BI0 A;  2ED1 A;  1R8O B;  1W2B P;  1M4Z A;  2HSP A;  2EPD A;  2WAC A;  3GP8 A;  2HEQ A;  1I5O B;  4IUQ A;  2DF6 A;  4GLM A;  4PFZ A;  5J3B A;  3CCM Q;  4J6W A;  3V7C A;  5GAO p;  2DL3 A;  2JOY A;  2QAZ A;  3OYB A;  3EAE A;  1WNL A;  2VVK A;  1QQJ A;  4HVU A;  2PNI A;  2CZ0 B;  3REB B;  4M78 C;  2DX1 A;  1X43 A;  3HRU A;  1M1K C;  3X26 B;  4K11 A;  3VU3 C;  4RTZ A;  2BZ8 A;  3V7S A;  1I07 A;  4FSX A;  5GAM j;  4NL3 A;  5KYX A;  1SRL A;  4M7D D;  2V8J A;  2QQB A;  2JNG A;  2FEI A;  2P0K A;  2ZZD A;  2A36 A;  2L8D A;  1QWE A;  3X25 B;  3G4S A;  1M2O A;  4II1 A;  3TRE A;  4E7H A;  3CPW S;  1R0B G;  4M75 G;  1K9A A;  2OAW A;  1WPY A;  4PKC C;  3RES A;  1VQ5 T;  4OB2 B;  5LJ3 h;  2KAF A;  1VQ8 Q;  3UA6 A;  2KK4 A;  1VIE A;  4FSS A;  1R0C B;  2KYM A;  1UGQ B;  1G5V A;  3CCE A;  2FZK B;  3RNJ A;  1YIJ Q;  1KJW A;  1T0H A;  2V8I A;  1PD0 A;  1YCS B;  4M7D E;  3RMS A;  3VYH B;  2MI6 A;  3RKW A;  3CCJ T;  1X75 C;  3WVD B;  3I5S A;  2M02 A;  2KRO A;  1TXQ A;  2OTJ T;  1VQM Q;  2WSF E;  5GAN 6;  1ZQ1 A;  3L2Z A;  5GAN 3;  1AOJ A;  3OYK A;  2KRM A;  1WX6 A;  4PJO E;  3WVE B;  3H8Z A;  2LVM A;  3KFV A;  2DTO A;  2JTE A;  3BDL A;  1BK2 A;  1DJ7 B;  2H3J A;  4C0F A;  5IHN A;  3QYH B;  4MZP A;  3CCQ Q;  1M8V A;  1IRX A;  2LX7 A;  1KG1 A;  2XI9 A;  4OB3 B;  2KE9 A;  3I5R A;  2VAS A;  5DY9 A;  2L2P A;  1OUL A;  4EPC A;  5HK3 A;  4JRK A;  1EFN A;  4E7Z A;  4DEY A;  4C5G A;  4ZGE B;  3HL8 A;  2KY9 A;  3JCM J;  4RCB A;  2G6F X;  3LGF A;  2HL5 C;  2CSQ A;  2DJQ A;  3HKS A;  5IH2 A;  1T3S A;  1Q81 C;  4J7I A;  3PGG A;  5CAI A;  4XTZ A;  1GBR A;  2Y4Y A;  2DXC A;  5LJ5 j;  3G1J A;  2XDD A;  4ELZ C;  3PT9 A;  2QG9 B;  3GF5 A;  1FMW A;  5HCK A;  5A0L A;  2XDP A;  3H6Z A;  2C0O A;  3M56 A;  4E2F B;  2VB6 A;  4A4H A;  3EHR A;  3HPW A;  2BIV A;  1KIK A;  4JS4 A;  2X4J A;  3OMC A;  2OTL A;  1EZZ B;  4CC7 A;  1YHQ T;  5KYU A;  1GCQ A;  1H3Z A;  3EHQ A;  4LDU A;  4AMC A;  4Q5W A;  1VOM A;  1EX4 A;  1HK9 A;  6AT1 B;  3LLR A;  4E47 A;  1BKB A;  1QP3 A;  2YUP A;  5J26 A;  2CP5 A;  1Q7Y U;  2KNB B;  2GTJ A;  1UGV A;  1VQ8 A;  4N4G A;  2DAQ A;  4CRI A;  1N9S A;  2DVE A;  2A7Y A;  2AHJ B;  5GAN j;  1VQ9 T;  3KUF A;  2RQR A;  4DOV A;  2O9V A;  4X1V A;  3EFO A;  2K5I A;  1BCO A;  3CPW A;  3JCM b;  2EKO A;  1NJI U;  3I55 T;  2KEA A;  1QLY A;  2DIQ A;  4QVZ A;  1Q7Y C;  1K0X A;  2W0Z A;  3L2U A;  4HT8 A;  1ZBX A;  3CBP A;  2E70 A;  3OS0 A;  2FYK A;  4JRQ A;  3IQL A;  4XU3 A;  4L59 A;  3MO8 A;  3HHT B;  4A4G A;  1GBQ A;  2FPE A;  1X6B A;  1X69 A;  4HT9 A;  3G6E Q;  2E1H A;  2RH2 A;  1Y96 B;  1FXX A;  3RBB B;  3LGL A;  3FC3 A;  1X27 A;  3ZL7 C;  4KT0 E;  3CCU Q;  1BBZ A;  1Y7X A;  4KH0 B;  4E7I A;  1VQL Q;  4KBM B;  4XU2 A;  2P0Q A;  3VS2 A;  4E6R A;  3PVL A;  1YJ9 A;  1ZSZ A;  3CCQ T;  1HXD A;  4ZNX A;  4M75 E;  2ZPB B;  1G3T A;  1AZG B;  2GQV A;  3SWN A;  2CH4 W;  5IAY A;  3CC2 T;  3OS5 A;  2NWM A;  1QCO A;  2F2V A;  2X51 A;  1KC8 R;  2VXE A;  3RDV A;  1V76 A;  2XID A;  4X9C A;  5LJ3 g;  2K5L A;  2KQW A;  4BE1 A;  3LWI A;  3HRS A;  3A8O B;  4OMP A;  4M75 F;  4VUB A;  1K8A R;  3EGD A;  2M51 A;  4RKU E;  4RG2 A;  2JW4 A;  2QK0 A;  2DLP A;  3S3M A;  1R77 A;  2E5Q A;  4RTW A;  4E7S A;  4CC3 A;  1G2B A;  2QYZ A;  2YXY A;  2QQA A;  5FRM A;  1N8R C;  3MHX A;  4M7D F;  4JLG A;  1NPR A;  1SSF A;  2A28 A;  5CKH A;  1C1A A;  2GFU A;  1ZX6 A;  5GAN f;  2D9T A;  1WA7 A;  4R56 A;  1B3Q A;  1UEB A;  4OP0 A;  1Q86 R;  2DRM A;  3OMG A;  2DBM A;  4PL6 A;  4C5H A;  1M90 R;  3T9N A;  1VQ7 Q;  1OU9 A;  3J7A F;  4KUD K;  5I21 A;  4QQG A;  3RUX A;  5IHK A;  1MHN A;  1PRM C;  2LCS A;  3TSZ A;  2JXB A;  4JDS A;  1JJ2 A;  2M0O A;  4N0A A;  1VQP T;  2KR3 A;  4ZTF A;  1LOJ A;  3I56 Q;  3PE0 A;  5GAO n;  3REA B;  2K4Y A;  2LP5 A;  1K73 U;  4MMK A;  3GLX A;  1WXT A;  3HFN A;  4Z02 A;  2DXB A;  4AFU C;  1IHV A;  1NBE B;  2RD1 A;  2XKO C;  3TU4 K;  2E41 A;  2LQ8 A;  1KHI A;  1VQ4 T;  1NJI C;  1U1T A;  4F17 A;  4L6V 5;  3QJY A;  2CP3 A;  4OGE A;  3UF4 A;  4JJB A;  2VWF A;  1AZE A;  3I35 A;  5HKC A;  2AKL A;  2E10 A;  4HKE A;  1OZ3 A;  4AFS C;  3P8D A;  2JMC A;  4A54 A;  2VKN A;  2LQN A;  5CIU A;  5D6Y A;  2CS7 A;  3CME Q;  2EVR A;  1ABO A;  2HZY A;  3JCM g;  3DLM A;  2CSI A;  2DL4 A;  1I1J A;  4RTX A;  1A0N B;  4LUE A;  1BI2 A;  3PMT A;  3CD6 A;  4CC2 A;  1UUE A;  1M3B A;  4PJM A;  5FU6 B;  4M75 B;  3CCQ A;  4KGV B;  3G71 A;  4PLL A;  1K76 A;  4WTO B;  1RAF B;  2HQH A;  2LCC A;  1AT1 B;  2KYB A;  2DNU A;  1Q81 U;  1NG2 A;  4OMN A;  3QZ9 B;  2CZ1 B;  1TTH B;  2OTJ Q;  3QWY A;  1VQ5 Q;  2YRC A;  1RI9 A;  1WHG A;  1BIA A;  2NUT A;  3M59 A;  5DM7 R;  2EYW A;  1JO8 A;  4JS5 A;  3V7R A;  2X4Y A;  2J06 A;  3EG1 A;  5KE3 A;  4LUD A;  1YIJ T;  4BE0 A;  2ZCF B;  3ZFJ A;  1IRE B;  2DA9 A;  2ZGW A;  1VQ4 A;  3FJP A;  1WHH A;  4FYX B;  3QPH A;  5LJ5 f;  3ME9 A;  1YJW Q;  3VS7 A;  2ED0 A;  4BUG A;  1OX8 A;  1K9M U;  1BIB A;  5AT1 B;  1YJN A;  1AEY A;  1RAC B;  3EFS A;  1OEB A;  1WFW A;  4J83 A;  1M2V B;  1E7O A;  3CBM A;  1QVF P;  2QGG A;  3GPL A;  4D8K A;  2D0N A;  3WXM B;  4A4F A;  4O5V A;  4MDW A;  1FMK A;  1HD3 A;  2EBP A;  5GAM h;  4EMK C;  3V8K A;  2KMT A;  1IO6 A;  3QYG B;  5FU6 C;  1YJN Q;  3CXC S;  3KBG A;  3RKX A;  2A08 A;  2D1X A;  2HMA A;  1OX9 A;  3CCS T;  4M7D C;  2RNA A;  2JT4 A;  1YCY A;  1NEG A;  4LDY A;  1FX7 A;  2RJD A;  5IXF A;  1XQH A;  3CEY A;  2O4X B;  1QVF S;  1JRI A;  2M1H A;  4EMK B;  4BD3 A;  3R6N A;  3X20 B;  1I4K 1;  2YLC A;  3ZBD A;  1QVP A;  1Y07 A;  2OTL Q;  2YRV A;  2OTL T;  1VQK Q;  1MMN A;  2EIF A;  2MK5 A;  2KXD A;  4C8Q G;  3NGP A;  1LPL A;  2K3Y A;  4M77 A;  5D6W A;  1QKX A;  3CC4 T;  2KGT A;  3A8G B;  4NS5 A;  1Z9Q A;  2QTV A;  1VQ7 T;  2EWN A;  4FYW B;  2OX7 A;  5KE2 A;  1FWZ A;  1UJ0 A;  4M78 E;  4P5N A;  2JS2 A;  2PQW A;  4JLI A;  1VQ9 Q;  5FW9 A;  3G71 Q;  1Q82 U;  3EGU A;  1YP5 A;  4M7A G;  1D0Y A;  3PIO A;  1JU5 C;  3CC7 Q;  4M7A C;  5GAN 5;  4BB7 A;  4PFO A;  4DQ2 A;  1QVF A;  4GY5 A;  1PM3 A;  3CCL T;  2MF2 A;  1M90 U;  4IUP A;  1D1B A;  1MGQ A;  4KGX B;  3CME T;  4Z89 A;  1WJQ A;  4C0D C;  1PSE A;  4XTU A;  2K3B A;  1J3T A;  2JZ2 A;  3A8M B;  2RK1 A;  1UEC A;  4Y91 A;  1UE9 A;  2PVD B;  2VYT A;  2R58 A;  3GIB A;  2DVJ A;  3QKJ A;  3FDR A;  2OI3 A;  1BI3 A;  4QVC A;  3AHU A;  3X28 B;  3JB9 G;  4C5I A;  2HD0 A;  2HCK A;  5CQY A;  5C6S A;  4BI3 A;  1D3B A;  3GBQ A;  2B86 A;  3VRZ A;  4FW2 A;  3OYE A;  1P92 A;  5FRN A;  1I8F A;  4RTV A;  1RAA B;  3OYA A;  2XMF A;  1X6G A;  1N9R A;  2HQX A;  3CCU A;  1VQL A;  4XU1 A;  3OYJ A;  3CCL A;  4E7K A;  2LT4 A;  1WQ7 A;  1B7T A;  2EKH A;  4AG2 C;  3A5Z B;  3GNG A;  4PJN A;  2ZPE B;  4JPB W;  2YWW A;  4M77 C;  3QZ5 B;  4BE2 A;  2CH4 A;  3MPU B;  2YSQ A;  1VYV A;  3UPU A;  3AT1 B;  1TUC A;  3HFO A;  5A0D A;  2QDY B;  3OYM A;  1ZUK A;  3BDU A;  5CKF A;  1OOT A;  1BYM A;  3TQ7 P;  4HCB A;  4M7A A;  1O9S A;  3VJP A;  3DB4 A;  1YJW A;  5GJV B;  4M7D G;  2P4T A;  3QSU A;  5FRO A;  2NUZ A;  1UGR B;  4FL6 A;  5FLX E;  4M77 E;  2MPX C;  1WJR A;  2K57 A;  3CXC A;  3JB9 J;  2JVV A;  1YFN A;  2LQK A;  4OB0 B;  2HKQ B;  2VUB A;  4QQ6 A;  1HJD A;  1YJ9 Q;  2M9U A;  2Z0W A;  1D3B B;  1YI2 T;  5I11 A;  2YDL A;  2AIR B;  2GGR A;  3QJ6 A;  4HA8 A;  2AZS A;  1VQ7 A;  4TVR A;  4PLI A;  1M30 A;  3JB9 I;  4C5E A;  3OA6 A;  2RI5 A;  2XK0 A;  3G4S Q;  3M57 A;  4WCI A;  4EIK A;  3INZ A;  1LVK A;  5GAM e;  4UC4 A;  2M16 A;  3I56 A;  3G6E A;  2QXF A;  5FU7 C;  1OZ2 A;  2YHT A;  1KHC A;  1M3C A;  2RQU A;  4DBQ A;  2B8A A;  2DIL A;  1YI2 Q;  2FPF A;  2L3S A;  3JRZ A;  1AHJ B;  2DJZ A;  2LC4 A;  2KI7 A;  2PUO B;  2ESW A;  1UDL A;  3A1P A;  3EGX B;  2COY A;  4J9E A;  1H3H A;  1MMA A;  1UTI A;  3NFC A;  3CCS A;  3DLL A;  4JUV A;  3H0H A;  3OYC A;  4M75 D;  1M5Q 1;  2PVG B;  1K0S A;  5GAO r;  1XOV A;  3M4Y A;  2EJG A;  1GCQ C;  5GMK i;  4XTX A;  3VV0 A;  3VS1 A;  3A8L B;  5EC7 A;  2EYQ A;  3S6W A;  1D1A A;  3A8H B;  1YWP A;  2GFA A;  2FB7 A;  2P4R A;  1E6H A;  1UHF A;  4C8Q A;  3JB9 D;  2RM4 A;  1IXD A;  4XQ3 A;  4LD9 K;  2V8K A;  1FMV A;  2LTO A;  2DXT A;  1NJI R;  3CD6 T;  1NM7 A;  5L23 A;  1KK7 A;  4J6Y A;  2P0P A;  4BY6 C;  1O75 A;  2X35 A;  3MP1 A;  1W4S A;  3NPF A;  2CP7 A;  3QWX X;  3OW2 P;  2DD4 A;  4FCY A;  3M58 A;  2LZ6 B;  4F7U F;  2DL8 A;  2DEU A;  4B9W A;  2YUN A;  2K6D A;  1LNX A;  2OAU A;  2F5K A;  4M77 D;  2K5F A;  2X4W A;  2PZ1 A;  4M7D B;  3EG0 A;  3CQT A;  3MCA B;  4O6J A;  4HCK A;  2CZ6 B;  2RHY A;  2DEQ A;  1GXI E;  1WIE A;  3ER0 A;  1MMD A;  4MML A;  1MUZ A;  4HVW A;  2L5Q A;  2A3L A;  5GAO l;  2C0I A;  4FT4 A;  1VA7 A;  1Q86 U;  1OYX A;  3A98 A;  2XIC A;  5CO7 A;  4KUI A;  3OYF A;  1RAB B;  1WHL A;  2HKN A;  1VQK A;  2JS0 A;  4J6X A;  3EFR A;  1KC8 U;  1KQ1 A;  3NTK A;  2R5M A;  1W70 A;  5GAM f;  3EGD B;  1JEG A;  2KSS A;  4IUV A;  5LJ5 d;  5M9O A;  4M78 B;  2ZPI B;  2HBW A;  3H0F A;  1SF9 A;  5CVI A;  4EDU A;  5D6X A;  3O8V A;  3JCM X;  5GAN h;  2O31 A;  3S3O A;  2IVW A; 
#chains in the Genus database with same CATH homology
 1JQQ A;  3THK A;  1K76 A;  2DM1 A;  4J9B A;  2PTK A;  2ENM A;  2KYB A;  1OV3 A;  2DNU A;  1NG2 A;  4OMN A;  2K7A A;  2J6F A;  2L0A A;  1ZBJ A;  3QWY A;  3PVQ A;  2LJ1 A;  3M0P A;  1RI9 A;  2DL5 A;  4CC4 B;  3TSW A;  3SHW A;  2GBQ A;  2EYW A;  1JO8 A;  4IIM A;  2LJ3 A;  2GQI A;  2J06 A;  1H92 A;  1S1N A;  3EG1 A;  4LUD A;  4RTY A;  2MOX A;  2DA9 A;  1BU1 A;  2ED1 A;  2HSP A;  2JMA A;  2EPD A;  2HEQ A;  5GJW B;  1NYF A;  1AD5 A;  1PNJ A;  3VS7 A;  2DF6 A;  2ED0 A;  2HDA A;  4GLM A;  1AEY A;  1UHC A;  1PKS A;  1WYX A;  2DL3 A;  5ECA A;  1OEB A;  1WFW A;  2VVK A;  1E7O A;  4HVU A;  2PNI A;  2RF0 A;  3REB B;  2DX1 A;  1X43 A;  2DMO A;  5IXB A;  4D8K A;  2D0N A;  4K11 A;  4RTZ A;  2W10 A;  1GL5 A;  2BZ8 A;  1FYN A;  1I07 A;  2AK5 A;  1FMK A;  1HD3 A;  2EBP A;  1SRL A;  2EYX A;  1IO6 A;  1NLP C;  2J05 A;  2FEI A;  1U06 A;  1AVZ C;  2A36 A;  2A08 A;  2EYZ A;  2YUQ A;  2D1X A;  3EG3 A;  1QWE A;  2BZY A;  3VS6 A;  1NLO C;  2RNA A;  1ZUU A;  2O2O A;  4OMQ A;  2JT4 A;  1K9A A;  2OAW A;  1ABQ A;  1NEG A;  1SSH A;  5IXF A;  1E6G A;  2FG0 A;  3UA6 A;  1GFC A;  4FSS A;  2KYM A;  4LE9 A;  3R6N A;  1JXM A;  3RNJ A;  2ROL A;  1KJW A;  1T0H A;  1AWO A;  3TVT A;  1SHF A;  1YCS B;  1YNZ A;  3FJ5 A;  3UAT A;  1NEB A;  2A37 A;  3NMZ C;  3I9Q A;  4GBQ A;  3I5S A;  2KXD A;  2KRO A;  3NGP A;  4OMO A;  1QKX A;  2O88 A;  1CKA A;  1UJY A;  1AOJ A;  2ECZ A;  2KGT A;  4J9G A;  1Z9Q A;  1WX6 A;  2KRM A;  1VYT A;  2QDL A;  3KFV A;  2MIO A;  2JTE A;  1UJ0 A;  1BK2 A;  2OJ2 A;  5IHN A;  2JS2 A;  2LX7 A;  2V1Q A;  5FW9 A;  2KE9 A;  3I5R A;  2L2P A;  4OMM A;  3EGU A;  1Y0M A;  1YP5 A;  1OPK A;  1GRI A;  1JU5 C;  3NHN A;  1EFN A;  4DEY A;  2FO0 A;  3O5Z A;  1B07 A;  1AWJ A;  2G6F X;  1V1C A;  2KT8 A;  2CSQ A;  2DJQ A;  5IH2 A;  4Z89 A;  1T3S A;  2AKK A;  1J3T A;  2K3B A;  1UEC A;  1UE9 A;  2LQW A;  2DVJ A;  1I0C A;  1GBR A;  1GFD A;  2OI3 A;  4IIO A;  1ZLM A;  2GNC A;  4Z88 A;  1ZUY A;  2IIM A;  2ROT A;  2RQV A;  4DEX A;  1YN8 A;  2GTO A;  2HCK A;  2RN8 A;  3ULR B;  1WXU A;  2KRN A;  3GBQ A;  2B86 A;  2DBK A;  3VRZ A;  1QCF A;  5HCK A;  4RTV A;  2C0O A;  2XMF A;  3EHR A;  1X6G A;  1KIK A;  2CT3 A;  2KXC A;  2LJ0 A;  1MV0 B;  1W6X A;  3VS3 A;  4J9H A;  4CC7 A;  2EKH A;  3H41 A;  1GCQ A;  4QT7 A;  4RTT A;  4AG2 C;  2H8H A;  3EHQ A;  1RLP C;  2EYY A;  4Y92 A;  2X3X D;  4HVV A;  4J9D A;  2KT1 A;  3UA7 A;  1SHG A;  4JPB W;  3VS4 A;  3U23 A;  2YUP A;  1UFF A;  2KRS A;  2J6O A;  2CH4 A;  4M4Z A;  4J9F A;  2KNB B;  1VYU A;  2GTJ A;  2YSQ A;  1UGV A;  1VYV A;  4LNP A;  1TUC A;  2X3W D;  3M0Q A;  2CUB A;  2EW3 A;  1ZUK A;  1JXO A;  3M0S A;  1OOT A;  2D8H A;  1SPK A;  2RQR A;  2M0Y A;  5GJV B;  2O9V A;  4LN2 A;  4X1V A;  2YUO A;  2NUZ A;  2K79 A;  2J6K A;  2FPD A;  2KEA A;  1QLY A;  1K0X A;  2W0Z A;  4JZ4 A;  2I0N A;  2L3P A;  1H8K A;  3IQL A;  2FRW A;  1HJD A;  1X2Q A;  1KSW A;  1Z9Z A;  3SEM A;  5FWB A;  1K1Z A;  4A63 B;  1GBQ A;  2FPE A;  1X6B A;  5IHI A;  2YDL A;  5I11 A;  1X69 A;  5FWC A;  2GGR A;  1PRL C;  3EG2 A;  1TG0 A;  2AZS A;  1QWF A;  1M30 A;  3RBB B;  1UG1 A;  1PKT A;  1LCK A;  1KFZ A;  1SRM A;  1X27 A;  3ZL7 C;  1BBZ A;  1NYG A;  4JJC A;  1T3L A;  4WCI A;  4EIK A;  4D8D A;  4ORZ A;  2EGE A;  2SEM A;  2AZV A;  4HXJ A;  3VS2 A;  2LMJ A;  2DL7 A;  4E6R A;  2L3Q A;  2RQT A;  3PVL A;  1M3C A;  1Y57 A;  2RQU A;  4ZNX A;  2DE0 X;  2K2M A;  2DIL A;  1AZG B;  2FPF A;  2L3S A;  1YWO A;  2O9S A;  2CH4 W;  2ESW A;  1UDL A;  4J9E A;  1H3H A;  4R0K A;  2NWM A;  2CT4 A;  1UTI A;  1ARK A;  1ZSG A;  2F2V A;  2LNH B;  1U5S A;  3H0H A;  1K0S A;  1QKW A;  1PHT A;  1XOV A;  4F14 A;  2YT6 A;  5I22 A;  1W1F A;  2E5K A;  1PWT A;  4OMP A;  1GCQ C;  2M51 A;  4ESR A;  2JW4 A;  2DLP A;  2RQW A;  3VS1 A;  1SEM A;  5EC7 A;  4AFQ C;  4RTW A;  1YWP A;  4CC3 A;  1G2B A;  1CKB A;  2P4R A;  1E6H A;  1UHF A;  1X2K A;  2A28 A;  3LH5 A;  2RPN A;  2C0T A;  1M8M A;  1AWX A;  2F2X A;  3M0U A;  1M3A A;  1AWW A;  1NM7 A;  1ZX6 A;  1G83 A;  2BTT A;  2CUD A;  5L23 A;  1WA7 A;  1B3Q A;  2JM9 A;  4AFZ C;  3VS5 A;  2DRM A;  3VRY A;  2EGA A;  2RMO A;  2DBM A;  1N5Z A;  1WI7 A;  3NPF A;  1WLP B;  3QWX X;  2CDT A;  2K9G A;  2FRY A;  5IHK A;  1PRM C;  2LZ6 B;  2LCS A;  3TSZ A;  2JXB A;  2EGC A;  2DL8 A;  1OPL A;  1CSK A;  4JZ3 A;  2KR3 A;  1MV3 A;  2DRK A;  2K6D A;  2YUN A;  4AG1 C;  3JV3 A;  1GCP A;  4RTU A;  4RUG A;  3PE0 A;  2PZ1 A;  3REA B;  1U3O A;  2LP5 A;  2MCN A;  3EG0 A;  1WXT A;  3CQT A;  4F16 A;  4HCK A;  4Z8A A;  4AFU C;  2KBT A;  1WDX A;  2EQI A;  4J9I A;  1WIE A;  4J9C A;  2SRC A;  2CRE A;  3H0I A;  4F17 A;  1MUZ A;  4HVW A;  2C0I A;  3UF4 A;  4JJB A;  2VWF A;  2JM8 A;  1AZE A;  1HSQ A;  1VA7 A;  2AKL A;  3I35 A;  3VS0 A;  3A98 A;  4AFS C;  4JJD A;  2BZX A;  1RUW A;  2JMC A;  2V1R A;  2JS0 A;  1WXB A;  2VKN A;  2LQN A;  1K4U S;  1W70 A;  1T0J A;  1JEG A;  4KRT A;  2ABL A;  3M0T A;  2EVR A;  3M0R A;  1ABO A;  2CSI A;  2DL4 A;  1I1J A;  4RTX A;  2HBW A;  1A0N B;  2DYB A;  4LUE A;  3H0F A;  1TUD A;  2D8J A;  4OML A;  1BB9 A;  4CC2 A;  1M27 C;  1RLQ C;  1UUE A;  1M3B A;  2F2W A;  2J7I A;  3C0C A;  2O31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...