3REVB

Crystal structure of human alloreactive tcr nb20
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
b'GVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSYVSQNNEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCR NB20 ALPHA CHAIN
publication title Structural and energetic evidence for highly peptide-specific tumor antigen targeting via allo-MHC restriction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 58
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2011-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3revB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3revB02
1P84K 3FN0H 3VFUA 3D85A 4JRXE 2NPLX 5C0CD 2BRQA 1ED3B 4WO4A 4ORGA 5C0AD 1MCOL 4R4BB 2BSTA 3M8OL 5EU4B 3NTCL 1A2YB 3LD8C 1WZ1H 3PGCB 3GJEA 1OP5H 4GXUN 4WU7A 1NBVL 1J87A 3KLSA 4Z0XA 4CL7A 5GPRA 3RDTB 2ZNWA 3P4OB 1NCAL 5DQDH 2FDBP 1C8PA 2OP4H 1FLRH 4HS8L 3LAFA 1D5XA 5JW4M 3S88H 1LO5A 1UFUA 2EO1A 3JWOL 4KC3B 1UZ6F 3MV9D 5DZOA 3KPSB 4KZDL 2EEDA 2Y5EA 1M7DB 3MRIB 3I6KB 3LCYA 4EIZC 4Z7QF 1EPFA 4PJ9D 4DGVL 4JCMA 4RGMC 4YHZH 4X8XA 2D7TL 1MHHA 1UXSB 5FCSH 2NY1C 1TENA 3G5XA 1D9KB 4OLVH 1QRNA 5FO7A 3MUY1 1DUZA 1YMMB 3RVTD 3O6FB 5ABDE 4U7MA 3L5XL 3O9WA 4YXLL 1MPAL 5ID1A 1NGPH 4HKBA 3R06A 3LZFL 3QCVL 2JJWA 4OCRH 1KCLA 4UV7H 3OKMB 1WIUA 2IPUK 4HJ0D 2NY4D 5JW3L 2KUTA 5D7KD 3PV6A 4C56A 2P5WE 5B3JF 4IHOA 1HWGB 3PQYB 4HBCH 3U46A 2RBLA 5IMKA 3ZL4L 4KVNH 4Y19B 1NKOA 2ADGB 1ZHNB 4FMFA 5SWQA 1JWMA 3BQUB 5AYUL 2WWKO 3MRFA 4GG6E 1BREA 5SWZA 4P2CG 3FO0L 3VFNA 2OLDA 4JFXA 4XPGL 2Y72A 4WUUD 2PTTA 2XQYK 1V7ML 4PGEA 3VRLF 3O4OC 1JF1B 4C55A 1IGYB 5ITBH 3VFWA 1IE5A 2X2YA 1XZ0B 4YFLF 3MNZA 2Z31C 4Z7VB 4PJ5A 3NCMA 1CFNB 1FRGL 5FGRA 4ZS6D 3G04B 4XNYH 3Q6FB 4QT5B 4F37F 1ZXQA 1CE1L 2FB4L 3ZTJG 1T0MA 3L95A 2B0SH 3ULVH 1AO7E 2K1MA 1NFIA 3K7UA 5EA0H 3KYMB 3MMEB 5FKAA 3BZ4A 4QWWC 4LKCA 1Q72L 1OTUD 4HK3J 4XPFL 1XIWD 2R2BA 4D8PA 1HHKB 4NO2A 4ONOA 4RGOH 1UQSA 5HYSG 3QWOB 4HQQH 2V17H 4WFGE 1X44A 5FO9B 4QHUA 2EDLA 3GRWA 1JBJA 1JTPA 3T0WA 5FYLE 4QRPD 4YWGL 1HOCA 1F3RB 1VGKB 4FXKA 4X5XB 2W9EH 3TJEL 1GH7A 4Q2ZA 4OV5B 2OJZH 1HSBA 1JPSH 1FFPB 5C0IB 1I7RA 4L1DA 4YE4H 1F6LL 1YECL 4PGZA 5ACZB 2FO1A 2NX5A 5F7FA 4K94L 1YNLH 2PYED 2Z31A 3KXFB 3PWPB 4K8RD 4PJGA 3BP4A 1DL7L 4M7LH 1OWRM 3AS2A 3V0WH 1RZGA 4OV6F 4ODTL 3G5VA 2R29L 4YEFA 2ZP0T 5F1KC 4P2OB 3HE6B 4GKZA 2BNRD 2ZUTA 5DMIH 3LH2L 3NOIA 5LAXB 2HVJA 4DZBA 5CKAA 3ARDD 2ZUWA 4UQ3B 1IC5L 2NLJB 5J6HB 1FG9C 3E6FB 1M05B 4X6DA 4HH8A 3U9PL 4J12A 4P5MB 3EHBC 3IF1B 2OXGA 1EGJA 4XBGB 4QYOA 1JK8A 3VXOA 3LKPB 2VABA 5DRWA 3BH8B 2F54D 5C09D 1OVZA 3AREB 3KR3H 1XF3A 3KAAA 4U33A 4IOIA 1N0LA 1OGAE 3RNQB 3QFJD 4Z7WA 4X6BA 1Y0LA 3IFNL 3IDGB 3IXAA 1IKNC 3NAAH 3O6LL 1JGVL 5CUSH 3KPPB 1NEZA 5MEQA 3O3DB 1JJUA 4NQTA 3U4BL 3DO7B 3QYCA 1W0WB 1Z2KA 2V7HB 1NC2A 3TLRA 3DV6A 4CVXB 1CGTA 1CG9A 3JV4A 3MRCA 1LK2B 4FG6C 1MRFH 1R24B 4QO1A 1V8HA 1U8NB 2UVEA 3UJIL 4HCRL 2CKBH 4PY8I 3O2DL 3WS3A 4HWEL 1BWMA 1A1MA 3ILQD 5K59E 5A2KH 4HS3A 4M62H 4JDZB 2LU4A 1A0QH 4XXDA 2MNUA 3VWKD 2HTKD 1P7QB 2D9CA 5B4MC 5E94B 5HGAB 3V6ZB 2H3NB 3CH1B 4P2QE 4N8VB 2YPLA 4CVWA 2FBOJ 1Q9WB 1R6VA 4MQSB 4B7LA 1XF1A 5HHVH 1QKZL 4L8CB 4ZSOA 1L7TL 4GT7A 3VMNA 4ZUVA 3VXMB 3DROA 3OKOB 1CICC 4WWKD 4WEBH 4S1QH 2HT2D 1PY9A 1NGYA 5FYKH 1ZKAA 2FIKB 3LN4B 1PZUB 5KTEH 5FDYA 1N26A 2Z4QB 1IKNA 4DUWA 2ZWLT 4KI1A 3UTTA 3W9DB 1S7RB 2NMSA 5T3ZL 4DKFL 5JMOC 4PRIE 2VDRL 4X4MA 4JDTH 1HHGB 1W8OA 5DMGC 4PIRF 1GCFA 1FL6B 4ONHA 4Z78A 5I1HL 3L5JA 2BHUA 1TZHA 4HGWA 5KSAD 4HJGB 5A3ID 5FV1L 3MGTB 1FSKB 3QSKB 3L3HB 4XHQA 5BZDA 4DTGH 2F8OA 3S7GA 2WQ8A 2YS4A 5L2KD 1UA6L 4P46D 1WK0A 1GIGL 1YC7A 4FA8A 2AGJH 5GSRB 4P49A 3BKML 3OHXB 3PP3H 1IM9A 4PJFF 3QWRA 2AP2A 2DQGH 4Q9RH 1NEUA 2LE9A 1QHPA 4APQA 3VCLB 3NFSL 1FFNA 4NSKB 4BQBA 5D7IB 4HG4K 1IILE 1QLEH 3CZFA 3TCXA 2XNAA 2YEZB 3IU4H 3GBLA 4N0FB 3FB7B 3MV7B 4GAJL 1CICA 2GSIB 5CZXC 5SWSD 4NOFA 4OZGA 4PBWD 3SKOB 1BOYA 4ZAKC 4J3VA 1BBDL 1JNJA 2D7MA 1AKJD 3EFDL 1S9WB 3DGCR 5BJTB 4IOFD 4OAWA 4UNUA 4HGMA 3EFFA 4OIIH 3TEUA 3GMOA 4PRBB 2O61B 2CJUL 3RRQA 4OQTL 5DI8B 1OAZL 2ED9A 4TOYL 4GXUM 4HMCA 5CIPH 1FC2D 3PQYE 1YEGH 3MTRA 1BWWA 4V1DB 5BVJA 3QXAB 2BXZA 1QBLH 5DC4B 2EE9A 2DKSA 2DYPB 1OW0C 4NRZB 5DJ8B 3UMTA 1UKQA 25C8H 1KENL 1WISA 3SDYL 1YNKH 1HQRB 3CFCH 4F2MA 3IKCB 1GGBH 4NUJA 5DRNB 5HBBA 3IRZA 4ZOCA 4OCLC 3DX7A 3O6ML 1A1NB 1R5IA 3CXHJ 4I18C 4X7FC 2Q87A 3MROB 1A6AA 3QZWB 5C0CB 3EJZC 4MZ2A 5C0AB 3MCG1 4MS8D 1JFQH 4OFDA 4KUZL 1HKLL 2I5YH 4KVCH 4OF0A 5T33L 4RNRA 3FAXA 4PBVC 4MLIA 5GSVA 5HHOD 1G0DA 1Q9OA 1FIGH 3ARFB 1QSEE 3BDXA 4XX1G 1NH6A 4ZAKA 3DXAD 3DYMA 3CU1A 1KPVB 1AJ7H 3HI6H 2X1OA 3DECA 3IJSA 1CFQA 1T89C 4YHIB 3BFOA 1C5DA 3LPFA 5ENWB 1H3TA 2Q3ZA 3CSPA 4CU6A 1A5FL 12E8L 4MCZA 4J6RH 2SEBB 4OD2A 5EZJB 1BFVH 3EOAA 3OR6B 4U1IB 4A6YA 2D7PA 3I75A 1CCZA 5DVOA 2J8UE 4WI5A 5F7KC 2UUDK 1LEIA 1RJCA 5GZOC 4LPYA 5F7EL 1OW0A 4PJ9B 5IHZB 4HAFA 5JMRA 1FL5A 5I1EL 4KXZI 4OLWH 1MI5A 1LE5A 3MOBH 1C1EH 4RISL 3S3JA 5FCUH 5IESH 4WVRA 1KB9K 4FS0A 4I18A 3L3JB 4P99A 5T1KA 5FYJL 4ZNCD 1N5YL 3Q3GB 5JQ6H 1T1XB 2FO4B 2X4UB 3S5LG 1ZSDB 2Y07L 4WHYG 2X1WL 4ZFZB 2NY4B 4MNHB 2DICA 3QQNA 5E56A 1PKOA 4PJDB 3N9GH 5CCKL 2C1OA 4FFYH 1TVBA 2EDFA 2YOCA 4PRHE 5E1AA 3PWPE 4KMTH 4QXUH 1PKQA 3FOLB 4X83A 3BZDA 1T1YA 4I3SL 1IKFL 2YMXH 3MRDB 15C8H 4XMLL 1MIEH 1HWHB 5FHAH 4GAYA 2YD3A 1T89A 3BD3A 4NQCE 1YYMH 3RX7A 2IPKA 1F4YL 2MWCA 3GIVB 5D72H 1CXEA 4GG6F 2V2WB 4G6KL 1HYRC 3DETD 4WUUB 4Y8DC 3QCUH 3QG7H 5DVNA 3BWAB 4NHCL 1F2XK 4L4JA 3AC0A 1SJHA 2WLYA 1JGLL 2EKSA 4NKQB 4UV4H 2H9GA 4MCYA 2MMXA 1DUYA 4JRWA 5T1LA 1NFDB 4LF3B 5EIIB 4JY4B 1TFHA 1MCCA 3VFSA 1NUDA 2Z8VC 2FHCA 4NT6B 1TTUA 2IGFH 3GMNA 3RHWK 4LSUL 1UEMA 4XP6L 1LEGA 3U79A 4NN7B 4R26L 2Q76A 3VXRA 4NWUH 5E6IA 1G7LB 3VFTA 2O26U 2AJSL 4AMKL 4G9DB 1X5ZA 3H0TA 3PP4L 4UIMA 2UVFA 5BRZD 2YHGA 2EDQA 2X70A 4RMTA 2C9AA 1XIWB 3CDCA 4KK8C 5TE7H 1U3HA 3BJLA 4EIGB 4G3YL 4DQOL 4ZUTA 3EYUH 3R8BB 2YBRA 2DS4A 1MCIA 5C70A 5TGBB 3BGFB 1BECA 4NC1E 1UH3A 2Q7YA 4OFIA 3PNWA 4QRPB 5GRJL 1KCSL 3CLEL 4JQIL 1NCTA 5MERB 5GS0L 3EOBA 4N8CL 5INDB 4JO2L 4NM8L 3BAEL 1PX4A 1YJDL 2PYEB 1QSZA 1TZGH 4WJ5B 1T20A 5AD0A 4TNVK 2NZIA 4HF5L 3CFKA 3FMGL 3U2SA 3STZA 3B6SA 2UWEB 1RI8A 5EO1B 3Q1SH 2A9NH 3HNSL 4NZUL 2X44D 5GGRA 1RFDH 5HHPB 2BNRB 2EZ0D 4N90D 5K9KA 3EO1B 2VDPL 3NCFB 3ARDB 3UTQB 2AK4A 3V4PH 3TH2T 3GHBH 4YBQC 3OF6D 3UZEA 1H3VA 3LRHA 5TPWL 1U0QA 3TNMB 2CGRH 4PGBA 1OCWL 4H25A 1YN6A 2XQYG 3QEHB 2F54B 5C09B 5IK3A 1MHCB 2HYMA 4K9EL 4ZOAA 1AC0A 1Q8MA 1RY7B 4NBYB 5DK2A 1KCRH 2XIDA 2IANB 4ZOBA 4P9HC 2DLHA 1T2JA 5JOEA 4PYGA 2OZ4H 4Z0BL 1OARH 3D3VA 3T2PA 1UCTA 1SEQL 3TIDB 4FQXD 4OM1H 4XTRD 1OTSD 5E2UH 3TWCL 1NL0H 4FFVD 4PJFA 2GIYA 4PR5A 3VXSA 4Z6AT 4YAQB 3MRQB 5K59F 5MEND 3TJHC 1N4XH 4QLRA 5CMAA 3LKQB 1BVKA 1W0VB 1DBBH 3QJFA 5HYJD 4HBQA 2HWZH 2FJGA 3NN8A 3VFMA 1DN2A 1LWRA 1NCNA 4OGAC 3TCLB 1BGXL 2JIXD 3L1OL 3O3AA 5IB2B 4WWKB 3C5ZC 3LMJH 1ETZB 1P2CB 3BPNB 1PBYA 1KCUL 2C7UB 4MA7L 4OF8A 1ORQA 1RHHA 4M1DH 5JPNB 3BH9B 4LK4A 3EYVA 3QQ4A 4GUPA 2XQBL 1TNMA 5DA0B 5E7BA 3QXTA 1KC5H 4F7MA 4Y1AE 4NP4H 5I1CH 4ONGH 1CDGA 2E6PA 4NC2B 3TBWA 3DX9B 2PW2A 5GRVK 3IFLH 3SDDC 4ZMAT 1X5GA 1WZLA 2ZG3A 3V7MA 4OGXL 5KSAB 5T5FH 4YK4C 4XC3L 4OCYL 4O51A 2VDOH 5FHBL 4NNPH 2O5XH 4ODBD 5L2KB 2FGWH 1EERB 4KKCD 1GGCH 3MLXH 4UDUB 4LL9A 3WFDH 2ENYA 4MD4A 5I15H 4JRXA 3ULSA 4OQ1A 3J7HA 3MV9E 2C3VB 2HTLC 2GJ6E 4K7FA 3HAEB 4KJPD 1S5IL 4XCNA 2CK0H 3L9RA 3GBNL 5FGCE 3WMSA 4NBXB 1BM3L 4ZO7A 2VC2H 2PTVA 2IAMD 3C5ZA 3S36L 1OT1A 5SWSB 5C0ND 1R3KB 4JO4L 1IGCL 4KUCD 1UWGL 1YN7A 3RWIA 1I1YA 4W4NA 2YD2A 2EH8L 1XGTA 3WKML 4OD3H 4M8QA 4ZFOL 3ARYA 3QO1B 5DJXB 4KK6D 3WS6C 4GXVH 3BJ91 2Y36L 3SDDA 3TZVD 1U91A 3W11D 3QDMA 4M7KH 2VZTA 4HKJA 4NQVB 3PL6C 5EDXA 4O02H 1R3LA 1WBYB 5I75B 4QEGA 1KPUA 3EDKA 1JMXA 4IJ3C 3QDJA 3QP3A 3BXNA 4NN5C 1P53A 2KZWA 1T4KB 1AHWC 1A7BA 4QTHB 3RX8A 4RZCB 5I9QB 4LCWE 4WUUE 7FABL 3MUJA 1BD2B 3QH3B 4N8VG 4X4XB 3VFRA 1I1AC 2YUVA 3O41B 4M6OH 1XCQA 4R2GB 3PHOA 1D5IL 3TYFB 2VQTA 3M07A 5DUBA 2CLVB 1S7TA 4PG2C 1UEYA 4RFOH 1QQDB 5I8OL 2XA8L 4X5WB 2HH0L 3V6FB 2MHAB 2B8OT 5HHOB 1IC1A 4HFUH 5HHQA 4BQ8A 3DX8B 3DXAB 2AI0H 2VWEE 1RURL 2XWBA 3GMQB 4JO3H 4KRLB 2EIEA 5DYOA 4YHLH 1Y6MR 4Q9CA 2R8SH 2PNDA 4XP5L 2NTFB 3WIHH 4M7JL 5C0EB 5E4IA 5I30H 3WS6A 4QRSB 1KV3A 4RSVA 1MAML 5IMLA 5T1DH 5FV2A 5J12C 4Q58C 2JB5H 4NJAH 3P4NB 1JRHL 1PY4A 1P4IH 3PL6A 3T8XA 2GJZA 2J8UF 2R23A 4L8SC 3AB0C 3OKYA 3OXRB 1IGTA 1JGDA 2FNBA 1V05A 3BD4A 3P9LA 43CAA 1AHWA 4XRCB 5KW9L 3DVFA 3VI4E 3EJJX 1BQHA 5DJ2B 4NZDA 4QRQB 4X98B 1A6TB 1I1AA 4O2FA 5E9DA 1N8ZA 1EEQA 5TDPB 4MNQB 4P0DA 4U6TA 1FZMA 2VDQH 3BEVB 5DD0H 4PP1D 4PG2A 4OF5A 1YPZE 1S9XB 1I9IL 4G43A 1PVHA 4NPYA 4G6JH 5D2NC 3VXNA 4UTBL 2ZCHL 2IALB 2LTQB 2AV1B 3ULUD 4RFNB 3RIFF 1MJUH 1B4JH 4CVZA 5I1GH 3KPNB 3FQRA 1AC6A 3F7RA 4ZNEE 4G9FE 2LFGA 1KG0A 3GSWB 4LSPL 1LD9A 4U1HA 1IFHL 1TCMA 3T0ED 3E3QE 5C0GA 4YFDB 1NCDL 1SYVB 1KEGL 1BOGB 4UNVA 1CE6B 3MLPA 5MI0B 1QVOA 3ARVA 2WP3T 4HUKB 1YEDA 2CK2A 2OTUB 1IVLA 1TJGL 5IHUH 3BYTA 2GFBA 4L8SA 4XBPB 5BVPH 2VO5A 3QFJE 4MWFA 4PTUB 1N5AA 4XNQA 5DXWA 4NKDB 4W70A 3VRIA 2HAZA 1OAXH 4JM2A 3RTQD 5D70L 1EEYA 2VLRD 3X3GH 5FFLA 3QUMH 1A9EB 1SBSH 2J4WH 4X4YB 4HDIA 5BQ7B 1NLDH 1HNGA 1OPGL 4I77H 3MCLH 1F4WL 3BP7B 4KDTC 3OAYH 5MEPB 5ETUA 5D2NA 5BRZB 1JYNA 5L2JA 2XG4A 3S34H 4UOW0 5GRUL 5IOPB 3FRUA 5F96H 2CXGA 3CFBB 2CIIA 3TBTB 1MFEH 3PWNA 4JFQB 3FQUA 2ADFL 4AENB 4LLWB 5CZVL 1OSZB 1GAFL 1KN4H 1JMZA 1U95A 1N7ML 4LDLB 1LO4L 4AQOA 2A6IA 9CGTA 1TJHH 2JK5B 2ZUSA 4FTVA 3PWUB 1XF5A 2XI9A 2ARJA 3JWDL 1CVSC 2HN7A 4X6EB 2Q7NA 4U6XA 5GQBA 4XBEH 1J10A 1QD0A 2PO6C 3DMMD 4MXWL 5KS9E 1S7XB 1F4XL 1WIOA 4NJ9L 3QIUC 1YY9D 4XCYA 2AJZB 5ICXA 5L9DL 5FOBB 3EOYG 2YXFA 5J4MA 4Z76B 3T1FA 3OV6A 1RU9H 1U8KB 1U3YA 2W9DL 3ZYZA 5CEZD 5HY9A 3RL1A 1RJZA 4DKEL 5TF0A 4BUHA 3CZJA 1WZ1L 4KDTA 5DJCB 3NPZB 1XGUA 4UQ2B 1EX0A 3CVIL 5D71H 3U4EB 4JKPL 5GGQH 1Y18A 3F65A 3QNYB 3GEWB 1FE8L 3MPCA 4WI2A 5DQDL 1FLRL 4JFFD 5F9AC 8FABB 5E2WL 3TN0D 2XICA 5F8QC 3S88L 1A6VH 2HJFA 1A3RH 4NFCA 3OJVC 2PF6A 5IR1B 4NO0D 4Y89A 3MRJB 3KPMA 4ODUB 1CXKA 4PJBE 3WCYA 4JREB 3QIUA 3MX0A 1GC1H 1WTGT 4FQXB 3BPOC 1IAIH 1MRCH 1A47A 4JKKA 2HMIC 4M00A 3RWJB 1UGNA 5FUCE 1FFRA 3QPXH 3FFDB 4PJHE 4NDMB 1NGPL 2C1PA 5JW4Q 1G1CA 1NMCB 4LOUD 4POUB 4JPIB 5MENB 3P11H 4PY8J 4H1LB 1K3IA 3IFOB 3OAYK 3RUGE 1T3FB 2LAGB 4LHUD 4HBCL 5DJ0B 4YDLC 3V0AC 4GKSB 1LNUB 3NIGE 5IB3B 4P59H 5IM7B 1T04A 3SN6N 2NY5H 4KVNL 4LCYB 1N3NB 5EWIH 5DQJB 5ADPL 1T80A 2EXYD 3B5TA 4H5SB 2HLFD 4E42A 2JIXB 1MOEA 1NBQA 1I8KA 4KJYB 3BPCA 2IC2A 1OTTD 4YZFE 3IJHB 1D6VH 1UVQA 2WSKA 2YPVH 4TTDD 2A6JA 2EIZB 3O3UN 5FECA 5JIPA 3S8WA 2WLZA 1P7HL 4AIZA 3B2VH 3K0WA 2GHWB 4N5EC 4LSTH 1ZWIA 2HT4C 4YJZL 5FIEA 1X4XA 3MXVL 5ITBL 3KPRE 5DSCB 3T3ME 1VDGA 1X3DA 2D31B 3VMOA 3CH8A 3MREA 4JAMA 2FYYA 1G6VK 3LHPL 3MFGB 5DUPH 4AEIH 1FORL 2BNQD 3DXAE 4XNYL 4WFEE 3SCMD 5I73C 2NY3D 4NKOA 3LQZB 3WIIL 1UH4A 1E6OH 4RBPH 1P4BH 5I74C 4AK1A 1RZKC 2B0SL 1N2RA 2IADA 1HEZA 1AXSA 3KLAA 1KTDA 2EDOA 2X05A 2FJHB 2HVKA 2GT9B 5CILL 1L9NA 5DJAB 3CFDB 3A6BH 3V5HA 1MFBH 1UXWB 4G42B 2XTJE 5MP6H 1UKTA 3KNBB 4RGOL 2EEAA 1G9MC 1KJ2H 4HQQL 1EIBA 4YHYB 5DJZB 2V5SA 4LLMA 4MD5A 4YDJA 2QL1A 4HUUA 1OB1A 4CADB 3GGWB 5IFHH 5E6ZA 4XAWH 4EOWH 1J5OH 4JZJB 3IDYC 2CR3A 5EN2B 3OB0H 2OJZL 4XP4H 4ODSH 1JPSL 5T1MB 1U8IA 4YE4L 1HXMB 4NKIH 3WDHA 3I6GB 2QBWA 1CR9H 2DLIA 1T7VA 2R56L 1I3VA 3TPUB 3TZVB 3HE7C 2HLAB 4M7LL 2W60B 2FSEB 5IG7A 1AI1H 3V0WL 2AERT 1YEJL 4WEMB 5C7XL 3CX2A 4U0QB 1SM3L 4PLKC 5DF0A 4RA0C 2AJ3A 1RPQA 1ZLVH 3JWOC 5DMIL 2X89D 2EECA 2X42A 1ZV5A 5F9OH 1N59A 4L4VD 4U1LA 5CJ8A 3OXSA 1K6QL 3H7BA 4P4KC 4IIQC 4OCNC 3WFBH 2BVYA 3WE6A 4UMGA 5JUEH 4K3EH 5HDQL 2AKRB 4AM0A 3QQ3A 4HW6A 2G60H 1E0OB 4PRHA 3F6IA 3KPOA 4O4YH 1CF8H 4ODHH 4EJ1C 2OI9C 4WW1A 4LVHB 4GW1A 1HILB 1ZA3A 1J1OH 5E08L 3WHE0 3VJ6B 3JXAA 5IB4B 1KTRL 1S7VB 3NAAL 3ZTNH 5CUSL 1CIUA 3T4AA 1UB5A 1F5WA 3CJJA 1AFVL 1Z6JT 2DB8A 3OAUH 2OK0L 1A21A 3QAZB 1T5WA 5JXED 5CINL 4NC1C 3VGEA 8CGTA 1MCSA 3S4SB 2Z93B 3H6JA 2QQLH 4R7NB 4NOBA 4H0GA 1MRFL 2PXYC 1LE9B 1F00I 4HHAB 4RBPK 1A02N 1CL7L 3HE7A 1UYWH 1XGRB 1FVEB 4LLDB 2H2SD 3O4LD 5L8JB 4NZRH 3QDGE 1NCCL 1KJ2B 1XF4A 4J3XA 3QXWA 1G7MB 3SDCD 4QRTB 4UB0L 1ZEAL 5JTWA 5ERWA 1D5ZA 1BEYL 5GS1B 3MBXL 2ZUQC 2VSDA 1C08A 1I85C 1QRKA 2Q86A 3EDJA 3DV4A 2A74A 3VXUD 4XX1E 3VI4F 1QOKA 3GBMH 4K3DH 4P4KA 1X5FA 5DD6A 1NJ9A 3OKKB 5I0DA 4B7IA 1KEMH 1E27B 4FQHB 2FEEI 3MOAL 4WEBL 4DN4H 5FYKL 1F3DH 2YRZA 2MOVA 1YPZF 4TNWK 2N56A 3F7VA 5ANMB 1VCAA 5IEHA 5KTEL 5D2LF 5IW6B 3PDGA 1IL1B 4D0CA 1U58B 3G9AB 1A4JB 4BQCA 2IG2L 4JDTL 3BKJH 3LEVH 1ND0A 4OJFH 1YMHB 4XAKE 3RWHB 2PXYA 3T0EB 3JTTA 4F9LC 5DQ9B 4HIJB 2ESVA 4Z77B 2BFVL 4DTGL 4JPVL 2XTLA 1DLHB 1ZT7B 4URTB 1T22A 2AABH 5LJYH 1INQA 2FR4B 2AGJL 3WLWC 2NXYC 5J13C 3EJYC 5GZND 1MJJA 2DQGL 5J9PA 1I85A 3RTQB 4Q9RL 2VLRB 4KI5D 4QXTA 2VR5A 3EYQD 1A6ZB 4IRZH 4ZFFA 1QLEL 3T0XA 2NXZC 1KF9B 4I9WD 2DLEA 2GW5A 3CLFH 3L3IA 4UUJB 4DWHA 1JV5B 3FQTB 1XGPA 1XF2B 4X8JA 1I7TA 3CDFA 3I2CL 1H15A 3FHAA 5KSBE 3DNKA 3GSOA 4PGDB 1MCHA 1A4KB 2W0PA 4P4RA 4PUBL 5E8NA 4PG9A 2G2RA 1JZ2A 4YDVB 4YBLC 1YEGL 4OGYH 5HYJE 2C4XA 3L6FA 1UM5H 4F9LA 1QBLL 3SDXB 5KOVC 1T1WB 25C8L 4ZPTA 3DMMB 4NFBA 4PRDA 5HHMD 4GAFB 4X7TB 2ZG2A 1C16B 1J05B 3ALXA 1QRND 1YNKL 3R8QA 2WWMD 3CFCL 4KRPC 1YQVH 5E5MA 3E2HB 1WCQA 2XXCB 3O9WD 5AAWA 2A6KA 2J12B 3C08H 4KY1L 2ITCB 5CGMA 3G5ZB 1NGWB 1NUGA 3RKPA 2P8PA 4JN2B 4Y4FC 1Z5LB 4R97C 3DVIA 3T2OA 3WLBB 4PLNC 4C56D 1EAPA 1JFQL 1QSVA 3TYGH 5KVEH 2I5YL 1DDHB 3CXDH 1G6RH 4KHXL 3HB3C 2JJTA 2J88L 1TPXC 1FBIH 4HS6A 4JRYB 1FLTX 1DCLA 3UTSD 4BH8B 5DHYA 3U9UA 4I0KA 3BO8B 4GJTB 2YSSB 5SWZD 4GG8A 1AR1C 2E8ZA 4CN1A 2ZOKB 5L88H 4U1NB 5EOTA 1MCJA 2BJMH 1GHFH 3RGVB 3TVMB 1E6JH 4JFFB 3UYPA 4J6RL 4C59B 3MYZA 3TN0B 1H0DA 4M6AA 1MVUB 3GMRA 3WUZA 32C2A 2M2DA 2ZG1A 3Q6GH 2M26A 4QRRA 3QG6A 3JV6B 1BIIA 1RUQH 3NPSB 2VDLH 4EI5D 2NY1D 4PJBF 4PJ5D 3NZ8A 1DQLL 3D25B 4TULH 2X4PA 4OLWL 3WHXA 4PJEE 3P9MA 3WNMA 3MOBL 1C1EL 1O7VA 5C0BA 1CFTB 4RMWA 5FCUL 5IESL 3BIKB 3L7EB 3VGHA 4C58B 3NGBC 4U1JA 5CSBA 1UWXH 2FEEL 4FABL 4H8WC 4PJHF 4Y4FA 3MODH 4L3AA 4LVEA 5HYQB 5D96B 3FQWB 5EZLA 3N9GL 2KPNA 4FFYL 4LHUB 4FXGB 3RUGF 2A0LC 4F33B 2XT1B 4QXUL 3PHSA 3WFHA 2YMXL 1LGVA 4HUMB 15C8L 3NIGF 3WXWH 1MIEL 5FHAL 3I3EA 3LEXB 3BVNA 5F89A 4D9QD 1JWSB 1YYML 5HVHC 3X13A 3VGAC 1MCDA 1DQQA 2Y5TA 2ED7A 3OTTA 1I8LC 4XWOC 1FAIH 2BVQB 2AJVL 2P5EE 3GB7B 4RDQG 1CTOA 3JSSA 3STLB 5EUKA 5DEGA 1PQZB 3NFPA 4Y7MA 3HR6A 2EDHA 2NX5D 4JQXC 3ZYIA 1M7IA 3HPLA 1F58L 1MHEA 3DHJA 2R4RH 4UV4L 5HXMA 3LSOA 4U6HB 5H35B 1G6RB 6FABH 1Y6KR 4DAGH 4JLRA 4S1SH 1FYHB 4OZIB 2ICCA 1A7QL 4NNYA 4H88H 1H8NA 1DBMH 1JNHB 2BNQB 1CLYH 3SCMB 1F6AA 2D0HA 3MCKB 2IGFL 1TVHA 4MJ6A 4Z7OE 2L7UA 4P23D 4LCWA 3ROOB 4QWWD 4JGMA 3U0PB 1CD1B 3BZFA 3I9GH 4NQDE 3QCTH 4BFGA 1FHGA 4E5XB 4ZO9A 5ICZB 3H9SD 3LPWA 1YEEH 1DEDA 2R0WH 4ODVH 2R1XA 5F9WB 5L8LB 3MJ8A 2F74A 5KSVA 4KGLA 3EYUL 4YBHA 5I71B 3NABH 1Z9MA 2A83B 1DFBH 2JCCE 2HJKA 4MMXC 1MWAB 5IFJA 1I8LA 4F3FB 1OQOA 2OJEA 1NC2D 4YHMH 4WI4A 4A2MA 1LP9E 4JQXA 5I1DB 2N7BA 1Q9KA 4OZFA 1L7IL 1UJ3B 4DJMA 1FVCB 5F7MC 1K8IA 4XPHH 5D7LA 1UWXK 1ZLUH 1ZHLB 3S37H 5GRVL 3ZHLA 3A6OA 1XMWA 4GRWH 1L0QA 1QYGH 1KTLA 4OQTA 5D1ZC 2A9NL 2X09A 4M03A 4X0KA 4ESKA 3WNOA 1FNGA 2PW1B 2YPLD 1TCRB 1RFDL 5K9QG 5FGBA 3U7WH 1AY1H 1JHLH 3GHBL 4L4VB 4B53A 3EHBD 3D87B 2H1PL 2HT3D 2VLJE 4D9RE 3ZHDA 2P8LB 2J6EH 3NFNB 2CGRL 3C5JB 5IVXA 1B0RA 3WUWG 4RFEA 3X11A 5D2LA 1Z0NA 1UADC 2VXSL 3TBVB 3ULVE 1INEH 1WC7A 2Y4SA 4E41E 3IT8D 4FXLA 1C12B 3UTTD 3IDMA 2AV7B 1A7PH 5EC1A 5EIVA 1IAKB 3GFUA 5EZOH 3DYPA 4G9FA 1YYLL 2OZ4L 4FG6D 3WEXA 2GQHA 2VXQL 4R4NC 4OM1L 1BFSA 3P3YA 3X17A 1JGEA 2A9MH 3PG2A 5IW3A 4P9ML 5CHNA 1HHHA 3WFCH 1NL0L 1FV1B 4FFZH 2MQ3A 3O4LB 5D1ZA 2WV3A 3U6RA 5F7HA 4WV1C 1LVEA 4NWTH 5DHVH 5F9JA 3SDCB 3QWRD 4JVUA 4N0UA 4ZXBA 2Q20A 4LDEB 3CUPB 3FONB 5JXAH 3MSPA 2QADB 3VH8B 1HDMA 3MA7B 5DJYA 3MLVH 2HWZL 3DRQB 1OAQH 4BH7B 3QUZC 4OLUH 4U3CA 1CICD 4GAGH 3RBSA 3FFCD 3ZE2E 1I9JH 2XN9B 3FCTB 3LMJL 3AFLA 4W81A 4LHQB 3ZT6A 3GSUA 4HIIB 5EUOB 1S9VB 4GRWB 4DCQA 1FGNH 5E4EB 3UJJH 2DLFH 2AK1H 4U3HA 3TF7C 2VB5A 1LO3H 4GFTB 2XKUA 1FP5A 3MLUH 1KC5L 2VDNH 5CEZE 4MZ3A 4NP4L 5DMGD 4IS6B 4OCMC 4ONGL 2GUOB 3SDAC 2R4SH 4UAOC 1WIPA 4BK4A 2Y6SC 1QFPA 1QR1B 3ZO0A 1FNEB 2P8MA 1DN0B 2MKLC 3LRSB 4U1KA 4H26A 3EYFB 4ELMB 3P4MB 3QIBC 1MCKA 4OI7A 2ADIA 5T5FL 4LBEB 1NBZB 3TBYB 2XFXB 1RJYB 2Y7QA 2VDOL 4MNGA 2AXHA 4NNPL 3O45A 1HZHL 5FKPA 3F6LA 4ORZC 1V3KA 2FGWL 2EIBA 4WV1A 5FUCC 3CVHH 3MLXL 4KAQH 4OT1H 3VD3A 1J8KA 4LSSH 3N1FC 2JB6B 2GTWA 3WFDL 3G6JF 2EYRA 3CPLB 3VFUB 4JG1H 2CMRH 3V95A 3G6DH 2WBWB 4HH9A 2ZPKH 5CP3H 5GS0C 4ORGB 5HYSA 3W9EB 4RMQA 1WAAE 3F12B 3V6BR 2BSTB 3PXHA 3QUZA 4WU5B 3U0TA 2CK0L 2H8PB 1LILA 2NNAB 4UOJA 4I3RH 5LXGH 4ZAKD 5FGSA 2RQ8A 4B5EA 3CC5A 5B22A 2ZOLB 4MJ5B 3C9NB 1EUTA 2R9HC 3F58H 4OD3L 5DHVB 5KSBF 5E24E 2E7MA 4JFDA 3SDAA 3T77A 4JFEA 3S4SG 4PJAB 3MRPA 2QV2A 4GXVL 4MA3A 3RIAK 1QO3A 1IEHA 1TZIA 3NTCH 2XYCA 3QIBA 1G7IA 5K9QI 1WFTA 4M93B 4MAYD 4K9EC 4U0RB 5HPOA 1MHHB 4XMPL 4XP1H 4NCDA 5HHMB 1MI5D 1AGFA 3G5XB 4PTTA 4JVWA 3OQ3B 5K9OB 2D4FA 4LVNC 1TETL 5HHXH 3CSBA 5ID1B 1FCGA 4HKBB 4MA1C 5BS0D 3Q48A 2WBJD 3EJZD 3RUGA 5EBLA 3PV6B 4C56B 2ZSWA 1RULH 2WANA 3D39B 3LD8B 1NFKA 4RFOL 3K4ZA 3FO2B 5DK0B 2XTJC 4NGHL 4DGVH 1OD9A 2WINA 1K5NB 4ELKB 4ZOEA 3UTSB 3M17A 5SWQB 2AI0L 2OS7A 1F90L 3QEUB 5HPMA 1JWMB 4U1MA 1EVTC 4BSWB 3BW9A 5SWZB 4TUJA 4YHLL 1MPAH 3CVHB 2R8SL 2OM5A 4JFXB 2E5EA 3VRJA 4DVBB 1CT8B 5DRXA 2BHYA 2Z9TA 5IWLC 5F7NC 2PTTB 3QIWC 3WD5H 5I30L 2XG5A 5JW3H 5CBAB 5T1DL 5IW1B 3PDDA 4NJAL 5GZOD 1S7QA 1P4IL 3PHQA 4QCIB 4G8GB 1C7SA 4RGMB 2X41A 1DANU 1NMAH 1J0KA 4EI5B 4HG4J 4DFHA 3MNZB 2NY1B 1JPFB 3LIZH 4PJ5B 5CJXC 3SJVD 1F6FB 5E00A 5AUMA 3B9AA 4CU7A 1T0NB 2D0FA 4FQPA 1XGQA 5BCAA 4AIXA 2YC1A 3L95B 3H3PL 1DEEA 5F7WC 1IAII 3VXRD 3IU3B 4P2RD 5IMMA 2DWEB 5FKAB 4LKCB 2ICEB 2VDQL 1S78C 1XCTA 1HCFX 5E99H 1QNZL 1MUJB 4P3CH 2R2BB 3ABZA 5I16A 4D8PB 1MH5A 2IMMA 1UQSB 5J7CC 1U8QB 1MCQA 1MJUL 2AJXH 1OT2A 4S1DC 5DDHA 1A3QA 3HUJA 4QHUB 3UTOA 5IQ9B 3LY6A 4WHTB 5IWLA 1F4AA 3OX8A 5JOFB 3R0NA 1I7ZB 5FB8B 3O4OB 2RAMA 4JFOA 2BXYA 2LVCA 3BEWA 2GI7A 1I7RB 3KHOA 2NX5B 4POZC 4S0SD 5TDNB 4ODXB 3K3QA 1NDGB 5CJXA 5BVPL 4PJGB 2A6DB 5IB5A 4LLYB 1OAXL 4J2XA 4LKXA 3X3GL 1FGVL 4GKZB 4LQFH 2YA0A 4RX4D 2ZJSL 4FQJH 4P23B 4ZUWA 4F7EB 2J4WL 1NLDL 1GGTA 4X6DB 3MCLL 3BGMB 4YHOH 4LSRH 4HT1L 4QYOB 3H9SB 1J88A 1JK8B 4KK8D 5BV7H 5C6PB 2AQ3A 3S34L 3W82A 1FVDA 2XWTA 5F96L 3FOMA 3KJ6L 1PEWA 1MFEL 4LVOC 1XF3B 3ZYJA 1IRAY 3MNVB 5E2VH 1Y0LB 2R29H 3IXAB 3EYOA 3LOWA 3F62A 1KN4L 4OCXL 2BC4A 5J3HC 3LH2H 2JCCF 3VXUE 4LDOB 3GMMA 1KB9J 3LB6C 1IC5H 1D5MA 5B21A 5JQHC 3HG1D 5ESVA 1CGVA 1NC2B 3D3VD 1FZKA 3I6LE 3T65B 2R2EB 3DV6B 3U9PH 2BSRB 4X6CB 3V5KA 3MRCB 3SO3C 4MDJB 3HZVB 2HJLB 2E7CA 1LP9F 4HWBH 4LRIC 4LCCB 5MEOB 4G8IA 3WO3B 3VXSD 1FPTL 5JNYA 3FQXB 1T6WA 5D5MA 3D1MC 4EQ2A 1IAIM 1MIMH 1RU9L 4L8BA 2DIBA 1CFSA 2VOTA 3MR9B 4CW1B 4JHAH 3MRLA 1NCWH 2YPLB 3H9HA 4YBQD 1AGBA 1I1CA 4XGZA 2QEJA 4QOKE 5I1LA 4WEUD 3ETBF 2AXJA 4JJ5B 4TQEH 2Y25A 4G80A 4PJ8C 5D71L 4ZSOB 4FHBD 2DWDB 2OYPA 3UJIH 3CSYA 4HCRH 2FRGP 4M61B 3O2DH 2CIKA 4HWEH 5FF6A 5IQ7L 1INDH 1ZHBA 3PWJA 5DD1L 3ULVF 3TPKA 5J1SC 3UTTB 1OL0A 1A6VL 4R9HA 4L3CA 4PLJC 4KI5E 1U8HA 4NYLA 4BZ1L 1QFWH 1FYTD 3ES6B 3MRNA 4QF1A 2VZUA 3BIBX 3WIFA 4J3OC 5FA3A 3SKMA 4GW5A 1K9TA 1QKZH 3RFZC 1TZHB 5FO8A 1L7TH 4KFZC 4HGWB 5CBEA 5IEKA 1IAIL 4U6YA 1DBAH 4LRIA 5BV7B 5EBWB 4IRSC 5EPMB 5A2IH 1E28B 3BD5A 1FG2A 4OUOA 3QPXL 3RX5A 2VXTH 3G6JA 1K2DB 2BMKB 3S5LA 1HSAA 1V7NH 1G9NC 3GSVA 1LEKA 1AGEB 3ZDYE 3UO1L 4MMZC 5CLTA 4JRXD 3C09B 3ZDZE 3P11L 4HK0B 5T3ZH 4DKFH 2VAAA 2VDRH 1HN1A 3T4YA 3OGCB 3H42H 3IB4A 1HHJB 5DC9B 1FFNB 4JDVA 2W1NA 5BO1L 1U41A 3BX7C 4OGAD 3CZFB 2Y06H 2NY5L 4UOW1 5EWIL 2XNAB 3HI5H 1OP3H 4E9LA 3V2AR 1CICB 5HHME 3C5ZD 4ZTOL 3FFCB 1QRNE 3U1SL 1S7UB 4G7VH 1UA6H 4YXHL 1BQUA 2F53B 4GH7B 1D6VL 2YPVL 4KV5E 4OAWB 3RWGA 1HH6A 3EFFB 2LABA 5C2BL 3GNMH 3GMOB 3B2VL 1VFMA 4LSTL 3GSXA 1JTTA 5IVZB 3SDDD 4BSVA 2P1YA 1D9KC 4NQEA 5GS2D 2Y23A 3Q5YA 1U93B 3E8UL 2HKHL 1FN4B 1ADQA 5DUPL 4AEIL 1RVFH 4IRSA 2APBA 2GAZB 1ED3A 3VXQB 1GGYA 3QDJD 1BBDH 3EFDH 5E5RB 1S5HA 2VDKH 5EU4A 5GIRB 1A2YA 3GSNA 1R0AH 3PGCA 1R5IB 3JWDC 1A6AB 3A6BL 3GHEH 2HTLD 2P46B 1OAZH 1MFBL 4TOYH 2V5TA 3P4OA 5HD8C 5MP6L 3BQUC 4N1CA 1J1PL 5E1HB 3VFVA 1WAAF 3UTZB 1EEZA 1KJ2L 5GSVB 1KENH 2W0LA 1A7NH 2WMPA 3C60D 1A7OH 1H8OA 2NW2B 4PRAA 3IJSB 1VFOA 5IFHL 3KPSA 3JTSB 4EOWL 1J5OL 1C5DB 5L0QC 4TVPE 1M7DA 3P30H 3TV3H 3I6KA 1TIUA 4XP4L 5DR5L 4D0BB 4J3SA 3VD9A 5IFAL 2LVEA 3BPLC 1D9KA 4A6YB 3VGGA 1CR9L 3I75B 1YMMA 4KUZH 1CGXA 3K2UL 3PL6D 1HKLH 35C8L 5T33H 4LLVA 1UM6H 2AAVA 4MAYB 1J0IA 1AI1L 3BE1H 3OKMA 4OTXL 3C2SA 5HVWA 3ULUL 1FL5B 3HRZB 3N1QC 4WI7A 1MI5B 1LE5B 1Y6NR 5IF0A 2EDXA 4BM7A 5E03A 1OY3B 4Z8FL 1AXTH 1WWWX 1BFTA 3T2QA 3U4AA 2BX5A 5EU3B 1I1AD 12E8H 5F9OL 3FB6B 1OP3K 4Y19A 5BS0B 2ADGA 2WBJB 1ZHNA 3WFBL 3BHBA 3QPQD 2BDNH 4K3EL 5C6WH 3BQUA 4I48A 3VE0B 3CMGA 2G60L 2QQKH 5EBGA 2FECI 1VB9A 1JF5A 1TVBB 1CF8L 2C26A 4ODHL 1KJMA 1PKQB 3BYYA 1T1YB 3MGOB 4WFGD 5K9JH 3HS0A 5I1EH 4QNPE 4XCEB 3DOSA 3ZTNL 2E9WA 4HUVA 4LIQH 2X4SB 2WBKA 4OUUB 5FYLD 2X4OA 5DMKB 3TESA 5C9JB 2WQRA 2P5EA 4LGRB 4Z7VA 2IH1A 2QQLL 4ZYKA 1CFNA 1YEHH 5TQ0H 3G04A 3Q6FA 4QT5A 5CCKH 1P9MC 4YPJA 1UYWL 1I1RA 4RWHA 1KJVB 4P2OC 1OAUL 1KGCE 3FN3A 4I3SH 7CGTA 1DUYB 4Z7WE 1BZQK 3KYMA 2EO9A 3MMEA 4YIQB 5C08B 3X3FL 3SJVB 4M7ZB 3ESVF 1CDHA 1SJXA 4MJIE 3BRDA 3PE9A 1TLKA 3GMNB 5TH2B 2DL2A 1J0YA 1HHKA 1LEGB 3UEZA 4P2RB 2VTFA 3QWOA 3VFTB 1KEML 4EBQH 4FP8H 1Z3GL 4NHCH 4PP2A 3H0TB 4N9GB 1N64H 5J57B 2BOCB 1VGKA 3DTXA 1VEOA 4ZO6A 1OGAD 3ULVC 4Y4KB 3AXLB 2MSPA 4GSDL 3B9EA 2V9RA 2JCCA 2OQJB 5ACZA 3BKJL 4YHNB 3AM8C 4OZ4B 5C07E 2YZ8A 4LSUH 5T3XD 4XP6H 4FTVD 2ZCKL 2DJSA 3RHWF 1LP9A 3MLSL 1P9MA 2AJSH 3EOBB 4P2OA 4JFHD 5DGQA 1SEBA 2AABL 5LBSH 5LAXA 5AD0B 3P0YH 4UQ3A 4TSAH 1SHMA 3IFPA 3U2SB 3UTTE 3B6SB 4DQOH 1PG7L 2RGSA 4L1HA 4P5MA 4P9HH 1EHAA 2KDGA 5AEAA 4X4ME 4PJ7B 4XBGA 3D6GA 2DL9A 5GRJH 1OP9A 1Q1JL 4ZS7H 4IRZL 3KYOA 3MRBA 4JQIH 4LEXH 1CDYA 3CLFL 3RNQA 1A6WH 1YA5A 1H9VA 2XY1A 1EFQA 4KRMB 3IGAA 1GPOL 1P5VA 3LEYH 2FH6A 2GCYA 4H25B 1YJDH 1YN6B 1L6ZA 5KAQG 4CU8A 3RWDB 5IBUB 3KVQA 4QXGL 3DO7A 4YC2C 1W0WA 4E41A 2V7HA 1UCBH 1U8MB 4TNVF 5J6GB 1F11B 3C6LB 4ALAL 4HJJH 2VXVL 4JFYA 4LAJH 2PN5A 1LK2A 5LGJA 3HNSH 3HCVB 3AM8A 4PRID 1R24A 5DK2B 5C86A 3CK0L 1OF2B 4OGYL 5GRXG 1FSKC 2VDPH 5D7JB 5FK9B 1UM5L 2PO6D 3HG1B 1P4LA 2OR9H 4JDZA 5TPWH 3PIQA 3QIUD 1OCWH 3LDBB 3FT4B 4OZGE 5JA8B 1P7QA 2QSTA 3VWJD 5HGAA 3V6ZA 2H3NA 3CH1A 4Y5XB 4N8VA 1YQVL 1S7SA 1DBJH 4ZPVB 4F15C 1CD0A 5EH1A 2AJYH 1UZ6E 2FECL 5HI5C 1P1ZA 3RWCA 3H2WA 5IT2H 2IFGA 3W2DL 3VXMA 5CMAB 3OKOA 1E4KC 3KPLA 1BZ7B 5H94B 2VRAA 3QJFB 4XI5C 2JKXA 1KIRB 4CMHB 4X7SH 2FIKA 3LN4A 5KVEL 3BN9C 1G6RL 3NN8B 5GS2H 1AD9A 1EFXB 2ENSA 2Z4QA 3QHTC 4M02A 3W9DA 1EZVY 4C54A 1S7RA 3O3AB 3F5WB 3TWCH 2L0DA 4JPKH 3FTGA 1HHGA 4AG4L 2H26B 1BX2A 2Y1VA 2BJML 1FL6A 1GHFL 1FJ1B 1E6JL 4LPVA 3OKNA 3HC3H 3P40A 4GUPB 4NO5A 4DVRH 4HJGA 2ZUXA 1CN4A 3MGTA 3L3HA 3HN3A 4ONFH 5AG9A 1T0PB 2X7LB 1KLFA 3Q6GL 5JIHA 1FYTB 4OM0H 1CU4H 5JW4N 3RI5K 2PW2B 4PGCB 3SKJL 1RUQL 5GSRA 2VDLL 4NIKB 3OHXA 4TULL 1GOHA 4OZHF 3V9FA 2HMID 3HLAB 1X6LA 2BZDA 1MWAL 4NSKA 1QLRB 3KDMA 4JHZA 3ZMRA 5D7IA 4HPOH 3RGHA 3VRLE 3MODL 4UINH 5KVMC 2YEZA 2XQBH 4MD4B 4JRXB 3VU2A 3FB7A 3ZDYF 1E4KA 3I02B 3ULSB 2GSIA 1X5KA 1ZE3C 3ARFC 4PJCF 3ZDZF 1MFCL 1WAAA 2CKBA 2F5BL 5A43C 2NCMA 1S9WA 5BJTA 4XCNB 3B3IB 2H6PB 3WXWL 3TA3D 5IV2A 3R0MA 2BRRL 2O61A 3C5SA 1MI5E 3C5ZB 4OCYH 3EYSH 5GRYA 5FHBH 3MRKA 1NGXA 3DRTB 5GRWA 3JV5A 3PGDA 1QEWB 1YN7B 3HR5B 4LSQH 3RWIB 1QACA 3QXAA 2VLLB 1XGTB 5DFVC 1FAIL 1EHXA 3ME0A 4ACPA 4M8QB 4KV5F 4R4FL 4NRZA 2A77H 1ZVYA 1HQRA 3B5GA 3BMWA 3SDDB 3IKCA 1U91B 6FABL 4MGXA 4DAGL 4YFEA 4HKJB 3RVTC 1A1NA 4YK4B 4JY5H 1AP2B 1R3LB 1DBML 1CLYL 1KPUB 3LV3A 3TO4B 4HWNA 3IRPX 3BXNB 5C0AA 2NY4C 5FYLH 1FIEA 1C5BH 2EH8H 4Q6IB 2FZ3B 5I8EA 4XH2A 3ARFA 3W39B 1RV6X 4I5BA 3ROLA 3OG4B 2P5WB 2Y36H 3FZUC 4PRHD 5B39G 1OAYL 2P45B 4WFHE 4YHIA 1YEEL 5HGGS 3RVVD 1ZGLB 5ENWA 4ODVL 3JBG7 1P6AB 5DD3H 2KQMA 4NQCD 3C60B 5HHQB 3NABL 5D7SH 2SEBA 1DFBL 5EZJA 1DVFC 3OR6A 4GG6B 3PXJA 1HH9A 1X5LA 5KN5B 4U3XA 1RZJL 2GJJA 4C4KT 3VXRE 5HYIA 1AQKH 4LPCA 1H3PH 4EDXB 1I9EA 2GTZA 4YHML 5IHZA 1WCBA 4JKLA 1MCEA 4QY8A 4NQSB 5F3BB 1BIHA 2V2TB 1JUFA 5IMLB 3D0LA 1XR9B 2BY3A 3HE7D 3QR2A 3C8HA 5J0BA 4XPHL 3PL6B 3L3JA 3S37L 3T8XB 2GJZB 3Q3GA 2X4UA 4IJ3B 1QYGL 1Z0MA 3EKCA 1ZSDA 4NN7C 4ZFZA 1RURH 1JGDB 4MNHA 3P9LB 1AHWB 4PJDA 1U36A 5CIPA 4FQQB 4KJQD 4K07A 1AO7B 3U7WL 2WIIA 1I1AB 1JHLL 4O2FB 1OOAA 3MRDA 2IH3B 5JO5B 3S96A 2J6EL 5I17B 3QUXB 1FZMB 1BLNB 1ERNA 3U48A 1JRHH 2AEWA 5CSZB 5C9KA 4G6AC 1MCWW 1INEL 2V2WA 4D9LH 1RZ8B 3NCCB 1FDLH 1DVFA 1UG9A 3LQAC 3HZYA 5KW9H 2X4QA 1A7PL 4QNPF 5EZOL 1PAMA 4YDIH 1IT9H 4K3HA 1CDBA 2AK4E 2MFNA 4O2CB 4PJXE 2FX9L 4XPTH 2A1WL 4ZFOB 4CVUA 5ID0B 1C5CL 5C0GB 5EIIA 3WJJC 3MJ7A 4ZO8A 5F7YC 4IDJH 4LLAA 2RHEA 2F8VA 2A9ML 1I9IH 2E7BA 2BY0A 4FFZL 4NM4H 5LGHH 2YK1H 3AB0B 2D7OA 1AGDB 2W38A 3GKWH 1IJ9A 4MWFB 4NWTL 1NCUA 1N5AB 1G7LA 3P77B 3VXPB 2IQAA 2QLVB 4G9DA 2VKXA 1EEYB 2ZSVA 3DJ9A 3P73B 1XIWA 4HPYL 4LSPH 3MLVL 3D3VE 1NCDH 4R96A 4HDIB 1IC4H 2B20A 2E6JA 4OLUL 3GJFH 4QGTA 2VITB 4U4BA 1T83C 5TGBA 4PJIE 5ETUB 3NCBB 4F7PB 4QRPA 3CAFA 4PJFE 3VXSE 3PWNB 1OGAB 2CDEB 1N6UA 4AYFA 5MERA 1FGNL 3T2NL 43C9A 5B38G 2AK1L 1WQVT 1LO3L 4GRMA 4CN6A 2VDNL 1JP5A 2R4SL 4YHPB 1GZQB 4WJ5A 1EEUA 3IYLW 4POYA 4YXKH 3WJJA 2ARJB 1OPGH 2UWEA 4Q9QH 5EO1A 2P24B 4WHDA 3I50H 5GRUH 3WLWD 4YLQT 2HTKC 4UZGA 2NXYD 5HHPA 2BNRA 3MYJB 3EO1A 3CVHL 5C0DA 5JDJA 1ZA6A 4OT1L 3LVEA 4LSSL 4M1GH 2ADFH 5CZVH 1ODAA 2QQQA 3T1FB 3BUYA 3TNMA 2ZPKL 1PZ5B 4QHNB 2DQIH 5A2JH 5HY9B 1LO4H 2NXZD 1JNLH 3QEHA 4H20H 3VW3L 4QOKA 1MHCA 2IFFH 4MB3A 2DQEH 3PF2A 1KFAH 3BPNC 1T83A 5LXGL 3R1GH 4CMMA 3QEGH 1XGUB 1F4XH 5EOQL 3VD4A 1O5DT 1RUMH 2C5DC 4HXAL 2IANA 5L9DH 5HI4C 1Y18B 2IWGA 1J0ZA 4UBDC 5FM5M 1X5YA 1CFBA 1VFAB 3F58L 4TTGA 4RDQF 4G8FB 1LMKA 3TIDA 1OQXA 5T5NG 2W9DH 3L7FB 4Y1AD 4PRIB 3ZKNC 3K74B 4DKEH 2H45A 2HG5A 3KPMB 4OZHA 4C83B 2PO6B 3D0VA 3TT1H 3GJFB 1OGTB 4YAQA 3MRQA 3CVIH 3OR7B 4XP1L 2AXGA 2IPTH 2ZUUA 4JKPH 3SEPA 4KRPD 1BFOA 1NSNH 3ARRA 3PDOA 3VWJB 3V7AG 3LKQA 3GSRA 3ARBD 4OZGF 2XV6B 1X7QA 1MAKA 1FE8H 2HRLA 5DD5H 5HHXL 1UJTA 3PWLA 4Y4FD 4O2EB 3GJFK 4PJCA 5E2WH 4CRPA 5ILTH 5DK3A 4TVSa 1R5WA 4QRUA 3WO4C 3OKLB 1RULL 2GJ6D 5SX5K 3HB3D 5I18H 5TQ2H 1ETZA 3QDME 4FFWC 2C7UA 1X4ZA 3MO1B 1T04B 2EE2A 1CI5A 5JPNA 3BH9A 3O6KL 2J1KA 4NN6C 5F1NB 1AR1D 3QDJE 1U8OA 3REWB 2EC9T 4FQIH 3DX9A 1S9YA 1PLGH 4M5YH 5GHWH 3WD5L 3C2AL 1I75A 5FECB 3MRMB 3INUL 2QR0A 5I75C 2FGZA 1ZWIB 3WJLA 4NKMA 3SQOL 1KIQA 4P57A 3SE4C 1NMAL 4NQXB 2PETA 2I26N 3QI9B 1PFCA 2XY2A 3MREB 2N7AA 4JAMB 1JZ7A 2HFGH 5CLWA 3LIZL 5ADPH 1QFWI 3KWWB 4FRWA 3FB8B 2DD8H 4O00A 5EC2B 1D3CA 1HXYA 2C3VA 4R2GC 4ZFGH 3C8KB 1WEJL 4LCWD 2OZ4A 2IADB 4EZMA 1KTDB 4DZ8B 1MLBB 2ITDA 1IGFL 1T5XA 2A0LD 4YDLB 3MXVH 3RPIB 3EZJB 5E99L 4P3CL 2MCPL 4PLOB 1S8DB 1JCKA 5D6CA 3LHPH 1I3RB 5IBUG 1FORH 1QSEB 3RP1A 3TA3B 1CGUA 3QULB 4YFLI 2AJXL 3QO1A 2FBJH 4ERSH 3WIIH 4HUUB 1OB1B 5IKCA 3DARA 4JZOA 5I1AB 5DTFB 5DEFB 5E9DE 1OP5K 2R0KL 4RAVB 5GGSY 2VLME 3UYOD 5CILH 1WBYA 2EYTA 1EZVX 1ZT1A 1U8IB 4GMTH 5IHBA 3FAWA 4B50A 1HQ4B 3SE4A 2YUZA 2O5YL 1T4KA 2PYFA 1FNSH 2J8UB 4WY7H 1F3DJ 1PG7W 1S9KC 1TNNA 4QTHA 3HPJA 3WNLA 4H0HB 4F7TB 4KTDH 1SJEB 1W72H 1BD2A 3QH3A 5DURD 5I73B 1XT5A 4X4XA 4PRPE 4DOHE 1EH9A 4LQFL 3TYFA 4FQJL 2CLVA 1QQDA 3IDIA 5ALCH 4WTWA 1N59B 1RJLA 4X5WA 5I66A 4KMQA 3V6FA 5HHOA 1ES0A 3OXSB 4YHOL 4LSRL 4YPGA 3DX8A 3GMQA 5BV7L 4AM0B 1RZIB 3GIZL 2R56H 1BF2A 2CRMA 4PRHB 5ALBH 1EO5A 4WW1B 2NTFA 1CYGA 5EU5B 4KKLD 4DGIL 4D94A 1YEJH 4R7DB 3B43A 5E2VL 1WFNA 4NQCB 5C7XH 4EUPH 1SM3H 1UM4H 3IDYB 1UB5B 1M71A 4Z95H 5AZ2H 4G9FD 3AY4C 1WUNT 1T5WB 5C2UB 3RIFK 1I8IB 1K6QH 2X10A 4LLUA 5I1JH 2AXFB 1GRWA 1JE6A 3OXRA 1BQLH 5GS3A 5TE4H 4MD0B 5HDQH 3MV11 3BMVA 2DQFB 5D2NE 2F9BT 3RWEB 4XWGH 3HE7B 4YUEL 4HWBL 4NHUB 5HJ3B 4JFPA 4X98A 2JJSC 4L5FH 5E08H 1XF4B 3RBGA 1MIML 2EDYA 2FH8A 4LSDA 4MNQA 3UPAA 4MJIA 3U36B 3B9KD 3UJTH 4JHAL 4JR9H 1AFVH 1NCWL 1S9XA 2OK0H 5CINH 5T3XE 1U2CA 3DV4B 4FTVE 5I1IH 3H3BC 4IIQB 3NA9H 4Y16B 4TQEL 5E2TL 3IDNA 4BZ2H 4GLRH 3P0GB 1CL7H 4JFHE 3EO9L 2OI9B 4MX7A 5J8OA 4U6VH 4HC1H 3VFOA 1NCCH 3GSWA 5IEHB 1W72B 1INDL 3ZKMC 2FLBT 4UB0H 3CDGA 1BOGA 1ZEAH 4D0CB 1CE6A 1EHNA 4RAHA 5FUZH 1BEYH 5JW5A 1WT5C 3MBXH 3AY4A 3ZKSD 2FLRT 5C07A 1QFWL 4APQC 4ZUUB 1ND0B 2QQNH 3NH7L 4Q6YA 5EFIA 2FWOB 4R4ND 3W0WA 3JTTB 4PJXF 4NKDA 3UROR 4NNXB 4RRPG 4P5TC 1DBAL 3MOAH 3L3KB 3QQ9C 4J4PC 2I9LA 2JJSA 2WZPD 4I2XE 3BT2L 3K1DA 2VXTL 5DUMH 3N06B 3AU1B 1A9EA 1V7NL 3WIHA 2FX8L 1A22B 1TQCB 3DVNB 4X4YA 3QISA 4WGWB 4TNWF 3QRGL 2ATPB 1MJJB 4EUPB 5J9PB 4K3GA 2IG2H 5MEPA 1CZ8H 1HI6B 5F88B 3H42L 5BRZA 2O5ZH 4AT6B 4NRYA 4QXTB 4A6YL 5ITFB 3QUZD 2DQDH 1KBGH 3CFBA 1TITA 2NR6D 4HWZA 3TBTA 4XCFH 1Q9LA 2Y06L 1O7SA 4JFQA 3HI5L 1TVDA 2YRPA 1HE7A 3J8F7 4KHTH 2BFVH 4E0RB 4JPVH 4RCAA 4G7VL 4DEPB 5DVMA 4PJIF 4X8JB 2JK5A 1H15B 1FNAA 3PWUA 4Y4HC 2Z8WC 4WW2B 3GSOB 1WT5A 4PBXA 4X6EA 3K81A 3GNML 4WUKL 4JFDD 3SDAD 1G0YR 4JFED 2KBGA 2Y6SD 4JREC 2X4TA 1MNUH 2G2RB 4FQXC 2AJZA 3RVWC 5FOBA 1QPPA 1SY6H 1A14H 3ECBB 3UZVB 5B8CC 4XNXH 3MXWL 4P5TA 4J4PA 1RVFL 2QHLA 4G8EB 3GK8L 4AL8H 4WTZG 3L5HA 1KTKE 4OLYH 3I2CH 5E5MB 2NXYB 2VDKL 5J13B 5C0RL 3E6HB 1R0AL 1LDPL 5DJCA 5INCB 4S11A 4PUBH 5HGDA 1KT2A 3GHEL 4UQ2A 3U4EA 2Z91A 2VISB 4MLSA 3MFFB 5CZKA 4U1SB 2NXZB 3QNYA 4G6FD 5DS8B 3X14B 4LEOB 1ZHKB 1B0GB 4R3SA 3QFDB 4EI6B 1A7NL 1A7OL 1BAFH 5DHYB 3VD7A 3U9UB 3ZT5A 2VUYA 1QBAA 5HHNB 1N0XL 3QUMA 2Z92A 3CCHA 5IR1A 1FZOB 3BP6B 2R9HD 4Y4HA 3MRJA 2B7DT 3P30L 4ODUA 3TV3L 1GXEA 4KY1H 4Y8AA 1J12A 4P5KA 4KTEH 3KJ4B 2XPGA 4FQXA 5CJ5A 4M48H 1NCBH 4Y1AB 4YX2L 1IARB 2AJUL 32C2B 4L4TE 5AZEL 1BP3B 3KPRD 2R1YB 5B8CA 3O81A 3IKKA 1FCCA 3QG6B 4KPHH 5EORL 3UTPD 1BIIB 4KHXH 2D4DA 2J88H 1UM6L 5EU7E 2X1XR 3BE1L 4JPIA 3QA3A 4WFED 3WHXB 3P9MB 5HVFB 3ZDXE 3IJYB 4N8PA 1T3FA 5DC0A 1EO8L 3ARBB 1AXTL 4EEEA 1QP1A 4GKSA 5JOPD 1RIHL 1LNUA 5IB3A 3UBXB 3WUWA 4Y4FB 3OGOE 3NVQA 4KJPC 4R97B 4LCYA 1N3NA 4K3JH 4DUXA 5DQJA 4H5SA 4MSWA 5IBTH 2JIXA 3MV9B 2BDNL 1GC1C 1J1XH 2PKDA 2XTJD 5E8EA 2QQKL 2GJ6B 1FFQA 5E8PA 4YNYA 4KJYA 1TPXB 1FNHA 3PP3K 4CKVX 5FGCB 3IJHA 1L4IA 3WFHB 3LRGA 1DQLH 4BJLA 5K9JL 3TO2A 1WV7T 3A67L 1JPGB 3BSZL 3NBNA 4LIQL 1GJIA 3B9VA 4UDTB 4M9OA 5DSCA 2Y5TB 4KK6C 4FABH 3QIWD 4OD1L 5JA9A 1T66C 4X7EC 1YEHL 5TQ0L 5E6IC 4NCC2 2NY5C 2LU7A 4MQ7A 3LQZA 1RSFA 4HFWB 1M7IB 4OCSL 1MHEB 4V2CB 4K8RH 1CLCA 1QBMH 1W2KT 1XGYH 2GT9A 1U3HC 4ISVB 3CFDA 3SHSA 4N68A 4JFZL 4U05A 5F93C 3NGBB 5ACLA 1UXWA 3L3GB 4Z7NE 5F72S 3HA0A 2R2HB 4LCWB 3GMLB 2AJVH 3BZFB 1S78D 4HIHA 1LQSR 4EBQL 4LVHC 4FP8L 3MUGB 2YA1A 4K2UH 2ID5A 3ELAT 2DTMH 3MC0A 4ZUSB 1N64L 3BN3B 1KIPA 3BDBA 1F58H 3OKDB 2EDKA 3GMPA 2NY6D 3WNNA 4X9IA 2R1XB 4S1DD 1A7QH 1U6AH 3QAZC 2F74B 5T1MA 2DQTH 1K4DB 3MLWH 3WFEH 1HXMA 4K71B 3VGAB 1S7WB 2IBZY 3LKRB 3I6GA 4CUCA 2IBBA 1IEAA 4GRLD 2BVOA 4AY0A 2HLAA 2W60A 2V5RA 2WIMA 3H8NA 5IBLC 2O93L 3DUSB 2FJFA 5LWYH 2J2ZA 5ISZA 2CUIA 2YD6A 3G08B 3QNXA 1JF6A 5LBSL 3P0YL 3QDGD 4UT7L 4TSAL 3DYOA 5DURB 4RIRA 4TUOA 1KTLB 4P9HL 5F3HB 3DIFB 4M43H 5EU6A 2W65B 1FNGB 5ESQB 4I0PD 2ADJA 3H7LA 3OG6B 4ZS7L 2DQJH 4LEXL 1HILA 1A6WL 4EVNB 4LPXA 3VA2C 1WBZB 3B5HA 1MF2L 3VJ6A 4GW4B 3LEYL 1S7VA 2ESVE 3KPQB 1L7IH 1YPZB 1CGYA 1FO0H 1ONQB 2CLZB 1UCBL 3S4SA 4JZNB 3FO1B 1FZJB 2ICWB 4IRJC 2H32H 4HJJL 2CO7B 1R5VB 5J3HD 4HHAA 4JM2F 3LB6D 4LAQL 1XGRA 5EB9A 1FVEA 1G7JB 4AH2A 1M4KA 4G9FB 4PJXA 5JLZB 4XAKD 1X5HA 1KJ2A 2H1PH 2OR9L 3RQ3A 1G7MA 2KZ1B 4QRTA 3QO0B 5GGSB 1PGRB 3WXVL 5BOZG 2F19H 1SYSA 2XKSA 5CHNB 2VXSH 3RTQC 1DBJL 2HA1A 4LNRA 2AJYL 3QFJB 3OKKA 3U6RB 2V5YA 5F9JB 3DI2B 4U1GC 4GKNB 1E27A 2ATKA 3RWFB 1BZ9B 5IT2L 2PCPA 3B9KB 4AEHL 1DBKL 1AD0A 2NQCA 1NDMA 1TTFA 1BJ1H 1U42A 1YYLH 3HAEH 4X7SL 1KIUA 3BIAX 5DJYB 2EDJA 5ANMA 5KOMC 4PJ8D 1KELL 4LU5L 2RR3A 2VXQH 4D3CH 3RZCD 1AR2A 4PJIA 2W0FB 4JPKL 1X5IA 4P9MH 4J3WA 4XCCL 3MRHB 1G7PB 4IRJA 3RWHA 2A2QT 1A1OB 3MZGB 1MFNA 3CDYA 1JRHI 3VWKB 3HC3L 2KL6A 4J8RB 4DVRL 2K3TA 3EOTH 4OF3A 4ONFL 2CLRA 5LGKA 1FNFA 1ZT7A 2X5PA 4OM0L 1CU4L 1CFVL 4NQED 4U1KB 1KXTB 4R90H 2Q6WB 2E27H 3I85A 4IRSD 2ADIB 5KS9B 5F6IB 4KQ3L 3N1GC 3RTQA 2Y7QB 2VLRA 5FKPB 1GOFA 1FO0B 4LCUB 4BYHA 1A6ZA 4HPOL 3GUTB 4UINL 3EO0A 2GTWB 1EMTL 5FA4A 2H32B 4MB5A 2YD9A 2DM4A 4JKWA 4LLQA 1OWWA 1V3JA 4HH9B 4AQ1B 1JV5A 1DLFL 4F8TA 3FQTA 4S2SA 4QRRE 1T7YA 3QUZB 1U8LB 1Q94B 2OTWA 4PGDA 4O9HL 4JO1H 2Z35B 1A4KA 3MOQA 3RGVC 3EYSL 3TVMC 4HLZH 4KKNA 5C0BE 1HZHH 4L9LB 4YDVA 3CC5B 4P46B 4LSQL 2G75A 1L0XA 3OJ2C 5JR1H 5TFSL 1AQDA 4KDWA 3NPSC 4HKZB 1L0YA 3SDAB 3DMMA 3HZKB 2A77L 1P6FA 4X7TA 1D9KD 1J05A 1CLZH 2XKNB 1YMMD 4PJBB 2NW3B 1PJ9A 3SKNA 4PY7B 1G7HB 4QHMA 2ITCA 4ETYA 4JY5L 3G5ZA 5C0FB 1YEFL 4JN2A 4KJWC 1Z5LA 2YWYA 1VSCA 1AGFB 4BFIA 3WLBA 4LOUC 4PTTB 4HUWB 1AKJB 5D96C 4MXQC 5FYLL 4PJHB 3RY4A 2CQVA 1C5BL 3CIQA 3D2UD 1DDHA 5FEBA 5EOCH 4Y19D 4JRYA 5KZCD 3NCYP 3WYRA 5ICYA 5KVFL 1VKXA 1CLOH 4UTAH 5HD8D 3VFPA 3RUGB 3L5WA 2YPKB 5F6HI 1MFAL 5IJVB 1KNOB 4HWUA 4XVTL 1RUAH 5JORA 3RIAF 4FQCH 4U1NA 5DA4A 1K3ZA 3OSKA 3RGVA 4RGNE 3TVMA 5DD3L 4XMPH 3MJ9H 5T3ZE 4P3DB 5D7SL 2B5IC 4U1MB 4TUJB 1TETH 3QNZB 5LG1A 3JV6A 1AQKL 1WTLA 3UC0H 1H3PL 5DRXB 5I6XB 2P5ED 2FIRT 3H9YA 1KCKA 3OJDB 3RY5A 5JPMA 3D25A 3CNKA 4C57C 4ENEC 2X4NA 1W8NA 5E6YA 2D03H 1CFTA 3SCMC 2DDQL 5HGHA 3KPRB 3BIKA 4TSBH 3QHFH 4NGHH 1BQSA 4O58H 2GK2A 4K7PL 2JF1A 3ISWA 1JNNL 1IGJB 3HNVL 3L3OB 4PPTA 5CGYD 1VPOL 3QXVA 2C4FT 1F90H 2MQCA 1NGQH 3V0VA 3DSNA 5E00B 4EN3C 1TXKA 3FQWA 4GQ9H 3C6SB 2XRAH 4LVNB 2HFEB 5GISL 3ZDXF 3UZQA 4EUPG 1XGQB 4FXGA 4F33A 3K8LA 4MA1B 5T3XL 1VA9A 5HTSA 1AGCB 2VZSA 4NQDD 3IVKA 1VACB 2QHRH 3LEXA 1AH1A 3VMPA 1JWSA 3BP5A 4JKMA 5J89A 1XCTB 3MLTB 4J1UB 2XTJB 1T21A 3VD5A 3WSQL 2VZVA 5D7LE 4WNQB 4D9LL 4ZQKB 1U8PA 1MREH 1FDLL 2RB8A 3QEQE 4XNUL 5I2IB 3STLA 3ZKXB 1PQZA 4JM2C 3F8UB 4YDIL 3H3PH 1YEIH 1IT9L 5H35A 4XPTL 3QIWB 1G6RA 1UJ3C 4NZJA 4OZIA 5I76A 3V7AE 4CNIB 5IVXE 3BEWB 3SCMA 4IDJL 1WZKA 3JWNC 1DZBA 1MHPL 1QNZH 5D2LE 1CWVA 1NBYB 4NM4L 5LGHL 2YK1L 5HYEA 3GKWL 3N85H 1CD1A 4EN3A 1J9CT 4PRPA 1MCBA 2VNCA 4LKXB 3UAJD 5JHDE 2APFA 5ICZA 2YRLA 5DJDB 1FL3A 1YY8A 4FNLL 1VGEL 3B8YA 4Z7NF 1S3KH 1IC4L 2VLJD 4D9RD 2ERJC 2BSSA 3D5OF 4HV8A 2YZ1A 1KXVC 1NUNB 2E7HA 4DN3H 4KH2A 1P7KB 4WENB 1E4WL 3D69B 5CJQH 4TN9A 2QSCL 3ULVD 4F3FA 1J0JA 2NY6B 1FAKT 4E41D 2UZYB 3EIFA 3AS3A 2BP3A 3AROA 4N0UE 3HI1B 2EDEA 4I1NB 1Z9LA 1FGVH 5I1DA 4IMLA 1UJ3A 3QZWG 2BC4B 2ZJSH 2V7NB 4PRNB 4YXKL 5KANG 1D5MB 4GRLB 2CRYA 3ARQA 1FZKB 2R0ZH 5C8JB 4M1CC 4Q9QL 3V5KB 4Q97A 3I50L 4HT1H 1P7QD 3MRRA 3SDCC 1ZOXA 2PW1A 1ACYH 1TCRA 3KJ6H 1QSFE 5FYJE 5JHLH 2X89A 4OI9A 3QDGB 4G8IB 2QADC 5E0QA 3NZHH 4M1GL 5CEYB 5JNYB 2P8LA 3ILPB 5CJBA 4H1LH 3C5JA 4L8BB 2V5MA 3F7YA 3UBXG 5DMYA 4OCXH 3VXMD 2B1HH 2DQIL 4I0PB 1JNLL 1MCPL 1F2QA 3BOVA 4H20L 1AGBB 1KPRB 3HZMB 3TBVA 2IFFL 2DQEL 2W59A 1KFAL 2YN5A 3O3EA 2AVGA 1C12A 3MV8A 2DN7A 3QEGL 3R1GL 4YR6A 1RUML 2YXMA 4OIBA 2AV7A 4MNGE 3LKSA 5KG9B 1IAKA 3V8CA 4LVOB 1JVKA 2CIKB 5FF6B 3ZHKA 4XP9H 1FPTH 4KK9C 3PWJB 4XVJH 4MAUH 1F3JB 1ULVA 3KS0H 1K4CB 3V4UL 5D1QC 3RU8H 3STBA 3MRNB 4QF1B 3IETA 3O4LA 1ZVSB 3TT1L 5FA3B 3SKMB 2XZZA 3SGDH 1PD6A 3SDCA 2IPTL 1QA9B 1TQBC 1NSNL 2R1WA 3CUPA 3FONA 5GZNC 2IBZX 4BQ6A 3B2UC 4I2XA 4NUGH 5TF1H 4ZD3H 1FG2B 2APXA 3MA7A 1WBXA 5DD5L 4G7YL 4F58H 1JHTA 5IQ7H 3GSVB 3DRQA 5DD1H 5FM4A 5HI5D 5ESAB 1NAKH 3DLQR 1U8JB 5E8DH 4JFDE 2OL3H 4JFEE 5ILTL 5IVOA 1KLUB 2OR8A 1CVRA 4XI5D 3T4YB 1A64A 4BZ1H 2XN9A 3FCTA 3BN9D 4M6ML 5I18L 5TQ2L 4JDVB 4UT6L 4PJ8B 1NC4A 4HIIA 1WLHA 5EUOA 1S9VA 3TH3T 2B1AL 3RZCB 3GDBA 3ARZA 5GGTH 4IS6A 4FQIL 4GLRI 1QR1A 1PLGL 2CDGA 4M5YL 5KSBB 3LRSA 3UO1H 1CL7I 3RKDC 1URLA 5GHWL 3RWGB 3P4MA 1U92B 2J6EA 4X9HA 4LBEA 5D1QA 3TBYA 1RJYA 3GSXB 5K33A 4N0CD 5FYKD 5HYJB 5BO1H 1G9ML 4NQEB 2C4FU 2WWMC 2HFGL 1WWBX 5IB1B 1WWAX 5SV3A 3CPLA 5EU7C 4ZTOH 4IRSB 2DD8L 3U1SH 2RIKA 4YXHH 2X9XA 1A9BB 5L7XH 3W9EA 1RMFH 3F12A 4ZFGL 4GKOA 1S5HB 2WW8A 4WU5A 2LU3A 2H8PA 3GSNB 4OGZA 4GO6B 2NNAA 5C2BH 1RZFH 3QXDA 1F13A 4N0YH 1GYAA 3ARFD 3QUYD 5EBMB 3KHQA 1R3IL 4LCIH 2VR4A 1CDIA 2ZOLA 4MDIA 4MJ5A 3UTPE 1CK0H 3C9NA 3VFVB 3AMKA 3E8UH 2HKHH 1EEZB 5GGUB 5KANI 5DHVA 1A7RH 2FBJL 4ERSL 5CEXB 3OKEA 4PRAB 4PJAA 1BJ8A 4DFIA 5JOPE 5DFVD 2VUOA 4EQ3A 1UWEL 1IM3B 4Z5RA 3OZ9L 2OL3B 4EI5C 2LV4A 4GMTL 3MLRL 3MJ6A 4L4TA 3P2TA 5AWNL 3UBXI 1FNSL 5K9OA 1J1PH 4HMEA 4WY7L 1A6UH 5EIQA 4LLVB 4KTDL 5LQBH 1W72L 2YN3A 4JY6A 2IAMB 1MEXL 2FD6H 4L3EA 1I7UA 3HUJE 4PJEB 1DJSA 5HGBB 2CDFA 5BZWA 1UC6A 5IF0B 4PD4K 3FT3B 4X99B 3D39A 4Z7UE 3FO2A 5DK0A 3D2UB 5ALCL 4R8WL 1K8DB 4YGVA 5DR5H 1K5NA 5KZCB 4ELKA 5IFAH 1T1ZB 3UTSA 3FZUD 5J1AA 2FX7H 3BHBB 3FT2B 3QEUA 4I48B 1YUHB 5D8JH 4PB9H 3K2UH 1I8MA 4BSWA 35C8H 5ALBL 3CVHA 1D5BA 1KJMB 3JUYA 4DVBA 1CT8A 1AE6H 4OTXH 2GITA 3ULUH 3HS0B 2FCBA 1DVFD 5H8DA 5FYKU 5CP3A 3AAZA 5CBAA 4PV9A 5IW1A 4HUVB 5L0QB 1UM4L 1QTYT 4MA8L 4Z8FH 1WITA 4Z95L 1KXQE 4OKVB 5AZ2L 2X4OB 4QCIA 4G8GA 3WN5C 3WDJA 4EI5A 3MBED 3UP1A 2P5EB 5I1JL 2OTPA 1JPFA 2IH1B 4XVSL 1BQLL 4ZYKB 5TE4L 3BPLB 1NLBH 2R0LH 4XWGL 4HEPG 1T0NA 2I60L 4HXBH 5D1XC 3DVGA 1CDJA 2MQ0A 1UZ8A 1M6OB 3IU3A 4L5FL 4CAGA 2GSGB 4OCWH 2DWEA 4P23C 2QSQA 2OSLB 3THMH 4RQQB 2ICEA 3KPTA 3BRGC 3UJTL 4P48A 4JR9L 3X12B 3UYRH 5CD3A 1OAKH 3EDEA 2BNUA 3V6OC 1MUJA 1B88A 4XVUC 3GSQA 3PABB 4LNVA 5I1IL 1J8HA 1XR8B 3NA9L 3D9AL 1U8QA 4NQDB 1LK3L 5DMJB 2R69L 4BZ2L 4PP2B 2BOBB 4F7CA 5IMOA 4G6AD 5IQ9A 1PDKA 3ARTA 1LO0L 4WHTA 4U6VL 4HC1L 1OAUH 2APTA 5DO2D 5CP7B 3S3SA 3DTXB 1MAJA 2VJXA 5JOFA 3O11B 3X3FH 1I7ZA 5FB8A 5D5ME 5T5NF 5FUZL 4KKAC 5KSUB 3RVUC 2JCCB 4XMKH 1TJIL 5CJOH 3WN5A 1WFOA 1AIFB 5TDNA 3TT3H 2VKWA 2QQNL 3LS4L 4ODXA 1V3MA 1NDGA 4YO0A 3I6LD 3O2VL 3OAZH 2A6DA 3HAEG 4LCCC 3KYNA 1V5JA 5CD5D 4U7KA 1Z3GH 1KSRA 4LLYA 1LP9B 1KLGA 1MJ7H 5D1XA 2WP3O 5DRZB 5IVXF 1CQYA 1SEBB 3SQBA 3K2MC 4PB0H 5M94B 2F8XC 5DUML 4P23A 3F7PC 1R3JB 2Q1EA 5A16A 2IQ9H 3OB0K 4F7EA 3VGBA 1ZLWH 3IFPB 1YNTA 5EZIL 1YC8A 3BESR 4GSDH 3BGMA 2XXMB 4AJ0A 3QXUA 3IXTA 2HT3C 4LSVL 1CZ8L 3V6OA 5CEZH 3H9SA 2O5ZL 2LAAA 3TP4A 4OLXH 2ICWI 2DQDL 1KBGL 4I0CC 3KYOB 2ZCKH 3MRBB 3ZYOA 2I07B 4HGKC 5C0JB 4QOKD 3VA6A 4XCFL 1NGZA 2VLJB 5CSGA 3MLSH 1HINL 1HHIB 3MNVA 4KHTL 4TPRL 3IGAB 4HUXB 4EXPX 5TDOA 3FL7A 4DGYL 2GCYB 1ZLVK 3IAPA 2G9HB 2IAND 3G6JE 3QDAA 1NAMH 4FOMA 4LPWA 4E41B 2HFFA 3T65A 1PG7H 3D85D 2R2EA 2BSRA 4X6CA 2NY2D 4WO4D 4JFYB 5LGJB 4MDJA 3HMXH 1PYWB 3HZVA 1KOAA 3NCJL 2HJLA 1JI2A 1MNUL 4L8DB 2P7TB 4GBXC 2DQHL 3CD4A 3EZ8A 1Q1JH 3O3BB 4RAUA 4K94C 5BV7C 1SY6L 4LCCA 1A14L 1RZ7L 5MEOA 3EDDA 4XNXL 1UACL 1P4LB 2JJTC 3FQXA 1KN2L 1DQDH 1UENA 3PIQB 1GPOH 5EO9A 2ED8A 4AL8L 2DM2A 1ZMYA 3MLZH 3C09C 3MR9A 4CW1A 4OLYL 3PJSB 3O2WL 5F7DA 4QXGH 1B4RA 1S7SB 4PJ7F 5E95B 5DGRA 4HLZG 2L4OA 5DFTA 4D2NA 4JJ5A 4ALAH 2VXVH 2RFXB 2VE6B 1P1ZB 5B39A 3RWCB 3MRGB 2DWDA 1EXUB 2JJVA 3CK0H 3KPLB 4P2YA 1CS6A 4M61A 4NQEE 1G7QB 3U30C 1E4XH 2E9IA 1PSKH 1AD9B 2AEPL 3SE8H 5HI4D 4FZEL 1BAFL 4UBDD 3ZE0E 1T2QL 4YC2B 5DHXB 3FTGB 1KYOK 3ES6A 3M1BB 2CUHA 4H8WL 1BX2B 3OAZK 4ETQB 4KTEL 3OKNB 1RUKH 4GBXA 3ZKND 4M48L 4NO5B 1NMBH 3W2DH 1NCBL 3T3PE 4Y5YB 5EBWA 1SMOA 2J8OA 5EPMA 1E28A 2DBLL 3FJTA 3BKYH 1EJOH 4KPHL 1K2DA 2BMKA 2UUDH 3QJHB 1A3LH 1ZLWK 4Q7DA 1AGEA 3REVB 4HEME 2WUCH 3FO9B 5HDOA 4J3TA 4HK0A 4KROC 4JHBA 5TE6L 3O0RH 4AG4H 1XH3A 3KPSE 3OGCA 1HHJA 4F15B 2R39A 3ESUF 1JYVA 1H5BC 1NAMB 3KDMB 4PREA 1I3GL 4K3JL 3FRPG 5I8KH 2N4IA 5IBTL 3G6AB 1OSPH 2BVUA 3IDXH 3FFCA 1J1XL 1F97A 2DIJA 4FFWD 4HWBA 1S7UA 4NO0B 1YMME 2F15A 2CKBB 2W0KA 3SKJH 1PG7X 2V2XB 3O8XC 2F53A 2JTDA 5E70A 2EH7L 3RI5F 2IJ0C 5IV2B 4RGNC 2VL5A 5F1OB 3C5SB 4UU9B 4YH6A 1MWAH 3MRKB 1NGXB 3CU7A 3PGDB 4OLEA 4TVPD 5IVZA 2GK0A 3LKNA 4QKXB 5EG6C 1U93A 4Y19E 2HKFH 1FN4A 1GZPB 2GAZA 4MAYC 2AW2A 5FXCH 3VXQA 1MFCH 4HCRA 1I4FA 2F5BH 4LFHD 3O2DA 1YDPB 4NO3A 4XC1L 3C8DA 1QHOA 4K8RL 5GIRA 2X1PA 1JI1A 1QBML 1UB6A 4NCC1 1BD2D 1XGYL 1RK0B 1DQJB 2BRRH 3LV3B 4R2GD 4WDIA 1H5BA 2WBJC 3WL9B 3SGJC 1BBJB 3UTZA 5I8EB 1BJMA 5IIEA 4G5ZH 4Z7VE 3UDWC 4OLZH 2KQNA 3VG0H 4XH2B 4R4FH 4I5BB 4K2UL 3QUYB 2NW2A 3ROLB 5EULV 2DTML 2KH2B 1Z9OA 3O8XA 1ITCA 3JTSA 2Z31D 2Y9RT 5B38A 1JZ5A 2J5LC 5DWUH 3UX9B 5F7UA 4RMUA 1U6AL 5KBNC 2NY3B 3QHZH 4D0BA 2DQTL 5LCVH 3MLWL 3WFEL 5JW4R 2XWJA 3MNWA 1HH9B 4XZUB 4CJ0A 3MGAA 3HC0A 1N6QH 3SY0B 1II4E 2UZXB 5FGBC 4MAYA 2GTZB 5LWYL 1WCBB 4QY8B 1NKRA 3HRZA 3ZKQD 5CWSB 4HULB 1JWUA 1JUFB 2VQ1B 3D0LB 4WI3A 4M7ZC 1OAYH 3HKFA 4FN0A 2YKLL 1KGCD 5EU3A 1QLFA 3FB6A 2JLLA 3LQAH 1FNLA 4HZLB 5BS0A 3D18B 2WBJA 4MNQD 3MACH 4UT9H 3BZEA 4MJID 4M43L