3REJC

2.55 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
103
structure length
103
Chain Sequence
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 31
structure length 103
sequence length 103
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rejC00
1M1AC 5AV9D 3AZFD 4UUZA 3AZKB 3TU4D 4ZUXB 4E45A 1M19B 3AZMB 3WAAC 1N1JB 3AZEC 1P3OC 5AVBC 4WU9C 4DRBA 5B2IC 3VH5T 1U35B 1TZYD 3O62B 3REJD 3X1VD 4Z66A 5B2JB 4J8WD 1HQ3C 4WNNA 1P3MC 3LELA 4QLCD 5GT3A 2F8NG 3UTAC 1P3FA 4EO5B 3AFAC 5DNMC 1ULYA 5AV8D 2HIOD 4Z66B 3AZJA 3VH6W 3W96C 3W98A 5F99A 3B6FA 3B0CW 5C3IC 5CPKC 1F66C 5GT3B 3C1BD 5B1MC 1P3FB 5B32G 1EQZD 3A6NC 3LJAD 1AOIC 1ZLAC 5B2JC 5B0YC 3X1TB 3W98B 5F99B 1P3ID 3B6FB 5AY8D 5E5AA 3AZGD 1TAFB 3NQUA 5JA4A 5CP6D 3UT9D 5B40A 3REIA 2F8ND 3REKD 1BFMA 5CPID 2PYOA 3KWQB 5JRGC 3W97D 1Q9CA 5B24C 5B31G 5E5AB 5GXQD 3LZ1A 4J8UD 1KX5D 3NQUB 5JA4B 4J8VD 3KXBC 5BNVB 4KGCC 3W99C 5B40B 3REIB 1KX4B 4JJNA 1KX3D 4WU8A 3KUYD 3AV2A 4Z5TD 1WWIA 1P34D 3C1CD 3AV1D 3LZ1B 4J8XD 1P3KD 1ID3C 4XZQD 4X23A 3AZHD 3RELC 5GSUB 4WU8B 3AZIA 3AV2B 3REHC 3X1UA 4NE6A 1P3GC 3MVDA 4LD9A 2JSSA 3AZIB 2NQBB 3B0CT 4Z2MG 5AV9C 5B33D 3X1UB 4G92B 3AZFC 5AV5B 3TU4C 2CV5D 4R8PB 2NZDB 5BS7A 1S32A 1M1AA 2IO5B 3WTPD 2YFWA 5GSUC 5DNNA 4HGAC 2FJ7A 3WA9D 1TZYC 3WAAA 3X1VC 3REJC 3AZEA 1P3OA 5B0ZB 5AVBA 3B0DC 3AZLB 5B2IA 4J8WC 1S32B 1M1AB 2YFWB 3MGQD 3B6GD 4AWLC 4QLCC 2F8NH 3WAAB 3AZEB 1HQ3A 5AV8C 2HIOC 5CHLB 4CAYA 5AV5C 5AVBB 3AZNA 4WU9B 1B67A 5B2IB 1P3MA 3UTAA 2IO5C 3LELD 3AFAA 4G91C 4ZBJC 5GT0D 3C1BC 3MNND 4KUDD 1N1JA 1EQZC 3W96A 3LJAC 3AZJD 1P3MB 5CPKA 1F66A 2AROD 5AV6D 3UTAB 5B1MA 3LZ0D 3AFAB 3O62A 5DNMB 1P3IC 5AY8C 3A6NA 3AZGC 1AOIA 5CP6C 3AN2B 3UT9C 5B2JA 5B0YA 3W96B 4CSRB 3REKC 3VH6A 5CPIC 5CPKB 5C3IB 1F66B 1P3BD 3W97C 5B1MB 4YS3D 5G49B 5GXQC 3A6NB 4J8UC 1KX5C 1AOIB 4J8VC 1WWSA 5JRGA 1ZLAB 3NQJA 5B0YB 2PYOD 5B24A 1KX3C 5B1LB 3KUYC 1P34C 3KXBA 3W99A 4XUJD 3AV1C 1P3AB 5CPJD 1P3KC 3AN2C 5JRGB 4JJND 3NQJB 4XZQC 2F8NK 5B24B 3AZHC 3X1TA 1TAFA 3MGSB 3WKJD 3KXBB 4H9RB 1P3PD 1ID3A 4KGCB 3W99B 3RELA 5AVCD 4X23D 3KWQA 1P3LD 3REHA 5B1LC 3WTPE 5BNVA 1ID3B 2YFVA 1P3GA 1P3AC 1KX4A 5B33C 4Z2MH 3RELB 3MVDD 4H9PA 2CV5C 4LD9D 3REHB 3MGRD 5AV9A 3WTPC 3MGSC 3V9RA 3TU4A 2YFVB 1P3GB 3WA9C 5GSUA 4H9PB 3VH5A 1M18D 5B32D 3X1SD 5AV9B 1TZYA 3MGQC 5DNND 3REJA 3AZFB 3X1VA 3V9RB 2FJ7D 3B6GC 3TU4B 1P3OD 4J8WA 3UTBD 4YM6D 2NQBA 4QLCA 1KU5A 4HGAB 3LELC 1TZYB 3REJB 3AYWD 3X1VB 5AV8A 5GT0C 2HIOA 5AV5A 3MNNC 3B0DB 1HQ3D 4R8PA 5B31D 4J8WB 4KUDC 2NZDA 1A7WA 3AZND 3MGPD 4AWLB 4QLCB 2AROC 5AV6C 3C1BA 3LZ0C 3AZKD 5AV8B 4ZUXD 3LJAA 1EQZA 2HIOB 5B0ZA 3AZMD 1M19D 3AZLA 5BO0A 1U35D 1B6WA 4G91B 1P3IA 5AY8A 3AZGA 4ZBJB 3C1BB 5CP6A 1P3BC 3O62D 4YS3C 1AOID 1EQZB 3LJAB 3REKA 5B2JD 4WU9A 3W97A 2HUEC 1BH9B 5BO0B 1P3IB 5AY8B 1KX5A 3AZGB 4J8VA 5CP6B 3UT9B 4WZSB 4XUJC 4Z66D 1KX3A 3REKB 5CPJC 2F8NB 5CPIB 3KUYA 4JJNC 3W97B 1P34A 5GT3D 3AV1A 5DNMA 1R4VA 5GXQB 4J8UB 1KX5B 1P3FD 4J8VB 3WKJC 1P3KA 3AN2A 1P3PC 4XZQA 3AZHA 4CSRA 1KX3B 5AVCC 4H9NA 4X23C 3KUYB 1P3LC 4Z5TB 3X1TD 1P34B 3W98D 5F99D 3B6FD 2RVQD 3C1CB 3AV1B 5G49A 4J8XB 2BYKA 1P3KB 1ZLAA 4XZQB 3KWQD 3AZHB 5B1LA 4H9NB 3MGRC 4M6BA 4H9SC 5E5AD 1P3AA 2BYKB 5B40D 4DRAA 3REID 2CV5A 1KX4D 1HTAA 3WTPA 1M18C 3MGSA 4Z5TC 5B32C 3X1SC 4H9RA 3LZ1D 5FUGB 3WA9A 4KGCA 3C1CC 5BT1D 5DNNC 5B33B 4J8XC 2FJ7C 2CV5B 5GSUD 3UTBC 4WU8D 3AV2D 4YM6C 3WTPB 3MGQA 3B6GA 3WA9B 4UUZB 3AYWC 4H9OA 5B31C 3AZID 2NQBD 3AZNC 3MGPC 3MGQB 3B6GB 5GT0A 3MNNA 3R45A 3X1UD 4KUDA 5AV5D 4H9OB 1F1EA 3AZKC 4ZUXC 4R8PD 2NZDD 1M19C 3AZMC 2AROA 4WNNB 5AV6A 1BH8A 3LZ0A 3LELB 1JFIA 1U35C 3AZFA 5GT0B 3O62C 3MNNB 4KHAA 3R45B 4KUDB 5B0ZD 3AZLD 3AZJB 1S32D 2AROB 1M1AD 1P3BA 5AV6B 1BH8B 3LZ0B 4YS3A 1JFIB 2BYMA 4EO5C 3WAAD 4KHAB 3AZED 5AVBD 4WU9D 4Z66C 5B2ID 4NE5A 1P3BB 4YS3B 4XUJA 5GT3C 2BYMB 1P3FC 5CPJA 1H3OA 2HUEB 4E44A 1P3MD 2PYOB 3UTAD 3AZJC 3WKJA 4H9QA 3X1TC 4WV4B 5F99C 5DNMD 3AFAD 1P3PA 3B6FC 3W98C 2RVQC 4XUJB 3AN2D 5CPJB 5AVCA 1H3OB 4JJNB 1P3LA 3W96D 1BH9A 5CPKD 3KWQC 1F66D 5B1MD 3WKJB 4H9QB 4NE3A 3UT9A 5E5AC 1P3PB 3A6ND 2CWEA 1ZLAD 2F8NA 5AVCB 5B40C 5CPIA 4X23B 3REIC 5B0YD 1KX4C 1P3LB 3VH5W 3MGRA 5B1LD 4H9SA 2PYOC 3VH6T 5GXQA 4J8UA 3B0BA 1P3AD 3LZ1C 5BT1C 4NFTA 5JRGD 3MVDB 1M18A 2L5AA 4LD9B 4Z5TA 5B24D 3MGRB 3X1SA 5B32A 4WU8C 3AV2C 3MGSD 3C1CA 3KXBD 4J8XA 4KGCD 3W99D 3UTBA 4YM6A 5BNXA 1M18B 5B32B 3X1SB 3AZIC 2NQBC 5DNNB 3AYWA 2FJ7B 1ID3D 5KDMA 1P3OB 3X1UC 4G92C 5B31A 3RELD 3UTBB 4YM6B 3MGPA 4R8PC 3MVDC 3REHD 5BNXB 2NZDC 4LD9C 3KSYA 5FUGA 3AZKA 2LY8A 5B33A 3AYWB 4ZUXA 1P3GD 1M19A 3AZMA 5KDMB 1HQ3B 5B31B 4CAYB 5B0ZC 3AZNB 3MGPB 3AZLC 5BS7C 1U35A 1S32C
chains in the Genus database with same CATH superfamily
1M1AC 5AV9D 3AZFD 4UUZA 3AZKB 3TU4D 3A1KA 4ZUXB 4E45A 1M19B 3AZMB 3WAAC 1N1JB 3AZEC 1P3OC 5AVBC 4WU9C 4DRBA 5B2IC 3VH5T 1U35B 1TZYD 3O62B 3REJD 3X1VD 4Z66A 5B2JB 4J8WD 1HQ3C 4WNNA 1P3MC 3LELA 4QLCD 5GT3A 2F8NG 3UTAC 1P3FA 4EO5B 3AFAC 5DNMC 1ULYA 5AV8D 2HIOD 4Z66B 2Y2GA 3AZJA 3VH6W 3W96C 3W98A 5F99A 3B6FA 3B0CW 5C3IC 5CPKC 1F66C 5GT3B 3C1BD 5B1MC 1P3FB 1W2EA 5B32G 1EQZD 3A6NC 3LJAD 4UPKA 1AOIC 1Z2CB 1ZLAC 5B2JC 5B0YC 3X1TB 3W98B 5F99B 1P3ID 3B6FB 5AY8D 5E5AA 3AZGD 1TAFB 3NQUA 5JA4A 5CP6D 3UT9D 5B40A 3REIA 2F8ND 3REKD 1BFMA 5CPID 2PYOA 3KWQB 5JRGC 3W97D 1Q9CA 5B24C 5B31G 5E5AB 5GXQD 3LZ1A 4J8UD 1KX5D 5JA4B 3NQUB 4J8VD 3KXBC 5BNVB 2DF4C 4KGCC 3W99C 5B40B 3REIB 1KX4B 4JJNA 1KX3D 2XD5A 4WU8A 3KUYD 3AV2A 4Z5TD 1WWIA 1P34D 3C1CD 3AV1D 3LZ1B 4J8XD 1P3KD 1ID3C 4XZQD 4X23A 3AZHD 3RELC 5GSUB 4WU8B 3AZIA 3AV2B 3REHC 1PZRA 2W8SA 3X1UA 4NE6A 1P3GC 3MVDA 3F6TA 4LD9A 2ZY5A 2JSSA 3AZIB 2NQBB 2ZY2A 3B0CT 4Z2MG 5AV9C 2ZM5A 5B33D 3X1UB 4G92B 3AZFC 5AV5B 1T3UA 3TU4C 2CV5D 4R8PB 2NZDB 5BS7A 1S32A 1M1AA 2IO5B 2JE5A 2YFWA 5GSUC 3WTPD 5DNNA 4HGAC 2FJ7A 3WA9D 1TZYC 3WAAA 3X1VC 3REJC 3AZEA 1P3OA 2Y2NA 5B0ZB 5AVBA 3B0DC 3AZLB 5B2IA 4J8WC 1S32B 1M1AB 2YFWB 3MGQD 3EG5B 3B6GD 4AWLC 4QLCC 2G5HC 2F8NH 3WAAB 3AZEB 1HQ3A 5AV8C 2HIOC 5CHLB 4CAYA 5AV5C 5AVBB 3AZNA 4WU9B 1B67A 5B2IB 1P3MA 3UTAA 2IO5C 3LELD 3IP4C 3AFAA 4G91C 4ZBJC 5GT0D 3C1BC 3MNND 4KUDD 2Y2MA 1N1JA 1EQZC 3W96A 3LJAC 3AZJD 1P3MB 5CPKA 1F66A 2AROD 5AV6D 3UTAB 5B1MA 3LZ0D 3AFAB 3O62A 5DNMB 1P3IC 5AY8C 3A6NA 3AZGC 1AOIA 5CP6C 3AN2B 3UT9C 5B2JA 5B0YA 3W96B 4CSRB 3REKC 3VH6A 5CPIC 5CPKB 5C3IB 1F66B 1P3BD 3W97C 5B1MB 4YS3D 3EPJA 5G49B 5GXQC 3A6NB 3FDDA 4J8UC 1KX5C 4J8VC 1AOIB 1WWSA 5JRGA 1ZLAB 3NQJA 5B0YB 2PYOD 5B24A 1KX3C 5B1LB 3KUYC 1P34C 3KXBA 3W99A 4XUJD 3AV1C 1P3AB 5CPJD 1P3KC 4WJ3C 3AN2C 5JRGB 4JJND 3NQJB 4XZQC 2F8NK 2Y2IA 5B24B 3AZHC 3X1TA 2Y2KA 1TAFA 3MGSB 3WKJD 3KXBB 4H9RB 1P3PD 1ID3A 4KGCB 3W99B 3RELA 5AVCD 4X23D 3KWQA 1P3LD 3REHA 5B1LC 3WTPE 5BNVA 1ID3B 2YFVA 1P3GA 1P3AC 1KX4A 5B33C 4Z2MH 3RELB 3MVDD 4H9PA 2CV5C 4LD9D 3REHB 2Y2JA 3MGRD 5AV9A 3WTPC 3MGSC 3V9RA 3TU4A 2YFVB 1P3GB 3WA9C 3EPLA 5GSUA 4H9PB 3VH5A 1M18D 5B32D 3X1SD 5AV9B 1TZYA 3MGQC 5DNND 3REJA 3AZFB 3X1VA 3V9RB 2FJ7D 3B6GC 3TU4B 1P3OD 4J8WA 3UTBD 4YM6D 2NQBA 4QLCA 1KU5A 3H0MC 4HGAB 3LELC 1TZYB 3REJB 3AYWD 3X1VB 5AV8A 5GT0C 2HIOA 5AV5A 3MNNC 3B0DB 1HQ3D 4R8PA 5B31D 4J8WB 4KUDC 2NZDA 1A7WA 3AZND 3MGPD 2DQNC 4AWLB 4QLCB 2AROC 2Y2LA 5AV6C 3C1BA 3KFUG 3LZ0C 3AZKD 3EPHA 5AV8B 4ZUXD 2ZY3A 3LJAA 1EQZA 2HIOB 5B0ZA 3AZMD 1M19D 3AZLA 5BO0A 2FFFB 1B6WA 4G91B 1U35D 5AY8A 1P3IA 3AZGA 4ZBJB 3C1BB 5CP6A 1P3BC 3O62D 4YS3C 1AOID 1EQZB 3LJAB 3REKA 5B2JD 4WU9A 3W97A 2BG1A 2G5IC 2HUEC 1BH9B 5BO0B 1P3IB 5AY8B 1KX5A 3AZGB 4J8VA 5CP6B 2ZY4A 3UT9B 4WZSB 4XUJC 4Z66D 1KX3A 3REKB 5CPJC 2F8NB 5CPIB 3KUYA 4JJNC 3W97B 1P34A 5GT3D 3AV1A 5DNMA 1R4VA 5GXQB 4J8UB 1KX5B 1P3FD 4J8VB 3WKJC 1P3KA 3AN2A 1P3PC 4XZQA 3AZHA 4CSRA 1KX3B 5AVCC 4H9NA 4X23C 3KUYB 1P3LC 4Z5TB 3X1TD 1P34B 3W98D 5F99D 3B6FD 2RVQD 3C1CB 3AV1B 5G49A 4J8XB 3P5JB 2BYKA 1P3KB 1ZLAA 4XZQB 3KWQD 3AZHB 5B1LA 4H9NB 3MGRC 4M6BA 4H9SC 5E5AD 3H0RC 1P3AA 2BYKB 5B40D 4DRAA 3REID 2CV5A 1KX4D 1HTAA 3WTPA 1M18C 2Y2QA 3MGSA 4Z5TC 5B32C 3X1SC 4H9RA 3LZ1D 5FUGB 3WA9A 4KGCA 3C1CC 5BT1D 5DNNC 5B33B 4J8XC 2FJ7C 2CV5B 5GSUD 3UTBC 4WU8D 3AV2D 4YM6C 3WTPB 3MGQA 3B6GA 3WA9B 4UUZB 3AYWC 4H9OA 2F2AC 2JCHA 2J8PA 5B31C 3AZID 2NQBD 3AZNC 3A1IA 3MGPC 3MGQB 2RIQA 3B6GB 5GT0A 3MNNA 3R45A 3X1UD 4KUDA 5AV5D 4H9OB 1F1EA 3AZKC 4ZUXC 4R8PD 2NZDD 1M19C 3AZMC 2AROA 4WNNB 5AV6A 1BH8A 3LZ0A 3LELB 1JFIA 1U35C 3AZFA 5GT0B 3O62C 3MNNB 4KHAA 3R45B 4KUDB 5B0ZD 3AZLD 3AZJB 1S32D 2AROB 1M1AD 1P3BA 5AV6B 1BH8B 3LZ0B 4YS3A 1JFIB 2BYMA 4EO5C 3WAAD 4KHAB 3AZED 5AVBD 4WU9D 4Z66C 3EPKA 5B2ID 2Y2OA 2Y2PA 4NE5A 1P3BB 4YS3B 5GT3C 4XUJA 2BYMB 2Y2HA 5CPJA 1P3FC 1H3OA 2HUEB 4E44A 1P3MD 2PYOB 3H0LC 3UTAD 3AZJC 3WKJA 4H9QA 3X1TC 4WV4B 5F99C 5DNMD 3AFAD 1P3PA 3B6FC 3W98C 2RVQC 4XUJB 3AN2D 5CPJB 5AVCA 1H3OB 4JJNB 1P3LA 3W96D 1BH9A 5CPKD 3KWQC 1F66D 5B1MD 3WKJB 4H9QB 2XD1A 4NE3A 3AL0C 3UT9A 5E5AC 1P3PB 3A6ND 2CWEA 1ZLAD 2F8NA 5AVCB 5B40C 5CPIA 4X23B 3REIC 5B0YD 1KX4C 1P3LB 3VH5W 3MGRA 5B1LD 4H9SA 2PYOC 3VH6T 5GXQA 4J8UA 3B0BA 1P3AD 3LZ1C 5BT1C 4NFTA 5JRGD 3MVDB 1M18A 2L5AA 4LD9B 4Z5TA 5B24D 3MGRB 3X1SA 5B32A 4WU8C 3AV2C 4DQYB 3MGSD 3C1CA 3KXBD 4J8XA 4KGCD 3W99D 3UTBA 4YM6A 5BNXA 1M18B 2UWXA 5B32B 3X1SB 3AZIC 2NQBC 2VQRA 5DNNB 3AYWA 2FJ7B 1ID3D 5KDMA 1P3OB 3X1UC 4G92C 5B31A 3RELD 3UTBB 4YM6B 3MGPA 4R8PC 3MVDC 3REHD 5BNXB 2NZDC 4LD9C 3KSYA 5FUGA 3AZKA 2LY8A 5B33A 3AYWB 4ZUXA 1P3GD 1M19A 3AZMA 5KDMB 1HQ3B 5B31B 4CAYB 5B0ZC 3AZNB 3MGPB 3AZLC 5BS7C 1U35A 1S32C
chains in the Genus database with same CATH topology
1M1AC 5AV9D 3AZFD 4UUZA 3AZKB 3TU4D 3A1KA 4ZUXB 4E45A 1M19B 3AZMB 3WAAC 1N1JB 3AZEC 1P3OC 5AVBC 4WU9C 4DRBA 5B2IC 3VH5T 1U35B 1TZYD 3O62B 3REJD 3X1VD 4Z66A 5B2JB 4J8WD 1HQ3C 4WNNA 1P3MC 3LELA 4QLCD 5GT3A 2F8NG 3UTAC 1P3FA 4EO5B 3AFAC 5DNMC 1ULYA 5AV8D 2HIOD 4Z66B 2Y2GA 3AZJA 3VH6W 3W96C 3W98A 5F99A 3B6FA 3B0CW 5C3IC 5CPKC 1F66C 5GT3B 3C1BD 5B1MC 1P3FB 1W2EA 5B32G 1EQZD 3A6NC 3LJAD 4UPKA 1AOIC 1Z2CB 1ZLAC 5B2JC 5B0YC 3X1TB 3W98B 5F99B 1P3ID 3B6FB 5AY8D 5E5AA 3AZGD 1TAFB 3NQUA 5JA4A 5CP6D 3UT9D 5B40A 3REIA 2F8ND 3REKD 1BFMA 5CPID 2PYOA 3KWQB 5JRGC 3W97D 1Q9CA 5B24C 5B31G 5E5AB 5GXQD 3LZ1A 4J8UD 1KX5D 5JA4B 3NQUB 4J8VD 3KXBC 5BNVB 2DF4C 4KGCC 3W99C 5B40B 3REIB 1KX4B 4JJNA 1KX3D 2XD5A 4WU8A 3KUYD 3AV2A 4Z5TD 1WWIA 1P34D 3C1CD 3AV1D 3LZ1B 4J8XD 1P3KD 1ID3C 4XZQD 4X23A 3AZHD 3RELC 5GSUB 4WU8B 3AZIA 3AV2B 3REHC 1PZRA 2W8SA 3X1UA 4NE6A 1P3GC 3MVDA 3F6TA 4LD9A 2ZY5A 2JSSA 3AZIB 2NQBB 2ZY2A 3B0CT 4Z2MG 5AV9C 2ZM5A 5B33D 3X1UB 4G92B 3AZFC 5AV5B 1T3UA 3TU4C 2CV5D 4R8PB 2NZDB 5BS7A 1S32A 1M1AA 2IO5B 2JE5A 2YFWA 5GSUC 3WTPD 5DNNA 4HGAC 2FJ7A 3WA9D 1TZYC 3WAAA 3X1VC 3REJC 3AZEA 1P3OA 2Y2NA 5B0ZB 5AVBA 3B0DC 3AZLB 5B2IA 4J8WC 1S32B 1M1AB 2YFWB 3MGQD 3EG5B 3B6GD 4AWLC 4QLCC 2G5HC 2F8NH 3WAAB 3AZEB 1HQ3A 5AV8C 2HIOC 5CHLB 4CAYA 5AV5C 5AVBB 3AZNA 4WU9B 1B67A 5B2IB 1P3MA 3UTAA 2IO5C 3LELD 3IP4C 3AFAA 4G91C 4ZBJC 5GT0D 3C1BC 3MNND 4KUDD 2Y2MA 1N1JA 1EQZC 3W96A 3LJAC 3AZJD 1P3MB 5CPKA 1F66A 2AROD 5AV6D 3UTAB 5B1MA 3LZ0D 3AFAB 3O62A 5DNMB 1P3IC 5AY8C 3A6NA 3AZGC 1AOIA 5CP6C 3AN2B 3UT9C 5B2JA 5B0YA 3W96B 4CSRB 3REKC 3VH6A 5CPIC 5CPKB 5C3IB 1F66B 1P3BD 3W97C 5B1MB 4YS3D 3EPJA 5G49B 5GXQC 3A6NB 3FDDA 4J8UC 1KX5C 4J8VC 1AOIB 1WWSA 5JRGA 1ZLAB 3NQJA 5B0YB 2PYOD 5B24A 1KX3C 5B1LB 3KUYC 1P34C 3KXBA 3W99A 4XUJD 3AV1C 1P3AB 5CPJD 1P3KC 4WJ3C 3AN2C 5JRGB 4JJND 3NQJB 4XZQC 2F8NK 2Y2IA 5B24B 3AZHC 3X1TA 2Y2KA 1TAFA 3MGSB 3WKJD 3KXBB 4H9RB 1P3PD 1ID3A 4KGCB 3W99B 3RELA 5AVCD 4X23D 3KWQA 1P3LD 3REHA 5B1LC 3WTPE 5BNVA 1ID3B 2YFVA 1P3GA 1P3AC 1KX4A 5B33C 4Z2MH 3RELB 3MVDD 4H9PA 2CV5C 4LD9D 3REHB 2Y2JA 3MGRD 5AV9A 3WTPC 3MGSC 3V9RA 3TU4A 2YFVB 1P3GB 3WA9C 3EPLA 5GSUA 4H9PB 3VH5A 1M18D 5B32D 3X1SD 5AV9B 1TZYA 3MGQC 5DNND 3REJA 3AZFB 3X1VA 3V9RB 2FJ7D 3B6GC 3TU4B 1P3OD 4J8WA 3UTBD 4YM6D 2NQBA 4QLCA 1KU5A 3H0MC 4HGAB 3LELC 1TZYB 3REJB 3AYWD 3X1VB 5AV8A 5GT0C 2HIOA 5AV5A 3MNNC 3B0DB 1HQ3D 4R8PA 5B31D 4J8WB 4KUDC 2NZDA 1A7WA 3AZND 3MGPD 2DQNC 4AWLB 4QLCB 2AROC 2Y2LA 5AV6C 3C1BA 3KFUG 3LZ0C 3AZKD 3EPHA 5AV8B 4ZUXD 2ZY3A 3LJAA 1EQZA 2HIOB 5B0ZA 3AZMD 1M19D 3AZLA 5BO0A 2FFFB 1B6WA 4G91B 1U35D 5AY8A 1P3IA 3AZGA 4ZBJB 3C1BB 5CP6A 1P3BC 3O62D 4YS3C 1AOID 1EQZB 3LJAB 3REKA 5B2JD 4WU9A 3W97A 2BG1A 2G5IC 2HUEC 1BH9B 5BO0B 1P3IB 5AY8B 1KX5A 3AZGB 4J8VA 5CP6B 2ZY4A 3UT9B 4WZSB 4XUJC 4Z66D 1KX3A 3REKB 5CPJC 2F8NB 5CPIB 3KUYA 4JJNC 3W97B 1P34A 5GT3D 3AV1A 5DNMA 1R4VA 5GXQB 4J8UB 1KX5B 1P3FD 4J8VB 3WKJC 1P3KA 3AN2A 1P3PC 4XZQA 3AZHA 4CSRA 1KX3B 5AVCC 4H9NA 4X23C 3KUYB 1P3LC 4Z5TB 3X1TD 1P34B 3W98D 5F99D 3B6FD 2RVQD 3C1CB 3AV1B 5G49A 4J8XB 3P5JB 2BYKA 1P3KB 1ZLAA 4XZQB 3KWQD 3AZHB 5B1LA 4H9NB 3MGRC 4M6BA 4H9SC 5E5AD 3H0RC 1P3AA 2BYKB 5B40D 4DRAA 3REID 2CV5A 1KX4D 1HTAA 3WTPA 1M18C 2Y2QA 3MGSA 4Z5TC 5B32C 3X1SC 4H9RA 3LZ1D 5FUGB 3WA9A 4KGCA 3C1CC 5BT1D 5DNNC 5B33B 4J8XC 2FJ7C 2CV5B 5GSUD 3UTBC 4WU8D 3AV2D 4YM6C 3WTPB 3MGQA 3B6GA 3WA9B 4UUZB 3AYWC 4H9OA 2F2AC 2JCHA 2J8PA 5B31C 3AZID 2NQBD 3AZNC 3A1IA 3MGPC 3MGQB 2RIQA 3B6GB 5GT0A 3MNNA 3R45A 3X1UD 4KUDA 5AV5D 4H9OB 1F1EA 3AZKC 4ZUXC 4R8PD 2NZDD 1M19C 3AZMC 2AROA 4WNNB 5AV6A 1BH8A 3LZ0A 3LELB 1JFIA 1U35C 3AZFA 5GT0B 3O62C 3MNNB 4KHAA 3R45B 4KUDB 5B0ZD 3AZLD 3AZJB 1S32D 2AROB 1M1AD 1P3BA 5AV6B 1BH8B 3LZ0B 4YS3A 1JFIB 2BYMA 4EO5C 3WAAD 4KHAB 3AZED 5AVBD 4WU9D 4Z66C 3EPKA 5B2ID 2Y2OA 2Y2PA 4NE5A 1P3BB 4YS3B 5GT3C 4XUJA 2BYMB 2Y2HA 5CPJA 1P3FC 1H3OA 2HUEB 4E44A 1P3MD 2PYOB 3H0LC 3UTAD 3AZJC 3WKJA 4H9QA 3X1TC 4WV4B 5F99C 5DNMD 3AFAD 1P3PA 3B6FC 3W98C 2RVQC 4XUJB 3AN2D 5CPJB 5AVCA 1H3OB 4JJNB 1P3LA 3W96D 1BH9A 5CPKD 3KWQC 1F66D 5B1MD 3WKJB 4H9QB 2XD1A 4NE3A 3AL0C 3UT9A 5E5AC 1P3PB 3A6ND 2CWEA 1ZLAD 2F8NA 5AVCB 5B40C 5CPIA 4X23B 3REIC 5B0YD 1KX4C 1P3LB 3VH5W 3MGRA 5B1LD 4H9SA 2PYOC 3VH6T 5GXQA 4J8UA 3B0BA 1P3AD 3LZ1C 5BT1C 4NFTA 5JRGD 3MVDB 1M18A 2L5AA 4LD9B 4Z5TA 5B24D 3MGRB 3X1SA 5B32A 4WU8C 3AV2C 4DQYB 3MGSD 3C1CA 3KXBD 4J8XA 4KGCD 3W99D 3UTBA 4YM6A 5BNXA 1M18B 2UWXA 5B32B 3X1SB 3AZIC 2NQBC 2VQRA 5DNNB 3AYWA 2FJ7B 1ID3D 5KDMA 1P3OB 3X1UC 4G92C 5B31A 3RELD 3UTBB 4YM6B 3MGPA 4R8PC 3MVDC 3REHD 5BNXB 2NZDC 4LD9C 3KSYA 5FUGA 3AZKA 2LY8A 5B33A 3AYWB 4ZUXA 1P3GD 1M19A 3AZMA 5KDMB 1HQ3B 5B31B 4CAYB 5B0ZC 3AZNB 3MGPB 3AZLC 5BS7C 1U35A 1S32C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1A C;  5AV9 D;  3AZF D;  4UUZ A;  3AZK B;  3TU4 D;  4ZUX B;  4E45 A;  1M19 B;  3AZM B;  3WAA C;  1N1J B;  3AZE C;  1P3O C;  5AVB C;  4WU9 C;  4DRB A;  5B2I C;  3VH5 T;  1U35 B;  1TZY D;  3O62 B;  3REJ D;  3X1V D;  4Z66 A;  5B2J B;  4J8W D;  1HQ3 C;  4WNN A;  1P3M C;  3LEL A;  4QLC D;  5GT3 A;  2F8N G;  3UTA C;  1P3F A;  4EO5 B;  3AFA C;  5DNM C;  1ULY A;  5AV8 D;  2HIO D;  4Z66 B;  3AZJ A;  3VH6 W;  3W96 C;  3W98 A;  5F99 A;  3B6F A;  3B0C W;  5C3I C;  5CPK C;  1F66 C;  5GT3 B;  3C1B D;  5B1M C;  1P3F B;  5B32 G;  1EQZ D;  3A6N C;  3LJA D;  1AOI C;  1ZLA C;  5B2J C;  5B0Y C;  3X1T B;  3W98 B;  5F99 B;  1P3I D;  3B6F B;  5AY8 D;  5E5A A;  3AZG D;  1TAF B;  3NQU A;  5JA4 A;  5CP6 D;  3UT9 D;  5B40 A;  3REI A;  2F8N D;  3REK D;  1BFM A;  5CPI D;  2PYO A;  3KWQ B;  5JRG C;  3W97 D;  1Q9C A;  5B24 C;  5B31 G;  5E5A B;  5GXQ D;  3LZ1 A;  4J8U D;  1KX5 D;  3NQU B;  5JA4 B;  4J8V D;  3KXB C;  5BNV B;  4KGC C;  3W99 C;  5B40 B;  3REI B;  1KX4 B;  4JJN A;  1KX3 D;  4WU8 A;  3KUY D;  3AV2 A;  4Z5T D;  1WWI A;  1P34 D;  3C1C D;  3AV1 D;  3LZ1 B;  4J8X D;  1P3K D;  1ID3 C;  4XZQ D;  4X23 A;  3AZH D;  3REL C;  5GSU B;  4WU8 B;  3AZI A;  3AV2 B;  3REH C;  3X1U A;  4NE6 A;  1P3G C;  3MVD A;  4LD9 A;  2JSS A;  3AZI B;  2NQB B;  3B0C T;  4Z2M G;  5AV9 C;  5B33 D;  3X1U B;  4G92 B;  3AZF C;  5AV5 B;  3TU4 C;  2CV5 D;  4R8P B;  2NZD B;  5BS7 A;  1S32 A;  1M1A A;  2IO5 B;  3WTP D;  2YFW A;  5GSU C;  5DNN A;  4HGA C;  2FJ7 A;  3WA9 D;  1TZY C;  3WAA A;  3X1V C;  3REJ C;  3AZE A;  1P3O A;  5B0Z B;  5AVB A;  3B0D C;  3AZL B;  5B2I A;  4J8W C;  1S32 B;  1M1A B;  2YFW B;  3MGQ D;  3B6G D;  4AWL C;  4QLC C;  2F8N H;  3WAA B;  3AZE B;  1HQ3 A;  5AV8 C;  2HIO C;  5CHL B;  4CAY A;  5AV5 C;  5AVB B;  3AZN A;  4WU9 B;  1B67 A;  5B2I B;  1P3M A;  3UTA A;  2IO5 C;  3LEL D;  3AFA A;  4G91 C;  4ZBJ C;  5GT0 D;  3C1B C;  3MNN D;  4KUD D;  1N1J A;  1EQZ C;  3W96 A;  3LJA C;  3AZJ D;  1P3M B;  5CPK A;  1F66 A;  2ARO D;  5AV6 D;  3UTA B;  5B1M A;  3LZ0 D;  3AFA B;  3O62 A;  5DNM B;  1P3I C;  5AY8 C;  3A6N A;  3AZG C;  1AOI A;  5CP6 C;  3AN2 B;  3UT9 C;  5B2J A;  5B0Y A;  3W96 B;  4CSR B;  3REK C;  3VH6 A;  5CPI C;  5CPK B;  5C3I B;  1F66 B;  1P3B D;  3W97 C;  5B1M B;  4YS3 D;  5G49 B;  5GXQ C;  3A6N B;  4J8U C;  1KX5 C;  1AOI B;  4J8V C;  1WWS A;  5JRG A;  1ZLA B;  3NQJ A;  5B0Y B;  2PYO D;  5B24 A;  1KX3 C;  5B1L B;  3KUY C;  1P34 C;  3KXB A;  3W99 A;  4XUJ D;  3AV1 C;  1P3A B;  5CPJ D;  1P3K C;  3AN2 C;  5JRG B;  4JJN D;  3NQJ B;  4XZQ C;  2F8N K;  5B24 B;  3AZH C;  3X1T A;  1TAF A;  3MGS B;  3WKJ D;  3KXB B;  4H9R B;  1P3P D;  1ID3 A;  4KGC B;  3W99 B;  3REL A;  5AVC D;  4X23 D;  3KWQ A;  1P3L D;  3REH A;  5B1L C;  3WTP E;  5BNV A;  1ID3 B;  2YFV A;  1P3G A;  1P3A C;  1KX4 A;  5B33 C;  4Z2M H;  3REL B;  3MVD D;  4H9P A;  2CV5 C;  4LD9 D;  3REH B;  3MGR D;  5AV9 A;  3WTP C;  3MGS C;  3V9R A;  3TU4 A;  2YFV B;  1P3G B;  3WA9 C;  5GSU A;  4H9P B;  3VH5 A;  1M18 D;  5B32 D;  3X1S D;  5AV9 B;  1TZY A;  3MGQ C;  5DNN D;  3REJ A;  3AZF B;  3X1V A;  3V9R B;  2FJ7 D;  3B6G C;  3TU4 B;  1P3O D;  4J8W A;  3UTB D;  4YM6 D;  2NQB A;  4QLC A;  1KU5 A;  4HGA B;  3LEL C;  1TZY B;  3REJ B;  3AYW D;  3X1V B;  5AV8 A;  5GT0 C;  2HIO A;  5AV5 A;  3MNN C;  3B0D B;  1HQ3 D;  4R8P A;  5B31 D;  4J8W B;  4KUD C;  2NZD A;  1A7W A;  3AZN D;  3MGP D;  4AWL B;  4QLC B;  2ARO C;  5AV6 C;  3C1B A;  3LZ0 C;  3AZK D;  5AV8 B;  4ZUX D;  3LJA A;  1EQZ A;  2HIO B;  5B0Z A;  3AZM D;  1M19 D;  3AZL A;  5BO0 A;  1U35 D;  1B6W A;  4G91 B;  1P3I A;  5AY8 A;  3AZG A;  4ZBJ B;  3C1B B;  5CP6 A;  1P3B C;  3O62 D;  4YS3 C;  1AOI D;  1EQZ B;  3LJA B;  3REK A;  5B2J D;  4WU9 A;  3W97 A;  2HUE C;  1BH9 B;  5BO0 B;  1P3I B;  5AY8 B;  1KX5 A;  3AZG B;  4J8V A;  5CP6 B;  3UT9 B;  4WZS B;  4XUJ C;  4Z66 D;  1KX3 A;  3REK B;  5CPJ C;  2F8N B;  5CPI B;  3KUY A;  4JJN C;  3W97 B;  1P34 A;  5GT3 D;  3AV1 A;  5DNM A;  1R4V A;  5GXQ B;  4J8U B;  1KX5 B;  1P3F D;  4J8V B;  3WKJ C;  1P3K A;  3AN2 A;  1P3P C;  4XZQ A;  3AZH A;  4CSR A;  1KX3 B;  5AVC C;  4H9N A;  4X23 C;  3KUY B;  1P3L C;  4Z5T B;  3X1T D;  1P34 B;  3W98 D;  5F99 D;  3B6F D;  2RVQ D;  3C1C B;  3AV1 B;  5G49 A;  4J8X B;  2BYK A;  1P3K B;  1ZLA A;  4XZQ B;  3KWQ D;  3AZH B;  5B1L A;  4H9N B;  3MGR C;  4M6B A;  4H9S C;  5E5A D;  1P3A A;  2BYK B;  5B40 D;  4DRA A;  3REI D;  2CV5 A;  1KX4 D;  1HTA A;  3WTP A;  1M18 C;  3MGS A;  4Z5T C;  5B32 C;  3X1S C;  4H9R A;  3LZ1 D;  5FUG B;  3WA9 A;  4KGC A;  3C1C C;  5BT1 D;  5DNN C;  5B33 B;  4J8X C;  2FJ7 C;  2CV5 B;  5GSU D;  3UTB C;  4WU8 D;  3AV2 D;  4YM6 C;  3WTP B;  3MGQ A;  3B6G A;  3WA9 B;  4UUZ B;  3AYW C;  4H9O A;  5B31 C;  3AZI D;  2NQB D;  3AZN C;  3MGP C;  3MGQ B;  3B6G B;  5GT0 A;  3MNN A;  3R45 A;  3X1U D;  4KUD A;  5AV5 D;  4H9O B;  1F1E A;  3AZK C;  4ZUX C;  4R8P D;  2NZD D;  1M19 C;  3AZM C;  2ARO A;  4WNN B;  5AV6 A;  1BH8 A;  3LZ0 A;  3LEL B;  1JFI A;  1U35 C;  3AZF A;  5GT0 B;  3O62 C;  3MNN B;  4KHA A;  3R45 B;  4KUD B;  5B0Z D;  3AZL D;  3AZJ B;  1S32 D;  2ARO B;  1M1A D;  1P3B A;  5AV6 B;  1BH8 B;  3LZ0 B;  4YS3 A;  1JFI B;  2BYM A;  4EO5 C;  3WAA D;  4KHA B;  3AZE D;  5AVB D;  4WU9 D;  4Z66 C;  5B2I D;  4NE5 A;  1P3B B;  4YS3 B;  4XUJ A;  5GT3 C;  2BYM B;  1P3F C;  5CPJ A;  1H3O A;  2HUE B;  4E44 A;  1P3M D;  2PYO B;  3UTA D;  3AZJ C;  3WKJ A;  4H9Q A;  3X1T C;  4WV4 B;  5F99 C;  5DNM D;  3AFA D;  1P3P A;  3B6F C;  3W98 C;  2RVQ C;  4XUJ B;  3AN2 D;  5CPJ B;  5AVC A;  1H3O B;  4JJN B;  1P3L A;  3W96 D;  1BH9 A;  5CPK D;  3KWQ C;  1F66 D;  5B1M D;  3WKJ B;  4H9Q B;  4NE3 A;  3UT9 A;  5E5A C;  1P3P B;  3A6N D;  2CWE A;  1ZLA D;  2F8N A;  5AVC B;  5B40 C;  5CPI A;  4X23 B;  3REI C;  5B0Y D;  1KX4 C;  1P3L B;  3VH5 W;  3MGR A;  5B1L D;  4H9S A;  2PYO C;  3VH6 T;  5GXQ A;  4J8U A;  3B0B A;  1P3A D;  3LZ1 C;  5BT1 C;  4NFT A;  5JRG D;  3MVD B;  1M18 A;  2L5A A;  4LD9 B;  4Z5T A;  5B24 D;  3MGR B;  3X1S A;  5B32 A;  4WU8 C;  3AV2 C;  3MGS D;  3C1C A;  3KXB D;  4J8X A;  4KGC D;  3W99 D;  3UTB A;  4YM6 A;  5BNX A;  1M18 B;  5B32 B;  3X1S B;  3AZI C;  2NQB C;  5DNN B;  3AYW A;  2FJ7 B;  1ID3 D;  5KDM A;  1P3O B;  3X1U C;  4G92 C;  5B31 A;  3REL D;  3UTB B;  4YM6 B;  3MGP A;  4R8P C;  3MVD C;  3REH D;  5BNX B;  2NZD C;  4LD9 C;  3KSY A;  5FUG A;  3AZK A;  2LY8 A;  5B33 A;  3AYW B;  4ZUX A;  1P3G D;  1M19 A;  3AZM A;  5KDM B;  1HQ3 B;  5B31 B;  4CAY B;  5B0Z C;  3AZN B;  3MGP B;  3AZL C;  5BS7 C;  1U35 A;  1S32 C; 
#chains in the Genus database with same CATH topology
 1M1A C;  5AV9 D;  3AZF D;  4UUZ A;  3AZK B;  3TU4 D;  3A1K A;  4ZUX B;  4E45 A;  1M19 B;  3AZM B;  3WAA C;  1N1J B;  3AZE C;  1P3O C;  5AVB C;  4WU9 C;  4DRB A;  5B2I C;  3VH5 T;  1U35 B;  1TZY D;  3O62 B;  3REJ D;  3X1V D;  4Z66 A;  5B2J B;  4J8W D;  1HQ3 C;  4WNN A;  1P3M C;  3LEL A;  4QLC D;  5GT3 A;  2F8N G;  3UTA C;  1P3F A;  4EO5 B;  3AFA C;  5DNM C;  1ULY A;  5AV8 D;  2HIO D;  4Z66 B;  2Y2G A;  3AZJ A;  3VH6 W;  3W96 C;  3W98 A;  5F99 A;  3B6F A;  3B0C W;  5C3I C;  5CPK C;  1F66 C;  5GT3 B;  3C1B D;  5B1M C;  1P3F B;  1W2E A;  5B32 G;  1EQZ D;  3A6N C;  3LJA D;  4UPK A;  1AOI C;  1Z2C B;  1ZLA C;  5B2J C;  5B0Y C;  3X1T B;  3W98 B;  5F99 B;  1P3I D;  3B6F B;  5AY8 D;  5E5A A;  3AZG D;  1TAF B;  3NQU A;  5JA4 A;  5CP6 D;  3UT9 D;  5B40 A;  3REI A;  2F8N D;  3REK D;  1BFM A;  5CPI D;  2PYO A;  3KWQ B;  5JRG C;  3W97 D;  1Q9C A;  5B24 C;  5B31 G;  5E5A B;  5GXQ D;  3LZ1 A;  4J8U D;  1KX5 D;  5JA4 B;  3NQU B;  4J8V D;  3KXB C;  5BNV B;  2DF4 C;  4KGC C;  3W99 C;  5B40 B;  3REI B;  1KX4 B;  4JJN A;  1KX3 D;  2XD5 A;  4WU8 A;  3KUY D;  3AV2 A;  4Z5T D;  1WWI A;  1P34 D;  3C1C D;  3AV1 D;  3LZ1 B;  4J8X D;  1P3K D;  1ID3 C;  4XZQ D;  4X23 A;  3AZH D;  3REL C;  5GSU B;  4WU8 B;  3AZI A;  3AV2 B;  3REH C;  1PZR A;  2W8S A;  3X1U A;  4NE6 A;  1P3G C;  3MVD A;  3F6T A;  4LD9 A;  2ZY5 A;  2JSS A;  3AZI B;  2NQB B;  2ZY2 A;  3B0C T;  4Z2M G;  5AV9 C;  2ZM5 A;  5B33 D;  3X1U B;  4G92 B;  3AZF C;  5AV5 B;  1T3U A;  3TU4 C;  2CV5 D;  4R8P B;  2NZD B;  5BS7 A;  1S32 A;  1M1A A;  2IO5 B;  2JE5 A;  2YFW A;  5GSU C;  3WTP D;  5DNN A;  4HGA C;  2FJ7 A;  3WA9 D;  1TZY C;  3WAA A;  3X1V C;  3REJ C;  3AZE A;  1P3O A;  2Y2N A;  5B0Z B;  5AVB A;  3B0D C;  3AZL B;  5B2I A;  4J8W C;  1S32 B;  1M1A B;  2YFW B;  3MGQ D;  3EG5 B;  3B6G D;  4AWL C;  4QLC C;  2G5H C;  2F8N H;  3WAA B;  3AZE B;  1HQ3 A;  5AV8 C;  2HIO C;  5CHL B;  4CAY A;  5AV5 C;  5AVB B;  3AZN A;  4WU9 B;  1B67 A;  5B2I B;  1P3M A;  3UTA A;  2IO5 C;  3LEL D;  3IP4 C;  3AFA A;  4G91 C;  4ZBJ C;  5GT0 D;  3C1B C;  3MNN D;  4KUD D;  2Y2M A;  1N1J A;  1EQZ C;  3W96 A;  3LJA C;  3AZJ D;  1P3M B;  5CPK A;  1F66 A;  2ARO D;  5AV6 D;  3UTA B;  5B1M A;  3LZ0 D;  3AFA B;  3O62 A;  5DNM B;  1P3I C;  5AY8 C;  3A6N A;  3AZG C;  1AOI A;  5CP6 C;  3AN2 B;  3UT9 C;  5B2J A;  5B0Y A;  3W96 B;  4CSR B;  3REK C;  3VH6 A;  5CPI C;  5CPK B;  5C3I B;  1F66 B;  1P3B D;  3W97 C;  5B1M B;  4YS3 D;  3EPJ A;  5G49 B;  5GXQ C;  3A6N B;  3FDD A;  4J8U C;  1KX5 C;  4J8V C;  1AOI B;  1WWS A;  5JRG A;  1ZLA B;  3NQJ A;  5B0Y B;  2PYO D;  5B24 A;  1KX3 C;  5B1L B;  3KUY C;  1P34 C;  3KXB A;  3W99 A;  4XUJ D;  3AV1 C;  1P3A B;  5CPJ D;  1P3K C;  4WJ3 C;  3AN2 C;  5JRG B;  4JJN D;  3NQJ B;  4XZQ C;  2F8N K;  2Y2I A;  5B24 B;  3AZH C;  3X1T A;  2Y2K A;  1TAF A;  3MGS B;  3WKJ D;  3KXB B;  4H9R B;  1P3P D;  1ID3 A;  4KGC B;  3W99 B;  3REL A;  5AVC D;  4X23 D;  3KWQ A;  1P3L D;  3REH A;  5B1L C;  3WTP E;  5BNV A;  1ID3 B;  2YFV A;  1P3G A;  1P3A C;  1KX4 A;  5B33 C;  4Z2M H;  3REL B;  3MVD D;  4H9P A;  2CV5 C;  4LD9 D;  3REH B;  2Y2J A;  3MGR D;  5AV9 A;  3WTP C;  3MGS C;  3V9R A;  3TU4 A;  2YFV B;  1P3G B;  3WA9 C;  3EPL A;  5GSU A;  4H9P B;  3VH5 A;  1M18 D;  5B32 D;  3X1S D;  5AV9 B;  1TZY A;  3MGQ C;  5DNN D;  3REJ A;  3AZF B;  3X1V A;  3V9R B;  2FJ7 D;  3B6G C;  3TU4 B;  1P3O D;  4J8W A;  3UTB D;  4YM6 D;  2NQB A;  4QLC A;  1KU5 A;  3H0M C;  4HGA B;  3LEL C;  1TZY B;  3REJ B;  3AYW D;  3X1V B;  5AV8 A;  5GT0 C;  2HIO A;  5AV5 A;  3MNN C;  3B0D B;  1HQ3 D;  4R8P A;  5B31 D;  4J8W B;  4KUD C;  2NZD A;  1A7W A;  3AZN D;  3MGP D;  2DQN C;  4AWL B;  4QLC B;  2ARO C;  2Y2L A;  5AV6 C;  3C1B A;  3KFU G;  3LZ0 C;  3AZK D;  3EPH A;  5AV8 B;  4ZUX D;  2ZY3 A;  3LJA A;  1EQZ A;  2HIO B;  5B0Z A;  3AZM D;  1M19 D;  3AZL A;  5BO0 A;  2FFF B;  1B6W A;  4G91 B;  1U35 D;  5AY8 A;  1P3I A;  3AZG A;  4ZBJ B;  3C1B B;  5CP6 A;  1P3B C;  3O62 D;  4YS3 C;  1AOI D;  1EQZ B;  3LJA B;  3REK A;  5B2J D;  4WU9 A;  3W97 A;  2BG1 A;  2G5I C;  2HUE C;  1BH9 B;  5BO0 B;  1P3I B;  5AY8 B;  1KX5 A;  3AZG B;  4J8V A;  5CP6 B;  2ZY4 A;  3UT9 B;  4WZS B;  4XUJ C;  4Z66 D;  1KX3 A;  3REK B;  5CPJ C;  2F8N B;  5CPI B;  3KUY A;  4JJN C;  3W97 B;  1P34 A;  5GT3 D;  3AV1 A;  5DNM A;  1R4V A;  5GXQ B;  4J8U B;  1KX5 B;  1P3F D;  4J8V B;  3WKJ C;  1P3K A;  3AN2 A;  1P3P C;  4XZQ A;  3AZH A;  4CSR A;  1KX3 B;  5AVC C;  4H9N A;  4X23 C;  3KUY B;  1P3L C;  4Z5T B;  3X1T D;  1P34 B;  3W98 D;  5F99 D;  3B6F D;  2RVQ D;  3C1C B;  3AV1 B;  5G49 A;  4J8X B;  3P5J B;  2BYK A;  1P3K B;  1ZLA A;  4XZQ B;  3KWQ D;  3AZH B;  5B1L A;  4H9N B;  3MGR C;  4M6B A;  4H9S C;  5E5A D;  3H0R C;  1P3A A;  2BYK B;  5B40 D;  4DRA A;  3REI D;  2CV5 A;  1KX4 D;  1HTA A;  3WTP A;  1M18 C;  2Y2Q A;  3MGS A;  4Z5T C;  5B32 C;  3X1S C;  4H9R A;  3LZ1 D;  5FUG B;  3WA9 A;  4KGC A;  3C1C C;  5BT1 D;  5DNN C;  5B33 B;  4J8X C;  2FJ7 C;  2CV5 B;  5GSU D;  3UTB C;  4WU8 D;  3AV2 D;  4YM6 C;  3WTP B;  3MGQ A;  3B6G A;  3WA9 B;  4UUZ B;  3AYW C;  4H9O A;  2F2A C;  2JCH A;  2J8P A;  5B31 C;  3AZI D;  2NQB D;  3AZN C;  3A1I A;  3MGP C;  3MGQ B;  2RIQ A;  3B6G B;  5GT0 A;  3MNN A;  3R45 A;  3X1U D;  4KUD A;  5AV5 D;  4H9O B;  1F1E A;  3AZK C;  4ZUX C;  4R8P D;  2NZD D;  1M19 C;  3AZM C;  2ARO A;  4WNN B;  5AV6 A;  1BH8 A;  3LZ0 A;  3LEL B;  1JFI A;  1U35 C;  3AZF A;  5GT0 B;  3O62 C;  3MNN B;  4KHA A;  3R45 B;  4KUD B;  5B0Z D;  3AZL D;  3AZJ B;  1S32 D;  2ARO B;  1M1A D;  1P3B A;  5AV6 B;  1BH8 B;  3LZ0 B;  4YS3 A;  1JFI B;  2BYM A;  4EO5 C;  3WAA D;  4KHA B;  3AZE D;  5AVB D;  4WU9 D;  4Z66 C;  3EPK A;  5B2I D;  2Y2O A;  2Y2P A;  4NE5 A;  1P3B B;  4YS3 B;  5GT3 C;  4XUJ A;  2BYM B;  2Y2H A;  5CPJ A;  1P3F C;  1H3O A;  2HUE B;  4E44 A;  1P3M D;  2PYO B;  3H0L C;  3UTA D;  3AZJ C;  3WKJ A;  4H9Q A;  3X1T C;  4WV4 B;  5F99 C;  5DNM D;  3AFA D;  1P3P A;  3B6F C;  3W98 C;  2RVQ C;  4XUJ B;  3AN2 D;  5CPJ B;  5AVC A;  1H3O B;  4JJN B;  1P3L A;  3W96 D;  1BH9 A;  5CPK D;  3KWQ C;  1F66 D;  5B1M D;  3WKJ B;  4H9Q B;  2XD1 A;  4NE3 A;  3AL0 C;  3UT9 A;  5E5A C;  1P3P B;  3A6N D;  2CWE A;  1ZLA D;  2F8N A;  5AVC B;  5B40 C;  5CPI A;  4X23 B;  3REI C;  5B0Y D;  1KX4 C;  1P3L B;  3VH5 W;  3MGR A;  5B1L D;  4H9S A;  2PYO C;  3VH6 T;  5GXQ A;  4J8U A;  3B0B A;  1P3A D;  3LZ1 C;  5BT1 C;  4NFT A;  5JRG D;  3MVD B;  1M18 A;  2L5A A;  4LD9 B;  4Z5T A;  5B24 D;  3MGR B;  3X1S A;  5B32 A;  4WU8 C;  3AV2 C;  4DQY B;  3MGS D;  3C1C A;  3KXB D;  4J8X A;  4KGC D;  3W99 D;  3UTB A;  4YM6 A;  5BNX A;  1M18 B;  2UWX A;  5B32 B;  3X1S B;  3AZI C;  2NQB C;  2VQR A;  5DNN B;  3AYW A;  2FJ7 B;  1ID3 D;  5KDM A;  1P3O B;  3X1U C;  4G92 C;  5B31 A;  3REL D;  3UTB B;  4YM6 B;  3MGP A;  4R8P C;  3MVD C;  3REH D;  5BNX B;  2NZD C;  4LD9 C;  3KSY A;  5FUG A;  3AZK A;  2LY8 A;  5B33 A;  3AYW B;  4ZUX A;  1P3G D;  1M19 A;  3AZM A;  5KDM B;  1HQ3 B;  5B31 B;  4CAY B;  5B0Z C;  3AZN B;  3MGP B;  3AZL C;  5BS7 C;  1U35 A;  1S32 C; 
#chains in the Genus database with same CATH homology
 1M1A C;  5AV9 D;  3AZF D;  4UUZ A;  3AZK B;  3TU4 D;  3A1K A;  4ZUX B;  4E45 A;  1M19 B;  3AZM B;  3WAA C;  1N1J B;  3AZE C;  1P3O C;  5AVB C;  4WU9 C;  4DRB A;  5B2I C;  3VH5 T;  1U35 B;  1TZY D;  3O62 B;  3REJ D;  3X1V D;  4Z66 A;  5B2J B;  4J8W D;  1HQ3 C;  4WNN A;  1P3M C;  3LEL A;  4QLC D;  5GT3 A;  2F8N G;  3UTA C;  1P3F A;  4EO5 B;  3AFA C;  5DNM C;  1ULY A;  5AV8 D;  2HIO D;  4Z66 B;  2Y2G A;  3AZJ A;  3VH6 W;  3W96 C;  3W98 A;  5F99 A;  3B6F A;  3B0C W;  5C3I C;  5CPK C;  1F66 C;  5GT3 B;  3C1B D;  5B1M C;  1P3F B;  1W2E A;  5B32 G;  1EQZ D;  3A6N C;  3LJA D;  4UPK A;  1AOI C;  1Z2C B;  1ZLA C;  5B2J C;  5B0Y C;  3X1T B;  3W98 B;  5F99 B;  1P3I D;  3B6F B;  5AY8 D;  5E5A A;  3AZG D;  1TAF B;  3NQU A;  5JA4 A;  5CP6 D;  3UT9 D;  5B40 A;  3REI A;  2F8N D;  3REK D;  1BFM A;  5CPI D;  2PYO A;  3KWQ B;  5JRG C;  3W97 D;  1Q9C A;  5B24 C;  5B31 G;  5E5A B;  5GXQ D;  3LZ1 A;  4J8U D;  1KX5 D;  5JA4 B;  3NQU B;  4J8V D;  3KXB C;  5BNV B;  2DF4 C;  4KGC C;  3W99 C;  5B40 B;  3REI B;  1KX4 B;  4JJN A;  1KX3 D;  2XD5 A;  4WU8 A;  3KUY D;  3AV2 A;  4Z5T D;  1WWI A;  1P34 D;  3C1C D;  3AV1 D;  3LZ1 B;  4J8X D;  1P3K D;  1ID3 C;  4XZQ D;  4X23 A;  3AZH D;  3REL C;  5GSU B;  4WU8 B;  3AZI A;  3AV2 B;  3REH C;  1PZR A;  2W8S A;  3X1U A;  4NE6 A;  1P3G C;  3MVD A;  3F6T A;  4LD9 A;  2ZY5 A;  2JSS A;  3AZI B;  2NQB B;  2ZY2 A;  3B0C T;  4Z2M G;  5AV9 C;  2ZM5 A;  5B33 D;  3X1U B;  4G92 B;  3AZF C;  5AV5 B;  1T3U A;  3TU4 C;  2CV5 D;  4R8P B;  2NZD B;  5BS7 A;  1S32 A;  1M1A A;  2IO5 B;  2JE5 A;  2YFW A;  5GSU C;  3WTP D;  5DNN A;  4HGA C;  2FJ7 A;  3WA9 D;  1TZY C;  3WAA A;  3X1V C;  3REJ C;  3AZE A;  1P3O A;  2Y2N A;  5B0Z B;  5AVB A;  3B0D C;  3AZL B;  5B2I A;  4J8W C;  1S32 B;  1M1A B;  2YFW B;  3MGQ D;  3EG5 B;  3B6G D;  4AWL C;  4QLC C;  2G5H C;  2F8N H;  3WAA B;  3AZE B;  1HQ3 A;  5AV8 C;  2HIO C;  5CHL B;  4CAY A;  5AV5 C;  5AVB B;  3AZN A;  4WU9 B;  1B67 A;  5B2I B;  1P3M A;  3UTA A;  2IO5 C;  3LEL D;  3IP4 C;  3AFA A;  4G91 C;  4ZBJ C;  5GT0 D;  3C1B C;  3MNN D;  4KUD D;  2Y2M A;  1N1J A;  1EQZ C;  3W96 A;  3LJA C;  3AZJ D;  1P3M B;  5CPK A;  1F66 A;  2ARO D;  5AV6 D;  3UTA B;  5B1M A;  3LZ0 D;  3AFA B;  3O62 A;  5DNM B;  1P3I C;  5AY8 C;  3A6N A;  3AZG C;  1AOI A;  5CP6 C;  3AN2 B;  3UT9 C;  5B2J A;  5B0Y A;  3W96 B;  4CSR B;  3REK C;  3VH6 A;  5CPI C;  5CPK B;  5C3I B;  1F66 B;  1P3B D;  3W97 C;  5B1M B;  4YS3 D;  3EPJ A;  5G49 B;  5GXQ C;  3A6N B;  3FDD A;  4J8U C;  1KX5 C;  4J8V C;  1AOI B;  1WWS A;  5JRG A;  1ZLA B;  3NQJ A;  5B0Y B;  2PYO D;  5B24 A;  1KX3 C;  5B1L B;  3KUY C;  1P34 C;  3KXB A;  3W99 A;  4XUJ D;  3AV1 C;  1P3A B;  5CPJ D;  1P3K C;  4WJ3 C;  3AN2 C;  5JRG B;  4JJN D;  3NQJ B;  4XZQ C;  2F8N K;  2Y2I A;  5B24 B;  3AZH C;  3X1T A;  2Y2K A;  1TAF A;  3MGS B;  3WKJ D;  3KXB B;  4H9R B;  1P3P D;  1ID3 A;  4KGC B;  3W99 B;  3REL A;  5AVC D;  4X23 D;  3KWQ A;  1P3L D;  3REH A;  5B1L C;  3WTP E;  5BNV A;  1ID3 B;  2YFV A;  1P3G A;  1P3A C;  1KX4 A;  5B33 C;  4Z2M H;  3REL B;  3MVD D;  4H9P A;  2CV5 C;  4LD9 D;  3REH B;  2Y2J A;  3MGR D;  5AV9 A;  3WTP C;  3MGS C;  3V9R A;  3TU4 A;  2YFV B;  1P3G B;  3WA9 C;  3EPL A;  5GSU A;  4H9P B;  3VH5 A;  1M18 D;  5B32 D;  3X1S D;  5AV9 B;  1TZY A;  3MGQ C;  5DNN D;  3REJ A;  3AZF B;  3X1V A;  3V9R B;  2FJ7 D;  3B6G C;  3TU4 B;  1P3O D;  4J8W A;  3UTB D;  4YM6 D;  2NQB A;  4QLC A;  1KU5 A;  3H0M C;  4HGA B;  3LEL C;  1TZY B;  3REJ B;  3AYW D;  3X1V B;  5AV8 A;  5GT0 C;  2HIO A;  5AV5 A;  3MNN C;  3B0D B;  1HQ3 D;  4R8P A;  5B31 D;  4J8W B;  4KUD C;  2NZD A;  1A7W A;  3AZN D;  3MGP D;  2DQN C;  4AWL B;  4QLC B;  2ARO C;  2Y2L A;  5AV6 C;  3C1B A;  3KFU G;  3LZ0 C;  3AZK D;  3EPH A;  5AV8 B;  4ZUX D;  2ZY3 A;  3LJA A;  1EQZ A;  2HIO B;  5B0Z A;  3AZM D;  1M19 D;  3AZL A;  5BO0 A;  2FFF B;  1B6W A;  4G91 B;  1U35 D;  5AY8 A;  1P3I A;  3AZG A;  4ZBJ B;  3C1B B;  5CP6 A;  1P3B C;  3O62 D;  4YS3 C;  1AOI D;  1EQZ B;  3LJA B;  3REK A;  5B2J D;  4WU9 A;  3W97 A;  2BG1 A;  2G5I C;  2HUE C;  1BH9 B;  5BO0 B;  1P3I B;  5AY8 B;  1KX5 A;  3AZG B;  4J8V A;  5CP6 B;  2ZY4 A;  3UT9 B;  4WZS B;  4XUJ C;  4Z66 D;  1KX3 A;  3REK B;  5CPJ C;  2F8N B;  5CPI B;  3KUY A;  4JJN C;  3W97 B;  1P34 A;  5GT3 D;  3AV1 A;  5DNM A;  1R4V A;  5GXQ B;  4J8U B;  1KX5 B;  1P3F D;  4J8V B;  3WKJ C;  1P3K A;  3AN2 A;  1P3P C;  4XZQ A;  3AZH A;  4CSR A;  1KX3 B;  5AVC C;  4H9N A;  4X23 C;  3KUY B;  1P3L C;  4Z5T B;  3X1T D;  1P34 B;  3W98 D;  5F99 D;  3B6F D;  2RVQ D;  3C1C B;  3AV1 B;  5G49 A;  4J8X B;  3P5J B;  2BYK A;  1P3K B;  1ZLA A;  4XZQ B;  3KWQ D;  3AZH B;  5B1L A;  4H9N B;  3MGR C;  4M6B A;  4H9S C;  5E5A D;  3H0R C;  1P3A A;  2BYK B;  5B40 D;  4DRA A;  3REI D;  2CV5 A;  1KX4 D;  1HTA A;  3WTP A;  1M18 C;  2Y2Q A;  3MGS A;  4Z5T C;  5B32 C;  3X1S C;  4H9R A;  3LZ1 D;  5FUG B;  3WA9 A;  4KGC A;  3C1C C;  5BT1 D;  5DNN C;  5B33 B;  4J8X C;  2FJ7 C;  2CV5 B;  5GSU D;  3UTB C;  4WU8 D;  3AV2 D;  4YM6 C;  3WTP B;  3MGQ A;  3B6G A;  3WA9 B;  4UUZ B;  3AYW C;  4H9O A;  2F2A C;  2JCH A;  2J8P A;  5B31 C;  3AZI D;  2NQB D;  3AZN C;  3A1I A;  3MGP C;  3MGQ B;  2RIQ A;  3B6G B;  5GT0 A;  3MNN A;  3R45 A;  3X1U D;  4KUD A;  5AV5 D;  4H9O B;  1F1E A;  3AZK C;  4ZUX C;  4R8P D;  2NZD D;  1M19 C;  3AZM C;  2ARO A;  4WNN B;  5AV6 A;  1BH8 A;  3LZ0 A;  3LEL B;  1JFI A;  1U35 C;  3AZF A;  5GT0 B;  3O62 C;  3MNN B;  4KHA A;  3R45 B;  4KUD B;  5B0Z D;  3AZL D;  3AZJ B;  1S32 D;  2ARO B;  1M1A D;  1P3B A;  5AV6 B;  1BH8 B;  3LZ0 B;  4YS3 A;  1JFI B;  2BYM A;  4EO5 C;  3WAA D;  4KHA B;  3AZE D;  5AVB D;  4WU9 D;  4Z66 C;  3EPK A;  5B2I D;  2Y2O A;  2Y2P A;  4NE5 A;  1P3B B;  4YS3 B;  5GT3 C;  4XUJ A;  2BYM B;  2Y2H A;  5CPJ A;  1P3F C;  1H3O A;  2HUE B;  4E44 A;  1P3M D;  2PYO B;  3H0L C;  3UTA D;  3AZJ C;  3WKJ A;  4H9Q A;  3X1T C;  4WV4 B;  5F99 C;  5DNM D;  3AFA D;  1P3P A;  3B6F C;  3W98 C;  2RVQ C;  4XUJ B;  3AN2 D;  5CPJ B;  5AVC A;  1H3O B;  4JJN B;  1P3L A;  3W96 D;  1BH9 A;  5CPK D;  3KWQ C;  1F66 D;  5B1M D;  3WKJ B;  4H9Q B;  2XD1 A;  4NE3 A;  3AL0 C;  3UT9 A;  5E5A C;  1P3P B;  3A6N D;  2CWE A;  1ZLA D;  2F8N A;  5AVC B;  5B40 C;  5CPI A;  4X23 B;  3REI C;  5B0Y D;  1KX4 C;  1P3L B;  3VH5 W;  3MGR A;  5B1L D;  4H9S A;  2PYO C;  3VH6 T;  5GXQ A;  4J8U A;  3B0B A;  1P3A D;  3LZ1 C;  5BT1 C;  4NFT A;  5JRG D;  3MVD B;  1M18 A;  2L5A A;  4LD9 B;  4Z5T A;  5B24 D;  3MGR B;  3X1S A;  5B32 A;  4WU8 C;  3AV2 C;  4DQY B;  3MGS D;  3C1C A;  3KXB D;  4J8X A;  4KGC D;  3W99 D;  3UTB A;  4YM6 A;  5BNX A;  1M18 B;  2UWX A;  5B32 B;  3X1S B;  3AZI C;  2NQB C;  2VQR A;  5DNN B;  3AYW A;  2FJ7 B;  1ID3 D;  5KDM A;  1P3O B;  3X1U C;  4G92 C;  5B31 A;  3REL D;  3UTB B;  4YM6 B;  3MGP A;  4R8P C;  3MVD C;  3REH D;  5BNX B;  2NZD C;  4LD9 C;  3KSY A;  5FUG A;  3AZK A;  2LY8 A;  5B33 A;  3AYW B;  4ZUX A;  1P3G D;  1M19 A;  3AZM A;  5KDM B;  1HQ3 B;  5B31 B;  4CAY B;  5B0Z C;  3AZN B;  3MGP B;  3AZL C;  5BS7 C;  1U35 A;  1S32 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...