3REHA

2.5 angstrom crystal structure of the nucleosome core particle assembled with a 145 bp alpha-satellite dna (ncp145)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rehA00
4H9OA 4YM6C 4YS3D 3UT9C 4QLCD 5B2JD 3X1VB 3AFAC 1EQZC 1P3GA 3AYWB 4J8WD 1M18A 3W97B 4J8VC 3LZ1C 3MGPB 4H9QB 4HGAB 5BNXA 3A6ND 1P3AD 3AZGD 1KX5C 5B0YD 4J8XB 3RELB 3KWQB 3KUYC 5DNMC 4JJNA 5CPJD 5B1MB 4XUJB 1P3PB 1S32C 3UTBA 5B24C 2LY8A 3W99B 5BT1C 3LELA 5KDMA 1BFMA 1P3LD 5GT0A 4G92B 2F8NB 3B6GB 1M19D 1ZLAD 5CPKD 4X23C 3MNND 3AZEA 1H3OB 5B31A 1P3IB 1P3FA 3WAAB 1P34D 1F66B 5CHLB 2HUEB 3B0DC 1U35A 4KUDB 1P3OB 5GSUA 4WU8A 3X1TB 5AV5D 5JRGA 5F99A 3REHC 4XZQB 3LZ0A 3REKB 5AY8B 4AWLB 4Z5TB 3AZLB 5FUGB 1R4VA 3X1UC 1P3BC 5AV8A 3C1BB 3MGSD 2AROD 3AZIB 5AVCB 5B33C 1TZYA 4H9OB 4J8UD 2BYMA 3AV2D 1HQ3A 4CAYA 3AZFA 4KGCD 2IO5B 2FJ7D 2HIOD 4YS3A 1P3GB 5AV6D 1JFIA 1M18B 4QLCA 5B2JA 3C1CD 4LD9D 5BNXB 4J8WA 3O62C 3TU4D 1KX3D 4H9PA 3A6NA 1P3AA 3UT9D 5B0YA 3AZMC 5BS7C 1P3KC 1KX4C 3AFAD 1EQZD 3UTBB 5CPJA 5KDMB 3VH6A 5GXQA 3W96D 4DRBA 1BH9A 3REID 1P3LA 3AZEB 1P3FB 5B31B 3MGRC 5DNMD 3AZNB 3REJB 4KHAA 5B2ID 1M19A 1ZLAA 5CPKA 5AVBC 3MNNA 1S32D 3MVDD 3X1SB 1P34A 2CV5D 4UUZB 5GSUB 4WU8B 2NQBD 3W98C 2F8NH 5F99B 3LZ0B 4X23D 5AV5A 5CPIA 5B31G 5AV8B 3X1VC 3B0CT 4E44A 3AYWC 3AZJD 1F1EA 4G91B 3MGSA 3MGPC 2AROA 5B0ZB 2BYMB 4HGAC 1HQ3B 4CAYB 3REHD 5BNVA 3MGQD 4J8UA 4J8XC 4WNNA 3VH5A 3AV2A 3KWQC 3AN2D 4YS3B 4KGCA 3X1UD 2FJ7A 2HIOA 1JFIB 5B1MC 4QLCB 5B2JB 3KXBD 1P3PC 5AV6A 3W99C 4J8WB 1M1AB 3WTPE 3AZKD 3C1CA 1ID3D 4LD9A 4EO5B 3A6NB 1P3AB 3NQUA 2NZDB 4CSRA 3TU4A 1KX3A 3LJAB 3WAAC 1P3IC 1F66C 3UT9A 5CPJB 2HUEC 4R8PC 3AFAA 4KUDC 5GXQB 3VH6T 1EQZA 1BH9B 4NFTA 3O62D 3X1TC 3W96A 4XZQC 3REIA 4KHAB 3AZMD 1M19B 3REKC 1ZLAB 5AY8C 4AWLC 5CPKB 3AZLC 1P3KD 3R45B 4WU9D 5B2IA 3C1BC 5E5AC 2RVQC 3AZIC 5AVCC 1S32A 3MVDA 1WWIA 1P3MB 2CV5A 3B6FB 2NQBA 5CPIB 2YFVA 2IO5C 3UTAA 4X23A 1M18C 5DNND 2AROB 3WTPD 3AZJA 2BYKB 5B32D 4ZBJB 5BNVB 4J8UB 2PYOD 4H9NA 3VH5T 3AZHD 3REHA 4KGCB 3NQJA 3MGQA 5GT3B 3AN2A 3AYWD 3UTBC 4Z66D 3X1UA 3KXBA 5B40B 4LD9B 3NQUB 3AZKA 4ZUXD 3TU4B 1KX3B 3WA9D 3AZEC 1P3FC 1ID3A 5B31C 3AZNC 3REJC 4H9RA 3AV1D 3WKJD 2L5AA 5CP6D 3X1SC 1EQZB 3W99D 5GSUC 1N1JA 4M6BA 5B1LD 4WU8C 5F99C 3W96B 3LZ0C 3REIB 2YFWA 5AV9C 1P3ID 4YM6D 1TAFA 5B2IB 3AZMA 4JJNB 3AZGA 1P3KA 4R8PD 1S32B 3MVDB 1AOIC 4WU9A 4G91C 4NE5A 2CV5B 5B0ZC 3LELB 4J8VD 3LZ1D 2NQBB 2YFVB 3UTAB 5GT0B 1KX5D 3AZLD 5BO0A 4YS3C 4QLCC 3KUYD 5B2JC 5E5AD 2RVQD 3AZJB 4J8WC 1U35B 1M1AC 5G49A 5B24D 5DNNA 3WTPA 5BT1D 4H9NB 4EO5C 2NZDC 3NQJB 5B32A 5JRGB 3MGQB 3LJAC 2PYOA 3AZHA 3AN2B 4Z2MG 1M18D 5CPJC 3KXBB 5GXQC 3AYWA 1KU5A 4Z66A 3AZKB 3W97C 1TZYB 1ID3B 4ZUXA 1M19C 1ZLAC 3AZFB 5CPKC 3WA9A 1B67A 3RELC 3AV1A 1P3BD 3WKJA 1N1JB 5CP6A 4XUJC 1P3MC 3W99A 3B6FC 2YFWB 5B1LA 5B33D 5CPIC 3AZND 5C3IB 3REJD 4G92C 1TAFB 4H9PB 3AZMB 3AZGB 3B6GC 5B0YB 1H3OA 1P3IA 4YM6A 3X1SD 4WU9B 2AROC 4R8PA 4WU8D 1BH8A 3LZ0D 4ZBJC 4J8UC 4H9SC 1P3OC 5AV9D 4J8VA 3LZ1A 4KGCC 1P3LB 5GT3C 1KX5A 3AZLA 5FUGA 1AOID 4Z5TC 3MNNB 1KX4D 2JSSA 3V9RA 5JA4A 3KUYA 5G49B 5E5AA 5DNMA 1P34B 5DNNB 5B40C 5B0ZD 3WTPB 5B32B 5B24A 3TU4C 1KX3C 4Z2MH 2PYOB 3AZHB 5AV5B 3MGRD 5AVBD 4Z66B 1M1AD 1B6WA 1P3GC 3MGSB 3W96C 2NZDD 3REIC 3W98D 4ZUXB 3LJAD 3WA9B 5B32G 4WNNB 3AV2B 5B2IC 4JJNC 3AV1B 2FJ7B 2HIOB 3WKJB 3MVDC 5GXQD 5CP6B 3X1VD 4E45A 2CV5C 1P3BA 5AV6B 4NE6A 5B1LB 3LELC 3W97D 2NQBC 3MGPD 3C1CB 3UTAC 5GT0C 5B33A 1A7WA 4CSRB 4YM6B 4J8XD 3RELD 3AZNA 3REJA 3KWQD 3UT9B 5B1MD 4R8PB 4XUJD 1P3PD 4WV4B 3X1SA 1BH8B 3AZJC 1P3MD 1U35C 3AFAB 3B6FD 4UUZA 2CWEA 4J8VB 3LZ1B 5CPID 1HTAA 5JRGC 2F8ND 3MGQC 2F8NG 3O62A 4NE3A 3B0CW 5AV9A 1KX5B 3B6GD 3AN2C 3WAAD 3V9RB 5JA4B 3KXBC 3KUYB 5DNMB 5E5AB 1F66D 5AV8C 5BS7A 1AOIA 1KX4A 4KUDD 3AZKC 5B24B 5B0ZA 1P3OD 1TZYC 1ID3C 3X1TD 1HQ3C 5GT3D 4XZQD 3AZFC 3REKD 1Q9CA 5AY8D 4Z5TD 4X23B 3MGRA 5B40D 3C1BD 3AZID 1WWSA 3B0DB 5AVBA 5AVCD 1M1AA 4LD9C 2NZDA 5C3IC 3W98A 3A6NC 4DRAA 1P3AC 3REHB 3AZGC 3LJAA 5B0YC 3VH6W 4WU9C 1P3GD 3X1UB 1P3BB 3X1VA 3W97A 5B33B 3MGPA 4H9QA 1P3LC 4JJND 4H9RB 4J8XA 3R45A 3MNNC 3RELA 3KWQA 3UTBD 1P34C 5DNNC 3WTPC 5B1MA 4XUJA 3LELD 1P3PA 1P3MA 3UTAD 5GT0D 5B32C 3B6FA 2PYOC 3O62B 5AV9B 3AZHC 3AZED 5AV5C 1P3FD 5B31D 2F8NA 3B6GA 1AOIB 1P3KB 4Z66C 3WAAA 1U35D 1KX4B 1F66A 3B0BA 3MGSC 3VH5W 4WZSB 2BYKA 5GSUD 4KUDA 5JRGD 5F99D 4ZUXC 4H9SA 3WA9C 1P3OA 3X1TA 3AV2C 5BO0B 5GT3A 4XZQA 1ULYA 3MGRB 3AV1C 2HIOC 5AV8D 2FJ7C 3WKJC 5CP6C 3REKA 5AY8A 4Z5TA 5AVBB 5AV6C 5B40A 3C1BA 5B1LC 3KSYA 1TZYD 3AZIA 5AVCA 3C1CC 2F8NK 1HQ3D 3W98B 3AZFD
chains in the Genus database with same CATH superfamily
4H9OA 4YM6C 4YS3D 3UT9C 4QLCD 5B2JD 3X1VB 3AFAC 1EQZC 1P3GA 3AYWB 4J8WD 1M18A 3W97B 4J8VC 3LZ1C 3MGPB 4H9QB 4HGAB 5BNXA 3A6ND 1P3AD 3AZGD 1KX5C 5B0YD 4J8XB 3RELB 3H0LC 3KWQB 3KUYC 5DNMC 4JJNA 5CPJD 5B1MB 4XUJB 1P3PB 1S32C 3UTBA 5B24C 2LY8A 3W99B 5BT1C 3LELA 5KDMA 1BFMA 2ZY3A 1P3LD 5GT0A 4G92B 2F8NB 3B6GB 1M19D 1ZLAD 5CPKD 4X23C 3MNND 3AZEA 1H3OB 5B31A 1P3IB 1P3FA 3WAAB 1P34D 1F66B 5CHLB 2F2AC 2W8SA 2HUEB 3B0DC 1U35A 4KUDB 1P3OB 5GSUA 4WU8A 3X1TB 5AV5D 5JRGA 5F99A 3REHC 4XZQB 3LZ0A 3REKB 5AY8B 4AWLB 4Z5TB 3AZLB 5FUGB 1R4VA 3X1UC 1P3BC 5AV8A 3C1BB 3MGSD 2AROD 3AZIB 5AVCB 5B33C 1TZYA 4H9OB 4J8UD 2BYMA 3AV2D 1HQ3A 2ZY4A 4CAYA 3AZFA 4KGCD 2IO5B 2FJ7D 2HIOD 4YS3A 2ZM5A 1P3GB 5AV6D 1JFIA 1M18B 4QLCA 5B2JA 3C1CD 4LD9D 5BNXB 2G5IC 4J8WA 3O62C 3TU4D 2DF4C 1KX3D 3KFUG 4H9PA 3A6NA 1P3AA 3UT9D 5B0YA 3AZMC 5BS7C 1P3KC 1KX4C 3AFAD 3EPLA 1EQZD 3UTBB 5CPJA 5KDMB 3VH6A 5GXQA 3W96D 4DRBA 1BH9A 3REID 2FFFB 1P3LA 3AZEB 1P3FB 5B31B 3MGRC 5DNMD 3AZNB 3REJB 4KHAA 5B2ID 1M19A 1ZLAA 5CPKA 5AVBC 3MNNA 1S32D 3MVDD 3X1SB 1P34A 2CV5D 4UUZB 5GSUB 2BG1A 4WU8B 2NQBD 3W98C 2F8NH 5F99B 3LZ0B 4X23D 5AV5A 5CPIA 5B31G 5AV8B 3H0MC 3X1VC 3B0CT 4E44A 3AYWC 3AZJD 1F1EA 4G91B 3MGSA 3MGPC 2AROA 5B0ZB 2BYMB 4HGAC 1HQ3B 3F6TA 4CAYB 3REHD 5BNVA 3MGQD 4J8UA 4J8XC 4WNNA 3VH5A 3AV2A 3KWQC 3AN2D 4YS3B 4KGCA 3X1UD 2FJ7A 2HIOA 1JFIB 5B1MC 4QLCB 5B2JB 3KXBD 1P3PC 2Y2JA 5AV6A 3W99C 4J8WB 1M1AB 3WTPE 3AZKD 3C1CA 1Z2CB 1ID3D 4LD9A 4EO5B 3H0RC 3A6NB 3NQUA 1P3AB 2NZDB 4CSRA 3TU4A 1KX3A 3LJAB 3WAAC 1P3IC 1F66C 3UT9A 5CPJB 2HUEC 4R8PC 3AFAA 4KUDC 5GXQB 3VH6T 1EQZA 1BH9B 4NFTA 3O62D 3X1TC 3W96A 4XZQC 3REIA 4KHAB 3AZMD 1M19B 3REKC 1ZLAB 5AY8C 4AWLC 5CPKB 3AZLC 1P3KD 3R45B 4WU9D 3EG5B 5B2IA 3C1BC 2JCHA 2RVQC 5E5AC 3AZIC 5AVCC 1S32A 3MVDA 3FDDA 1WWIA 1P3MB 2CV5A 3B6FB 2NQBA 5CPIB 2YFVA 2IO5C 3UTAA 2ZY5A 4X23A 1M18C 5DNND 2RIQA 2AROB 3WTPD 3AZJA 2BYKB 5B32D 2VQRA 3A1KA 4ZBJB 5BNVB 4J8UB 2PYOD 4H9NA 3VH5T 3AZHD 4DQYB 3REHA 4KGCB 3NQJA 3MGQA 5GT3B 3AN2A 3AYWD 3UTBC 4Z66D 2Y2MA 3X1UA 3KXBA 5B40B 4LD9B 3NQUB 3AZKA 4ZUXD 3TU4B 1KX3B 3WA9D 3AZEC 1P3FC 1ID3A 5B31C 3AZNC 3REJC 4H9RA 3AV1D 3WKJD 2L5AA 5CP6D 3X1SC 1EQZB 3W99D 5GSUC 1N1JA 4M6BA 5B1LD 4WU8C 5F99C 3W96B 3LZ0C 3REIB 2YFWA 5AV9C 1P3ID 4YM6D 1TAFA 5B2IB 3AZMA 4JJNB 3AZGA 1P3KA 4R8PD 1S32B 3MVDB 1AOIC 4WU9A 4G91C 4NE5A 2CV5B 5B0ZC 3LELB 4J8VD 3LZ1D 2NQBB 2YFVB 3UTAB 5GT0B 1KX5D 3AZLD 5BO0A 4YS3C 4QLCC 3KUYD 5B2JC 5E5AD 2RVQD 3AZJB 4J8WC 1U35B 1M1AC 5G49A 5B24D 5DNNA 3WTPA 5BT1D 4H9NB 4EO5C 2NZDC 3NQJB 5B32A 5JRGB 3MGQB 3LJAC 2PYOA 3AZHA 3AN2B 4Z2MG 1M18D 5CPJC 3KXBB 1W2EA 5GXQC 3EPHA 3AYWA 1KU5A 4Z66A 3AZKB 3W97C 1TZYB 1ID3B 4ZUXA 1M19C 1ZLAC 3AZFB 5CPKC 3WA9A 1B67A 3RELC 2Y2PA 3AV1A 4WJ3C 1P3BD 3WKJA 1N1JB 5CP6A 4XUJC 1P3MC 3W99A 3B6FC 2YFWB 5B1LA 5B33D 5CPIC 3AZND 5C3IB 3REJD 4G92C 1TAFB 4H9PB 3AZMB 2ZY2A 3AZGB 3B6GC 5B0YB 1H3OA 1P3IA 4YM6A 3X1SD 4WU9B 2AROC 4R8PA 4WU8D 1BH8A 3LZ0D 4ZBJC 4J8UC 4H9SC 1P3OC 5AV9D 4J8VA 3LZ1A 4KGCC 1P3LB 3IP4C 5GT3C 1KX5A 3AZLA 2J8PA 5FUGA 1AOID 4Z5TC 3MNNB 1KX4D 2JSSA 3V9RA 5JA4A 3KUYA 5G49B 5E5AA 5DNMA 1P34B 5DNNB 5B40C 5B0ZD 3WTPB 5B32B 5B24A 3TU4C 1KX3C 4Z2MH 2PYOB 3AZHB 5AV5B 3MGRD 5AVBD 2Y2QA 4Z66B 1M1AD 1B6WA 1P3GC 3MGSB 3W96C 2NZDD 3REIC 3W98D 4ZUXB 3LJAD 3WA9B 5B32G 4WNNB 3AV2B 5B2IC 4JJNC 2Y2LA 3AV1B 2FJ7B 2HIOB 3WKJB 3MVDC 5GXQD 5CP6B 2Y2OA 3X1VD 4E45A 2CV5C 1P3BA 5AV6B 4NE6A 5B1LB 2Y2NA 3LELC 3W97D 3MGPD 2NQBC 3C1CB 3UTAC 5GT0C 3A1IA 5B33A 1A7WA 4CSRB 4YM6B 4J8XD 3RELD 3AZNA 3REJA 3KWQD 2Y2KA 3P5JB 3UT9B 5B1MD 4R8PB 4XUJD 1P3PD 4WV4B 3X1SA 1BH8B 3AZJC 1P3MD 1U35C 3AFAB 3B6FD 4UPKA 4UUZA 2CWEA 4J8VB 3LZ1B 5CPID 1HTAA 2XD1A 5JRGC 2F8ND 3MGQC 2F8NG 3O62A 4NE3A 3B0CW 5AV9A 1KX5B 3B6GD 3AN2C 3WAAD 2UWXA 3V9RB 5JA4B 3KXBC 3KUYB 5DNMB 5E5AB 1F66D 5AV8C 2DQNC 5BS7A 3EPKA 1AOIA 1KX4A 4KUDD 3AZKC 5B24B 5B0ZA 1P3OD 2Y2HA 1TZYC 1ID3C 3X1TD 1T3UA 1HQ3C 2Y2IA 5GT3D 4XZQD 3AZFC 2Y2GA 1Q9CA 3REKD 5AY8D 4Z5TD 4X23B 3MGRA 5B40D 3C1BD 2G5HC 3AZID 1WWSA 3B0DB 5AVBA 5AVCD 1M1AA 4LD9C 2NZDA 5C3IC 3W98A 3A6NC 4DRAA 1P3AC 3REHB 3AZGC 3LJAA 5B0YC 3VH6W 4WU9C 1P3GD 3X1UB 1P3BB 3X1VA 3W97A 5B33B 3MGPA 4H9QA 1P3LC 1PZRA 4JJND 2XD5A 4H9RB 4J8XA 3R45A 3MNNC 3RELA 3KWQA 3UTBD 1P34C 5DNNC 3WTPC 5B1MA 4XUJA 3LELD 1P3PA 1P3MA 3UTAD 5GT0D 5B32C 3B6FA 2JE5A 2PYOC 3O62B 5AV9B 3AZHC 3AZED 5AV5C 1P3FD 5B31D 2F8NA 3B6GA 1AOIB 1P3KB 4Z66C 3WAAA 1U35D 1KX4B 1F66A 3B0BA 3MGSC 3EPJA 3VH5W 4WZSB 2BYKA 5GSUD 4KUDA 5JRGD 5F99D 4ZUXC 4H9SA 3WA9C 1P3OA 3X1TA 3AV2C 5BO0B 5GT3A 4XZQA 1ULYA 3MGRB 3AV1C 2HIOC 5AV8D 2FJ7C 3WKJC 5CP6C 3REKA 5AY8A 4Z5TA 5AVBB 3AL0C 5AV6C 5B40A 3C1BA 5B1LC 3KSYA 1TZYD 3AZIA 5AVCA 3C1CC 2F8NK 1HQ3D 3W98B 3AZFD
chains in the Genus database with same CATH topology
4H9OA 4YM6C 4YS3D 3UT9C 4QLCD 5B2JD 3X1VB 3AFAC 1EQZC 1P3GA 3AYWB 4J8WD 1M18A 3W97B 4J8VC 3LZ1C 3MGPB 4H9QB 4HGAB 5BNXA 3A6ND 1P3AD 3AZGD 1KX5C 5B0YD 4J8XB 3RELB 3H0LC 3KWQB 3KUYC 5DNMC 4JJNA 5CPJD 5B1MB 4XUJB 1P3PB 1S32C 3UTBA 5B24C 2LY8A 3W99B 5BT1C 3LELA 5KDMA 1BFMA 2ZY3A 1P3LD 5GT0A 4G92B 2F8NB 3B6GB 1M19D 1ZLAD 5CPKD 4X23C 3MNND 3AZEA 1H3OB 5B31A 1P3IB 1P3FA 3WAAB 1P34D 1F66B 5CHLB 2F2AC 2W8SA 2HUEB 3B0DC 1U35A 4KUDB 1P3OB 5GSUA 4WU8A 3X1TB 5AV5D 5JRGA 5F99A 3REHC 4XZQB 3LZ0A 3REKB 5AY8B 4AWLB 4Z5TB 3AZLB 5FUGB 1R4VA 3X1UC 1P3BC 5AV8A 3C1BB 3MGSD 2AROD 3AZIB 5AVCB 5B33C 1TZYA 4H9OB 4J8UD 2BYMA 3AV2D 1HQ3A 2ZY4A 4CAYA 3AZFA 4KGCD 2IO5B 2FJ7D 2HIOD 4YS3A 2ZM5A 1P3GB 5AV6D 1JFIA 1M18B 4QLCA 5B2JA 3C1CD 4LD9D 5BNXB 2G5IC 4J8WA 3O62C 3TU4D 2DF4C 1KX3D 3KFUG 4H9PA 3A6NA 1P3AA 3UT9D 5B0YA 3AZMC 5BS7C 1P3KC 1KX4C 3AFAD 3EPLA 1EQZD 3UTBB 5CPJA 5KDMB 3VH6A 5GXQA 3W96D 4DRBA 1BH9A 3REID 2FFFB 1P3LA 3AZEB 1P3FB 5B31B 3MGRC 5DNMD 3AZNB 3REJB 4KHAA 5B2ID 1M19A 1ZLAA 5CPKA 5AVBC 3MNNA 1S32D 3MVDD 3X1SB 1P34A 2CV5D 4UUZB 5GSUB 2BG1A 4WU8B 2NQBD 3W98C 2F8NH 5F99B 3LZ0B 4X23D 5AV5A 5CPIA 5B31G 5AV8B 3H0MC 3X1VC 3B0CT 4E44A 3AYWC 3AZJD 1F1EA 4G91B 3MGSA 3MGPC 2AROA 5B0ZB 2BYMB 4HGAC 1HQ3B 3F6TA 4CAYB 3REHD 5BNVA 3MGQD 4J8UA 4J8XC 4WNNA 3VH5A 3AV2A 3KWQC 3AN2D 4YS3B 4KGCA 3X1UD 2FJ7A 2HIOA 1JFIB 5B1MC 4QLCB 5B2JB 3KXBD 1P3PC 2Y2JA 5AV6A 3W99C 4J8WB 1M1AB 3WTPE 3AZKD 3C1CA 1Z2CB 1ID3D 4LD9A 4EO5B 3H0RC 3A6NB 3NQUA 1P3AB 2NZDB 4CSRA 3TU4A 1KX3A 3LJAB 3WAAC 1P3IC 1F66C 3UT9A 5CPJB 2HUEC 4R8PC 3AFAA 4KUDC 5GXQB 3VH6T 1EQZA 1BH9B 4NFTA 3O62D 3X1TC 3W96A 4XZQC 3REIA 4KHAB 3AZMD 1M19B 3REKC 1ZLAB 5AY8C 4AWLC 5CPKB 3AZLC 1P3KD 3R45B 4WU9D 3EG5B 5B2IA 3C1BC 2JCHA 2RVQC 5E5AC 3AZIC 5AVCC 1S32A 3MVDA 3FDDA 1WWIA 1P3MB 2CV5A 3B6FB 2NQBA 5CPIB 2YFVA 2IO5C 3UTAA 2ZY5A 4X23A 1M18C 5DNND 2RIQA 2AROB 3WTPD 3AZJA 2BYKB 5B32D 2VQRA 3A1KA 4ZBJB 5BNVB 4J8UB 2PYOD 4H9NA 3VH5T 3AZHD 4DQYB 3REHA 4KGCB 3NQJA 3MGQA 5GT3B 3AN2A 3AYWD 3UTBC 4Z66D 2Y2MA 3X1UA 3KXBA 5B40B 4LD9B 3NQUB 3AZKA 4ZUXD 3TU4B 1KX3B 3WA9D 3AZEC 1P3FC 1ID3A 5B31C 3AZNC 3REJC 4H9RA 3AV1D 3WKJD 2L5AA 5CP6D 3X1SC 1EQZB 3W99D 5GSUC 1N1JA 4M6BA 5B1LD 4WU8C 5F99C 3W96B 3LZ0C 3REIB 2YFWA 5AV9C 1P3ID 4YM6D 1TAFA 5B2IB 3AZMA 4JJNB 3AZGA 1P3KA 4R8PD 1S32B 3MVDB 1AOIC 4WU9A 4G91C 4NE5A 2CV5B 5B0ZC 3LELB 4J8VD 3LZ1D 2NQBB 2YFVB 3UTAB 5GT0B 1KX5D 3AZLD 5BO0A 4YS3C 4QLCC 3KUYD 5B2JC 5E5AD 2RVQD 3AZJB 4J8WC 1U35B 1M1AC 5G49A 5B24D 5DNNA 3WTPA 5BT1D 4H9NB 4EO5C 2NZDC 3NQJB 5B32A 5JRGB 3MGQB 3LJAC 2PYOA 3AZHA 3AN2B 4Z2MG 1M18D 5CPJC 3KXBB 1W2EA 5GXQC 3EPHA 3AYWA 1KU5A 4Z66A 3AZKB 3W97C 1TZYB 1ID3B 4ZUXA 1M19C 1ZLAC 3AZFB 5CPKC 3WA9A 1B67A 3RELC 2Y2PA 3AV1A 4WJ3C 1P3BD 3WKJA 1N1JB 5CP6A 4XUJC 1P3MC 3W99A 3B6FC 2YFWB 5B1LA 5B33D 5CPIC 3AZND 5C3IB 3REJD 4G92C 1TAFB 4H9PB 3AZMB 2ZY2A 3AZGB 3B6GC 5B0YB 1H3OA 1P3IA 4YM6A 3X1SD 4WU9B 2AROC 4R8PA 4WU8D 1BH8A 3LZ0D 4ZBJC 4J8UC 4H9SC 1P3OC 5AV9D 4J8VA 3LZ1A 4KGCC 1P3LB 3IP4C 5GT3C 1KX5A 3AZLA 2J8PA 5FUGA 1AOID 4Z5TC 3MNNB 1KX4D 2JSSA 3V9RA 5JA4A 3KUYA 5G49B 5E5AA 5DNMA 1P34B 5DNNB 5B40C 5B0ZD 3WTPB 5B32B 5B24A 3TU4C 1KX3C 4Z2MH 2PYOB 3AZHB 5AV5B 3MGRD 5AVBD 2Y2QA 4Z66B 1M1AD 1B6WA 1P3GC 3MGSB 3W96C 2NZDD 3REIC 3W98D 4ZUXB 3LJAD 3WA9B 5B32G 4WNNB 3AV2B 5B2IC 4JJNC 2Y2LA 3AV1B 2FJ7B 2HIOB 3WKJB 3MVDC 5GXQD 5CP6B 2Y2OA 3X1VD 4E45A 2CV5C 1P3BA 5AV6B 4NE6A 5B1LB 2Y2NA 3LELC 3W97D 3MGPD 2NQBC 3C1CB 3UTAC 5GT0C 3A1IA 5B33A 1A7WA 4CSRB 4YM6B 4J8XD 3RELD 3AZNA 3REJA 3KWQD 2Y2KA 3P5JB 3UT9B 5B1MD 4R8PB 4XUJD 1P3PD 4WV4B 3X1SA 1BH8B 3AZJC 1P3MD 1U35C 3AFAB 3B6FD 4UPKA 4UUZA 2CWEA 4J8VB 3LZ1B 5CPID 1HTAA 2XD1A 5JRGC 2F8ND 3MGQC 2F8NG 3O62A 4NE3A 3B0CW 5AV9A 1KX5B 3B6GD 3AN2C 3WAAD 2UWXA 3V9RB 5JA4B 3KXBC 3KUYB 5DNMB 5E5AB 1F66D 5AV8C 2DQNC 5BS7A 3EPKA 1AOIA 1KX4A 4KUDD 3AZKC 5B24B 5B0ZA 1P3OD 2Y2HA 1TZYC 1ID3C 3X1TD 1T3UA 1HQ3C 2Y2IA 5GT3D 4XZQD 3AZFC 2Y2GA 1Q9CA 3REKD 5AY8D 4Z5TD 4X23B 3MGRA 5B40D 3C1BD 2G5HC 3AZID 1WWSA 3B0DB 5AVBA 5AVCD 1M1AA 4LD9C 2NZDA 5C3IC 3W98A 3A6NC 4DRAA 1P3AC 3REHB 3AZGC 3LJAA 5B0YC 3VH6W 4WU9C 1P3GD 3X1UB 1P3BB 3X1VA 3W97A 5B33B 3MGPA 4H9QA 1P3LC 1PZRA 4JJND 2XD5A 4H9RB 4J8XA 3R45A 3MNNC 3RELA 3KWQA 3UTBD 1P34C 5DNNC 3WTPC 5B1MA 4XUJA 3LELD 1P3PA 1P3MA 3UTAD 5GT0D 5B32C 3B6FA 2JE5A 2PYOC 3O62B 5AV9B 3AZHC 3AZED 5AV5C 1P3FD 5B31D 2F8NA 3B6GA 1AOIB 1P3KB 4Z66C 3WAAA 1U35D 1KX4B 1F66A 3B0BA 3MGSC 3EPJA 3VH5W 4WZSB 2BYKA 5GSUD 4KUDA 5JRGD 5F99D 4ZUXC 4H9SA 3WA9C 1P3OA 3X1TA 3AV2C 5BO0B 5GT3A 4XZQA 1ULYA 3MGRB 3AV1C 2HIOC 5AV8D 2FJ7C 3WKJC 5CP6C 3REKA 5AY8A 4Z5TA 5AVBB 3AL0C 5AV6C 5B40A 3C1BA 5B1LC 3KSYA 1TZYD 3AZIA 5AVCA 3C1CC 2F8NK 1HQ3D 3W98B 3AZFD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9O A;  4YM6 C;  4YS3 D;  3UT9 C;  4QLC D;  5B2J D;  3X1V B;  3AFA C;  1EQZ C;  1P3G A;  3AYW B;  4J8W D;  1M18 A;  3W97 B;  4J8V C;  3LZ1 C;  3MGP B;  4H9Q B;  4HGA B;  5BNX A;  3A6N D;  1P3A D;  3AZG D;  1KX5 C;  5B0Y D;  4J8X B;  3REL B;  3KWQ B;  3KUY C;  5DNM C;  4JJN A;  5CPJ D;  5B1M B;  4XUJ B;  1P3P B;  1S32 C;  3UTB A;  5B24 C;  2LY8 A;  3W99 B;  5BT1 C;  3LEL A;  5KDM A;  1BFM A;  1P3L D;  5GT0 A;  4G92 B;  2F8N B;  3B6G B;  1M19 D;  1ZLA D;  5CPK D;  4X23 C;  3MNN D;  3AZE A;  1H3O B;  5B31 A;  1P3I B;  1P3F A;  3WAA B;  1P34 D;  1F66 B;  5CHL B;  2HUE B;  3B0D C;  1U35 A;  4KUD B;  1P3O B;  5GSU A;  4WU8 A;  3X1T B;  5AV5 D;  5JRG A;  5F99 A;  3REH C;  4XZQ B;  3LZ0 A;  3REK B;  5AY8 B;  4AWL B;  4Z5T B;  3AZL B;  5FUG B;  1R4V A;  3X1U C;  1P3B C;  5AV8 A;  3C1B B;  3MGS D;  2ARO D;  3AZI B;  5AVC B;  5B33 C;  1TZY A;  4H9O B;  4J8U D;  2BYM A;  3AV2 D;  1HQ3 A;  4CAY A;  3AZF A;  4KGC D;  2IO5 B;  2FJ7 D;  2HIO D;  4YS3 A;  1P3G B;  5AV6 D;  1JFI A;  1M18 B;  4QLC A;  5B2J A;  3C1C D;  4LD9 D;  5BNX B;  4J8W A;  3O62 C;  3TU4 D;  1KX3 D;  4H9P A;  3A6N A;  1P3A A;  3UT9 D;  5B0Y A;  3AZM C;  5BS7 C;  1P3K C;  1KX4 C;  3AFA D;  1EQZ D;  3UTB B;  5CPJ A;  5KDM B;  3VH6 A;  5GXQ A;  3W96 D;  4DRB A;  1BH9 A;  3REI D;  1P3L A;  3AZE B;  1P3F B;  5B31 B;  3MGR C;  5DNM D;  3AZN B;  3REJ B;  4KHA A;  5B2I D;  1M19 A;  1ZLA A;  5CPK A;  5AVB C;  3MNN A;  1S32 D;  3MVD D;  3X1S B;  1P34 A;  2CV5 D;  4UUZ B;  5GSU B;  4WU8 B;  2NQB D;  3W98 C;  2F8N H;  5F99 B;  3LZ0 B;  4X23 D;  5AV5 A;  5CPI A;  5B31 G;  5AV8 B;  3X1V C;  3B0C T;  4E44 A;  3AYW C;  3AZJ D;  1F1E A;  4G91 B;  3MGS A;  3MGP C;  2ARO A;  5B0Z B;  2BYM B;  4HGA C;  1HQ3 B;  4CAY B;  3REH D;  5BNV A;  3MGQ D;  4J8U A;  4J8X C;  4WNN A;  3VH5 A;  3AV2 A;  3KWQ C;  3AN2 D;  4YS3 B;  4KGC A;  3X1U D;  2FJ7 A;  2HIO A;  1JFI B;  5B1M C;  4QLC B;  5B2J B;  3KXB D;  1P3P C;  5AV6 A;  3W99 C;  4J8W B;  1M1A B;  3WTP E;  3AZK D;  3C1C A;  1ID3 D;  4LD9 A;  4EO5 B;  3A6N B;  1P3A B;  3NQU A;  2NZD B;  4CSR A;  3TU4 A;  1KX3 A;  3LJA B;  3WAA C;  1P3I C;  1F66 C;  3UT9 A;  5CPJ B;  2HUE C;  4R8P C;  3AFA A;  4KUD C;  5GXQ B;  3VH6 T;  1EQZ A;  1BH9 B;  4NFT A;  3O62 D;  3X1T C;  3W96 A;  4XZQ C;  3REI A;  4KHA B;  3AZM D;  1M19 B;  3REK C;  1ZLA B;  5AY8 C;  4AWL C;  5CPK B;  3AZL C;  1P3K D;  3R45 B;  4WU9 D;  5B2I A;  3C1B C;  5E5A C;  2RVQ C;  3AZI C;  5AVC C;  1S32 A;  3MVD A;  1WWI A;  1P3M B;  2CV5 A;  3B6F B;  2NQB A;  5CPI B;  2YFV A;  2IO5 C;  3UTA A;  4X23 A;  1M18 C;  5DNN D;  2ARO B;  3WTP D;  3AZJ A;  2BYK B;  5B32 D;  4ZBJ B;  5BNV B;  4J8U B;  2PYO D;  4H9N A;  3VH5 T;  3AZH D;  3REH A;  4KGC B;  3NQJ A;  3MGQ A;  5GT3 B;  3AN2 A;  3AYW D;  3UTB C;  4Z66 D;  3X1U A;  3KXB A;  5B40 B;  4LD9 B;  3NQU B;  3AZK A;  4ZUX D;  3TU4 B;  1KX3 B;  3WA9 D;  3AZE C;  1P3F C;  1ID3 A;  5B31 C;  3AZN C;  3REJ C;  4H9R A;  3AV1 D;  3WKJ D;  2L5A A;  5CP6 D;  3X1S C;  1EQZ B;  3W99 D;  5GSU C;  1N1J A;  4M6B A;  5B1L D;  4WU8 C;  5F99 C;  3W96 B;  3LZ0 C;  3REI B;  2YFW A;  5AV9 C;  1P3I D;  4YM6 D;  1TAF A;  5B2I B;  3AZM A;  4JJN B;  3AZG A;  1P3K A;  4R8P D;  1S32 B;  3MVD B;  1AOI C;  4WU9 A;  4G91 C;  4NE5 A;  2CV5 B;  5B0Z C;  3LEL B;  4J8V D;  3LZ1 D;  2NQB B;  2YFV B;  3UTA B;  5GT0 B;  1KX5 D;  3AZL D;  5BO0 A;  4YS3 C;  4QLC C;  3KUY D;  5B2J C;  5E5A D;  2RVQ D;  3AZJ B;  4J8W C;  1U35 B;  1M1A C;  5G49 A;  5B24 D;  5DNN A;  3WTP A;  5BT1 D;  4H9N B;  4EO5 C;  2NZD C;  3NQJ B;  5B32 A;  5JRG B;  3MGQ B;  3LJA C;  2PYO A;  3AZH A;  3AN2 B;  4Z2M G;  1M18 D;  5CPJ C;  3KXB B;  5GXQ C;  3AYW A;  1KU5 A;  4Z66 A;  3AZK B;  3W97 C;  1TZY B;  1ID3 B;  4ZUX A;  1M19 C;  1ZLA C;  3AZF B;  5CPK C;  3WA9 A;  1B67 A;  3REL C;  3AV1 A;  1P3B D;  3WKJ A;  1N1J B;  5CP6 A;  4XUJ C;  1P3M C;  3W99 A;  3B6F C;  2YFW B;  5B1L A;  5B33 D;  5CPI C;  3AZN D;  5C3I B;  3REJ D;  4G92 C;  1TAF B;  4H9P B;  3AZM B;  3AZG B;  3B6G C;  5B0Y B;  1H3O A;  1P3I A;  4YM6 A;  3X1S D;  4WU9 B;  2ARO C;  4R8P A;  4WU8 D;  1BH8 A;  3LZ0 D;  4ZBJ C;  4J8U C;  4H9S C;  1P3O C;  5AV9 D;  4J8V A;  3LZ1 A;  4KGC C;  1P3L B;  5GT3 C;  1KX5 A;  3AZL A;  5FUG A;  1AOI D;  4Z5T C;  3MNN B;  1KX4 D;  2JSS A;  3V9R A;  5JA4 A;  3KUY A;  5G49 B;  5E5A A;  5DNM A;  1P34 B;  5DNN B;  5B40 C;  5B0Z D;  3WTP B;  5B32 B;  5B24 A;  3TU4 C;  1KX3 C;  4Z2M H;  2PYO B;  3AZH B;  5AV5 B;  3MGR D;  5AVB D;  4Z66 B;  1M1A D;  1B6W A;  1P3G C;  3MGS B;  3W96 C;  2NZD D;  3REI C;  3W98 D;  4ZUX B;  3LJA D;  3WA9 B;  5B32 G;  4WNN B;  3AV2 B;  5B2I C;  4JJN C;  3AV1 B;  2FJ7 B;  2HIO B;  3WKJ B;  3MVD C;  5GXQ D;  5CP6 B;  3X1V D;  4E45 A;  2CV5 C;  1P3B A;  5AV6 B;  4NE6 A;  5B1L B;  3LEL C;  3W97 D;  2NQB C;  3MGP D;  3C1C B;  3UTA C;  5GT0 C;  5B33 A;  1A7W A;  4CSR B;  4YM6 B;  4J8X D;  3REL D;  3AZN A;  3REJ A;  3KWQ D;  3UT9 B;  5B1M D;  4R8P B;  4XUJ D;  1P3P D;  4WV4 B;  3X1S A;  1BH8 B;  3AZJ C;  1P3M D;  1U35 C;  3AFA B;  3B6F D;  4UUZ A;  2CWE A;  4J8V B;  3LZ1 B;  5CPI D;  1HTA A;  5JRG C;  2F8N D;  3MGQ C;  2F8N G;  3O62 A;  4NE3 A;  3B0C W;  5AV9 A;  1KX5 B;  3B6G D;  3AN2 C;  3WAA D;  3V9R B;  5JA4 B;  3KXB C;  3KUY B;  5DNM B;  5E5A B;  1F66 D;  5AV8 C;  5BS7 A;  1AOI A;  1KX4 A;  4KUD D;  3AZK C;  5B24 B;  5B0Z A;  1P3O D;  1TZY C;  1ID3 C;  3X1T D;  1HQ3 C;  5GT3 D;  4XZQ D;  3AZF C;  3REK D;  1Q9C A;  5AY8 D;  4Z5T D;  4X23 B;  3MGR A;  5B40 D;  3C1B D;  3AZI D;  1WWS A;  3B0D B;  5AVB A;  5AVC D;  1M1A A;  4LD9 C;  2NZD A;  5C3I C;  3W98 A;  3A6N C;  4DRA A;  1P3A C;  3REH B;  3AZG C;  3LJA A;  5B0Y C;  3VH6 W;  4WU9 C;  1P3G D;  3X1U B;  1P3B B;  3X1V A;  3W97 A;  5B33 B;  3MGP A;  4H9Q A;  1P3L C;  4JJN D;  4H9R B;  4J8X A;  3R45 A;  3MNN C;  3REL A;  3KWQ A;  3UTB D;  1P34 C;  5DNN C;  3WTP C;  5B1M A;  4XUJ A;  3LEL D;  1P3P A;  1P3M A;  3UTA D;  5GT0 D;  5B32 C;  3B6F A;  2PYO C;  3O62 B;  5AV9 B;  3AZH C;  3AZE D;  5AV5 C;  1P3F D;  5B31 D;  2F8N A;  3B6G A;  1AOI B;  1P3K B;  4Z66 C;  3WAA A;  1U35 D;  1KX4 B;  1F66 A;  3B0B A;  3MGS C;  3VH5 W;  4WZS B;  2BYK A;  5GSU D;  4KUD A;  5JRG D;  5F99 D;  4ZUX C;  4H9S A;  3WA9 C;  1P3O A;  3X1T A;  3AV2 C;  5BO0 B;  5GT3 A;  4XZQ A;  1ULY A;  3MGR B;  3AV1 C;  2HIO C;  5AV8 D;  2FJ7 C;  3WKJ C;  5CP6 C;  3REK A;  5AY8 A;  4Z5T A;  5AVB B;  5AV6 C;  5B40 A;  3C1B A;  5B1L C;  3KSY A;  1TZY D;  3AZI A;  5AVC A;  3C1C C;  2F8N K;  1HQ3 D;  3W98 B;  3AZF D; 
#chains in the Genus database with same CATH topology
 4H9O A;  4YM6 C;  4YS3 D;  3UT9 C;  4QLC D;  5B2J D;  3X1V B;  3AFA C;  1EQZ C;  1P3G A;  3AYW B;  4J8W D;  1M18 A;  3W97 B;  4J8V C;  3LZ1 C;  3MGP B;  4H9Q B;  4HGA B;  5BNX A;  3A6N D;  1P3A D;  3AZG D;  1KX5 C;  5B0Y D;  4J8X B;  3REL B;  3H0L C;  3KWQ B;  3KUY C;  5DNM C;  4JJN A;  5CPJ D;  5B1M B;  4XUJ B;  1P3P B;  1S32 C;  3UTB A;  5B24 C;  2LY8 A;  3W99 B;  5BT1 C;  3LEL A;  5KDM A;  1BFM A;  2ZY3 A;  1P3L D;  5GT0 A;  4G92 B;  2F8N B;  3B6G B;  1M19 D;  1ZLA D;  5CPK D;  4X23 C;  3MNN D;  3AZE A;  1H3O B;  5B31 A;  1P3I B;  1P3F A;  3WAA B;  1P34 D;  1F66 B;  5CHL B;  2F2A C;  2W8S A;  2HUE B;  3B0D C;  1U35 A;  4KUD B;  1P3O B;  5GSU A;  4WU8 A;  3X1T B;  5AV5 D;  5JRG A;  5F99 A;  3REH C;  4XZQ B;  3LZ0 A;  3REK B;  5AY8 B;  4AWL B;  4Z5T B;  3AZL B;  5FUG B;  1R4V A;  3X1U C;  1P3B C;  5AV8 A;  3C1B B;  3MGS D;  2ARO D;  3AZI B;  5AVC B;  5B33 C;  1TZY A;  4H9O B;  4J8U D;  2BYM A;  3AV2 D;  1HQ3 A;  2ZY4 A;  4CAY A;  3AZF A;  4KGC D;  2IO5 B;  2FJ7 D;  2HIO D;  4YS3 A;  2ZM5 A;  1P3G B;  5AV6 D;  1JFI A;  1M18 B;  4QLC A;  5B2J A;  3C1C D;  4LD9 D;  5BNX B;  2G5I C;  4J8W A;  3O62 C;  3TU4 D;  2DF4 C;  1KX3 D;  3KFU G;  4H9P A;  3A6N A;  1P3A A;  3UT9 D;  5B0Y A;  3AZM C;  5BS7 C;  1P3K C;  1KX4 C;  3AFA D;  3EPL A;  1EQZ D;  3UTB B;  5CPJ A;  5KDM B;  3VH6 A;  5GXQ A;  3W96 D;  4DRB A;  1BH9 A;  3REI D;  2FFF B;  1P3L A;  3AZE B;  1P3F B;  5B31 B;  3MGR C;  5DNM D;  3AZN B;  3REJ B;  4KHA A;  5B2I D;  1M19 A;  1ZLA A;  5CPK A;  5AVB C;  3MNN A;  1S32 D;  3MVD D;  3X1S B;  1P34 A;  2CV5 D;  4UUZ B;  5GSU B;  2BG1 A;  4WU8 B;  2NQB D;  3W98 C;  2F8N H;  5F99 B;  3LZ0 B;  4X23 D;  5AV5 A;  5CPI A;  5B31 G;  5AV8 B;  3H0M C;  3X1V C;  3B0C T;  4E44 A;  3AYW C;  3AZJ D;  1F1E A;  4G91 B;  3MGS A;  3MGP C;  2ARO A;  5B0Z B;  2BYM B;  4HGA C;  1HQ3 B;  3F6T A;  4CAY B;  3REH D;  5BNV A;  3MGQ D;  4J8U A;  4J8X C;  4WNN A;  3VH5 A;  3AV2 A;  3KWQ C;  3AN2 D;  4YS3 B;  4KGC A;  3X1U D;  2FJ7 A;  2HIO A;  1JFI B;  5B1M C;  4QLC B;  5B2J B;  3KXB D;  1P3P C;  2Y2J A;  5AV6 A;  3W99 C;  4J8W B;  1M1A B;  3WTP E;  3AZK D;  3C1C A;  1Z2C B;  1ID3 D;  4LD9 A;  4EO5 B;  3H0R C;  3A6N B;  3NQU A;  1P3A B;  2NZD B;  4CSR A;  3TU4 A;  1KX3 A;  3LJA B;  3WAA C;  1P3I C;  1F66 C;  3UT9 A;  5CPJ B;  2HUE C;  4R8P C;  3AFA A;  4KUD C;  5GXQ B;  3VH6 T;  1EQZ A;  1BH9 B;  4NFT A;  3O62 D;  3X1T C;  3W96 A;  4XZQ C;  3REI A;  4KHA B;  3AZM D;  1M19 B;  3REK C;  1ZLA B;  5AY8 C;  4AWL C;  5CPK B;  3AZL C;  1P3K D;  3R45 B;  4WU9 D;  3EG5 B;  5B2I A;  3C1B C;  2JCH A;  2RVQ C;  5E5A C;  3AZI C;  5AVC C;  1S32 A;  3MVD A;  3FDD A;  1WWI A;  1P3M B;  2CV5 A;  3B6F B;  2NQB A;  5CPI B;  2YFV A;  2IO5 C;  3UTA A;  2ZY5 A;  4X23 A;  1M18 C;  5DNN D;  2RIQ A;  2ARO B;  3WTP D;  3AZJ A;  2BYK B;  5B32 D;  2VQR A;  3A1K A;  4ZBJ B;  5BNV B;  4J8U B;  2PYO D;  4H9N A;  3VH5 T;  3AZH D;  4DQY B;  3REH A;  4KGC B;  3NQJ A;  3MGQ A;  5GT3 B;  3AN2 A;  3AYW D;  3UTB C;  4Z66 D;  2Y2M A;  3X1U A;  3KXB A;  5B40 B;  4LD9 B;  3NQU B;  3AZK A;  4ZUX D;  3TU4 B;  1KX3 B;  3WA9 D;  3AZE C;  1P3F C;  1ID3 A;  5B31 C;  3AZN C;  3REJ C;  4H9R A;  3AV1 D;  3WKJ D;  2L5A A;  5CP6 D;  3X1S C;  1EQZ B;  3W99 D;  5GSU C;  1N1J A;  4M6B A;  5B1L D;  4WU8 C;  5F99 C;  3W96 B;  3LZ0 C;  3REI B;  2YFW A;  5AV9 C;  1P3I D;  4YM6 D;  1TAF A;  5B2I B;  3AZM A;  4JJN B;  3AZG A;  1P3K A;  4R8P D;  1S32 B;  3MVD B;  1AOI C;  4WU9 A;  4G91 C;  4NE5 A;  2CV5 B;  5B0Z C;  3LEL B;  4J8V D;  3LZ1 D;  2NQB B;  2YFV B;  3UTA B;  5GT0 B;  1KX5 D;  3AZL D;  5BO0 A;  4YS3 C;  4QLC C;  3KUY D;  5B2J C;  5E5A D;  2RVQ D;  3AZJ B;  4J8W C;  1U35 B;  1M1A C;  5G49 A;  5B24 D;  5DNN A;  3WTP A;  5BT1 D;  4H9N B;  4EO5 C;  2NZD C;  3NQJ B;  5B32 A;  5JRG B;  3MGQ B;  3LJA C;  2PYO A;  3AZH A;  3AN2 B;  4Z2M G;  1M18 D;  5CPJ C;  3KXB B;  1W2E A;  5GXQ C;  3EPH A;  3AYW A;  1KU5 A;  4Z66 A;  3AZK B;  3W97 C;  1TZY B;  1ID3 B;  4ZUX A;  1M19 C;  1ZLA C;  3AZF B;  5CPK C;  3WA9 A;  1B67 A;  3REL C;  2Y2P A;  3AV1 A;  4WJ3 C;  1P3B D;  3WKJ A;  1N1J B;  5CP6 A;  4XUJ C;  1P3M C;  3W99 A;  3B6F C;  2YFW B;  5B1L A;  5B33 D;  5CPI C;  3AZN D;  5C3I B;  3REJ D;  4G92 C;  1TAF B;  4H9P B;  3AZM B;  2ZY2 A;  3AZG B;  3B6G C;  5B0Y B;  1H3O A;  1P3I A;  4YM6 A;  3X1S D;  4WU9 B;  2ARO C;  4R8P A;  4WU8 D;  1BH8 A;  3LZ0 D;  4ZBJ C;  4J8U C;  4H9S C;  1P3O C;  5AV9 D;  4J8V A;  3LZ1 A;  4KGC C;  1P3L B;  3IP4 C;  5GT3 C;  1KX5 A;  3AZL A;  2J8P A;  5FUG A;  1AOI D;  4Z5T C;  3MNN B;  1KX4 D;  2JSS A;  3V9R A;  5JA4 A;  3KUY A;  5G49 B;  5E5A A;  5DNM A;  1P34 B;  5DNN B;  5B40 C;  5B0Z D;  3WTP B;  5B32 B;  5B24 A;  3TU4 C;  1KX3 C;  4Z2M H;  2PYO B;  3AZH B;  5AV5 B;  3MGR D;  5AVB D;  2Y2Q A;  4Z66 B;  1M1A D;  1B6W A;  1P3G C;  3MGS B;  3W96 C;  2NZD D;  3REI C;  3W98 D;  4ZUX B;  3LJA D;  3WA9 B;  5B32 G;  4WNN B;  3AV2 B;  5B2I C;  4JJN C;  2Y2L A;  3AV1 B;  2FJ7 B;  2HIO B;  3WKJ B;  3MVD C;  5GXQ D;  5CP6 B;  2Y2O A;  3X1V D;  4E45 A;  2CV5 C;  1P3B A;  5AV6 B;  4NE6 A;  5B1L B;  2Y2N A;  3LEL C;  3W97 D;  3MGP D;  2NQB C;  3C1C B;  3UTA C;  5GT0 C;  3A1I A;  5B33 A;  1A7W A;  4CSR B;  4YM6 B;  4J8X D;  3REL D;  3AZN A;  3REJ A;  3KWQ D;  2Y2K A;  3P5J B;  3UT9 B;  5B1M D;  4R8P B;  4XUJ D;  1P3P D;  4WV4 B;  3X1S A;  1BH8 B;  3AZJ C;  1P3M D;  1U35 C;  3AFA B;  3B6F D;  4UPK A;  4UUZ A;  2CWE A;  4J8V B;  3LZ1 B;  5CPI D;  1HTA A;  2XD1 A;  5JRG C;  2F8N D;  3MGQ C;  2F8N G;  3O62 A;  4NE3 A;  3B0C W;  5AV9 A;  1KX5 B;  3B6G D;  3AN2 C;  3WAA D;  2UWX A;  3V9R B;  5JA4 B;  3KXB C;  3KUY B;  5DNM B;  5E5A B;  1F66 D;  5AV8 C;  2DQN C;  5BS7 A;  3EPK A;  1AOI A;  1KX4 A;  4KUD D;  3AZK C;  5B24 B;  5B0Z A;  1P3O D;  2Y2H A;  1TZY C;  1ID3 C;  3X1T D;  1T3U A;  1HQ3 C;  2Y2I A;  5GT3 D;  4XZQ D;  3AZF C;  2Y2G A;  1Q9C A;  3REK D;  5AY8 D;  4Z5T D;  4X23 B;  3MGR A;  5B40 D;  3C1B D;  2G5H C;  3AZI D;  1WWS A;  3B0D B;  5AVB A;  5AVC D;  1M1A A;  4LD9 C;  2NZD A;  5C3I C;  3W98 A;  3A6N C;  4DRA A;  1P3A C;  3REH B;  3AZG C;  3LJA A;  5B0Y C;  3VH6 W;  4WU9 C;  1P3G D;  3X1U B;  1P3B B;  3X1V A;  3W97 A;  5B33 B;  3MGP A;  4H9Q A;  1P3L C;  1PZR A;  4JJN D;  2XD5 A;  4H9R B;  4J8X A;  3R45 A;  3MNN C;  3REL A;  3KWQ A;  3UTB D;  1P34 C;  5DNN C;  3WTP C;  5B1M A;  4XUJ A;  3LEL D;  1P3P A;  1P3M A;  3UTA D;  5GT0 D;  5B32 C;  3B6F A;  2JE5 A;  2PYO C;  3O62 B;  5AV9 B;  3AZH C;  3AZE D;  5AV5 C;  1P3F D;  5B31 D;  2F8N A;  3B6G A;  1AOI B;  1P3K B;  4Z66 C;  3WAA A;  1U35 D;  1KX4 B;  1F66 A;  3B0B A;  3MGS C;  3EPJ A;  3VH5 W;  4WZS B;  2BYK A;  5GSU D;  4KUD A;  5JRG D;  5F99 D;  4ZUX C;  4H9S A;  3WA9 C;  1P3O A;  3X1T A;  3AV2 C;  5BO0 B;  5GT3 A;  4XZQ A;  1ULY A;  3MGR B;  3AV1 C;  2HIO C;  5AV8 D;  2FJ7 C;  3WKJ C;  5CP6 C;  3REK A;  5AY8 A;  4Z5T A;  5AVB B;  3AL0 C;  5AV6 C;  5B40 A;  3C1B A;  5B1L C;  3KSY A;  1TZY D;  3AZI A;  5AVC A;  3C1C C;  2F8N K;  1HQ3 D;  3W98 B;  3AZF D; 
#chains in the Genus database with same CATH homology
 4H9O A;  4YM6 C;  4YS3 D;  3UT9 C;  4QLC D;  5B2J D;  3X1V B;  3AFA C;  1EQZ C;  1P3G A;  3AYW B;  4J8W D;  1M18 A;  3W97 B;  4J8V C;  3LZ1 C;  3MGP B;  4H9Q B;  4HGA B;  5BNX A;  3A6N D;  1P3A D;  3AZG D;  1KX5 C;  5B0Y D;  4J8X B;  3REL B;  3H0L C;  3KWQ B;  3KUY C;  5DNM C;  4JJN A;  5CPJ D;  5B1M B;  4XUJ B;  1P3P B;  1S32 C;  3UTB A;  5B24 C;  2LY8 A;  3W99 B;  5BT1 C;  3LEL A;  5KDM A;  1BFM A;  2ZY3 A;  1P3L D;  5GT0 A;  4G92 B;  2F8N B;  3B6G B;  1M19 D;  1ZLA D;  5CPK D;  4X23 C;  3MNN D;  3AZE A;  1H3O B;  5B31 A;  1P3I B;  1P3F A;  3WAA B;  1P34 D;  1F66 B;  5CHL B;  2F2A C;  2W8S A;  2HUE B;  3B0D C;  1U35 A;  4KUD B;  1P3O B;  5GSU A;  4WU8 A;  3X1T B;  5AV5 D;  5JRG A;  5F99 A;  3REH C;  4XZQ B;  3LZ0 A;  3REK B;  5AY8 B;  4AWL B;  4Z5T B;  3AZL B;  5FUG B;  1R4V A;  3X1U C;  1P3B C;  5AV8 A;  3C1B B;  3MGS D;  2ARO D;  3AZI B;  5AVC B;  5B33 C;  1TZY A;  4H9O B;  4J8U D;  2BYM A;  3AV2 D;  1HQ3 A;  2ZY4 A;  4CAY A;  3AZF A;  4KGC D;  2IO5 B;  2FJ7 D;  2HIO D;  4YS3 A;  2ZM5 A;  1P3G B;  5AV6 D;  1JFI A;  1M18 B;  4QLC A;  5B2J A;  3C1C D;  4LD9 D;  5BNX B;  2G5I C;  4J8W A;  3O62 C;  3TU4 D;  2DF4 C;  1KX3 D;  3KFU G;  4H9P A;  3A6N A;  1P3A A;  3UT9 D;  5B0Y A;  3AZM C;  5BS7 C;  1P3K C;  1KX4 C;  3AFA D;  3EPL A;  1EQZ D;  3UTB B;  5CPJ A;  5KDM B;  3VH6 A;  5GXQ A;  3W96 D;  4DRB A;  1BH9 A;  3REI D;  2FFF B;  1P3L A;  3AZE B;  1P3F B;  5B31 B;  3MGR C;  5DNM D;  3AZN B;  3REJ B;  4KHA A;  5B2I D;  1M19 A;  1ZLA A;  5CPK A;  5AVB C;  3MNN A;  1S32 D;  3MVD D;  3X1S B;  1P34 A;  2CV5 D;  4UUZ B;  5GSU B;  2BG1 A;  4WU8 B;  2NQB D;  3W98 C;  2F8N H;  5F99 B;  3LZ0 B;  4X23 D;  5AV5 A;  5CPI A;  5B31 G;  5AV8 B;  3H0M C;  3X1V C;  3B0C T;  4E44 A;  3AYW C;  3AZJ D;  1F1E A;  4G91 B;  3MGS A;  3MGP C;  2ARO A;  5B0Z B;  2BYM B;  4HGA C;  1HQ3 B;  3F6T A;  4CAY B;  3REH D;  5BNV A;  3MGQ D;  4J8U A;  4J8X C;  4WNN A;  3VH5 A;  3AV2 A;  3KWQ C;  3AN2 D;  4YS3 B;  4KGC A;  3X1U D;  2FJ7 A;  2HIO A;  1JFI B;  5B1M C;  4QLC B;  5B2J B;  3KXB D;  1P3P C;  2Y2J A;  5AV6 A;  3W99 C;  4J8W B;  1M1A B;  3WTP E;  3AZK D;  3C1C A;  1Z2C B;  1ID3 D;  4LD9 A;  4EO5 B;  3H0R C;  3A6N B;  3NQU A;  1P3A B;  2NZD B;  4CSR A;  3TU4 A;  1KX3 A;  3LJA B;  3WAA C;  1P3I C;  1F66 C;  3UT9 A;  5CPJ B;  2HUE C;  4R8P C;  3AFA A;  4KUD C;  5GXQ B;  3VH6 T;  1EQZ A;  1BH9 B;  4NFT A;  3O62 D;  3X1T C;  3W96 A;  4XZQ C;  3REI A;  4KHA B;  3AZM D;  1M19 B;  3REK C;  1ZLA B;  5AY8 C;  4AWL C;  5CPK B;  3AZL C;  1P3K D;  3R45 B;  4WU9 D;  3EG5 B;  5B2I A;  3C1B C;  2JCH A;  2RVQ C;  5E5A C;  3AZI C;  5AVC C;  1S32 A;  3MVD A;  3FDD A;  1WWI A;  1P3M B;  2CV5 A;  3B6F B;  2NQB A;  5CPI B;  2YFV A;  2IO5 C;  3UTA A;  2ZY5 A;  4X23 A;  1M18 C;  5DNN D;  2RIQ A;  2ARO B;  3WTP D;  3AZJ A;  2BYK B;  5B32 D;  2VQR A;  3A1K A;  4ZBJ B;  5BNV B;  4J8U B;  2PYO D;  4H9N A;  3VH5 T;  3AZH D;  4DQY B;  3REH A;  4KGC B;  3NQJ A;  3MGQ A;  5GT3 B;  3AN2 A;  3AYW D;  3UTB C;  4Z66 D;  2Y2M A;  3X1U A;  3KXB A;  5B40 B;  4LD9 B;  3NQU B;  3AZK A;  4ZUX D;  3TU4 B;  1KX3 B;  3WA9 D;  3AZE C;  1P3F C;  1ID3 A;  5B31 C;  3AZN C;  3REJ C;  4H9R A;  3AV1 D;  3WKJ D;  2L5A A;  5CP6 D;  3X1S C;  1EQZ B;  3W99 D;  5GSU C;  1N1J A;  4M6B A;  5B1L D;  4WU8 C;  5F99 C;  3W96 B;  3LZ0 C;  3REI B;  2YFW A;  5AV9 C;  1P3I D;  4YM6 D;  1TAF A;  5B2I B;  3AZM A;  4JJN B;  3AZG A;  1P3K A;  4R8P D;  1S32 B;  3MVD B;  1AOI C;  4WU9 A;  4G91 C;  4NE5 A;  2CV5 B;  5B0Z C;  3LEL B;  4J8V D;  3LZ1 D;  2NQB B;  2YFV B;  3UTA B;  5GT0 B;  1KX5 D;  3AZL D;  5BO0 A;  4YS3 C;  4QLC C;  3KUY D;  5B2J C;  5E5A D;  2RVQ D;  3AZJ B;  4J8W C;  1U35 B;  1M1A C;  5G49 A;  5B24 D;  5DNN A;  3WTP A;  5BT1 D;  4H9N B;  4EO5 C;  2NZD C;  3NQJ B;  5B32 A;  5JRG B;  3MGQ B;  3LJA C;  2PYO A;  3AZH A;  3AN2 B;  4Z2M G;  1M18 D;  5CPJ C;  3KXB B;  1W2E A;  5GXQ C;  3EPH A;  3AYW A;  1KU5 A;  4Z66 A;  3AZK B;  3W97 C;  1TZY B;  1ID3 B;  4ZUX A;  1M19 C;  1ZLA C;  3AZF B;  5CPK C;  3WA9 A;  1B67 A;  3REL C;  2Y2P A;  3AV1 A;  4WJ3 C;  1P3B D;  3WKJ A;  1N1J B;  5CP6 A;  4XUJ C;  1P3M C;  3W99 A;  3B6F C;  2YFW B;  5B1L A;  5B33 D;  5CPI C;  3AZN D;  5C3I B;  3REJ D;  4G92 C;  1TAF B;  4H9P B;  3AZM B;  2ZY2 A;  3AZG B;  3B6G C;  5B0Y B;  1H3O A;  1P3I A;  4YM6 A;  3X1S D;  4WU9 B;  2ARO C;  4R8P A;  4WU8 D;  1BH8 A;  3LZ0 D;  4ZBJ C;  4J8U C;  4H9S C;  1P3O C;  5AV9 D;  4J8V A;  3LZ1 A;  4KGC C;  1P3L B;  3IP4 C;  5GT3 C;  1KX5 A;  3AZL A;  2J8P A;  5FUG A;  1AOI D;  4Z5T C;  3MNN B;  1KX4 D;  2JSS A;  3V9R A;  5JA4 A;  3KUY A;  5G49 B;  5E5A A;  5DNM A;  1P34 B;  5DNN B;  5B40 C;  5B0Z D;  3WTP B;  5B32 B;  5B24 A;  3TU4 C;  1KX3 C;  4Z2M H;  2PYO B;  3AZH B;  5AV5 B;  3MGR D;  5AVB D;  2Y2Q A;  4Z66 B;  1M1A D;  1B6W A;  1P3G C;  3MGS B;  3W96 C;  2NZD D;  3REI C;  3W98 D;  4ZUX B;  3LJA D;  3WA9 B;  5B32 G;  4WNN B;  3AV2 B;  5B2I C;  4JJN C;  2Y2L A;  3AV1 B;  2FJ7 B;  2HIO B;  3WKJ B;  3MVD C;  5GXQ D;  5CP6 B;  2Y2O A;  3X1V D;  4E45 A;  2CV5 C;  1P3B A;  5AV6 B;  4NE6 A;  5B1L B;  2Y2N A;  3LEL C;  3W97 D;  3MGP D;  2NQB C;  3C1C B;  3UTA C;  5GT0 C;  3A1I A;  5B33 A;  1A7W A;  4CSR B;  4YM6 B;  4J8X D;  3REL D;  3AZN A;  3REJ A;  3KWQ D;  2Y2K A;  3P5J B;  3UT9 B;  5B1M D;  4R8P B;  4XUJ D;  1P3P D;  4WV4 B;  3X1S A;  1BH8 B;  3AZJ C;  1P3M D;  1U35 C;  3AFA B;  3B6F D;  4UPK A;  4UUZ A;  2CWE A;  4J8V B;  3LZ1 B;  5CPI D;  1HTA A;  2XD1 A;  5JRG C;  2F8N D;  3MGQ C;  2F8N G;  3O62 A;  4NE3 A;  3B0C W;  5AV9 A;  1KX5 B;  3B6G D;  3AN2 C;  3WAA D;  2UWX A;  3V9R B;  5JA4 B;  3KXB C;  3KUY B;  5DNM B;  5E5A B;  1F66 D;  5AV8 C;  2DQN C;  5BS7 A;  3EPK A;  1AOI A;  1KX4 A;  4KUD D;  3AZK C;  5B24 B;  5B0Z A;  1P3O D;  2Y2H A;  1TZY C;  1ID3 C;  3X1T D;  1T3U A;  1HQ3 C;  2Y2I A;  5GT3 D;  4XZQ D;  3AZF C;  2Y2G A;  1Q9C A;  3REK D;  5AY8 D;  4Z5T D;  4X23 B;  3MGR A;  5B40 D;  3C1B D;  2G5H C;  3AZI D;  1WWS A;  3B0D B;  5AVB A;  5AVC D;  1M1A A;  4LD9 C;  2NZD A;  5C3I C;  3W98 A;  3A6N C;  4DRA A;  1P3A C;  3REH B;  3AZG C;  3LJA A;  5B0Y C;  3VH6 W;  4WU9 C;  1P3G D;  3X1U B;  1P3B B;  3X1V A;  3W97 A;  5B33 B;  3MGP A;  4H9Q A;  1P3L C;  1PZR A;  4JJN D;  2XD5 A;  4H9R B;  4J8X A;  3R45 A;  3MNN C;  3REL A;  3KWQ A;  3UTB D;  1P34 C;  5DNN C;  3WTP C;  5B1M A;  4XUJ A;  3LEL D;  1P3P A;  1P3M A;  3UTA D;  5GT0 D;  5B32 C;  3B6F A;  2JE5 A;  2PYO C;  3O62 B;  5AV9 B;  3AZH C;  3AZE D;  5AV5 C;  1P3F D;  5B31 D;  2F8N A;  3B6G A;  1AOI B;  1P3K B;  4Z66 C;  3WAA A;  1U35 D;  1KX4 B;  1F66 A;  3B0B A;  3MGS C;  3EPJ A;  3VH5 W;  4WZS B;  2BYK A;  5GSU D;  4KUD A;  5JRG D;  5F99 D;  4ZUX C;  4H9S A;  3WA9 C;  1P3O A;  3X1T A;  3AV2 C;  5BO0 B;  5GT3 A;  4XZQ A;  1ULY A;  3MGR B;  3AV1 C;  2HIO C;  5AV8 D;  2FJ7 C;  3WKJ C;  5CP6 C;  3REK A;  5AY8 A;  4Z5T A;  5AVB B;  3AL0 C;  5AV6 C;  5B40 A;  3C1B A;  5B1L C;  3KSY A;  1TZY D;  3AZI A;  5AVC A;  3C1C C;  2F8N K;  1HQ3 D;  3W98 B;  3AZF D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...