3REAB

Hiv-1 nef protein in complex with engineered hck-sh3 domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
EDIIVVALYDYVSWSPDDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein Nef
publication title Molecular design, functional characterization and structural basis of a protein inhibitor against the HIV-1 pathogenicity factor Nef.
pubmed doi rcsb
source organism Hiv-1 m:b_arv2/sf2
molecule tags Protein binding
total genus 11
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3reaB00
1H3HA 2QDLA 1G2BA 2K2MA 2CSQA 2FPDA 3VS3A 1QCFA 1SRMA 1NLOC 1YWOA 1NEBA 5FWBA 1PRMC 2KBTA 1JXOA 2DL4A 3EGUA 1J3TA 2DF6A 1X6GA 1UDLA 1M27C 3VRZA 2V1RA 1AWWA 2DX1A 5GJVB 2FEIA 4JZ3A 4F16A 1ZUKA 1PNJA 1MV3A 4J9BA 3C0CA 2DA9A 4HVWA 4LUDA 4IIMA 3VS7A 1Y57A 2RQUA 1PRLC 2RMOA 3GBQA 1A0NB 1WX6A 2ABLA 4JJBA 3EG3A 1FMKA 1H8KA 2AKKA 1OEBA 1Z9ZA 3RNJA 4Z89A 2F2XA 3M0SA 2L3SA 1S1NA 1BB9A 1ZUYA 1YNZA 3EHRA 1OV3A 2FO0A 2J6FA 1VYTA 1XOVA 1Y0MA 2ENMA 2KT1A 2O9VA 4JJCA 2EGCA 2DRMA 2EYYA 2V1QA 5IHNA 1OPLA 1MV0B 2J6OA 1VA7A 3PE0A 2DM1A 4KRTA 1K9AA 2I0NA 2C0IA 2K7AA 4LUEA 1FYNA 1YWPA 1T3LA 3U23A 4CC2A 3R6NA 1ARKA 4RTXA 3IQLA 4HCKA 4J9GA 1KSWA 3TVTA 2BZYA 1K76A 2L2PA 1X69A 1N5ZA 1K0XA 2GTJA 4HXJA 2K6DA 2GQIA 2DL5A 4Z88A 1ZX6A 1NEGA 1PWTA 1TUDA 2F2WA 1E6GA 4CC4B 2G6FX 2FRYA 2ED0A 2D1XA 1NYGA 2EGEA 2A37A 5I11A 4AFQC 2ECZA 4JZ4A 1M8MA 4OMMA 2YT6A 2GTOA 1ZLMA 1SHGA 3A98A 3H41A 1WA7A 1YN8A 2YUNA 5FWCA 2DBMA 1UJ0A 2VKNA 1WDXA 4DEYA 2YUOA 2H8HA 3RBBB 1Z9QA 3EHQA 1GL5A 1MUZA 1NLPC 2RPNA 1RI9A 1X6BA 4AFSC 2BZXA 2L0AA 2A36A 2OI3A 3EG0A 2KYBA 2O31A 2DMOA 1CKBA 1GCQA 2D0NA 2DL3A 1WXTA 3M0UA 3NGPA 4X1VA 2JTEA 1UHCA 3QWXX 1GCPA 1BK2A 5IHIA 2RQWA 2RQTA 3I9QA 4A63B 4AFZC 5ECAA 3PVQA 4J9DA 2LQNA 1GBRA 4RUGA 5EC7A 3VS1A 4RTVA 3UF4A 1PKSA 2CREA 3UA7A 1M3AA 2GNCA 4D8KA 4M4ZA 3VS6A 2FG0A 2ESWA 2LQWA 1QWFA 1QKWA 4IIOA 1RLQC 4J9IA 2JS0A 4OMLA 2YDLA 1AEYA 1HD3A 1YCSB 1LCKA 2KXDA 2KXCA 2X3WD 3VS4A 2DVJA 2HEQA 1BU1A 2B86A 3UA6A 2HCKA 3ULRB 2HSPA 2HDAA 4J9FA 4OMPA 1KIKA 4D8DA 1W70A 2LJ3A 1K0SA 1I0CA 1KJWA 1ABQA 2KRMA 2DNUA 2RQRA 4LNPA 2EKHA 4FSSA 1TUCA 2JM8A 2P4RA 1M3BA 5IHKA 2DL8A 3M0QA 2FRWA 2CT3A 1NG2A 2EYWA 2DRKA 2J6KA 4J9HA 4F14A 2DLPA 3FJ5A 2GGRA 1PHTA 2KE9A 2RF0A 1K4US 2CH4W 1UTIA 2BZ8A 3NHNA 2JMCA 1TG0A 4OMOA 4RTWA 4WCIA 1UECA 4EIKA 1UG1A 2CUDA 1QLYA 2PNIA 2LX7A 3EG1A 5HCKA 1AZGB 1WXBA 2XMFA 1VYUA 3VS5A 2FPEA 2NWMA 2KYMA 1WIEA 4QT7A 2O88A 4OMNA 2NUZA 2X3XD 1SEMA 1UJYA 1UUEA 1KFZA 2D8JA 1G83A 2SRCA 4HVVA 4OMQA 1B3QA 2JMAA 1WXUA 2O2OA 2JW4A 1IO6A 3ZL7C 1UFFA 2L3PA 4RTUA 4ZNXA 1WLPB 2DJQA 2EYZA 4ESRA 1BBZA 1SPKA 5IXBA 2KT8A 1HJDA 1NM7A 5IXFA 5L23A 2D8HA 2KR3A 2KRSA 1U06A 1UGVA 2YSQA 1H92A 1U3OA 3PVLA 2MIOA 3VRYA 1AZEA 1JXMA 1AWXA 2DL7A 3I35A 1SHFA 2MCNA 1QWEA 3JV3A 2M0YA 1T3SA 2VWFA 2KNBB 1VYVA 3REBB 2AKLA 2DILA 1AWOA 1JEGA 3M0PA 2BTTA 1W6XA 4J9CA 5IH2A 1HSQA 2ROTA 2RNAA 2HBWA 2PTKA 2EYXA 2K9GA 3M0TA 3VS0A 2J05A 1YP5A 2OAWA 2GBQA 2VVKA 1ZUUA 2JXBA 2DE0X 1OOTA 2LNHB 2CT4A 2AZSA 2KGTA 3NMZC 5GJWB 2AK5A 1U5SA 1M30A 1E6HA 1X2KA 2EGAA 4J9EA 1RLPC 1SRLA 5FW9A 3H0FA 1T0HA 2RN8A 2JS2A 3NPFA 1AWJA 4CC7A 2K79A 4Z8AA 1M3CA 1WYXA 3I5RA 2OJ2A 4DEXA 4RTTA 4R0KA 2W0ZA 1T0JA 2DYBA 2YUPA 3TSWA 2JM9A 2JT4A 1ZSGA 1AOJA 4LE9A 4RTZA 2SEMA 2CUBA 3UATA 1GBQA 1GFCA 1JQQA 2J06A 4E6RA 1GCQC 3KFVA 1QKXA 2YUQA 3SEMA 3REAB 1I1JA 4GBQA 2FPFA 2LZ6B 3CQTA 3O5ZA 2KROA 1ABOA 2L3QA 2K3BA 2C0OA 4Y92A 2CSIA 2W10A 3M0RA 1B07A 1AD5A 2CDTA 1NYFA 1JO8A 2IIMA 4CC3A 2F2VA 2PZ1A 3SHWA 4ORZA 4RTYA 1X2QA 2DBKA 2LJ1A 3THKA 2RQVA 2EW3A 1SSHA 2M51A 4AFUC 1PKTA 2LJ0A 2ED1A 1GRIA 2A28A 1OPKA 1V1CA 3H0IA 4AG1C 4LN2A 2EPDA 2EBPA 2C0TA 2LP5A 3H0HA 2LMJA 3LH5A 1UHFA 1ZBJA 1EFNA 4K11A 3TSZA 4HVUA 1WI7A 3VS2A 3I5SA 1AVZC 4GLMA 4JPBW 2LCSA 1W1FA 1JU5C 1GFDA 2AZVA 1K1ZA 2O9SA 4AG2C 1UE9A 2J7IA 2KRNA 1X43A 2A08A 2CH4A 1CKAA 4F17A 2KEAA 2EQIA 2ROLA 3EG2A 3QWYA 2MOXA 1E7OA 1CSKA 5I22A 1X27A 1WFWA 4JJDA 2E5KA 1RUWA 2EVRA 1I07A
chains in the Genus database with same CATH superfamily
3AT1B 3OYBA 1MMGA 2K2MA 4II1A 2EJFA 1NLOC 4M7AF 4FW1A 2FZGB 2KBTA 1I5OB 5GAOp 2DL4A 2OTJT 4QVCA 3EGUA 4XU1A 2MF2A 1J3TA 2DETA 1M27C 2V1RA 2CP6A 4LDVA 1YI2Q 2RO0A 5GJVB 4PLIA 4JZ3A 3V7SA 4C5EA 4F16A 4JDSA 4KT0E 5D7UA 4LUDA 1ZSZB 4QQDA 4C5HA 5LJ5g 2DXCA 2RQUA 3OBYA 3S3MA 1D0XA 2HQEA 2KSSA 1D1BA 2JOYA 4HA8A 2QA4T 1TH7A 2AKKA 2LCCA 1OEBA 2F2XA 3M0SA 4X34A 4M7AD 1YNZA 4JRKA 2FO0A 5KE2A 1VYTA 4MZMA 4JJCA 1M2VB 2DAQA 2J6OA 2HSEB 5KYWB 3SWNB 2DM1A 2DPPB 2K7AA 3UT1A 2C0IA 3GOXA 2CZ7B 4RTXA 4J8OA 2L89A 3TVTA 1EX4A 3JCMV 1I8FA 1K76A 5KYUA 3CCVQ 1X69A 1N5ZA 3JRZA 3OS2A 4IUTA 2GQIA 4F7UB 3CBOA 1AT1B 1NEGA 1PWTA 4ZTJA 2F2WA 2DERA 1TU0B 4PNOA 3CBPA 1NYGA 2EGEA 2QQSA 3OYEA 1K9MR 5I21A 4BI3A 3L2RA 1YBYA 1HXDA 2ECZA 4JZ4A 3CC4T 4OMMA 1M1KR 2Y4XA 1K9MU 4M77D 1JBMA 3OYCA 5J3BA 3JCMb 2NUPB 2BE7D 1UJ0A 2DBMA 2VKNA 1M1KU 4DEYA 4M77E 3RBBB 3QHSA 4BE2A 2X4YA 2MAMA 4D6WA 1MUZA 4ZN3A 1NPRA 4LXCA 4LDUA 2KYBA 1G3WA 3LX7A 3UPUA 1CKBA 3QKJA 1GCQA 2CP7A 1Q86R 3MEUA 2RQWA 4PJLA 4QQGA 3I55T 4RUGA 3UF4A 3UA7A 5KYYA 3DLLA 2OTLA 4D8KA 2ESWA 2LQWA 8ATCB 1QWFA 3GLXA 1VQKQ 4F7UG 3RKYA 4GY5A 1Q81C 1HD3A 1QVPA 4N0AA 3PIOA 2X3WD 1BU1A 2B86A 3ULRB 4M78F 4J9FA 1MGQA 4A4HA 2OTJQ 2LJ3A 2KI7A 1N9SA 1VQ5A 1U1SA 3L2QA 2EKHA 4FSSA 2JM8A 4M7DE 2HL3A 3RMSA 2DL8A 1Y7XA 2F69A 4FYWB 2EYWA 2QA4Q 2RI5A 5C0MA 4PJOC 1S72T 2DLPA 4FIBA 3FJ5A 3CC2A 2BUDA 5GAOn 3OSVA 2VUBA 3CMAT 4M78D 2QK0A 2GFUA 2LT4A 1UTIA 2BZ8A 2JMCA 4XAXB 1VQMQ 2X4XA 4WCIA 1UECA 4J6YA 1YJWQ 5CKHA 1EIFA 5GMKl 5HCKA 3FDRA 3CXCA 3TEEA 2F1LA 4PFOA 2FPEA 4QT7A 1SEMA 2GF7A 2QI2A 1YJNT 1G83A 4N4IA 3J81E 2VXEA 3OW2P 4FT2A 2JNGA 1OZ2A 3MP8A 3SB2A 1Y96A 2DVEA 4OMQA 2EQJA 1WXUA 2O2OA 2YRCA 1YITT 1N9RA 4C92A 2E12A 1WLPB 3L2UA 4JRIA 2RHYA 2DK3A 3UDCA 1SPKA 1SG5A 2KT8A 1HJDA 1NM7A 3G6EA 5GAN7 1ZQ1A 2KRSA 1IGQA 2WSCE 1KQSS 1M4ZA 2DZ9A 3PVLA 2YRDA 1HK9A 5FU6B 3OS5A 1M5Q1 2MCNA 3GPLA 4A53A 2QEXT 2QXFA 1IGUA 3X24B 2RHIA 4A4KA 2CP3A 3ZBDA 1FMWA 2KQWA 3FJPA 4J9CA 2ROTA 3O8VA 2HBWA 5DLQE 4J6XA 2EYQA 3I55Q 4OMFB 2OAWA 2V26A 4XTZA 3BY7A 4J7IA 2B8AA 2DE0X 4NS5A 4C8QA 2AZSA 2KMTA 2KDSA 2KGTA 3NMZC 5GJWB 5FU7B 1C6VX 5FW9A 3JB9I 1KC8R 3FLGA 2K79A 5GAN5 4Z8AA 2RJDA 1WQ7A 3P8DA 1I81A 1B7TA 4EMKB 3L2WA 1KC8U 3HHTB 1T0JA 2JM9A 2AHJB 2IVWA 4C92C 3L2ZA 3EH2A 1FX7A 4E7IA 2J06A 5GAOl 4E6RA 2HBPA 3KFVA 4M75C 3QBYA 4OB0B 2YUQA 3SEMA 3REAB 2DXBA 4ZN1A 2LQKA 1Y71A 4M7DA 4M7AB 3HRTA 2LCLA 3PT9A 2K3BA 4IUQA 3QDFA 3TQ7P 2HAXA 5LJ3g 2DTHA 2E6ZA 3SHWA 1Q82R 1XQHA 2XDPA 4Z02A 2LJ1A 2RM4A 1U1TA 3CMAQ 3THKA 2ZPBB 3HKSA 1SSHA 3OYFA 4BY6B 1PKTA 1ZBXA 1YIJT 2LJ0A 3CCUT 3CC4A 3CCST 2XG8D 1V1CA 3H0IA 3M53A 4AG1C 2M16A 3JCMe 2LP5A 3H0HA 4FU6A 1VQ8Q 1LJOA 4EDUA 3S6WA 1UHFA 3TSZA 1OI1A 1RAAB 4E7LA 1YJNQ 1MNEA 5I2MA 2EJ9A 2KAFA 4M77B 4XU0A 3ME9A 1X01A 1UE9A 2MWPA 2KRNA 5D6YA 4FW2A 2A08A 2JJ9A 5CVIA 5GAMj 1CKAA 5KYNA 2EQIA 4NL3A 2K57A 1VQNA 4JJDA 3VUBA 3A8GB 1I07A 3RIRA 1KK7A 4JS4A 1WPYA 2CSQA 2FPDA 3LLRA 1QCFA 3VS3A 1QW1A 2XU8A 1NEBA 4FSXA 1VQLT 2CYZB 1VQ6A 2FL7A 4IUUA 4KULA 1JXOA 3L1AA 3LWIA 2PVGB 4IKFA 2QEXQ 3OB9A 2R58A 2LVMA 4B9XA 2DF6A 1FMVA 3M4YA 1AWWA 2DX1A 2CP2A 2FEIA 1ZSZA 1OQKA 1ZUKA 3NTHA 4Q5WA 3PNWC 4J9BA 5IT9E 3C0CA 2DA9A 2JUFA 4IIMA 3NTKA 4XTWA 1PRLC 1KG1A 3L2VA 2ABLA 3QO3A 3EG3A 1FMKA 1D1AA 3CMET 3FB9A 2ZGWA 4C92G 2RHUA 3GNGA 1BB9A 4BI4A 1XNIA 2KY9A 4R56A 3CD6A 1ZUYA 3EHRA 1OV3A 3RR6A 2J6FA 1MMDA 1M2VA 1ZHIA 4J5YA 1YJ9T 4QKUA 3HTRA 2XIDA 5KYWA 2DRMA 2EYYA 2V1QA 3SWNA 3FC3A 4JRQA 1NPPA 3PMIA 1MV0B 1K9MC 1S72A 1D0YA 3VJPA 2A7YA 4LUEA 5KYXB 1M1KC 1LOJA 2FYKA 1T3LA 4PJOF 3CPWA 2XHCA 3OYYA 3IQLA 1QVGP 4HCKA 2LNVA 3UWNA 2BZYA 3WXMB 2L2PA 3PMTA 5CQYA 1WGSA 2Z0WA 3CC7T 3NFCA 4CC4B 2D1XA 2HKQB 1IHWA 3LYIA 4M78B 3A8LB 2A37A 5A2QE 1PM3A 1KQSA 1R0CB 5I11A 3OS1A 2ZPGB 4HCCA 1M8MA 3M9QA 4L59A 2YT6A 4C8QG 3CCQQ 2NUPA 2PVDB 4DBFA 1Q86C 1WA7A 1YN8A 1O75A 3I56A 4OB1B 5FWCA 1WDXA 2VV5A 2HQXA 3SD4A 1ZSZC 5LJ3e 1YITA 4PJOD 5GAN2 1GL5A 3QDRB 1NLPC 4J6WA 3CCUQ 1YIJQ 1D09B 2NYSA 3CCSQ 3WVDB 2BZXA 2CS7A 2DIGA 2OI3A 3EG0A 2P84A 4E7SA 2DMOA 2DL3A 3HFNA 2QTVA 3JCMd 1BK2A 2P0KA 1BI2A 1RI0A 2RQTA 3JCMc 4M7DG 2L3RA 5EC7A 1TXQA 3LH0A 1LVKA 2CREA 4OGCA 1BKBA 2QGFB 2VASA 4DBRA 2CKKA 2FG0A 3QIIA 3QPHA 4IIOA 4L6V5 4AMCA 5LJ5j 5GANg 2HL5C 2L8DA 3HSBA 2EWNA 4XTXA 2E6NA 1AEYA 4LDWA 1GXIE 5KCHA 3OYGA 2XDBA 1VQLQ 2WACA 2DVJA 1QCOA 2E5QA 5GAN3 2X4JA 1IB8A 5GAMe 4E2FB 4WTOB 4XTUA 1K0SA 1I0CA 4E7HA 1ABQA 1RAHB 1W2BP 3V8JA 3DB4A 2RQRA 4LNPA 4M7AE 3VYHB 3CCEA 2V8IA 3CCLA 1VQMT 3VV0A 5IHKA 1VQ9A 4LDXA 1YJWT 2CT3A 1VQPA 2DRKA 3RUXA 2J6KA 3VU3C 4ANJA 3CMEQ 4C92F 3GP8A 2DXTA 3MHXA 2WSEE 3C4SA 1PHTA 3JCMh 1K4US 2D6FA 2OX7A 2AIRB 3CCRQ 3RKWA 1U8RA 4M75F 4LDYA 3HFOA 3HPWA 3NHNA 1YJ9Q 1TG0A 4IURA 2CZ1B 4PFZA 3MEAA 2RH2A 1QVFS 2EQUA 3V8LA 2VYTA 2YRVA 1IZ6A 1OU9A 3CPFA 4C0ZA 2A0FB 1UEBA 2NUZA 4OMNA 1UJYA 1VUBA 2LRQA 1W2BA 4C5IA 1D1CA 3JAME 3CC7Q 1N8RR 3ZEHA 3BDLA 2SRCA 4HVVA 5GAN4 2FVUA 2RHXA 2JW4A 1IO6A 2E1HA 1N8RU 4M75D 2RHZA 1BCOA 2DJQA 1W4SA 2QQ9A 4C8QF 1BBZA 3MKDA 3SFMA 4O5VA 3QXEB 5IXFA 5L23A 2COWA 2KR3A 2EJGA 2MIOA 1Q86U 1TOVA 1RABB 2F5TX 3BFMA 2EIFA 4CRIA 3H8ZA 2IPOB 2DFUA 1IRXA 2KNBB 1VYVA 1YI2A 3JSCA 1KC8C 3JCMf 4JJNK 2AKLA 5GMKe 4ELYC 3M0PA 5IN1A 4F04B 2PVOB 2YLCA 5IH2A 2O4XB 4MZPA 1HSQA 2PTKA 3CCJT 1JB0E 2K9GA 2DTOA 5CKBA 1N27A 3VS0A 1BCMA 1D3BB 2J05A 3CXCP 2QTXA 2VVKA 3E19A 2LNHB 2CT4A 1TTHB 2HZYA 1ACMB 1M30A 3BDUA 3H0FA 4CC7A 4EMKA 4NOYA 3A8OB 3QG1A 2CZ0B 1UGPB 4RKUE 4DEXA 4RTTA 3E2UA 4JS5A 2W0ZA 2YUPA 4OP0A 2JT4A 4BDYA 2QG9B 4PJMA 1BYMA 1Q82C 3E1SA 3CCVA 3EAEA 3EH1A 4HT9A 2CUBA 1BIBA 3G4ST 2LT1A 5GAMd 5LJ5e 4Y28E 1GCQC 3AHUA 3CCMQ 4M7AA 1I1JA 1VQOQ 2LZ6B 2XI9A 3T9NA 4M78E 2DEQA 4JLGA 1QMCA 2L3QA 1VQ7T 3OYKA 2C0OA 2W10A 3MEVA 4MDWA 1NYFA 3VUZA 4JLIA 1QP2A 2IIMA 1H641 4PJNA 1VQ8T 3CC7A 4A4EA 3NTIA 2RQVA 2QQRA 4C0GA 1PSFA 1UGQB 2L5QA 1GRIA 4N0AC 1OPKA 4KBMB 4A54A 4FT4A 2EPDA 2RK2A 4J7FA 2DYIA 3QYHB 4O6JA 2KK4A 1BI3A 1AVZC 4M77A 1W1FA 2VGNA 2DD4A 3OYIA 1K1ZA 3OS0A 2XKOC 2J7IA 2K5FA 2CH4A 4Y91A 3X28B 3MCAB 4F17A 1VQKA 2DO3A 3QJYA 4PJOB 5GAMh 2DXUA 5GAOr 1E7OA 1CSKA 2DKGA 4A4FA 1X27A 4A4GA 1RUWA 1H3HA 2QDLA 1G2BA 2VXFA 3URGA 1YHQQ 3META 1SRMA 1YWOA 2M0OA 1QQJA 1BIAA 1LPLA 2OTJA 4BACA 1MNDA 3A1PA 2GCXA 2E41A 2K2VA 3FIFA 5KCOA 2HNIA 2C06A 3DLMA 2DTIA 5HK0A 4L5GA 4F7UF 4DBHA 4BD3A 5DM7R 3CCJQ 4HVWA 2QA4A 1N6AA 2MI6A 3VS7A 2COYA 1A0NB 1BI1A 2JTMA 4JJBA 3GIBA 1QVGS 5DY9A 3OYDA 3BE3A 3CBMA 1VQMA 2IG0A 2COZA 2ENMA 2ZPHB 2EGCA 3N5BB 1YJWA 4M77C 1LNXA 2JTFA 5LJ3j 2QAZA 5IHNA 1OPLA 5KYXA 3EFOB 4XQ3A 4BDZA 1VA7A 3A8HB 2I0NA 2ZPEB 1NBEB 3QZ9B 3JCMP 1YWPA 3JB9G 3R6NA 1ARKA 3CCQT 3G4SQ 2VB6A 3OY9A 4J9GA 1JJ2S 3H9NA 2GTJA 1Q82U 5LJ5d 2RI2A 4M78A 5KE3A 2G6FX 1D0ZA 2MMPA 1VQ7Q 3H6ZA 1V29B 1TUGB 4C8QC 1ZLMA 3H41A 4LD6A 4OGEA 2YUNA 3RERA 1I4K1 2YUOA 1Z9QA 3RESA 2RPNA 4XTYA 1X6BA 4FM4B 5L8RE 4KGXB 2L0AA 2A36A 1JRIA 2FHDA 2O31A 2ZPFB 3M0UA 3NGPA 3RDVA 4DQ2A 2RJFA 3X26B 1VQ4T 5HKCA 1OZ3A 4M75B 2QYZA 3I55A 2GQVA 4N4GA 5CO7A 4C0DC 3I9QA 4A63B 4XTVA 4AFZC 4M7AG 5ECAA 2HQHA 3PVQA 3C12A 2LQNA 4M7DC 3Q1JA 2MPXC 1PKSA 1WNLA 3CPWP 2XICA 1WZOA 4B6MA 1RAGB 4M4ZA 3VS6A 4YTLA 5C6SA 4KUDK 1QKWA 4VUBA 1RLQC 4J9IA 5LJ5h 5FRMA 5KH6A 4OMLA 2YDLA 4MDXA 4FCYA 2K5LA 2HEQA 1KQSP 4NL2A 2QQBA 2HCKA 3EGXB 2HSPA 2HDAA 4E7JA 2CP5A 1WHGA 1F1BB 3ER0A 4X9DA 2KRMA 2DNUA 2RI3A 3JB9J 3VKIA 3CCRT 2E3HA 2FZCB 2V8JA 1YFNA 2P4RA 1M3BA 6AT1B 3M0QA 2Y90A 4M77G 2FRWA 1FXXA 2NLUA 1RL2A 1PSEA 3MJXA 3CMAA 2EVRA 2I2LA 2KE9A 2X51A 3CC2T 3HL8A 1N8RC 2M9UA 1EZZB 4OMOA 5CKEA 1WJQA 2G3RA 4EIKA 1UG1A 1QLYA 2LX7A 1VQ8A 3EG1A 4GLKA 1AZGB 2F5KA 1M9SA 2QGGA 3JB9F 4PL6A 3D7SB 2XMFA 1HYOA 1OYXA 3MEWA 1YJNA 1M8VA 2VC8A 2O88A 2X3XD 5LJ5f 5GMKj 1UUEA 2E65A 3HP9A 3OYLA 3TU4K 5GMKi 1PG5B 1M90R 1AHJB 3ZL7C 1I5LA 4PJOE 2L3PA 3F70A 2MYSA 3KBGA 1M90U 4HCBA 2EYZA 2NUTB 4ZTFA 4ESRA 2XDDA 2YWWA 2EQKA 2V8KA 1UGVA 2BIVA 2YSQA 4FYYB 1H92A 3CXCS 3G6ET 1U3OA 4IUPA 1AWXA 2Y4YA 3SWNC 2QEXA 2DJZA 1K8AR 2DL7A 1SHFA 1QWEA 2EKOA 5GANj 1TWBA 3JV3A 2M0YA 1T3SA 1MMNA 2VWFA 4RG8A 1K8AU 2LC4A 3REBB 4P5NA 2O4XA 2MWOA 4PLLA 3DB3A 4KGVB 3M58A 1VQ4Q 5FLXE 2RNAA 1PC0A 3QSUA 5EG2A 4FYXB 5CKFA 1D3BA 2EYXA 2JVVA 2OAUA 2VGMA 3BW1A 5DLOA 1ZA2B 1X75C 4M78G 2M02A 1OOTA 1B34B 3OYHA 2AK5A 1E6HA 1X2KA 2P0QA 4J9EA 1SRLA 2XD0A 1VOMA 1T0HA 2OTLQ 2JS2A 5FRNA 3NPFA 4IUVA 3CCMT 1WYXA 1VQOT 4XU3A 3I5RA 1JJ2A 3G7ZA 4PJJA 2RJCA 3QJ6A 3S3NA 2LX9A 2GFAA 3GNFB 2PUKB 2SEMA 3PFSA 3UATA 1GBQA 1GFCA 4KGZB 3RMQA 3OW2S 2BE9B 1QKXA 1VQ5Q 1Q7YR 2FPFA 3CQTA 2RA2A 1H3ZA 4OB2B 1ABOA 4M77F 1Q7YU 2PUOB 2CSIA 3M0RA 5CCAA 3CCQA 1K73R 1AD5A 3M57A 7AT1B 1JO8A 3M4GA 2FB7A 2XK0A 4C0FA 1X2QA 1K73U 2DBKA 4DBQA 3CC2Q 2EW3A 1YIJA 3CCUA 3HRUA 3CCSA 2M51A 2R5AA 4C92D 1KD1R 2E10A 2ED1A 1UGSB 4ATOA 4C92E 1KD1U 4X9CA 2HMAA 3J7AF 2ZAEA 3G71T 3PGGA 2C0TA 4M75E 5D6XA 3QYGB 1QCNA 1EFNA 1WI7A 3VS2A 1YHQT 2K3YA 4OVAA 3G1JA 4JPBW 1IREB 2AZVA 2O9SA 3M55A 2R57A 5LJ3d 4PJOA 4ZGJB 1X43A 3EG9B 4OF1A 3M59A 2ROLA 3EG2A 1VQ4A 1NJIR 3OYJA 1PD1A 5I22A 1RAFB 4EMHA 4DA4A 2X9HA 1NJIU 1VQLA 1IHVA 3EGDA 5LL6S 1R0BG 1VQNT 5CIUA 3G6EQ 5FWBA 4C8QD 5GAOq 5CK9A 1PRMC 4M7DF 1VQ6T 3EFSA 4C8QE 1SF9A 1TSFA 2EAYA 4QQ6A 5D6WA 1X6GA 1UDLA 3KXTA 3VRZA 4EPCA 1RAEB 2EQMA 3MPUB 1PNJA 1MV3A 3X25B 3R6OA 4PKCC 4CI0C 3JCMJ 1Y57A 2RJEA 3CMEA 2RMOA 5I2SA 3GBQA 4C5GA 1WX6A 1RADB 5GANe 4BE1A 1H8KA 3OQ5A 3A5ZB 4Z89A 1Z9ZA 3RNJA 3OA6A 2L3SA 1S1NA 3CCRA 3LWHA 4QW2A 2RB6A 4ZGEB 2ZZDA 1YJ9A 4M7DD 1WHJA 1XOVA 1Y0MA 4E47A 2KT1A 2O9VA 3CD6T 3OSSC 3EFOA 1M2OA 5FU6C 4MZTA 5GMKm 5LJ3h 3PE0A 4JRPA 3C95A 4KRTA 1K9AA 1FYNA 3PIPA 3U23A 5CR2A 4MMLA 4E7KA 4CC2A 4ME7A 4RCBA 1G5VA 2HD0A 3SDZA 1KSWA 1K0XA 4TVRA 4HXJA 2K6DA 3JCMg 2DL5A 4Z88A 5KYUB 1ZX6A 3ZFJA 3JB9H 1TUDA 1E6GA 2DEUA 1O9SA 2ED0A 2FRYA 2KVQG 2QASA 3JCMX 1PD0A 3MP1A 4KH0B 4AFQC 2EFIA 5FU7C 1OU8A 4N4HA 2GTOA 3OMGA 1SHGA 3OBWA 3A98A 5J26A 4KUIA 4ZGDB 2H8HA 1Q95G 3QZ5B 4EMKC 3OYAA 3EHQA 3I56T 5HY6A 3FRNA 3CPWS 3E9GA 1RI9A 1WJRA 4AFSC 4HCZA 2O01E 1M1GA 1BI0A 1OULA 1QVFP 3CC4Q 1MHNA 3X20B 3G71Q 1R8OB 2D0NA 1WXTA 2E70A 4M75A 4X1VA 2JTEA 1UHCA 1V76A 3QWXX 3WVEB 2K3XA 1GCPA 1C0MA 5IHIA 1YCYA 4M7AC 1WHMA 1OX8A 3GF5A 2AT1B 3EGDB 4J9DA 5LJ3f 1GBRA 3C94A 3VS1A 3P8BB 4RTVA 4LD9K 3INZA 2K5IA 1M3AA 2GNCA 4RG2A 4MMKA 5KYYB 2D0QB 4BUGA 1RAIB 4PK4A 1G3TA 3EFRA 2D9TA 3PTAA 3V8KA 2BKDN 4BY6C 2E4HA 3JCMQ 1DJ7B 2JS0A 3A8MB 1YCSB 1VQNQ 1LCKA 2DD5A 2KXDA 2KXCA 3EGXA 2YXYA 4R55A 3VS4A 3OW2A 5IAYA 3UA6A 4RCCA 4QVDA 4OMPA 1VQ6Q 1KIKA 1XTDA 4D8DA 1R77A 1W70A 5J39A 2K4YA 2R5MA 1KJWA 5GAOm 3TREA 3CCMA 1QVFA 2ZPIB 4HKEA 4RMOA 1VQOA 3OYMA 3VYGA 5A0LA 1TUCA 1NZ9A 5GAN8 1KQ2A 2H3EB 1Q81R 2MK5A 3CCET 3CCLT 1NG2A 2LDMA 4J9HA 1C1AA 1VQ9T 2WSFE 1Q81U 5AT1B 1VQPT 4F14A 4PJOG 1G3YA 5GAMf 2GGRA 3RKXA 5GANd 2RF0A 1FWZA 4QVZA 4F7UE 4HT8A 2CH4W 4FYVB 4EMGA 2A3LA 3CD6Q 4RTWA 1M90C 3MO8A 3HRSA 2CP0A 2PQWA 2CUDA 2PNIA 1S72Q 1WXBA 3LW5E 1KHCA 3VS5A 1VYUA 2NWMA 1WJSA 1SKUB 2KYMA 1WIEA 4BE0A 1KFZA 2D8JA 5GMKh 1UB4A 2YLBA 1B3QA 2JMAA 1K8AC 2H3JA 3G71A 1RACB 1UFFA 1Y96B 1WHLA 4RTUA 4ZNXA 2RD1A 2NUTA 1P92A 3M54A 4C92B 1YHQA 3ASKA 5IXBA 5GAN6 4FL6A 2D8HA 1U06A 3P8HA 2FZKB 8AT1B 3DKMA 3I56Q 1VIEA 3VRYA 4UC4A 1AZEA 1WHKA 1JXMA 1OX9A 1YITQ 4KH1B 3I35A 1M1FA 1W2BS 5GANh 5A0DA 5CAIA 2JZ2A 3LGLA 2DILA 3CCJA 1AWOA 1JEGA 2OTLT 2BTTA 5GAMg 1KHIA 1W6XA 1YI2T 4V2SA 2X4WA 3L42A 4PFPA 3FEOA 3M0TA 3V7CA 4M78C 1YP5A 3TCJA 1B34A 2GBQA 4DOWA 1ZUUA 1WQWA 2JXBA 5AYFA 2DZCA 4ELZC 2JN0A 2P4TA 2M1HA 1U5SA 2EGAA 1RLPC 4C8QB 2RN8A 1Q7YC 2CZ6B 2X35A 1AWJA 5M9OA 1VQ5T 1X6OA 1M3CA 5CQXA 4WF2A 2OJ2A 4R0KA 4JUVA 1XJWB 2DYBA 1K73C 3TSWA 5A0GA 1G3SA 1ZSGA 3G4SA 1AOJA 2RK1A 4AT1B 4LE9A 4RTZA 1JQQA 4E7ZA 3CCVT 4XU2A 3J80E 4M75G 3V7RA 1KD1C 4GBQA 9ATCB 3O5ZA 3JCMW 1VIFA 1VQ7A 2KROA 5HK3A 4C0DB 2ATCB 3OMCA 2LQ8A 2P0PA 3CCEQ 2CGHA 1ZA1B 4Y92A 2DIQA 3CCLQ 3LGFA 4M7DB 3E9FA 1B07A 1VQ9Q 2CDTA 1MMAA 4BI8B 5GANf 1VQPQ 2F2VA 1TS9A 2PZ1A 4J83A 4ORZA 4RTYA 1UGRB 3M56A 4F7UA 4XK8E 2YHTA 4AFUC 1G8XA 2LTOA 4BB7A 3S3OA 2A28A 5CKDA 4B9WA 1PCXA 1NJIC 4LN2A 2EBPA 4DOVA 2E64A 1KQ1A 2LMJA 3KUFA 3LH5A 1ZBJA 4K11A 3CEYA 4HVUA 3QUIA 2ZCFB 3I5SA 3JB9D 1JJ2P 4GLMA 2E3IA 2LCSA 3MP6A 1NE8A 2HKNA 1JU5C 2QQAA 1QP3A 1SSFA 1GFDA 4AG2C 3EG9A 1IXDA 2QDYB 3OYNA 2KEAA 1WHHA 3QWYA 2MOXA 1Y07A 5FROA 4OB3B 1WFWA 1VQKT 4CC3A 2E5KA 3M5AA 2PU9B 1QVGA
chains in the Genus database with same CATH topology
1H3HA 2QDLA 1G2BA 2K2MA 2CSQA 2FPDA 3VS3A 1QCFA 1SRMA 1NLOC 1YWOA 1NEBA 5FWBA 1PRMC 2KBTA 1JXOA 2DL4A 3EGUA 1J3TA 2DF6A 1X6GA 1UDLA 1M27C 3VRZA 2V1RA 1AWWA 2DX1A 5GJVB 2FEIA 4JZ3A 4F16A 1ZUKA 1PNJA 1MV3A 4J9BA 3C0CA 2DA9A 4HVWA 4LUDA 4IIMA 3VS7A 1Y57A 2RQUA 1PRLC 2RMOA 3GBQA 1A0NB 1WX6A 2ABLA 4JJBA 3EG3A 1FMKA 1H8KA 2AKKA 1OEBA 1Z9ZA 3RNJA 4Z89A 2F2XA 3M0SA 2L3SA 1S1NA 1BB9A 1ZUYA 1YNZA 3EHRA 1OV3A 2FO0A 2J6FA 1VYTA 1XOVA 1Y0MA 2ENMA 2KT1A 2O9VA 4JJCA 2EGCA 2DRMA 2EYYA 2V1QA 5IHNA 1OPLA 1MV0B 2J6OA 1VA7A 3PE0A 2DM1A 4KRTA 1K9AA 2I0NA 2C0IA 2K7AA 4LUEA 1FYNA 1YWPA 1T3LA 3U23A 4CC2A 3R6NA 1ARKA 4RTXA 3IQLA 4HCKA 4J9GA 1KSWA 3TVTA 2BZYA 1K76A 2L2PA 1X69A 1N5ZA 1K0XA 2GTJA 4HXJA 2K6DA 2GQIA 2DL5A 4Z88A 1ZX6A 1NEGA 1PWTA 1TUDA 2F2WA 1E6GA 4CC4B 2G6FX 2FRYA 2ED0A 2D1XA 1NYGA 2EGEA 2A37A 5I11A 4AFQC 2ECZA 4JZ4A 1M8MA 4OMMA 2YT6A 2GTOA 1ZLMA 1SHGA 3A98A 3H41A 1WA7A 1YN8A 2YUNA 5FWCA 2DBMA 1UJ0A 2VKNA 1WDXA 4DEYA 2YUOA 2H8HA 3RBBB 1Z9QA 3EHQA 1GL5A 1MUZA 1NLPC 2RPNA 1RI9A 1X6BA 4AFSC 2BZXA 2L0AA 2A36A 2OI3A 3EG0A 2KYBA 2O31A 2DMOA 1CKBA 1GCQA 2D0NA 2DL3A 1WXTA 3M0UA 3NGPA 4X1VA 2JTEA 1UHCA 3QWXX 1GCPA 1BK2A 5IHIA 2RQWA 2RQTA 3I9QA 4A63B 4AFZC 5ECAA 3PVQA 4J9DA 2LQNA 1GBRA 4RUGA 5EC7A 3VS1A 4RTVA 3UF4A 1PKSA 2CREA 3UA7A 1M3AA 2GNCA 4D8KA 4M4ZA 3VS6A 2FG0A 2ESWA 2LQWA 1QWFA 1QKWA 4IIOA 1RLQC 4J9IA 2JS0A 4OMLA 2YDLA 1AEYA 1HD3A 1YCSB 1LCKA 2KXDA 2KXCA 2X3WD 3VS4A 2DVJA 2HEQA 1BU1A 2B86A 3UA6A 2HCKA 3ULRB 2HSPA 2HDAA 4J9FA 4OMPA 1KIKA 4D8DA 1W70A 2LJ3A 1K0SA 1I0CA 1KJWA 1ABQA 2KRMA 2DNUA 2RQRA 4LNPA 2EKHA 4FSSA 1TUCA 2JM8A 2P4RA 1M3BA 5IHKA 2DL8A 3M0QA 2FRWA 2CT3A 1NG2A 2EYWA 2DRKA 2J6KA 4J9HA 4F14A 2DLPA 3FJ5A 2GGRA 1PHTA 2KE9A 2RF0A 1K4US 2CH4W 1UTIA 2BZ8A 3NHNA 2JMCA 1TG0A 4OMOA 4RTWA 4WCIA 1UECA 4EIKA 1UG1A 2CUDA 1QLYA 2PNIA 2LX7A 3EG1A 5HCKA 1AZGB 1WXBA 2XMFA 1VYUA 3VS5A 2FPEA 2NWMA 2KYMA 1WIEA 4QT7A 2O88A 4OMNA 2NUZA 2X3XD 1SEMA 1UJYA 1UUEA 1KFZA 2D8JA 1G83A 2SRCA 4HVVA 4OMQA 1B3QA 2JMAA 1WXUA 2O2OA 2JW4A 1IO6A 3ZL7C 1UFFA 2L3PA 4RTUA 4ZNXA 1WLPB 2DJQA 2EYZA 4ESRA 1BBZA 1SPKA 5IXBA 2KT8A 1HJDA 1NM7A 5IXFA 5L23A 2D8HA 2KR3A 2KRSA 1U06A 1UGVA 2YSQA 1H92A 1U3OA 3PVLA 2MIOA 3VRYA 1AZEA 1JXMA 1AWXA 2DL7A 3I35A 1SHFA 2MCNA 1QWEA 3JV3A 2M0YA 1T3SA 2VWFA 2KNBB 1VYVA 3REBB 2AKLA 2DILA 1AWOA 1JEGA 3M0PA 2BTTA 1W6XA 4J9CA 5IH2A 1HSQA 2ROTA 2RNAA 2HBWA 2PTKA 2EYXA 2K9GA 3M0TA 3VS0A 2J05A 1YP5A 2OAWA 2GBQA 2VVKA 1ZUUA 2JXBA 2DE0X 1OOTA 2LNHB 2CT4A 2AZSA 2KGTA 3NMZC 5GJWB 2AK5A 1U5SA 1M30A 1E6HA 1X2KA 2EGAA 4J9EA 1RLPC 1SRLA 5FW9A 3H0FA 1T0HA 2RN8A 2JS2A 3NPFA 1AWJA 4CC7A 2K79A 4Z8AA 1M3CA 1WYXA 3I5RA 2OJ2A 4DEXA 4RTTA 4R0KA 2W0ZA 1T0JA 2DYBA 2YUPA 3TSWA 2JM9A 2JT4A 1ZSGA 1AOJA 4LE9A 4RTZA 2SEMA 2CUBA 3UATA 1GBQA 1GFCA 1JQQA 2J06A 4E6RA 1GCQC 3KFVA 1QKXA 2YUQA 3SEMA 3REAB 1I1JA 4GBQA 2FPFA 2LZ6B 3CQTA 3O5ZA 2KROA 1ABOA 2L3QA 2K3BA 2C0OA 4Y92A 2CSIA 2W10A 3M0RA 1B07A 1AD5A 2CDTA 1NYFA 1JO8A 2IIMA 4CC3A 2F2VA 2PZ1A 3SHWA 4ORZA 4RTYA 1X2QA 2DBKA 2LJ1A 3THKA 2RQVA 2EW3A 1SSHA 2M51A 4AFUC 1PKTA 2LJ0A 2ED1A 1GRIA 2A28A 1OPKA 1V1CA 3H0IA 4AG1C 4LN2A 2EPDA 2EBPA 2C0TA 2LP5A 3H0HA 2LMJA 3LH5A 1UHFA 1ZBJA 1EFNA 4K11A 3TSZA 4HVUA 1WI7A 3VS2A 3I5SA 1AVZC 4GLMA 4JPBW 2LCSA 1W1FA 1JU5C 1GFDA 2AZVA 1K1ZA 2O9SA 4AG2C 1UE9A 2J7IA 2KRNA 1X43A 2A08A 2CH4A 1CKAA 4F17A 2KEAA 2EQIA 2ROLA 3EG2A 3QWYA 2MOXA 1E7OA 1CSKA 5I22A 1X27A 1WFWA 4JJDA 2E5KA 1RUWA 2EVRA 1I07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H3H A;  2QDL A;  1G2B A;  2K2M A;  2CSQ A;  2FPD A;  3VS3 A;  1QCF A;  1SRM A;  1NLO C;  1YWO A;  1NEB A;  5FWB A;  1PRM C;  2KBT A;  1JXO A;  2DL4 A;  3EGU A;  1J3T A;  2DF6 A;  1X6G A;  1UDL A;  1M27 C;  3VRZ A;  2V1R A;  1AWW A;  2DX1 A;  5GJV B;  2FEI A;  4JZ3 A;  4F16 A;  1ZUK A;  1PNJ A;  1MV3 A;  4J9B A;  3C0C A;  2DA9 A;  4HVW A;  4LUD A;  4IIM A;  3VS7 A;  1Y57 A;  2RQU A;  1PRL C;  2RMO A;  3GBQ A;  1A0N B;  1WX6 A;  2ABL A;  4JJB A;  3EG3 A;  1FMK A;  1H8K A;  2AKK A;  1OEB A;  1Z9Z A;  3RNJ A;  4Z89 A;  2F2X A;  3M0S A;  2L3S A;  1S1N A;  1BB9 A;  1ZUY A;  1YNZ A;  3EHR A;  1OV3 A;  2FO0 A;  2J6F A;  1VYT A;  1XOV A;  1Y0M A;  2ENM A;  2KT1 A;  2O9V A;  4JJC A;  2EGC A;  2DRM A;  2EYY A;  2V1Q A;  5IHN A;  1OPL A;  1MV0 B;  2J6O A;  1VA7 A;  3PE0 A;  2DM1 A;  4KRT A;  1K9A A;  2I0N A;  2C0I A;  2K7A A;  4LUE A;  1FYN A;  1YWP A;  1T3L A;  3U23 A;  4CC2 A;  3R6N A;  1ARK A;  4RTX A;  3IQL A;  4HCK A;  4J9G A;  1KSW A;  3TVT A;  2BZY A;  1K76 A;  2L2P A;  1X69 A;  1N5Z A;  1K0X A;  2GTJ A;  4HXJ A;  2K6D A;  2GQI A;  2DL5 A;  4Z88 A;  1ZX6 A;  1NEG A;  1PWT A;  1TUD A;  2F2W A;  1E6G A;  4CC4 B;  2G6F X;  2FRY A;  2ED0 A;  2D1X A;  1NYG A;  2EGE A;  2A37 A;  5I11 A;  4AFQ C;  2ECZ A;  4JZ4 A;  1M8M A;  4OMM A;  2YT6 A;  2GTO A;  1ZLM A;  1SHG A;  3A98 A;  3H41 A;  1WA7 A;  1YN8 A;  2YUN A;  5FWC A;  2DBM A;  1UJ0 A;  2VKN A;  1WDX A;  4DEY A;  2YUO A;  2H8H A;  3RBB B;  1Z9Q A;  3EHQ A;  1GL5 A;  1MUZ A;  1NLP C;  2RPN A;  1RI9 A;  1X6B A;  4AFS C;  2BZX A;  2L0A A;  2A36 A;  2OI3 A;  3EG0 A;  2KYB A;  2O31 A;  2DMO A;  1CKB A;  1GCQ A;  2D0N A;  2DL3 A;  1WXT A;  3M0U A;  3NGP A;  4X1V A;  2JTE A;  1UHC A;  3QWX X;  1GCP A;  1BK2 A;  5IHI A;  2RQW A;  2RQT A;  3I9Q A;  4A63 B;  4AFZ C;  5ECA A;  3PVQ A;  4J9D A;  2LQN A;  1GBR A;  4RUG A;  5EC7 A;  3VS1 A;  4RTV A;  3UF4 A;  1PKS A;  2CRE A;  3UA7 A;  1M3A A;  2GNC A;  4D8K A;  4M4Z A;  3VS6 A;  2FG0 A;  2ESW A;  2LQW A;  1QWF A;  1QKW A;  4IIO A;  1RLQ C;  4J9I A;  2JS0 A;  4OML A;  2YDL A;  1AEY A;  1HD3 A;  1YCS B;  1LCK A;  2KXD A;  2KXC A;  2X3W D;  3VS4 A;  2DVJ A;  2HEQ A;  1BU1 A;  2B86 A;  3UA6 A;  2HCK A;  3ULR B;  2HSP A;  2HDA A;  4J9F A;  4OMP A;  1KIK A;  4D8D A;  1W70 A;  2LJ3 A;  1K0S A;  1I0C A;  1KJW A;  1ABQ A;  2KRM A;  2DNU A;  2RQR A;  4LNP A;  2EKH A;  4FSS A;  1TUC A;  2JM8 A;  2P4R A;  1M3B A;  5IHK A;  2DL8 A;  3M0Q A;  2FRW A;  2CT3 A;  1NG2 A;  2EYW A;  2DRK A;  2J6K A;  4J9H A;  4F14 A;  2DLP A;  3FJ5 A;  2GGR A;  1PHT A;  2KE9 A;  2RF0 A;  1K4U S;  2CH4 W;  1UTI A;  2BZ8 A;  3NHN A;  2JMC A;  1TG0 A;  4OMO A;  4RTW A;  4WCI A;  1UEC A;  4EIK A;  1UG1 A;  2CUD A;  1QLY A;  2PNI A;  2LX7 A;  3EG1 A;  5HCK A;  1AZG B;  1WXB A;  2XMF A;  1VYU A;  3VS5 A;  2FPE A;  2NWM A;  2KYM A;  1WIE A;  4QT7 A;  2O88 A;  4OMN A;  2NUZ A;  2X3X D;  1SEM A;  1UJY A;  1UUE A;  1KFZ A;  2D8J A;  1G83 A;  2SRC A;  4HVV A;  4OMQ A;  1B3Q A;  2JMA A;  1WXU A;  2O2O A;  2JW4 A;  1IO6 A;  3ZL7 C;  1UFF A;  2L3P A;  4RTU A;  4ZNX A;  1WLP B;  2DJQ A;  2EYZ A;  4ESR A;  1BBZ A;  1SPK A;  5IXB A;  2KT8 A;  1HJD A;  1NM7 A;  5IXF A;  5L23 A;  2D8H A;  2KR3 A;  2KRS A;  1U06 A;  1UGV A;  2YSQ A;  1H92 A;  1U3O A;  3PVL A;  2MIO A;  3VRY A;  1AZE A;  1JXM A;  1AWX A;  2DL7 A;  3I35 A;  1SHF A;  2MCN A;  1QWE A;  3JV3 A;  2M0Y A;  1T3S A;  2VWF A;  2KNB B;  1VYV A;  3REB B;  2AKL A;  2DIL A;  1AWO A;  1JEG A;  3M0P A;  2BTT A;  1W6X A;  4J9C A;  5IH2 A;  1HSQ A;  2ROT A;  2RNA A;  2HBW A;  2PTK A;  2EYX A;  2K9G A;  3M0T A;  3VS0 A;  2J05 A;  1YP5 A;  2OAW A;  2GBQ A;  2VVK A;  1ZUU A;  2JXB A;  2DE0 X;  1OOT A;  2LNH B;  2CT4 A;  2AZS A;  2KGT A;  3NMZ C;  5GJW B;  2AK5 A;  1U5S A;  1M30 A;  1E6H A;  1X2K A;  2EGA A;  4J9E A;  1RLP C;  1SRL A;  5FW9 A;  3H0F A;  1T0H A;  2RN8 A;  2JS2 A;  3NPF A;  1AWJ A;  4CC7 A;  2K79 A;  4Z8A A;  1M3C A;  1WYX A;  3I5R A;  2OJ2 A;  4DEX A;  4RTT A;  4R0K A;  2W0Z A;  1T0J A;  2DYB A;  2YUP A;  3TSW A;  2JM9 A;  2JT4 A;  1ZSG A;  1AOJ A;  4LE9 A;  4RTZ A;  2SEM A;  2CUB A;  3UAT A;  1GBQ A;  1GFC A;  1JQQ A;  2J06 A;  4E6R A;  1GCQ C;  3KFV A;  1QKX A;  2YUQ A;  3SEM A;  3REA B;  1I1J A;  4GBQ A;  2FPF A;  2LZ6 B;  3CQT A;  3O5Z A;  2KRO A;  1ABO A;  2L3Q A;  2K3B A;  2C0O A;  4Y92 A;  2CSI A;  2W10 A;  3M0R A;  1B07 A;  1AD5 A;  2CDT A;  1NYF A;  1JO8 A;  2IIM A;  4CC3 A;  2F2V A;  2PZ1 A;  3SHW A;  4ORZ A;  4RTY A;  1X2Q A;  2DBK A;  2LJ1 A;  3THK A;  2RQV A;  2EW3 A;  1SSH A;  2M51 A;  4AFU C;  1PKT A;  2LJ0 A;  2ED1 A;  1GRI A;  2A28 A;  1OPK A;  1V1C A;  3H0I A;  4AG1 C;  4LN2 A;  2EPD A;  2EBP A;  2C0T A;  2LP5 A;  3H0H A;  2LMJ A;  3LH5 A;  1UHF A;  1ZBJ A;  1EFN A;  4K11 A;  3TSZ A;  4HVU A;  1WI7 A;  3VS2 A;  3I5S A;  1AVZ C;  4GLM A;  4JPB W;  2LCS A;  1W1F A;  1JU5 C;  1GFD A;  2AZV A;  1K1Z A;  2O9S A;  4AG2 C;  1UE9 A;  2J7I A;  2KRN A;  1X43 A;  2A08 A;  2CH4 A;  1CKA A;  4F17 A;  2KEA A;  2EQI A;  2ROL A;  3EG2 A;  3QWY A;  2MOX A;  1E7O A;  1CSK A;  5I22 A;  1X27 A;  1WFW A;  4JJD A;  2E5K A;  1RUW A;  2EVR A;  1I07 A; 
#chains in the Genus database with same CATH topology
 3AT1 B;  3OYB A;  1MMG A;  2K2M A;  4II1 A;  2EJF A;  1NLO C;  4M7A F;  4FW1 A;  2FZG B;  2KBT A;  1I5O B;  5GAO p;  2DL4 A;  2OTJ T;  4QVC A;  3EGU A;  4XU1 A;  2MF2 A;  1J3T A;  2DET A;  1M27 C;  2V1R A;  2CP6 A;  4LDV A;  1YI2 Q;  2RO0 A;  5GJV B;  4PLI A;  4JZ3 A;  3V7S A;  4C5E A;  4F16 A;  4JDS A;  4KT0 E;  5D7U A;  4LUD A;  1ZSZ B;  4QQD A;  4C5H A;  5LJ5 g;  2DXC A;  2RQU A;  3OBY A;  3S3M A;  1D0X A;  2HQE A;  2KSS A;  1D1B A;  2JOY A;  4HA8 A;  2QA4 T;  1TH7 A;  2AKK A;  2LCC A;  1OEB A;  2F2X A;  3M0S A;  4X34 A;  4M7A D;  1YNZ A;  4JRK A;  2FO0 A;  5KE2 A;  1VYT A;  4MZM A;  4JJC A;  1M2V B;  2DAQ A;  2J6O A;  2HSE B;  5KYW B;  3SWN B;  2DM1 A;  2DPP B;  2K7A A;  3UT1 A;  2C0I A;  3GOX A;  2CZ7 B;  4RTX A;  4J8O A;  2L89 A;  3TVT A;  1EX4 A;  3JCM V;  1I8F A;  1K76 A;  5KYU A;  3CCV Q;  1X69 A;  1N5Z A;  3JRZ A;  3OS2 A;  4IUT A;  2GQI A;  4F7U B;  3CBO A;  1AT1 B;  1NEG A;  1PWT A;  4ZTJ A;  2F2W A;  2DER A;  1TU0 B;  4PNO A;  3CBP A;  1NYG A;  2EGE A;  2QQS A;  3OYE A;  1K9M R;  5I21 A;  4BI3 A;  3L2R A;  1YBY A;  1HXD A;  2ECZ A;  4JZ4 A;  3CC4 T;  4OMM A;  1M1K R;  2Y4X A;  1K9M U;  4M77 D;  1JBM A;  3OYC A;  5J3B A;  3JCM b;  2NUP B;  2BE7 D;  1UJ0 A;  2DBM A;  2VKN A;  1M1K U;  4DEY A;  4M77 E;  3RBB B;  3QHS A;  4BE2 A;  2X4Y A;  2MAM A;  4D6W A;  1MUZ A;  4ZN3 A;  1NPR A;  4LXC A;  4LDU A;  2KYB A;  1G3W A;  3LX7 A;  3UPU A;  1CKB A;  3QKJ A;  1GCQ A;  2CP7 A;  1Q86 R;  3MEU A;  2RQW A;  4PJL A;  4QQG A;  3I55 T;  4RUG A;  3UF4 A;  3UA7 A;  5KYY A;  3DLL A;  2OTL A;  4D8K A;  2ESW A;  2LQW A;  8ATC B;  1QWF A;  3GLX A;  1VQK Q;  4F7U G;  3RKY A;  4GY5 A;  1Q81 C;  1HD3 A;  1QVP A;  4N0A A;  3PIO A;  2X3W D;  1BU1 A;  2B86 A;  3ULR B;  4M78 F;  4J9F A;  1MGQ A;  4A4H A;  2OTJ Q;  2LJ3 A;  2KI7 A;  1N9S A;  1VQ5 A;  1U1S A;  3L2Q A;  2EKH A;  4FSS A;  2JM8 A;  4M7D E;  2HL3 A;  3RMS A;  2DL8 A;  1Y7X A;  2F69 A;  4FYW B;  2EYW A;  2QA4 Q;  2RI5 A;  5C0M A;  4PJO C;  1S72 T;  2DLP A;  4FIB A;  3FJ5 A;  3CC2 A;  2BUD A;  5GAO n;  3OSV A;  2VUB A;  3CMA T;  4M78 D;  2QK0 A;  2GFU A;  2LT4 A;  1UTI A;  2BZ8 A;  2JMC A;  4XAX B;  1VQM Q;  2X4X A;  4WCI A;  1UEC A;  4J6Y A;  1YJW Q;  5CKH A;  1EIF A;  5GMK l;  5HCK A;  3FDR A;  3CXC A;  3TEE A;  2F1L A;  4PFO A;  2FPE A;  4QT7 A;  1SEM A;  2GF7 A;  2QI2 A;  1YJN T;  1G83 A;  4N4I A;  3J81 E;  2VXE A;  3OW2 P;  4FT2 A;  2JNG A;  1OZ2 A;  3MP8 A;  3SB2 A;  1Y96 A;  2DVE A;  4OMQ A;  2EQJ A;  1WXU A;  2O2O A;  2YRC A;  1YIT T;  1N9R A;  4C92 A;  2E12 A;  1WLP B;  3L2U A;  4JRI A;  2RHY A;  2DK3 A;  3UDC A;  1SPK A;  1SG5 A;  2KT8 A;  1HJD A;  1NM7 A;  3G6E A;  5GAN 7;  1ZQ1 A;  2KRS A;  1IGQ A;  2WSC E;  1KQS S;  1M4Z A;  2DZ9 A;  3PVL A;  2YRD A;  1HK9 A;  5FU6 B;  3OS5 A;  1M5Q 1;  2MCN A;  3GPL A;  4A53 A;  2QEX T;  2QXF A;  1IGU A;  3X24 B;  2RHI A;  4A4K A;  2CP3 A;  3ZBD A;  1FMW A;  2KQW A;  3FJP A;  4J9C A;  2ROT A;  3O8V A;  2HBW A;  5DLQ E;  4J6X A;  2EYQ A;  3I55 Q;  4OMF B;  2OAW A;  2V26 A;  4XTZ A;  3BY7 A;  4J7I A;  2B8A A;  2DE0 X;  4NS5 A;  4C8Q A;  2AZS A;  2KMT A;  2KDS A;  2KGT A;  3NMZ C;  5GJW B;  5FU7 B;  1C6V X;  5FW9 A;  3JB9 I;  1KC8 R;  3FLG A;  2K79 A;  5GAN 5;  4Z8A A;  2RJD A;  1WQ7 A;  3P8D A;  1I81 A;  1B7T A;  4EMK B;  3L2W A;  1KC8 U;  3HHT B;  1T0J A;  2JM9 A;  2AHJ B;  2IVW A;  4C92 C;  3L2Z A;  3EH2 A;  1FX7 A;  4E7I A;  2J06 A;  5GAO l;  4E6R A;  2HBP A;  3KFV A;  4M75 C;  3QBY A;  4OB0 B;  2YUQ A;  3SEM A;  3REA B;  2DXB A;  4ZN1 A;  2LQK A;  1Y71 A;  4M7D A;  4M7A B;  3HRT A;  2LCL A;  3PT9 A;  2K3B A;  4IUQ A;  3QDF A;  3TQ7 P;  2HAX A;  5LJ3 g;  2DTH A;  2E6Z A;  3SHW A;  1Q82 R;  1XQH A;  2XDP A;  4Z02 A;  2LJ1 A;  2RM4 A;  1U1T A;  3CMA Q;  3THK A;  2ZPB B;  3HKS A;  1SSH A;  3OYF A;  4BY6 B;  1PKT A;  1ZBX A;  1YIJ T;  2LJ0 A;  3CCU T;  3CC4 A;  3CCS T;  2XG8 D;  1V1C A;  3H0I A;  3M53 A;  4AG1 C;  2M16 A;  3JCM e;  2LP5 A;  3H0H A;  4FU6 A;  1VQ8 Q;  1LJO A;  4EDU A;  3S6W A;  1UHF A;  3TSZ A;  1OI1 A;  1RAA B;  4E7L A;  1YJN Q;  1MNE A;  5I2M A;  2EJ9 A;  2KAF A;  4M77 B;  4XU0 A;  3ME9 A;  1X01 A;  1UE9 A;  2MWP A;  2KRN A;  5D6Y A;  4FW2 A;  2A08 A;  2JJ9 A;  5CVI A;  5GAM j;  1CKA A;  5KYN A;  2EQI A;  4NL3 A;  2K57 A;  1VQN A;  4JJD A;  3VUB A;  3A8G B;  1I07 A;  3RIR A;  1KK7 A;  4JS4 A;  1WPY A;  2CSQ A;  2FPD A;  3LLR A;  1QCF A;  3VS3 A;  1QW1 A;  2XU8 A;  1NEB A;  4FSX A;  1VQL T;  2CYZ B;  1VQ6 A;  2FL7 A;  4IUU A;  4KUL A;  1JXO A;  3L1A A;  3LWI A;  2PVG B;  4IKF A;  2QEX Q;  3OB9 A;  2R58 A;  2LVM A;  4B9X A;  2DF6 A;  1FMV A;  3M4Y A;  1AWW A;  2DX1 A;  2CP2 A;  2FEI A;  1ZSZ A;  1OQK A;  1ZUK A;  3NTH A;  4Q5W A;  3PNW C;  4J9B A;  5IT9 E;  3C0C A;  2DA9 A;  2JUF A;  4IIM A;  3NTK A;  4XTW A;  1PRL C;  1KG1 A;  3L2V A;  2ABL A;  3QO3 A;  3EG3 A;  1FMK A;  1D1A A;  3CME T;  3FB9 A;  2ZGW A;  4C92 G;  2RHU A;  3GNG A;  1BB9 A;  4BI4 A;  1XNI A;  2KY9 A;  4R56 A;  3CD6 A;  1ZUY A;  3EHR A;  1OV3 A;  3RR6 A;  2J6F A;  1MMD A;  1M2V A;  1ZHI A;  4J5Y A;  1YJ9 T;  4QKU A;  3HTR A;  2XID A;  5KYW A;  2DRM A;  2EYY A;  2V1Q A;  3SWN A;  3FC3 A;  4JRQ A;  1NPP A;  3PMI A;  1MV0 B;  1K9M C;  1S72 A;  1D0Y A;  3VJP A;  2A7Y A;  4LUE A;  5KYX B;  1M1K C;  1LOJ A;  2FYK A;  1T3L A;  4PJO F;  3CPW A;  2XHC A;  3OYY A;  3IQL A;  1QVG P;  4HCK A;  2LNV A;  3UWN A;  2BZY A;  3WXM B;  2L2P A;  3PMT A;  5CQY A;  1WGS A;  2Z0W A;  3CC7 T;  3NFC A;  4CC4 B;  2D1X A;  2HKQ B;  1IHW A;  3LYI A;  4M78 B;  3A8L B;  2A37 A;  5A2Q E;  1PM3 A;  1KQS A;  1R0C B;  5I11 A;  3OS1 A;  2ZPG B;  4HCC A;  1M8M A;  3M9Q A;  4L59 A;  2YT6 A;  4C8Q G;  3CCQ Q;  2NUP A;  2PVD B;  4DBF A;  1Q86 C;  1WA7 A;  1YN8 A;  1O75 A;  3I56 A;  4OB1 B;  5FWC A;  1WDX A;  2VV5 A;  2HQX A;  3SD4 A;  1ZSZ C;  5LJ3 e;  1YIT A;  4PJO D;  5GAN 2;  1GL5 A;  3QDR B;  1NLP C;  4J6W A;  3CCU Q;  1YIJ Q;  1D09 B;  2NYS A;  3CCS Q;  3WVD B;  2BZX A;  2CS7 A;  2DIG A;  2OI3 A;  3EG0 A;  2P84 A;  4E7S A;  2DMO A;  2DL3 A;  3HFN A;  2QTV A;  3JCM d;  1BK2 A;  2P0K A;  1BI2 A;  1RI0 A;  2RQT A;  3JCM c;  4M7D G;  2L3R A;  5EC7 A;  1TXQ A;  3LH0 A;  1LVK A;  2CRE A;  4OGC A;  1BKB A;  2QGF B;  2VAS A;  4DBR A;  2CKK A;  2FG0 A;  3QII A;  3QPH A;  4IIO A;  4L6V 5;  4AMC A;  5LJ5 j;  5GAN g;  2HL5 C;  2L8D A;  3HSB A;  2EWN A;  4XTX A;  2E6N A;  1AEY A;  4LDW A;  1GXI E;  5KCH A;  3OYG A;  2XDB A;  1VQL Q;  2WAC A;  2DVJ A;  1QCO A;  2E5Q A;  5GAN 3;  2X4J A;  1IB8 A;  5GAM e;  4E2F B;  4WTO B;  4XTU A;  1K0S A;  1I0C A;  4E7H A;  1ABQ A;  1RAH B;  1W2B P;  3V8J A;  3DB4 A;  2RQR A;  4LNP A;  4M7A E;  3VYH B;  3CCE A;  2V8I A;  3CCL A;  1VQM T;  3VV0 A;  5IHK A;  1VQ9 A;  4LDX A;  1YJW T;  2CT3 A;  1VQP A;  2DRK A;  3RUX A;  2J6K A;  3VU3 C;  4ANJ A;  3CME Q;  4C92 F;  3GP8 A;  2DXT A;  3MHX A;  2WSE E;  3C4S A;  1PHT A;  3JCM h;  1K4U S;  2D6F A;  2OX7 A;  2AIR B;  3CCR Q;  3RKW A;  1U8R A;  4M75 F;  4LDY A;  3HFO A;  3HPW A;  3NHN A;  1YJ9 Q;  1TG0 A;  4IUR A;  2CZ1 B;  4PFZ A;  3MEA A;  2RH2 A;  1QVF S;  2EQU A;  3V8L A;  2VYT A;  2YRV A;  1IZ6 A;  1OU9 A;  3CPF A;  4C0Z A;  2A0F B;  1UEB A;  2NUZ A;  4OMN A;  1UJY A;  1VUB A;  2LRQ A;  1W2B A;  4C5I A;  1D1C A;  3JAM E;  3CC7 Q;  1N8R R;  3ZEH A;  3BDL A;  2SRC A;  4HVV A;  5GAN 4;  2FVU A;  2RHX A;  2JW4 A;  1IO6 A;  2E1H A;  1N8R U;  4M75 D;  2RHZ A;  1BCO A;  2DJQ A;  1W4S A;  2QQ9 A;  4C8Q F;  1BBZ A;  3MKD A;  3SFM A;  4O5V A;  3QXE B;  5IXF A;  5L23 A;  2COW A;  2KR3 A;  2EJG A;  2MIO A;  1Q86 U;  1TOV A;  1RAB B;  2F5T X;  3BFM A;  2EIF A;  4CRI A;  3H8Z A;  2IPO B;  2DFU A;  1IRX A;  2KNB B;  1VYV A;  1YI2 A;  3JSC A;  1KC8 C;  3JCM f;  4JJN K;  2AKL A;  5GMK e;  4ELY C;  3M0P A;  5IN1 A;  4F04 B;  2PVO B;  2YLC A;  5IH2 A;  2O4X B;  4MZP A;  1HSQ A;  2PTK A;  3CCJ T;  1JB0 E;  2K9G A;  2DTO A;  5CKB A;  1N27 A;  3VS0 A;  1BCM A;  1D3B B;  2J05 A;  3CXC P;  2QTX A;  2VVK A;  3E19 A;  2LNH B;  2CT4 A;  1TTH B;  2HZY A;  1ACM B;  1M30 A;  3BDU A;  3H0F A;  4CC7 A;  4EMK A;  4NOY A;  3A8O B;  3QG1 A;  2CZ0 B;  1UGP B;  4RKU E;  4DEX A;  4RTT A;  3E2U A;  4JS5 A;  2W0Z A;  2YUP A;  4OP0 A;  2JT4 A;  4BDY A;  2QG9 B;  4PJM A;  1BYM A;  1Q82 C;  3E1S A;  3CCV A;  3EAE A;  3EH1 A;  4HT9 A;  2CUB A;  1BIB A;  3G4S T;  2LT1 A;  5GAM d;  5LJ5 e;  4Y28 E;  1GCQ C;  3AHU A;  3CCM Q;  4M7A A;  1I1J A;  1VQO Q;  2LZ6 B;  2XI9 A;  3T9N A;  4M78 E;  2DEQ A;  4JLG A;  1QMC A;  2L3Q A;  1VQ7 T;  3OYK A;  2C0O A;  2W10 A;  3MEV A;  4MDW A;  1NYF A;  3VUZ A;  4JLI A;  1QP2 A;  2IIM A;  1H64 1;  4PJN A;  1VQ8 T;  3CC7 A;  4A4E A;  3NTI A;  2RQV A;  2QQR A;  4C0G A;  1PSF A;  1UGQ B;  2L5Q A;  1GRI A;  4N0A C;  1OPK A;  4KBM B;  4A54 A;  4FT4 A;  2EPD A;  2RK2 A;  4J7F A;  2DYI A;  3QYH B;  4O6J A;  2KK4 A;  1BI3 A;  1AVZ C;  4M77 A;  1W1F A;  2VGN A;  2DD4 A;  3OYI A;  1K1Z A;  3OS0 A;  2XKO C;  2J7I A;  2K5F A;  2CH4 A;  4Y91 A;  3X28 B;  3MCA B;  4F17 A;  1VQK A;  2DO3 A;  3QJY A;  4PJO B;  5GAM h;  2DXU A;  5GAO r;  1E7O A;  1CSK A;  2DKG A;  4A4F A;  1X27 A;  4A4G A;  1RUW A;  1H3H A;  2QDL A;  1G2B A;  2VXF A;  3URG A;  1YHQ Q;  3MET A;  1SRM A;  1YWO A;  2M0O A;  1QQJ A;  1BIA A;  1LPL A;  2OTJ A;  4BAC A;  1MND A;  3A1P A;  2GCX A;  2E41 A;  2K2V A;  3FIF A;  5KCO A;  2HNI A;  2C06 A;  3DLM A;  2DTI A;  5HK0 A;  4L5G A;  4F7U F;  4DBH A;  4BD3 A;  5DM7 R;  3CCJ Q;  4HVW A;  2QA4 A;  1N6A A;  2MI6 A;  3VS7 A;  2COY A;  1A0N B;  1BI1 A;  2JTM A;  4JJB A;  3GIB A;  1QVG S;  5DY9 A;  3OYD A;  3BE3 A;  3CBM A;  1VQM A;  2IG0 A;  2COZ A;  2ENM A;  2ZPH B;  2EGC A;  3N5B B;  1YJW A;  4M77 C;  1LNX A;  2JTF A;  5LJ3 j;  2QAZ A;  5IHN A;  1OPL A;  5KYX A;  3EFO B;  4XQ3 A;  4BDZ A;  1VA7 A;  3A8H B;  2I0N A;  2ZPE B;  1NBE B;  3QZ9 B;  3JCM P;  1YWP A;  3JB9 G;  3R6N A;  1ARK A;  3CCQ T;  3G4S Q;  2VB6 A;  3OY9 A;  4J9G A;  1JJ2 S;  3H9N A;  2GTJ A;  1Q82 U;  5LJ5 d;  2RI2 A;  4M78 A;  5KE3 A;  2G6F X;  1D0Z A;  2MMP A;  1VQ7 Q;  3H6Z A;  1V29 B;  1TUG B;  4C8Q C;  1ZLM A;  3H41 A;  4LD6 A;  4OGE A;  2YUN A;  3RER A;  1I4K 1;  2YUO A;  1Z9Q A;  3RES A;  2RPN A;  4XTY A;  1X6B A;  4FM4 B;  5L8R E;  4KGX B;  2L0A A;  2A36 A;  1JRI A;  2FHD A;  2O31 A;  2ZPF B;  3M0U A;  3NGP A;  3RDV A;  4DQ2 A;  2RJF A;  3X26 B;  1VQ4 T;  5HKC A;  1OZ3 A;  4M75 B;  2QYZ A;  3I55 A;  2GQV A;  4N4G A;  5CO7 A;  4C0D C;  3I9Q A;  4A63 B;  4XTV A;  4AFZ C;  4M7A G;  5ECA A;  2HQH A;  3PVQ A;  3C12 A;  2LQN A;  4M7D C;  3Q1J A;  2MPX C;  1PKS A;  1WNL A;  3CPW P;  2XIC A;  1WZO A;  4B6M A;  1RAG B;  4M4Z A;  3VS6 A;  4YTL A;  5C6S A;  4KUD K;  1QKW A;  4VUB A;  1RLQ C;  4J9I A;  5LJ5 h;  5FRM A;  5KH6 A;  4OML A;  2YDL A;  4MDX A;  4FCY A;  2K5L A;  2HEQ A;  1KQS P;  4NL2 A;  2QQB A;  2HCK A;  3EGX B;  2HSP A;  2HDA A;  4E7J A;  2CP5 A;  1WHG A;  1F1B B;  3ER0 A;  4X9D A;  2KRM A;  2DNU A;  2RI3 A;  3JB9 J;  3VKI A;  3CCR T;  2E3H A;  2FZC B;  2V8J A;  1YFN A;  2P4R A;  1M3B A;  6AT1 B;  3M0Q A;  2Y90 A;  4M77 G;  2FRW A;  1FXX A;  2NLU A;  1RL2 A;  1PSE A;  3MJX A;  3CMA A;  2EVR A;  2I2L A;  2KE9 A;  2X51 A;  3CC2 T;  3HL8 A;  1N8R C;  2M9U A;  1EZZ B;  4OMO A;  5CKE A;  1WJQ A;  2G3R A;  4EIK A;  1UG1 A;  1QLY A;  2LX7 A;  1VQ8 A;  3EG1 A;  4GLK A;  1AZG B;  2F5K A;  1M9S A;  2QGG A;  3JB9 F;  4PL6 A;  3D7S B;  2XMF A;  1HYO A;  1OYX A;  3MEW A;  1YJN A;  1M8V A;  2VC8 A;  2O88 A;  2X3X D;  5LJ5 f;  5GMK j;  1UUE A;  2E65 A;  3HP9 A;  3OYL A;  3TU4 K;  5GMK i;  1PG5 B;  1M90 R;  1AHJ B;  3ZL7 C;  1I5L A;  4PJO E;  2L3P A;  3F70 A;  2MYS A;  3KBG A;  1M90 U;  4HCB A;  2EYZ A;  2NUT B;  4ZTF A;  4ESR A;  2XDD A;  2YWW A;  2EQK A;  2V8K A;  1UGV A;  2BIV A;  2YSQ A;  4FYY B;  1H92 A;  3CXC S;  3G6E T;  1U3O A;  4IUP A;  1AWX A;  2Y4Y A;  3SWN C;  2QEX A;  2DJZ A;  1K8A R;  2DL7 A;  1SHF A;  1QWE A;  2EKO A;  5GAN j;  1TWB A;  3JV3 A;  2M0Y A;  1T3S A;  1MMN A;  2VWF A;  4RG8 A;  1K8A U;  2LC4 A;  3REB B;  4P5N A;  2O4X A;  2MWO A;  4PLL A;  3DB3 A;  4KGV B;  3M58 A;  1VQ4 Q;  5FLX E;  2RNA A;  1PC0 A;  3QSU A;  5EG2 A;  4FYX B;  5CKF A;  1D3B A;  2EYX A;  2JVV A;  2OAU A;  2VGM A;  3BW1 A;  5DLO A;  1ZA2 B;  1X75 C;  4M78 G;  2M02 A;  1OOT A;  1B34 B;  3OYH A;  2AK5 A;  1E6H A;  1X2K A;  2P0Q A;  4J9E A;  1SRL A;  2XD0 A;  1VOM A;  1T0H A;  2OTL Q;  2JS2 A;  5FRN A;  3NPF A;  4IUV A;  3CCM T;  1WYX A;  1VQO T;  4XU3 A;  3I5R A;  1JJ2 A;  3G7Z A;  4PJJ A;  2RJC A;  3QJ6 A;  3S3N A;  2LX9 A;  2GFA A;  3GNF B;  2PUK B;  2SEM A;  3PFS A;  3UAT A;  1GBQ A;  1GFC A;  4KGZ B;  3RMQ A;  3OW2 S;  2BE9 B;  1QKX A;  1VQ5 Q;  1Q7Y R;  2FPF A;  3CQT A;  2RA2 A;  1H3Z A;  4OB2 B;  1ABO A;  4M77 F;  1Q7Y U;  2PUO B;  2CSI A;  3M0R A;  5CCA A;  3CCQ A;  1K73 R;  1AD5 A;  3M57 A;  7AT1 B;  1JO8 A;  3M4G A;  2FB7 A;  2XK0 A;  4C0F A;  1X2Q A;  1K73 U;  2DBK A;  4DBQ A;  3CC2 Q;  2EW3 A;  1YIJ A;  3CCU A;  3HRU A;  3CCS A;  2M51 A;  2R5A A;  4C92 D;  1KD1 R;  2E10 A;  2ED1 A;  1UGS B;  4ATO A;  4C92 E;  1KD1 U;  4X9C A;  2HMA A;  3J7A F;  2ZAE A;  3G71 T;  3PGG A;  2C0T A;  4M75 E;  5D6X A;  3QYG B;  1QCN A;  1EFN A;  1WI7 A;  3VS2 A;  1YHQ T;  2K3Y A;  4OVA A;  3G1J A;  4JPB W;  1IRE B;  2AZV A;  2O9S A;  3M55 A;  2R57 A;  5LJ3 d;  4PJO A;  4ZGJ B;  1X43 A;  3EG9 B;  4OF1 A;  3M59 A;  2ROL A;  3EG2 A;  1VQ4 A;  1NJI R;  3OYJ A;  1PD1 A;  5I22 A;  1RAF B;  4EMH A;  4DA4 A;  2X9H A;  1NJI U;  1VQL A;  1IHV A;  3EGD A;  5LL6 S;  1R0B G;  1VQN T;  5CIU A;  3G6E Q;  5FWB A;  4C8Q D;  5GAO q;  5CK9 A;  1PRM C;  4M7D F;  1VQ6 T;  3EFS A;  4C8Q E;  1SF9 A;  1TSF A;  2EAY A;  4QQ6 A;  5D6W A;  1X6G A;  1UDL A;  3KXT A;  3VRZ A;  4EPC A;  1RAE B;  2EQM A;  3MPU B;  1PNJ A;  1MV3 A;  3X25 B;  3R6O A;  4PKC C;  4CI0 C;  3JCM J;  1Y57 A;  2RJE A;  3CME A;  2RMO A;  5I2S A;  3GBQ A;  4C5G A;  1WX6 A;  1RAD B;  5GAN e;  4BE1 A;  1H8K A;  3OQ5 A;  3A5Z B;  4Z89 A;  1Z9Z A;  3RNJ A;  3OA6 A;  2L3S A;  1S1N A;  3CCR A;  3LWH A;  4QW2 A;  2RB6 A;  4ZGE B;  2ZZD A;  1YJ9 A;  4M7D D;  1WHJ A;  1XOV A;  1Y0M A;  4E47 A;  2KT1 A;  2O9V A;  3CD6 T;  3OSS C;  3EFO A;  1M2O A;  5FU6 C;  4MZT A;  5GMK m;  5LJ3 h;  3PE0 A;  4JRP A;  3C95 A;  4KRT A;  1K9A A;  1FYN A;  3PIP A;  3U23 A;  5CR2 A;  4MML A;  4E7K A;  4CC2 A;  4ME7 A;  4RCB A;  1G5V A;  2HD0 A;  3SDZ A;  1KSW A;  1K0X A;  4TVR A;  4HXJ A;  2K6D A;  3JCM g;  2DL5 A;  4Z88 A;  5KYU B;  1ZX6 A;  3ZFJ A;  3JB9 H;  1TUD A;  1E6G A;  2DEU A;  1O9S A;  2ED0 A;  2FRY A;  2KVQ G;  2QAS A;  3JCM X;  1PD0 A;  3MP1 A;  4KH0 B;  4AFQ C;  2EFI A;  5FU7 C;  1OU8 A;  4N4H A;  2GTO A;  3OMG A;  1SHG A;  3OBW A;  3A98 A;  5J26 A;  4KUI A;  4ZGD B;  2H8H A;  1Q95 G;  3QZ5 B;  4EMK C;  3OYA A;  3EHQ A;  3I56 T;  5HY6 A;  3FRN A;  3CPW S;  3E9G A;  1RI9 A;  1WJR A;  4AFS C;  4HCZ A;  2O01 E;  1M1G A;  1BI0 A;  1OUL A;  1QVF P;  3CC4 Q;  1MHN A;  3X20 B;  3G71 Q;  1R8O B;  2D0N A;  1WXT A;  2E70 A;  4M75 A;  4X1V A;  2JTE A;  1UHC A;  1V76 A;  3QWX X;  3WVE B;  2K3X A;  1GCP A;  1C0M A;  5IHI A;  1YCY A;  4M7A C;  1WHM A;  1OX8 A;  3GF5 A;  2AT1 B;  3EGD B;  4J9D A;  5LJ3 f;  1GBR A;  3C94 A;  3VS1 A;  3P8B B;  4RTV A;  4LD9 K;  3INZ A;  2K5I A;  1M3A A;  2GNC A;  4RG2 A;  4MMK A;  5KYY B;  2D0Q B;  4BUG A;  1RAI B;  4PK4 A;  1G3T A;  3EFR A;  2D9T A;  3PTA A;  3V8K A;  2BKD N;  4BY6 C;  2E4H A;  3JCM Q;  1DJ7 B;  2JS0 A;  3A8M B;  1YCS B;  1VQN Q;  1LCK A;  2DD5 A;  2KXD A;  2KXC A;  3EGX A;  2YXY A;  4R55 A;  3VS4 A;  3OW2 A;  5IAY A;  3UA6 A;  4RCC A;  4QVD A;  4OMP A;  1VQ6 Q;  1KIK A;  1XTD A;  4D8D A;  1R77 A;  1W70 A;  5J39 A;  2K4Y A;  2R5M A;  1KJW A;  5GAO m;  3TRE A;  3CCM A;  1QVF A;  2ZPI B;  4HKE A;  4RMO A;  1VQO A;  3OYM A;  3VYG A;  5A0L A;  1TUC A;  1NZ9 A;  5GAN 8;  1KQ2 A;  2H3E B;  1Q81 R;  2MK5 A;  3CCE T;  3CCL T;  1NG2 A;  2LDM A;  4J9H A;  1C1A A;  1VQ9 T;  2WSF E;  1Q81 U;  5AT1 B;  1VQP T;  4F14 A;  4PJO G;  1G3Y A;  5GAM f;  2GGR A;  3RKX A;  5GAN d;  2RF0 A;  1FWZ A;  4QVZ A;  4F7U E;  4HT8 A;  2CH4 W;  4FYV B;  4EMG A;  2A3L A;  3CD6 Q;  4RTW A;  1M90 C;  3MO8 A;  3HRS A;  2CP0 A;  2PQW A;  2CUD A;  2PNI A;  1S72 Q;  1WXB A;  3LW5 E;  1KHC A;  3VS5 A;  1VYU A;  2NWM A;  1WJS A;  1SKU B;  2KYM A;  1WIE A;  4BE0 A;  1KFZ A;  2D8J A;  5GMK h;  1UB4 A;  2YLB A;  1B3Q A;  2JMA A;  1K8A C;  2H3J A;  3G71 A;  1RAC B;  1UFF A;  1Y96 B;  1WHL A;  4RTU A;  4ZNX A;  2RD1 A;  2NUT A;  1P92 A;  3M54 A;  4C92 B;  1YHQ A;  3ASK A;  5IXB A;  5GAN 6;  4FL6 A;  2D8H A;  1U06 A;  3P8H A;  2FZK B;  8AT1 B;  3DKM A;  3I56 Q;  1VIE A;  3VRY A;  4UC4 A;  1AZE A;  1WHK A;  1JXM A;  1OX9 A;  1YIT Q;  4KH1 B;  3I35 A;  1M1F A;  1W2B S;  5GAN h;  5A0D A;  5CAI A;  2JZ2 A;  3LGL A;  2DIL A;  3CCJ A;  1AWO A;  1JEG A;  2OTL T;  2BTT A;  5GAM g;  1KHI A;  1W6X A;  1YI2 T;  4V2S A;  2X4W A;  3L42 A;  4PFP A;  3FEO A;  3M0T A;  3V7C A;  4M78 C;  1YP5 A;  3TCJ A;  1B34 A;  2GBQ A;  4DOW A;  1ZUU A;  1WQW A;  2JXB A;  5AYF A;  2DZC A;  4ELZ C;  2JN0 A;  2P4T A;  2M1H A;  1U5S A;  2EGA A;  1RLP C;  4C8Q B;  2RN8 A;  1Q7Y C;  2CZ6 B;  2X35 A;  1AWJ A;  5M9O A;  1VQ5 T;  1X6O A;  1M3C A;  5CQX A;  4WF2 A;  2OJ2 A;  4R0K A;  4JUV A;  1XJW B;  2DYB A;  1K73 C;  3TSW A;  5A0G A;  1G3S A;  1ZSG A;  3G4S A;  1AOJ A;  2RK1 A;  4AT1 B;  4LE9 A;  4RTZ A;  1JQQ A;  4E7Z A;  3CCV T;  4XU2 A;  3J80 E;  4M75 G;  3V7R A;  1KD1 C;  4GBQ A;  9ATC B;  3O5Z A;  3JCM W;  1VIF A;  1VQ7 A;  2KRO A;  5HK3 A;  4C0D B;  2ATC B;  3OMC A;  2LQ8 A;  2P0P A;  3CCE Q;  2CGH A;  1ZA1 B;  4Y92 A;  2DIQ A;  3CCL Q;  3LGF A;  4M7D B;  3E9F A;  1B07 A;  1VQ9 Q;  2CDT A;  1MMA A;  4BI8 B;  5GAN f;  1VQP Q;  2F2V A;  1TS9 A;  2PZ1 A;  4J83 A;  4ORZ A;  4RTY A;  1UGR B;  3M56 A;  4F7U A;  4XK8 E;  2YHT A;  4AFU C;  1G8X A;  2LTO A;  4BB7 A;  3S3O A;  2A28 A;  5CKD A;  4B9W A;  1PCX A;  1NJI C;  4LN2 A;  2EBP A;  4DOV A;  2E64 A;  1KQ1 A;  2LMJ A;  3KUF A;  3LH5 A;  1ZBJ A;  4K11 A;  3CEY A;  4HVU A;  3QUI A;  2ZCF B;  3I5S A;  3JB9 D;  1JJ2 P;  4GLM A;  2E3I A;  2LCS A;  3MP6 A;  1NE8 A;  2HKN A;  1JU5 C;  2QQA A;  1QP3 A;  1SSF A;  1GFD A;  4AG2 C;  3EG9 A;  1IXD A;  2QDY B;  3OYN A;  2KEA A;  1WHH A;  3QWY A;  2MOX A;  1Y07 A;  5FRO A;  4OB3 B;  1WFW A;  1VQK T;  4CC3 A;  2E5K A;  3M5A A;  2PU9 B;  1QVG A; 
#chains in the Genus database with same CATH homology
 1H3H A;  2QDL A;  1G2B A;  2K2M A;  2CSQ A;  2FPD A;  3VS3 A;  1QCF A;  1SRM A;  1NLO C;  1YWO A;  1NEB A;  5FWB A;  1PRM C;  2KBT A;  1JXO A;  2DL4 A;  3EGU A;  1J3T A;  2DF6 A;  1X6G A;  1UDL A;  1M27 C;  3VRZ A;  2V1R A;  1AWW A;  2DX1 A;  5GJV B;  2FEI A;  4JZ3 A;  4F16 A;  1ZUK A;  1PNJ A;  1MV3 A;  4J9B A;  3C0C A;  2DA9 A;  4HVW A;  4LUD A;  4IIM A;  3VS7 A;  1Y57 A;  2RQU A;  1PRL C;  2RMO A;  3GBQ A;  1A0N B;  1WX6 A;  2ABL A;  4JJB A;  3EG3 A;  1FMK A;  1H8K A;  2AKK A;  1OEB A;  1Z9Z A;  3RNJ A;  4Z89 A;  2F2X A;  3M0S A;  2L3S A;  1S1N A;  1BB9 A;  1ZUY A;  1YNZ A;  3EHR A;  1OV3 A;  2FO0 A;  2J6F A;  1VYT A;  1XOV A;  1Y0M A;  2ENM A;  2KT1 A;  2O9V A;  4JJC A;  2EGC A;  2DRM A;  2EYY A;  2V1Q A;  5IHN A;  1OPL A;  1MV0 B;  2J6O A;  1VA7 A;  3PE0 A;  2DM1 A;  4KRT A;  1K9A A;  2I0N A;  2C0I A;  2K7A A;  4LUE A;  1FYN A;  1YWP A;  1T3L A;  3U23 A;  4CC2 A;  3R6N A;  1ARK A;  4RTX A;  3IQL A;  4HCK A;  4J9G A;  1KSW A;  3TVT A;  2BZY A;  1K76 A;  2L2P A;  1X69 A;  1N5Z A;  1K0X A;  2GTJ A;  4HXJ A;  2K6D A;  2GQI A;  2DL5 A;  4Z88 A;  1ZX6 A;  1NEG A;  1PWT A;  1TUD A;  2F2W A;  1E6G A;  4CC4 B;  2G6F X;  2FRY A;  2ED0 A;  2D1X A;  1NYG A;  2EGE A;  2A37 A;  5I11 A;  4AFQ C;  2ECZ A;  4JZ4 A;  1M8M A;  4OMM A;  2YT6 A;  2GTO A;  1ZLM A;  1SHG A;  3A98 A;  3H41 A;  1WA7 A;  1YN8 A;  2YUN A;  5FWC A;  2DBM A;  1UJ0 A;  2VKN A;  1WDX A;  4DEY A;  2YUO A;  2H8H A;  3RBB B;  1Z9Q A;  3EHQ A;  1GL5 A;  1MUZ A;  1NLP C;  2RPN A;  1RI9 A;  1X6B A;  4AFS C;  2BZX A;  2L0A A;  2A36 A;  2OI3 A;  3EG0 A;  2KYB A;  2O31 A;  2DMO A;  1CKB A;  1GCQ A;  2D0N A;  2DL3 A;  1WXT A;  3M0U A;  3NGP A;  4X1V A;  2JTE A;  1UHC A;  3QWX X;  1GCP A;  1BK2 A;  5IHI A;  2RQW A;  2RQT A;  3I9Q A;  4A63 B;  4AFZ C;  5ECA A;  3PVQ A;  4J9D A;  2LQN A;  1GBR A;  4RUG A;  5EC7 A;  3VS1 A;  4RTV A;  3UF4 A;  1PKS A;  2CRE A;  3UA7 A;  1M3A A;  2GNC A;  4D8K A;  4M4Z A;  3VS6 A;  2FG0 A;  2ESW A;  2LQW A;  1QWF A;  1QKW A;  4IIO A;  1RLQ C;  4J9I A;  2JS0 A;  4OML A;  2YDL A;  1AEY A;  1HD3 A;  1YCS B;  1LCK A;  2KXD A;  2KXC A;  2X3W D;  3VS4 A;  2DVJ A;  2HEQ A;  1BU1 A;  2B86 A;  3UA6 A;  2HCK A;  3ULR B;  2HSP A;  2HDA A;  4J9F A;  4OMP A;  1KIK A;  4D8D A;  1W70 A;  2LJ3 A;  1K0S A;  1I0C A;  1KJW A;  1ABQ A;  2KRM A;  2DNU A;  2RQR A;  4LNP A;  2EKH A;  4FSS A;  1TUC A;  2JM8 A;  2P4R A;  1M3B A;  5IHK A;  2DL8 A;  3M0Q A;  2FRW A;  2CT3 A;  1NG2 A;  2EYW A;  2DRK A;  2J6K A;  4J9H A;  4F14 A;  2DLP A;  3FJ5 A;  2GGR A;  1PHT A;  2KE9 A;  2RF0 A;  1K4U S;  2CH4 W;  1UTI A;  2BZ8 A;  3NHN A;  2JMC A;  1TG0 A;  4OMO A;  4RTW A;  4WCI A;  1UEC A;  4EIK A;  1UG1 A;  2CUD A;  1QLY A;  2PNI A;  2LX7 A;  3EG1 A;  5HCK A;  1AZG B;  1WXB A;  2XMF A;  1VYU A;  3VS5 A;  2FPE A;  2NWM A;  2KYM A;  1WIE A;  4QT7 A;  2O88 A;  4OMN A;  2NUZ A;  2X3X D;  1SEM A;  1UJY A;  1UUE A;  1KFZ A;  2D8J A;  1G83 A;  2SRC A;  4HVV A;  4OMQ A;  1B3Q A;  2JMA A;  1WXU A;  2O2O A;  2JW4 A;  1IO6 A;  3ZL7 C;  1UFF A;  2L3P A;  4RTU A;  4ZNX A;  1WLP B;  2DJQ A;  2EYZ A;  4ESR A;  1BBZ A;  1SPK A;  5IXB A;  2KT8 A;  1HJD A;  1NM7 A;  5IXF A;  5L23 A;  2D8H A;  2KR3 A;  2KRS A;  1U06 A;  1UGV A;  2YSQ A;  1H92 A;  1U3O A;  3PVL A;  2MIO A;  3VRY A;  1AZE A;  1JXM A;  1AWX A;  2DL7 A;  3I35 A;  1SHF A;  2MCN A;  1QWE A;  3JV3 A;  2M0Y A;  1T3S A;  2VWF A;  2KNB B;  1VYV A;  3REB B;  2AKL A;  2DIL A;  1AWO A;  1JEG A;  3M0P A;  2BTT A;  1W6X A;  4J9C A;  5IH2 A;  1HSQ A;  2ROT A;  2RNA A;  2HBW A;  2PTK A;  2EYX A;  2K9G A;  3M0T A;  3VS0 A;  2J05 A;  1YP5 A;  2OAW A;  2GBQ A;  2VVK A;  1ZUU A;  2JXB A;  2DE0 X;  1OOT A;  2LNH B;  2CT4 A;  2AZS A;  2KGT A;  3NMZ C;  5GJW B;  2AK5 A;  1U5S A;  1M30 A;  1E6H A;  1X2K A;  2EGA A;  4J9E A;  1RLP C;  1SRL A;  5FW9 A;  3H0F A;  1T0H A;  2RN8 A;  2JS2 A;  3NPF A;  1AWJ A;  4CC7 A;  2K79 A;  4Z8A A;  1M3C A;  1WYX A;  3I5R A;  2OJ2 A;  4DEX A;  4RTT A;  4R0K A;  2W0Z A;  1T0J A;  2DYB A;  2YUP A;  3TSW A;  2JM9 A;  2JT4 A;  1ZSG A;  1AOJ A;  4LE9 A;  4RTZ A;  2SEM A;  2CUB A;  3UAT A;  1GBQ A;  1GFC A;  1JQQ A;  2J06 A;  4E6R A;  1GCQ C;  3KFV A;  1QKX A;  2YUQ A;  3SEM A;  3REA B;  1I1J A;  4GBQ A;  2FPF A;  2LZ6 B;  3CQT A;  3O5Z A;  2KRO A;  1ABO A;  2L3Q A;  2K3B A;  2C0O A;  4Y92 A;  2CSI A;  2W10 A;  3M0R A;  1B07 A;  1AD5 A;  2CDT A;  1NYF A;  1JO8 A;  2IIM A;  4CC3 A;  2F2V A;  2PZ1 A;  3SHW A;  4ORZ A;  4RTY A;  1X2Q A;  2DBK A;  2LJ1 A;  3THK A;  2RQV A;  2EW3 A;  1SSH A;  2M51 A;  4AFU C;  1PKT A;  2LJ0 A;  2ED1 A;  1GRI A;  2A28 A;  1OPK A;  1V1C A;  3H0I A;  4AG1 C;  4LN2 A;  2EPD A;  2EBP A;  2C0T A;  2LP5 A;  3H0H A;  2LMJ A;  3LH5 A;  1UHF A;  1ZBJ A;  1EFN A;  4K11 A;  3TSZ A;  4HVU A;  1WI7 A;  3VS2 A;  3I5S A;  1AVZ C;  4GLM A;  4JPB W;  2LCS A;  1W1F A;  1JU5 C;  1GFD A;  2AZV A;  1K1Z A;  2O9S A;  4AG2 C;  1UE9 A;  2J7I A;  2KRN A;  1X43 A;  2A08 A;  2CH4 A;  1CKA A;  4F17 A;  2KEA A;  2EQI A;  2ROL A;  3EG2 A;  3QWY A;  2MOX A;  1E7O A;  1CSK A;  5I22 A;  1X27 A;  1WFW A;  4JJD A;  2E5K A;  1RUW A;  2EVR A;  1I07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...