3REVB

Crystal structure of human alloreactive tcr nb20
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
GVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSYVSQNNEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and energetic evidence for highly peptide-specific tumor antigen targeting via allo-MHC restriction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords TCR NB20 ALPHA CHAIN
total genus 58
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2011-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3revB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3revB02
4X7CC 3K2MC 2ZCHH 3HFML 4JJ5B 3FOMB 4I5BA 4PJ8D 1Q0YL 1G6RH 1NANI 1NDMB 2VDLL 2ZUWA 3HR5B 4Y1AB 3TIDB 2GCYA 3CIQA 3LEYH 5IBTH 1BOYA 1K5NA 3MA7B 3REWB 4LAJH 1ZV5A 2NW2A 1YN6B 2DJSA 2R56H 2I9LB 4MDJB 5CLWA 3QUXD 4YPJA 4RNRA 3GK8L 5I75B 4CU8A 3ZTJH 3RDTA 4G8EA 2DN7A 2NZ9C 5E1HB 3BPNB 4FQCH 4LK4A 1N59A 5EU7C 1PG7H 1L7IH 1X7QA 3U0TB 3G6DH 1ORQB 1PG7W 4LL9A 3BXNB 4KTEL 3NCEB 3BX7C 3MNZB 5KS9F 3H0TB 2D7NA 5DQJA 1VGEL 5L2KA 3MGAA 3MJ9L 5E9DA 4OZFB 4RAVB 1YEIH 2HJFA 4J3VA 4U1HA 3UTPD 2I5YH 3BGMB 5BMFL 3WD5H 1QSEE 4NKIL 1OW0C 5GSRB 1OGAD 2FEDC 2P5WE 4HDIA 3GHBH 4LLWB 3KXFD 3HHRB 4G6JL 2H32H 4D9RD 1NGQL 1FNGA 3WDHA 4U2ZA 5KW9L 3G5ZA 1MCBA 3DI3B 2IFFH 5JZ7C 4HJJH 4LF3B 4LDEB 5IB5B 3O6FB 4AIXA 3LKNB 1NAMH 3I2CH 4N0UE 4X5WB 3HC4H 3KPNB 3PP4L 4U0QB 1MOEA 2GJ6B 3RBSA 4N0YL 5H35B 3IU4L 5DD3H 1TTGA 5FUCE 3B2VH 5EZOL 5IFJA 1QLEL 4WUKH 3UPAA 3N9GH 2A9NL 5DMKA 1XT5A 1TJGL 3GFUA 1UT9A 5D6CB 4RZCB 1IJ9A 1NBVH 5DUPL 1NCUA 5BRZA 1AXIB 1RZKH 4PLKD 4PGCB 1OP5K 2IH3A 4JO2L 5KAQF 5KSAD 1RZ7H 3MRLA 4XMPL 3SCMC 1J0ZA 2EXYD 2YK1L 3RWGB 2XN9A 1M7XA 4PP2B 4DKAA 4P5TD 4D0BA 4GW1B 3ZT7A 1I1AC 4KUCF 4LP5A 4HT1H 4URTB 1CICC 4OD2B 5HHOA 4JPIA 4KI5C 4HLZG 3V4UL 1U3HC 3H7BB 3ZYOA 5T33H 4I4WA 3MFFB 2J6EA 5B21A 3OR6B 3DX6A 4HK0A 3W82A 4DUXA 5HVHB 5DVNA 4PB0L 4OGZA 3G5YB 1YMMB 3CU1A 1YNLL 3MRKA 5E8DH 4IMLB 1WC7A 3BZ4A 3SDDB 5L88L 3R06B 2EDNA 4YBLC 4KDVA 4RGMC 3S35H 3C6SB 3TT1L 1ZVSA 4NO3A 4KDTA 3VD4A 2JCCF 2BP3A 1QP1A 5JO5A 3QEQD 4RFNB 3KYOB 1X44A 3NH7L 1WWWX 2R4SH 3V5HA 3M8OH 5GGQH 1NFDE 1JTOA 4ZG1A 1IM9B 4KZEH 3OXRB 1AKJD 4LSQL 3IJHB 3L5XH 3BN3B 2PXYB 3H9YA 4X4ZA 3DX8A 1U2HA 1UZ8B 2HTLD 4U6VH 4I18C 5DK2A 4WUUB 3VRLF 2BK8A 2XWBA 4PBVC 1IM3B 3ARPA 3FQRB 3RDTD 3HE6B 3ELAT 3NFPB 4WHYH 3U9PL 1AI1H 1IC5H 2H3NA 2HH0L 5JIPA 2DB8A 4LEOB 4JZNA 4PJBF 3EJZC 4GO6B 3PV6B 3QXDA 2I9TB 2GFBB 3IJYB 2CO6B 2A73B 4I8DA 2EE6A 4E5XA 4YHNA 1XGRA 1N4XH 4Y7MA 1A6PA 3C5JA 5JDJA 5EBMA 2F9BT 4ZUWB 3N1PC 4WU7B 3PWPB 5I9QC 1NC4D 5GGRA 3SCMA 4QHNA 2HTKC 2NYYD 1HHHB 1MLCA 4AEHL 1WGOA 1LP9B 1TVDA 4WIQA 1RY7B 3KR3L 5F88A 5JHDB 5L2JA 2Z4QA 2AERT 4GAGH 3EJYD 3QQ3A 4KK9D 5D6DC 2Q76B 4OCXH 1U3ZA 4JO4H 3P73B 4KJQC 3VE0A 2DI9A 3LDBB 4XHQA 1RJLA 5DJ6A 3H9HB 4PRPD 1RD6A 5F89A 4TSCH 1TZIA 4X6DB 4U33A 3DURA 3MRRB 3BP4B 2PUQT 1CLZL 4HG4J 3QPXL 3DVFA 1QHPA 4CVUA 2CLRA 3CPLA 3GBNH 1NCAL 2H9GA 3OKLB 3FMGL 3J7HA 5EUOB 4KVCH 4P2CG 4HIHB 5C0IA 3C6LC 3F7QA 5F9OL 3O2VH 4HH9A 4F58L 3BGFC 3MGTB 5F96H 3LIZL 4R2GC 1AHWB 3QQ4A 5CD5D 2NPLX 2GJJA 4Z9KB 4XAKE 4OFYA 1AGDB 3ARXA 3DX9B 5F7LB 3QIUB 5FUZH 2PYFB 1U6AH 4HWEH 4GUPB 2CKBH 1I1FB 3BYTA 3O4OC 5IB2B 5EDXA 4C83B 3HS0A 4JQIH 3ZZ1A 1Q9LA 2FO1A 2Q7YA 1JK8A 2Z35B 3DWTA 4G9FA 5IHUL 2C7UA 3QH3A 3Q5OA 4H1LB 2ZSVA 4Q9BA 1IAKB 43C9B 4UU9A 5EPMA 4JPVH 1MI5B 3U4BL 5KJRL 4APQB 1I3GH 2OZ4A 3QA3B 5FCUL 1J1OH 32C2B 5E99L 1WJ3A 3VGDA 4LQFL 5E7FA 4HXAL 3FB5A 3SY0B 3FRUA 1G7HA 3CMGA 1ED3A 3JTTA 3UJJL 4I48B 1UVQA 4DGVH 4AEIL 1QFWM 4QXTA 1FNEB 1EXUB 1N59B 2AK4E 3MCKB 5CD3A 3R8QA 4MNQD 4Y5XC 5ANME 4KQ4H 3PWUA 5JA8B 1C1EH 1RZGA 2PTVA 4MA3B 5B22A 2DYPA 3QUZC 3CSBA 1CU4H 4OT1L 1U2CA 4PPTA 3KAAA 1BZ9A 4LIQL 3O45B 5EOCH 3OB0H 3GMMB 2CDFA 1CXFA 5B8CA 5GS2D 5I16A 1LO4L 1AKJA 1EHLH 3WLWD 4M6OL 2DQGH 5JIKA 2A83B 1NBQA 4LVHC 4JFFA 5CJQH 4ONFL 1QEWA 4MD0B 5CJQL 2DTMH 2R29H 1S9XA 1RUQH 3QQNA 4Y4HC 3BP6B 3KPSD 1CLYL 4A6YL 3IRZA 3IXTB 3GIVB 4M7ZC 4C56B 3BPCB 3IJSA 4NUJB 5C0ND 5HGHB 4L4VA 4O5LL 1F58H 3U36B 1ZGLA 4LLYA 5C0DA 4K94C 2BOBB 5JR1L 1RHHB 5GGTL 1ZT4B 4Z95H 2X4TB 2W9EH 4XP1H 3JWDH 4EI5D 1P9MC 5AZEH 2ITDB 1MCRA 4KHTH 1NFDF 4QGYA 1MCCA 3O4LB 2RR3A 1I4FB 3ARVA 4QGTA 4I2XA 5IJVA 4RZCA 4UUJA 1NJ9B 1YEJL 1U3YA 4G9FE 1GPOH 5EWIL 4ZUUA 3KG5A 5DRWA 3PL6A 4WV1A 5DJZB 4FN0A 1RAMA 2CK0H 2HFFB 5GJTL 3N1QC 2C3WA 3D39B 1M4KA 2JF1A 4HFWB 3BKYL 4Y4KC 1U8OB 3BKYH 5D1ZC 1C7SA 4LVOC 3VWJD 3WDIA 1IAIH 4APQC 4E41B 4FABL 4QRQB 3FFCA 4FFVD 4YXHL 2J8UA 2RAMA 5F7MC 2NR6D 4HXBH 2KZWA 3BZFB 4MB4A 3ESVF 1MCHA 1MREH 4WWKD 1XCQA 2D9CA 5KSAC 4YHZL 4J6RL 1NC4B 4PJGB 4XP5H 4D0CB 8CGTA 4S1SH 2VQUA 5J9PA 5TDPA 2J8UF 4OD1L 5ESVB 4YGAB 5EZIH 1MHPL 4FZ8L 2F15A 2VNCA 5CS7A 1JGLL 4PJGE 2QHRL 3BPLC 2X9WA 1QSFD 4FXLA 1FLTX 5EUKA 2AQ3A 5ALBH 5T5NF 4FFVC 3RWCB 2KDGA 4R7NB 3QJFA 5INCA 4G6JH 1PFCA 4NN5B 3H9SB 4FQQB 3QPQD 3NIFE 3TNMB 1WWCA 3GSQB 3OXSB 3H42L 5ANMB 2RCSH 4PRIB 1LD9B 1QD0A 3PHOA 1NAML 1YMHB 1KELL 1KTLB 3C8KA 4OZ4B 4PRHD 4ZODA 4WO4B 5DJAA 3IDGB 3PWLB 1JF1A 3C2SA 3VFWA 5ITFA 1AH1A 1A3RL 1ODAA 5DD3L 5LAXB 1MFNA 1ZA3A 3AMLA 4XPBL 1M7IA 1ZA6A 1FG2B 1J1PH 4M48H 3UDWA 1KV3A 1NFDB 4AQ1B 1T6VN 3BESR 1FORH 2EH7H 1AR1C 4F37K 1D5IH 3BD4A 2NW3A 3HE7C 1UZ6F 2PW1A 4U1KB 1ZHNA 2QQQA 2VKWA 4F9LA 2AXFA 3N85H 5FYKE 3N85L 1OSZA 2JB5L 4KI5E 3B8YA 5ILTL 1N5YH 1MCPH 3MBXL 3HZMA 1HXMA 3NZ8B 4NO2B 3KDMA 3U7YH 5TE6H 1FFPB 5HHXL 3ZTJG 3L5HA 2P44B 2PYEE 3VA2C 4N8PA 4Y5VC 1S7RA 5ICYA 5AUMA 4L3EE 2DI7A 4YXLH 4UTBL 2HG5A 3B6SB 2CKNA 3TO4A 1IEBB 3ZE0F 4AEFA 5I8OL 2EO9A 1PVHA 3ZDXF 1HILB 4ETYA 5E8EB 3T65B 1DQQB 3QJHB 1J0YA 1G0XA 3V6OA 3RVUD 1XF5A 2HWZH 2IEPA 2JB6A 3WKNA 5CEYB 1WUNT 1XIWA 3DOSA 4HJGA 5HYSB 4N9OB 5J6GB 3MUJA 3WXVH 3OAUH 1FP5A 4LVOB 3PGDA 4NZDA 4HBCL 4XP6L 4CMMA 2AI0L 2EDHA 4OCMC 3KPMB 3MJ8A 1U41A 3ZHDA 3HC3H 3WHXB 4HIXH 4R7DA 2JCCB 3AFLA 1KUMA 3M8OL 5LG1A 2W91A 5DMJB 2DQCL 4XCFH 4CRPA 5IHLB 2NY0C 1HH6A 1T1YB 4YK4C 4GT7A 8FABA 5IKCB 1RIUL 1MCWM 4U1GC 1I1YA 2W0PA 4P5KB 3SGKA 1EO8L 4P23B 3TF7C 2VLKA 3RX5A 3CZJA 5DXWA 5HY9A 1MQKH 2B5IC 2BSRA 1KN4L 4HJJL 1I1FA 2OJEA 3U82B 4QXUH 3QXVA 4C83A 3VFOA 1C5CH 4QYOA 1WISA 4ODUB 3QHFL 2AKRB 3P30L 2GUOB 7FABH 4OZIF 1D6VL 1JZ4A 1YECH 4K71B 3FOMA 4I5BB 5I1EL 3AM8A 4GSDL 5C0CA 4KQ4L 5C08E 5IBTL 5FM4A 4W6WB 1SJEB 4IRSD 5TQ2L 4MS8D 1QA9B 4YXKL 3GIZH 4FQ1L 4OI7A 3VFSB 3QZWB 4YE4H 4C54A 3GMQA 3QB7C 4G5ZL 3LRHA 2AJXL 3DIFB 1ACYH 5BV7C 3W5MA 1YPZF 5JW3L 5LQBL 3QO1B 1YY8B 2HRPH 5FF6A 1MFAL 3X13B 4UZGA 4CVZB 2FECI 2A6DB 2NY1D 3OG6B 1FZMA 4FXGB 1QPPA 4HBCH 2O5XH 4KTYA 5BS0D 4U6TA 1G6RA 2JE8A 1W8OA 5C0JB 3QDJD 4O5LH 4QRTA 1S3KH 4JY4B 5CBEB 3C8HA 1YEGL 2XZCL 4OZGA 5D7LB 3VGAB 2PTUA 5K59E 4BM7A 1JWMA 4MD5B 3WD5L 1JNNH 4PJCE 3BUTA 3H8NA 5IROA 4X7TB 1KBGH 2F54B 3WEXA 4AY0A 1EGJL 3KNBB 4GQPH 5E8NB 4ODXA 5B8CC 1L0QA 4BSVA 4HK3N 1DBML 1UC6A 4P4RB 4MA7H 4K3DL 3CCHA 3NCFB 4ZXBB 5IW6A 2EKSA 1BF8A 5L9DL 2NXYD 3HC4L 1FQ9C 1UKQA 2FECL 4LNVA 4PUBH 4NC0B 2L0DA 1VFAA 5IF0B 1RZ8A 4D9QD 2NX5E 3ARWA 3ME0A 1RUMH 4N1CA 4F3FA 4YE4L 4Y2OA 2UUDK 2HKFH 1NJ9A 4PREA 3VFMB 1KLGA 5HDQH 3S98A 4BSWB 2GSIB 3ARGC 1JZ2A 4NPYA 5D1QD 5C3TA 5MERA 3HPLA 2YK1H 5JQ6L 4IHOB 2VH5L 1DQDL 4U6HB 3BAEL 5I1IH 4FQJL 4QRQA 3TN0A 3K46A 3RQ3A 1DBJL 2Z92B 1NDGA 1JNHA 1Y0LA 4FQIH 2CK0L 4NNPL 4TUJB 2BERA 4TULH 1RUPL 5HHME 5BW7A 1HWHB 2M2DA 4P3WA 1CK0H 4NQCB 4DN3L 3I9GH 1UH4A 3HZVA 5A43C 4Y89A 4PJ5E 4KGJA 5H2BB 1WC7B 3BZ4B 5CILL 3G5VB 2LVCA 3RKDC 4Z0BH 4NQED 5KVFL 5IB1A 1W72H 4P4KB 4A6YH 4OQTA 3IDYB 1G7LA 3TVMC 4XBEH 4M02A 1CL7H 5IROC 5D2LB 4FNLL 4KK5D 3FKUS 1CXIA 3L7FA 3ARED 2IPTH 4JM4L 3ZE1F 1HYRC 1FNFA 3QCTL 5CP3H 2V7NB 3D85A 2Y72A 1ZLSL 4FP8L 2XT1B 2XXMB 2DQIH 4NZTL 4U1LA 2DIJA 4QOKB 3V52H 2GTWA 4L4TA 3W81A 1A1OA 4YUEH 5HYJD 4XRCB 5DD0H 2GSGB 5DHYB 5ERWB 3HG1A 3MGOB 3RY4A 5IHZB 5I2IA 2EEBA 2A6KA 1H3XA 2APTA 4Y4HB 3VGBA 4MAUL 5D2NA 1CDIA 3GSNA 5T1MA 5F6IB 1Q1JL 1Q1JH 4MS8C 4HKBA 4XH2A 1W72A 3MRJB 2VWEC 3QDJE 4DGIH 2Q8AH 5EU7E 3P9LB 5BS0E 5EO0A 1A1NB 3MLRL 3L6FA 3K8MA 4IRJC 3T77A 3WIIH 5IEKB 3BO8A 5CSZA 4CN6A 5A2IH 1VFBB 5E94B 4XCEB 4JO3L 4NM8H 3AAZB 3U6RB 2F5AL 4X9HA 1H3VA 3U46A 1N0XH 4ZFFA 1T7WA 5CLTA 4B5EA 4RCAA 3EYUH 4LLVA 2BVYA 2YUWA 4U6YB 4PJ7E 4JO4L 5C07B 2WNGA 4LU5H 5IK3A 3Q5TA 3TO2A 1JPTH 5F8RC 3VWKC 1DZBA 4FQLH 1RK1A 2O5YL 3DURB 5KZCD 3QPXH 3BI9X 3CFDA 1E4XH 1QRNB 5EBLB 2RQ8A 4IEFB 2CLRB 3CPLB 2X9YA 5E2UL 4LPYA 1KPRA 4W4OA 1T5WA 2WWKO 5DURB 3QNZB 2X42A 4N5ED 1EBAA 2IAMB 3QUYD 4UAOC 1IE5A 1EHLL 2EC8A 1P4BL 3FO9B 5T1LA 1J12A 5IOPB 4GW5B 4M43H 4ZD3H 1HNGA 4WEBL 5TF1H 2BDNH 4NQEE 4WNQA 4P9HC 1FJ1B 4QXGL 1KEML 4P5KA 1S9YA 4WWKB 1KTDB 1AHWA 3DI2B 1NKRA 3RWFB 5DO2C 1D9KC 2ERJC 2VZ3A 5A3ID 1NCWH 3QWRD 4LBEA 2XZQH 4Z76B 5JPMB 3DHMA 3VXUE 3LKPB 4KI5F 4GG8B 4BKLA 5CIPB 3RKPA 4NQCE 2NY5C 4PJ8B 2HVKA 1E6OH 4OKVA 1OGAA 1VGKA 4PJXF 1MCOH 1OLZA 1ZT1A 1FE8L 4MJIA 4RAUA 3MRBB 4OLVH 3BZDA 1L7IL 4JG1H 1K5NB 4KV5E 1J8HD 2XTJB 2DWDB 1J1OL 5E99H 1QLRB 32C2A 4FG6D 3GSWB 4JRYB 3IKCB 4XNXL 3P0YL 5F21B 1FNAA 5TF0A 4LMQI 1TETH 4JHWH 1PG7X 4R4BB 1OGAE 3BIKB 2FO4B 5MHSE 3LN5A 1JPSH 1UG9A 4M1DH 4PRID 3RZCC 4OZGF 4HX1B 3VI4E 3V5HB 2V2TA 5TGBA 5IGXH 2BVOB 1UB6B 1OF2A 4P2OA 1U93A 3O0RL 4JKLA 4UT9L 3IF1A 5CP7B 4TOYL 2BFVH 1XF2B 4RX4D 2P8PB 1EX0A 1QSED 1AQDB 3MPCA 5I1LB 3U4EB 3WUZA 3FMGH 1U92B 3BPOB 1JPGA 3QNYB 3TBWB 4GMSL 5CMAA 4EJ1C 2HT2D 3D18B 4UNTA 2H2SC 3GSXB 3D3VA 3ULSB 1RUQL 2EZ0D 2X1WL 4LEOA 1BGXH 1K2DA 2VLJB 3TCLA 5D71L 2KH2B 1UGNA 1ZS8A 5J1AB 1LO5A 3WFEH 5B4MC 4HS8H 1A6AB 4I0KA 3DBXA 1BQUA 3ARBD 3DXAA 3G5ZB 2QADB 2B0SH 2HTLC 2R0LL 2ED7A 2WWMC 2E8YA 1QKZL 5INDA 1MHCA 1Q9KA 1ORSB 2DL2A 3MBEC 6CGTA 5KS9E 5AZ2H 1RULH 4XVJH 4CVXA 3MYJA 5DT1H 2Q87A 3VXSA 5F7FA 5F88B 4Z7OE 1HSAB 3D69A 2UZIL 3PWNB 3VI4F 1I85A 4JANA 3E6FB 1RZ8B 4DCQB 3HAEA 3NPZB 4Z7UE 1NC2D 4MXVF 3WFDH 3V0AC 2VZSA 1NAMB 1U91B 5DRWB 1T7ZA 2IH3B 2NXYC 5GJTH 4YQXL 3WLWC 3LEYL 1DUZB 2BNQD 5IQ9B 4DKDC 4JG0L 5GRUL 2XA3A 2PR4L 4OZIB 2N4IA 1T3FB 2AJZB 5DZOA 1TJGH 2YRLA 4OV6F 2CLZB 3VGGA 4XWGL 4LSUL 4ODSH 3ZE2F 5LWYH 2P5EE 3Q1SH 4X4ME 1RZKL 1ACZA 3FQNB 3HRZA 4PJEB 2E7CA 4MCYA 2YC1A 2BVEA 5EA0H 1KC5H 3I75A 1MCIA 3KPRA 4EN3A 1QHOA 2A1WL 3S36H 1NGXA 5T1LD 3G5YA 4HPYH 2YN5A 3HB3D 3TBVA 12E8L 1Q0XH 1X3DA 2X1QA 3GMNB 3I6KB 2CR6A 4BUHA 5BMFH 5DVKA 5HI3C 5CZVH 4Z95L 1YUHB 5D1XB 2R1WA 1RU9H 5JW4R 3HS0B 4XAWL 5F1IB 2BSSB 4UU9B 4WJ5A 4OF3A 3WUWA 3GMLB 5FDWB 2Y06L 5DD0L 4RISH 1FO0A 3G04B 3RNQB 3MCLL 3WJLA 1J8HA 3OXRA 4G8GA 1DVFA 4LSSL 4NRZB 3QIBA 1L9NA 2Y6SD 1MCEA 4I48A 1Y6MR 4WWKC 4P5TB 4XPBH 2F5BH 4NDMB 1I9JH 2DIAA 3RDTB 3VXNB 4MA8L 1OSPL 1DLHA 1U0QA 2VABA 5EC1B 3UYRL 3MACH 3KPSE 5KSAB 2FJGA 5DRNB 1FFOA 4YO0A 5C2UB 5B8CB 1TCRB 2A6KB 2ZOLA 4QHLA 5FK9A 5ILTH 4QRPE 4Z5RA 3KWWA 2H8PA 5E24E 2C4FT 5E8PA 1EERB 1HQ4B 3OKOA 4J8RA 2A83A 5BXFB 2QQKL 4OGAC 4UT7H 3TNNA 4NWTH 1C5BL 1D5XA 2ICWA 3KPSA 1C08A 1MF2L 4MNGA 4WW1B 5JOFA 3PXHA 1XGPB 4GXVH 2ILLA 1RZIB 2IANB 3MRFA 2QR0B 3FONB 4DEPC 1DJSA 4X9FA 3ZHKA 5I1JL 2WBJB 2EH8H 4UDTA 5GS1C 5FYKH 1ADQH 1A6VL 4ENED 3ARBA 4KUZH 2Q76A 4PFEA 5C0EB 4NYLB 3IDJA 4HAGA 4OUUA 5IFAH 2OS7A 3C5ZD 1TZHA 3F58L 4X4MA 3EOBA 3RPIB 2RCSL 4U1NA 2IALB 5IMMA 4NM4L 4MA1C 3C6LA 4YGVB 4GAGL 1MNUL 3P9MA 5D7KD 2VL5B 35C8L 4LNRA 1T4KA 4M8QA 1M71B 3I02B 3P3YA 4XHJC 4WFED 5C0GA 1KPRB 4BQCA 1J0JA 2QSCL 3KHOA 3TBSB 4ZPVA 4N0CD 2VLRB 4M7LL 5CZXC 3GO1H 3SO5A 4Q2ZA 3QUZA 5GRJL 4U3HA 3VFRB 1J86A 3HZYA 3O3DB 1V3JA 2HMIC 1XGTB 3GRWA 2QSTA 1OAQL 4HZAA 4DTGL 3T2NL 2HFEA 2QQLL 4B7IA 3FO2B 1MQKL 3RVTC 1IBGH 1BD2D 4XBGB 1KTRL 3JTSB 4OCYL 4YDVB 2BSRB 3WFBL 2F53D 2A6IA 5FHBH 5EOQL 5FOBB 2WLZA 3LKRA 2QSVA 2XPGB 5EIIA 1RIVL 2BDNL 4H1LA 1VGKB 1MJ8L 5IG7B 3GB7A 3WL9B 4X6EA 1NDMA 4Y5YC 1YN7A 1U8QA 4X83A 5FUZL 4X6DE 3TPUA 3MYZA 5MP6H 1WWBX 4ZO7A 5I8KL 4P46C 1MH5B 3LEVL 1T66D 4JQIL 3QJFB 1S7UB 3SDCB 4IJ3B 3T09A 5CD5C 4GMSH 1F6LL 4O2FA 4BK4A 1DVFC 2OLDA 5FO9A 3VXTA 5TH2B 5GS0L 3PWUB 4JRXD 5FA4B 1QSEA 3ZLQC 2I27N 2B4CL 4FRWA 1GXEA 4NQDB 2YSSB 4X7FC 4GG6A 3PQYB 1BZ9B 3H0TA 4FMKA 4GKNB 4R4FL 1CGXA 1CFTA 4Y19A 4DW2H 3CFIC 4R9HA 5L2KB 1BVLA 1DBJH 3EZJB 1G1YA 4M9PA 4DOHB 43CAA 5I76B 4TNWK 1FYTB 1ZT7B 5M94B 1F4AA 3PJSB 1NFDA 3PWPE 2BVUA 5CMAB 3PIQB 1MRCH 4S2SA 2X89D 4JQXC 1DUYB 1O0VA 4PV8A 2LAGB 1D6EA 1CU4L 4DOHE 5CKAA 2ADIB 5HGBB 5T5FH 5I1HH 4E5XB 2NXZD 1L0XA 4YFDB 5EZLB 3ULVD 2EE9A 5MHSD 2VAJA 4K8RH 2P5WA 3UTQB 3DTXA 2WIIA 1MLCB 4NQDD 3T4YB 4JG0H 5GRUH 4PUBL 4Y4FD 1I9IH 1FYHB 1R3JA 4NCDA 1OHQA 2A9NH 5MP6L 3QQ3B 3JBG7 3LVEA 1RUML 1P4IH 5I1DB 4TTDD 2R0LH 3VXQA 4HEME 2EIDA 4M7JL 2JIXD 3EYOB 3UMTA 2WV3A 1ACYL 5T1KA 4R2GD 1KLGB 2FBJH 1FVEB 1MCOL 1MFDH 1R3IL 4M9OA 2X1XR 4XC3H 1UKSA 2YR3A 5C0CE 5HHQA 4E42A 3EDJA 1I3GL 1MCQA 1U8KB 5HI4D 1INEH 4OZIA 4IHOA 3FCTB 5FYLE 4ETQB 1XZ0A 4KJYA 4G6MH 1Z0NA 2DLIA 4YDKH 4F33B 4PJ5A 2VRAA 3ZDXE 4OM0L 1VEMA 4LCCA 1R5IA 4FFWD 4TSAH 4CW1A 2H2PD 2W9DL 3V79C 2Z8WC 5HDOA 1GRWA 1JNNL 4RQQA 1HQRA 2XZAL 4NC2B 2D7PA 1FVCA 3I75B 2FRGP 3MRGA 5EU6D 4MHHI 3KYNA 1FLRL 3HZVB 5HHOD 3D3VD 1T89C 5GS2H 4OQTL 2HLAB 5EC2A 4Z0XA 3VD7A 3JWOC 2DBJA 2WZPD 1MREL 4J3TA 4RFEA 5ISZA 5TDNA 3M1BA 1ZVSB 4NO3B 1BD2A 1YJDC 3KPQB 1QSFA 3CDFA 1P2CA 3K1DA 4O00A 4GLRH 2WLYA 1OL0A 5GGSY 1UQSA 2J88L 5DQ9A 4WRLA 3K7UA 2EDDA 4M1GH 2QQNH 1BIIB 1JGEB 4HSQA 1LD9A 4M7JH 4M3KB 3ARZA 5ESAA 1YYMH 2R8SL 4YBLB 1J8HB 4KXZI 2MKWA 1K4CB 2HKHL 1FIEA 3KXFE 5E1AA 2OYPA 3GMQB 1WWAX 4Z7UF 5J7CC 3GUTA 3S5LG 1H5BB 1MCPL 1S7TB 1RMFH 5I75C 4ZFOL 3P4LA 4N8CH 4Z7QE 4PRHE 5ACZA 4L29A 3EW3B 2EDOA 5SWZD 3WFDL 1UEMA 2X4UB 3X11A 4HT1L 3OKEA 3SBWA 4UQ2B 4UT6L 3MCLH 2PF6A 2X4RA 5DRNA 5BRZD 5C0JA 2GTZB 4F2MB 3AC0A 4TVPE 5SWZA 4CKVX 1HXMB 3TN0D 2V2WB 4RSVA 4JDTL 3DROA 1OSPH 2VXTH 1WV7T 2VO5A 1HHKA 3SCMB 5EO0B 3LMJH 1J1XH 1YYLL 3ZKND 3V7AE 4GRLD 1CE6A 5DJDB 1JZ6A 1YNTB 5L88H 5CJXC 3PV7A 4NM4H 3CXHJ 1CIUA 3MXWH 4D8PB 1FRGL 3W0WA 2VIRB 4HF5L 3LQAH 3LKNA 3WHE0 4PJAE 4K3EH 5GGUB 1G7QB 1RHHA 2BX5A 4FHBD 4UT7L 3W11C 4K8RD 4G7YH 1D9KB 3VXMA 4YNYA 1WZKA 3P0YH 3PG2A 4WDIB 3GMOA 4IOIB 2DMCA 4LIQE 4YHLH 3DX7A 1JPTL 4ZUSB 1MFEL 3P4OB 2DQHH 4ZS7H 5JTWA 4ALAL 3TZVB 3BP4A 5DEGB 4FTVD 4F3FB 1HDMB 1ND0A 1T4KB 2B1AL 4NC1E 1FG9C 1GOHA 2EIZB 4X0KB 5KVGH 1DBKL 1NGYA 4QWWC 4LHUG 4RIRA 3WHXA 3G9VA 3L3HB 2NY6C 3QG7L 3K4AA 3ULVH 1RQ5A 4NPYB 4YUEL 3VRJA 2EDRA 2IQ9L 1YDPB 3FHAA 1MCFA 5EO9B 3G08B 5C0IB 3QDJB 2D03H 3T8XA 1W0VB 2AEPL 3N1FC 1D6VH 1R5VB 5L2KE 3MV9E 1AY1H 1XH3A 4CNIA 2F53E 4HMEA 3ARDB 4TSBH 5C9JB 3BW9A 1IKFL 4K2UL 2Y1VA 2B0SL 2CUIA 4NWUL 1FBIH 2C9AA 3DX6B 4Z7VE 5TFSH 1JHTB 3L5JA 3MUY1 2GAZA 2AV1A 4UIMA 3LB6D 5DJCA 2AKRA 1OGTA 43C9A 3PP3K 4XGZB 1FE8H 4MJIB 3BH9A 3FB8A 4RAUB 3QIUD 1N5AA 5T5NG 1YN7B 3F7VA 3RBGA 1IT9L 3KPRE 4JFPA 4Z8FL 3PE9A 5F6IC 2OBGA 1F4WH 3IXAB 1IM9D 1A7QH 3HC0A 1EIBA 2ADGA 1CZ8H 1CD8A 4TSCL 3K3QA 3DUSA 3CNKA 4OFVA 5FYJE 2YRZA 4HIEB 4M5ZH 5TH2A 3SE4C 1Z2KA 1R24B 4JO1H 2ZUSA 5C2BL 4JFYB 4GG6B 2V7NA 1INDL 2C1OB 3FT4B 2K9UA 2IQAB 5DD5L 1D9KD 5LAXA 3CAFA 5DK2B 1JCKA 1P6AB 3FFDA 3VFNA 3EFFA 4MD4B 4GRWF 2CDEB 1M05A 1XF3B 1J0IA 1NMAH 4QRSA 5SWQB 1H3GA 1ZHNB 1GVIA 2WUCH 3L3OA 3BP7A 4JZJA 3BT2L 3NFNA 1JN6B 3L7EB 3V4VH 2Y7QA 1N6QL 2D31A 4P4KC 3PDGA 1IGTA 3F65A 4WI6A 1JF5A 3FAXA 2P5WD 3C09C 3C5JB 3P11H 3RL2A 4XH2B 1H8OA 2YUVA 5I8EA 1MRCL 4GMTH 1I3VA 3TJHD 1AJ7L 4XAKD 5BQ7A 1AJ7H 4OBSA 3CXHK 4NGHL 2CK2A 1GHFL 4CGTA 4P9HL 1I75A 1RK0B 1PYWA 1MRFH 5IW1A 3TIEB 3VMNA 3MRQB 3MLZL 4X5LA 2VZ1A 5H37H 2XICA 5IMLA 2FL5B 1U8MA 1HILA 4HS6B 3ZO0A 3U7AA 3PL6B 1YECL 5M7QA 1OAZL 4GFTB 5I74B 5DMIH 2H26A 4Q9RH 4JPWH 5MERB 3AUVA 4L8SB 3L3GB 3TEUA 2EECA 2AJZA 1RFDH 3JV5A 5CWSA 5HPMB 1FHGA 4L9LC 1NBVL 2VAAB 4M00A 3IDXH 1V5JA 3BZFA 4M4PA 5D70L 2LVEA 4H8WL 3VFTA 4FA8A 1RZFH 2YC1B 3ARFC 4PRHA 4XPAH 4KKLC 2P5ED 1HH6B 1T1YA 5HSFA 4M3JA 4EN3B 3TBTA 1GH7A 5DTFA 1A2YA 1MF2H 2XIDA 3CD4A 4QRPB 4X4XA 4WCYL 2PYEA 1QACA 3KJ4B 4J1UB 1S3KL 1IL1B 5D7SH 4IOFC 1G9ML 3UTSE 2F53B 1LGVA 1S7WB 1ADQL 4X8JB 1OW0A 1BD2B 1B90A 5IJKC 4HV8B 3KPQA 1UWGH 1FN4A 4R7NA 2Q7YB 3QDME 1UXSA 5E2WL 3RY5A 4XNMA 4N8VB 2EKJA 2NY2C 2ZSVB 1FL5A 1FVDA 1ZHLA 2AK4B 4I0PB 3SKJH 1XCTB 1AR1D 2F74A 5DR5L 3HMWL 2GCYB 3D0LA 3LCYA 3TZVD 3MA7A 1BQSA 3REWA 2FYYA 1QR4A 3B5TA 1DQTA 3FAWA 3QA3A 1G7PB 5IIEB 4JVPA 4BQ9A 4HULB 1QA9A 5CFHA 3RVVC 5BVPH 1VKXB 2ICWJ 4R2GB 5A2KH 3ULUD 3QWQB 4Z6AT 3VDCA 4JB9L 3N9GL 4AT6B 4QXTB 4X6FB 3C6SA 4XBEL 1CCZA 3ZYJA 3MV7D 1U93B 3SE8H 3MOAH 5HBBA 5EFIB 1XAUA 3QCTH 4PV9A 4JO2H 3MGOA 5IHZA 2IG2L 3PABA 4Q0XH 5GGVY 5K9OB 1DEEB 2G5RA 4QRTB 2R39A 3HMXH 1YEHL 1WAAF 2N1KA 4LPTA 1DE4A 4WFFD 1ZSDB 4AL8L 12E8H 1YEDB 3F7YB 3R0MA 4G7VH 4LLWA 5ETUB 3WEXB 2GY5A 3B3IB 5AWNH 2J3SA 1JGVH 2EDLA 3V8OA 1T83C 2XZAH 4ZFOA 3WJLC 2I25N 5FGRA 5EBGA 3QI9D 3ARFA 3MRMA 3VRIA 3U48A 2HT4C 4NKMB 1K6QH 2FR4B 5E6IA 4UQ3B 5IFAL 2DQFB 4WDIA 1GC1C 1AGCB 1EEQA 1E4WL 3OKYA 1NL0L 4PJGF 2G9HB 2PETA 3P4OA 3BD5A 4ZTPL 3IFNH 5C0RH 4M6ML 5IJVB 1KCSH 1OP9A 2APBA 4JFED 1CICD 1LP9A 1EO5A 4ZUVB 3WO4C 2Q3AA 4XBPA 2E3VA 2FX9L 3FN9A 1MAMH 2V2XA 2CKBL 2DYPD 4JKPL 2OTWB 3I50L 3OX8A 4GXUM 1YDPA 4OKDA 4UTAH 4RMTA 4RRPA 4LSPL 2VDNL 3MOQA 1NMBL 4OAWA 4I18B 4OB5L 5EBWA 3QUMB 1GGIH 4RX4A 1JPFB 3F62A 4DTGH 4C55A 4EQ2A 3ARDA 2WM0A 4OLZL 2QQKH 4L3EA 3RWJB 3MRRA 4YDVA 2ZUQB 4WI2A 4QKXB 2N56A 5F6HI 3BRDA 3SCMD 5KVDL 2P4AB 3OJMB 1HCVA 2XI9A 4LPVA 1OGAB 2A0LC 2VXUH 1OGTB 1IAII 1A7RL 2QEJA 3G5VA 4XVSH 4L9DA 1OB1B 3H6JA 4XPGL 4UNUA 3TPUB 4QHMA 4IRZH 1P84J 4HZLB 5KZCB 3AS3A 1FV1B 5TFSL 3DIFA 3BQUC 5E9DE 3SEPA 5JOPD 2X70A 1FNLA 2PYFA 5HDLA 5GS0H 3ABZA 4MMXC 4G8FA 3SDAB 1KTLA 3C8KB 3G6DL 2APVA 1JK8B 1NKOA 4P5MA 2BVQA 4AEEA 3C8DA 2P8PA 2HJKB 4G6ML 2VLJE 4DKFL 4KROD 3EOAB 1XF1A 2AW2A 4DKEL 2D0HA 1IC7H 1X5GA 2XTJC 1XGUB 4XMLL 5TE4L 3LPWA 2NLJB 3O11A 2VABB 5GGSA 4X80H 1G7HB 3MR9B 1HYSC 4YIQA 1GHFH 1O7SA 1PDKA 3A6BH 2NY2D 4QF1A 4QTHA 3ARTA 5HI4C 1OSZB 3D2UA 5HGBA 1DL7L 3ES6A 3QUZD 2IQ9H 1KJVA 4NN6B 2OZ4L 3CUPB 5E8PB 2XY1A 4NO0B 2DYPB 5EWIH 3NTCL 5INDB 3W0WD 1J05B 3QHFH 3WFHA 2R1XB 3JV0A 2V17H 1FFPA 5BV7L 1GIGH 1M6OB 1W0YT 2C5DC 4N0YH 1HKFA 1XR8A 2B7DT 3GM0A 5FYJU 5C0FA 3BRFA 3B2VL 5EZOH 5AUMB 2J5LB 4N5EC 5BOPA 5ACMA 2C4FU 4DWHA 3ULUL 4TN9A 3U1SL 4ZYKA 2QKIB 2PN5A 4WEUD 1CGVA 1P69B 5LCVH 1MELA 1WTLA 5DUPH 3V0WL 4LLVB 1U3HA 5T1KB 3WNLA 1JYWA 4ZQKA 4BZ1H 1YA5A 1UM5L 2BRRH 3V7MA 3FO0L 4XTRC 4L5FL 1HH9A 5HGGS 4XMPH 4E42B 5DLML 1WCBB 4JQXA 3KLSA 4P2QB 2V5MA 3G9AB 2ZUYA 3LPGA 1A0QL 2HT3C 5ALCL 5B39B 3QFJD 4U7SA 3MJ9H 2J5LC 3VWKA 4FZ8H 4PJ5B 4PGZA 3OPZH 4OM0H 2D0GA 2RHEA 1CE1H 4HWBH 3VFTB 1N64L 2R0KH 4Z7WA 4ZPVB 5FA3A 4JDZA 4J3XA 4WUUD 5ALBL 3IGAB 1NCNA 3ZKXC 5DJXA 2KL6A 5C0BE 1CG9A 2CR3A 1WF5A 4BK5A 1R0AH 2OI9C 2HLAA 4JFEE 3LQZA 2XN9D 3QO0B 4EQ3A 1BX2B 1E4JA 3QT2A 4JFZL 2AJSH 3B5GA 4RFEB 1Q9WA 5TDNB 1KCVH 5ISZB 1F6AA 1KCVL 4NP4L 2XQBL 1SYSA 3CFEA 1J7VR 2IAND 3VGEA 4Z76A 3ZDYF 4LSTL 1I7RB 4W6YB 5EN2B 5C0BD 1WZ1L 1TZGH 3I6LD 1X5AA 2Y5EA 4JB9H 1ZHKB 5DUML 3PUCA 3KPPB 5SV3A 5F7KC 2R15A 3QDGA 1IGFH 1G7JA 1CL7L 4NN7B 1KLUA 4QY8A 1AGEA 3VH8G 1JP5A 3GMLA 4QOKE 4WWID 1BZQK 5L8JB 5GRYA 1LMKA 3SDAC 4O51A 3GSWA 3GGWB 4HGWA 1Q94B 3QZWA 1JUFA 5DJ0B 1MH5A 1HXYA 1AD9A 2OI9B 4KRMB 3GSVB 3NIGE 4DZBA 3LN5B 1CFVH 2ITCA 2F19H 3RWIA 5D7JA 4OGYH 2UZIH 1HINL 1GGYA 2I60H 1Z3GL 3W11D 4O2FB 5F70A 4QOKA 2HP4A 1UJ3C 4P4KD 2ZUUA 3U7YL 1AQKH 4V1DE 5MEOB 3NPSC 5E4EC 4Z78B 3VWJA 5EU5A 1L7TL 2DTSA 4KK9C 5IHBA 2VLLA 5GXBB 2CGRL 2W07A 4PV9B 5MENA 4NQVB 2ZOKA 3SKOB 5KG9A 1EO7A 2HN7A 4O9HH 1T66C 1F4XH 4UOW1 1R6VA 4Z7OF 2L7UA 5C8JB 5HYJA 5DFVC 1JI2A 2CH8A 5CP3A 5DJ8B 1C08B 3MOBL 1UZ8A 4XCYA 1A6UL 4OF7A 2OQJB 2NY7L 3DHJA 4G8EB 3KS0J 4NM8L 1QFUL 5DDHB 4P2RD 4F7CA 3LQAL 4JRYE 4HF5H 2DQJH 1NLDH 3B2UC 1GZQB 3MLYL 1T0NA 2ZG3A 4P5TC 4OLUL 4Z18A 3KXFA 2BSTB 3OG4B 2FGWL 2FSEB 4OD3H 1U3JA 5DVLA 3O3EA 4F8QA 4KV5F 3WKMH 3RAJH 3EGSA 3C6LB 2XKUA 4JANB 1DQMH 3RTQB 5E2VH 4BYHA 4UBDD 4YDJB 3VXQB 3EO1B 5L7XH 1X5ZA 3H9SD 3LB6C 1CGSL 2NR6C 5E2WH 2QQLH 4MJID 4P57A 4PJEE 3HB3C 5D7IF 5SWSD 4BFEA 5E2UH 1NGYB 1UADC 4F9LC 1QLFB 5C0GB 1D5BB 1GGBL 3WIFB 3LV3B 4OLXH 5J12C 4OLXL 1E4WH 4NZJA 3LKOA 4QXUL 4JPKH 4PP1D 3BN9D 3QDJA 2OL3L 3T8XB 1T5XA 4Y19E 3LIZH 4AH2B 2Z31D 4D94A 4CNIB 1BHGA 1R5IB 4LRIC 4LPWA 5H37G 4HWEL 2XFXA 3W9DB 1FC2D 4P3DB 4UMGA 3BIBX 4HAFA 1LK3L 4PGEB 4PJHB 1GGTA 2QTEA 3GSUA 2OP4L 4NFCA 2X7LA 2R4RH 4OZHB 1ZT1B 3NABH 1INQA 1X4ZA 2IC2A 4CUCA 4MXWL 3I6KA 3MV8A 2B4CH 1MEXH 1A5FH 1OAXH 1A5FL 5IQ7L 1PX4A 1PAMA 3MLUH 5H94B 4GW1A 4LQFH 4RWHA 4PJFE 3SN6N 4R4BA 4N68A 2CMRL 4FQLL 2DJ4A 4NKDA 1H3WM 5I19H 1NBYB 5E2VL 2YKLL 3LPFA 4BH7B 3PHOB 4JRYD 1S7VB 5I8OH 4Q9RL 1WITA 2EYTA 4TOYH 3VFOB 3LQMA 1XFPA 4I3RL 3RFZC 1BLNB 1GGBH 3A0OA 5D1QA 2CD0A 4RMQA 4NDMA 2NY4D 4J4PC 5IWLC 5T1DH 1S7TA 1JPGB 3QNYA 2V6HA 4JHBA 4J2XA 3UPRA 5D7JD 4ONFH 3EYSL 5J1TC 2ZKHH 3M17A 2GSGA 4WU5A 4M03A 2FJGB 4XPFH 4NKOA 1ZXQA 2XG5A 4YHIB 3HG1D 1YEKH 4UDUB 4HUXB 3THML 3QUXB 5DFTA 4M7LH 1F3DJ 3DRQA 3MJ9A 3QYCA 1SVCP 1WIPA 2OP4H 4OB5H 3WFHB 1T6WA 3D87B 2BRQA 1T7YA 1OAQH 2QR0A 2R9HD 4KHTL 2R0ZL 2E6PA 3F5WB 2COQA 4N0CC 3QIBC 2HFGH 2H3NB 4POZD 5IP4A 1ERNA 2YBRA 3EYOA 4TUKH 4LP4A 2APFA 3SGEI 1CZ8L 4GRWB 3UJTH 2XG4A 3GKWL 2BXZA 1I7UA 4YHNB 1B4JH 4JJHA 4M5ZL 4XXCC 5DMIL 1JNJA 3PDOB 4ZUSA 5DURD 1CK0L 4X5XB 2PR4H 1EJOH 4DN3H 2J2ZA 1U8KA 3PWPA 3S4SG 4NHCH 1T3FA 2EKSB 2DM4A 4FFYL 2FEDD 2O26U 4OFPA 2DMKA 2FX8L 1TENA 1KPUB 4S1DC 5HDQL 3UC0H 1KGCE 2HLFD 2DBLL 4DVRH 3C2AH 4JN2A 3OGCA 4XVUD 1XGQA 3IGAA 4UUJB 2O5XL 3QUZB 4RBPH 1MFCL 3PGFL 2FWOB 3FRPG 5GSVB 1I3RA 5IM7A 1B9ZA 4M1CD 4F7EA 1N6QH 1VEOA 4UIKH 3VXUD 3IDYC 3CDGB 1IL1A 4L1HA 4YEFA 4PRPB 1U8OA 2XN9B 2LU7A 5J1SC 5F9AC 1S7WA 5C0BA 4HUWA 3JV4A 1EVUA 4JFDA 1E4XI 2PCPA 4NGHH 4MCZA 2AJVL 5DT1L 1YJDH 1TQCC 3UX9B 3D25B 4EVNB 5C0AE 5I1HL 4LRNL 5DR5H 4ZO9A 3CK0L 4PD4K 2F74B 5ACLA 3L9RA 2Q3ZA 4MYWB 3QDAA 3SDXB 1NL0H 3VMPA 2DWDA 1X5LA 5DSCB 4P48A 5FGBA 2PW2A 3N06B 5ESVA 3OV6A 5DWUL 4WI3A 5C0AB 1U3HD 1I9JL 3FN0L 2SEBA 1B0WA 3SDCA 2J88H 5HYIA 2EDBA 4HX1A 4X6FA 4OGAD 5FO9B 3A6CH 5DJ2A 1F45A 2XKNA 5FO7A 5FDYA 5GGQL 4CVZA 3S35X 4KQ3H 1OAYH 2IPTL 3IF1B 5CP7A 3Q1SL 5CINH 4JVUA 5D70H 1NLBL 3SDYL 1YNKL 1EAPB 3CDYA 1YN6A 4AMKH 2I60L 4MDJA 4QNPE 1TMCB 4FZEL 3UP1A 3MLYH 3HE7A 1TTUA 4NRXB 1JIBA 4MNGB 5IB4A 3ULSA 1HE7A 3STZA 3O81A 1HZHH 1ITCA 4LCIH 1JN6A 2F8VA 1T1ZB 3D6GA 4M6NH 3I9GL 1BPVA 4NIKB 4YPGA 2VJXA 5DRXB 4AZ8A 1IEAA 5SX5K 4ELMA 1AD0B 4UQ3A 4O4YH 1ZVHA 4HGKC 2Y9RT 4LRNH 5CIPH 3MUHL 1ZANL 3QG7H 2XRAH 2CPCA 1AGFB 2CKBA 4JVWA 2HFTA 2RB8A 1RK0A 3SJVB 2CIKA 4YHYC 4GKOA 4KJWD 1QEWB 4MD0A 3PXJA 1G9MC 2AEPH 4M6MH 2A0LD 2VL5A 3IVKA 1HDMA 3WE6B 4M5YH 1LNUA 3VGAC 5I1AB 1PZ5B 1NGZA 4V1DD 4X99B 3I02A 4OI9A 4BSJA 1MJ7H 3O4LE 3MRDA 3LKOB 3FQUB 4PJEF 5D7IE 3TLRA 5CINL 4GBXD 1RIUH 4H0HB 5IESH 5HPMA 3E1F1 3MLXL 5DYOB 1UWXK 4G9DB 1XF5B 3TN0B 1EO8H 2ZUVA 4EBQH 4YDLB 1Z9LA 5E70A 3QIBD 5C9KA 4X7DC 3S6CA 4AM0A 3QPQC 2DICA 5C09A 2AQ1A 4MHHG 3MV9D 3PGDB 5L2KD 4PGDA 3S97C 2Y36H 1NCCH 2MMXA 2BHYA 3OF6D 2P24B 4QRPA 1I8LC 1S9WA 1BOGB 1NGPL 2BFVL 2CIIA 4XPGH 1IAMA 4QO1A 2MOVA 3U1SH 3GK8H 1F5WA 2W65A 2PTTA 3FOLB 2AJXH 1KTDA 3EYQC 3QAZC 1HOCA 2IADB 1UA6H 3RWFA 4WUUE 3QRFM 4YHKL 4F7PA 1UM5H 2BRRL 2JELH 3LY6A 1J5OH 2DTML 2R29L 4Z7UA 2DQUH 2AJYH 4FQHB 1S7VA 4E41E 4WI4A 2MFNA 2XACC 1KT2A 4G8GD 3RA7H 2XWTB 5ELIA 2O61A 3P11L 4D9QE 3UYPA 2D4DA 4HIIB 2XKSA 4JFQA 5EC1A 4N0UB 4LCWB 5JLZA 4PS4H 4XVJL 3A6BL 2D3VA 1EGJH 5KSVB 3D2UB 3ULVL 2EYSB 4KJPC 2UUDH 1KXTB 4M61B 1HWGB 3B9KD 4FFZL 5DD1L 6FABL 1N8ZA 1C5CL 4J8RB 5BXFA 5I8EB 4OTXL 1JTTA 4WO4A 5DJAB 3DRTA 5D93C 3TBYB 5L9DH 3DX8B 1AHWC 1DR9A 4HHAA 5C1MB 4XNUH 4Z7NF 2WQRA 4EUPA 1EMTL 5M95B 1ZA6B 1QLEH 4WUKL 4QXWA 3BOVA 4IMKC 2FATL 2LTQC 1DDHB 2R2BA 5H8DA 4D8PA 5I1KH 5AEAA 3V0WH 4X7TA 4P0DA 3K74B 1J9CT 1A4JA 3D48R 5IR1B 5E6IB 4JLRA 2WWMD 1ONQB 5IK3B 5HHQB 1N7MH 2RJMA 2R0ZH 4JFXB 1CFQA 2J8OA 2VLJD 4LFHG 4ETQA 1ORSA 3VG0L 4POZC 1HHHA 2GJ6A 5DS8A 1A6WH 2ARWA 4YDKL 5KANI 3UCRA 4WFHD 3VWKB 3DUUB 5CCKL 4LCCB 5DUBB 1G1CA 4NJ9H 1OTSD 3EYVA 5EUOF 2CRYA 3V6ZA 5LGKA 1XMWA 4Z7WB 4LSVH 4KKBC 2Q20A 1KB5A 3HNTH 2NY6D 4WW2C 4F80A 5FKPB 1I8MA 1YC8A 4FS0A 4LSUH 1IGIL 3MX0A 5I15H 3ZTNL 1OT2A 3LQZB 3QEUB 2OZ4H 2ZUTA 4PGBB 4GRMB 3NTCH 2I26N 4L8DA 3M1BB 4L9LB 5IBUG 4PJXE 3V4PL 4HUWB 4HV8A 1LHZA 1XGYH 1WIUA 3PGFH 1MFCH 4U05A 4QHKJ 4IDJL 3MV9A 4YBQC 3D25A 5FYLD 5LBSL 4MAYB 3GB7B 3WL9A 2R4SL 5ICZB 4M1GL 3DO7B 4MJ6A 3V7AG 2KPNA 4NQCA 1FGNH 3LRSA 5DEFB 4UV7H 4LSQH 2HKHH 4YAQB 4KKAC 2EDXA 2BJML 1YMMA 2PW2B 1ZLSH 2VZOA 1AO7A 1N7ML 4IJ3C 3R06A 3CFJB 4NQSB 1MJUL 3TN0C 3TH3T 1RUKH 3QCVL 2YA2A 3U9PH 5FO7B 1K4DB 1VEPA 2YHGA 4HQQH 4UV4L 4I9WD 5CEZE 1G9NH 5CCKH 1ZWIB 3S37X 4CMHC 3INUH 5D72L 4TSAL 2HJKA 2G60H 4Q58C 1F6FB 5KG9B 4R97C 2W9DH 3GSQA 5ANMA 5T1KD 3IDNB 1U95A 3V95A 4WFHE 4JHAL 1IGJA 2YUXA 3G04A 1SJEA 3RIAK 2PO6B 5AG9A 3SDDC 5GGSB 5LGJA 4KQ3L 3MLWL 4A2LA 1EAJA 3EDFA 3ULUF 1TQBC 3KR3H 2MCG1 3Q5YA 4X6BA 1RZFL 3E6HA 5J3HC 3DBXB 3DJ9A 4DVBA 3MRCB 4L4TB 1KJVB 1RZGB 1N0XL 4NO0A 3DMMB 3K2UH 4EZMA 4KI5D 3WJJC 2W60B 3X14B 3OKMA 1IEAB 2A2QT 3GMMA 5HHXH 3UTQA 3T0WA 5JW4Q 4WTZA 5E9DB 4O2CA 3V8CA 4F7TB 4Z5RB 4LCIL 1A9EB 4LSPH 5D1XD 5CKGA 1ZVYA 3MODL 4HJ0D 4DCQA 5D7LD 2MQ0A 4NSKA 4B41A 4PJFB 3BP6A 1CGSH 2V7HA 4CU6A 3WS3B 1U91A 1NCAH 1MQ8A 1RMFL 4ZQKB 3BPCA 3IJSB 4XCEA 5IVZB 3PWJB 4GAJH 3BKJH 2YD7A 4JAMA 2Y06H 3AY4A 5E2TL 3FQUA 3LS4H 4FMFA 4KVCL 3QXAA 5HYJE 1AIFA 3UAJD 4K55A 4RFOL 5E8EA 5F9OH 3T65A 2E7LA 2VXQH 3TH4T 3QUMA 5JNYA 3H9HA 4G9DA 3EUUA 3FB6A 2ORBH 3GI9L 5T3XL 5KS9A 1Y18A 1CTOA 2JB6B 2WBJC 2GIYA 4N0FB 1OARH 4KXZH 4PLJD 3CLEL 3KYMA 1PY9A 4HIXL 3TVMD 5DMKB 5D7IA 1MVUA 1IKFH 3C9NB 4K2UH 3W9DA 4JDZB 3DSFH 1QRNA 4UINL 3S34H 5MEND 1IGYA 3RVVD 3KPMA 3MJ8B 4WV1B 1NLBH 3UTZA 3TM6A 2P5EB 5FM5O 3RY6A 1WIOA 4MB5A 1KENL 5K9QI 3FB8B 2MKLC 3QZWG 1P7HL 2O93L 4MXWH 4GW5A 4OCYH 2V5RA 2O5ZH 3KJ4C 5L8KB 1A4KA 1S9YB 4K3JH 2ADGB 1P2CB 2WBJD 3UJJH 4GG6E 4P23A 1UXSB 2EZ0C 4OCSH 1AGDA 3DX9A 4QNPF 5HD8C 4PY8J 5IVOA 1JRHI 5C7XH 1J0HA 1A6VH 4PP1C 2HRLA 2D7OA 3RI5F 2FZ3A 3STBA 4G8FB 3S37H 2AABH 3C5ZB 2ADJA 1LVEA 3QH3B 1G0DA 5I8KH 3CFCH 5GGTA 5EOTB 3SE3A 4G9FD 4K8RC 3DGGB 4ZAKC 3QIWC 1OT1A 4YHPA 5T3ZH 1UWXH 4PJIE 1T04A 1QFWH 4JN1H 1F42A 1DANU 3F7PC 2GY7B 4PJAA 1KCSL 1BGXL 4N1EA 1EHXA 4Z78A 4LVNB 1T0MB 2DDQL 5EU5B 5I18L 1VACB 4QF1B 4QTHB 1DSFL 2UY7A 5CGYC 1B4RA 2FIKA 2FJFA 3VI3E 5JPNA 5SWSB 4QHLB 3MV11 2DQCH 1UB6A 3G6AA 5GJSH 4DUVA 4H26B 4LSRL 4PB9H 3IB4A 5E5MA 3LQAC 4ZSOA 3RL1A 4X6CB 3DRTB 4K23H 3JWDL 4YR6A 3NABL 1RULL 5BZWB 1KCUH 1KCUL 4RMSA 5ETUA 1DQLH 4XNZB 2ICCA 3WHE1 4RWYH 3WJJA 4TUOB 2WBKA 4QRPD 3AXLA 3BVNB 3TC9A 3OAYK 3O6MH 1FGVL 4KVNH 5KW9H 3HE6A 4PD4J 3SE9H 4FQXB 3WNKA 4XX1E 4M93C 5D6DA 3NIGF 3P77B 1TETL 3NA9L 5DFVD 3I2CL 4OQ1A 1HHJA 3AY4C 1JF6A 4OUUB 3HG1B 1OAKL 2AXFB 4YNYB 5FUOH 5C86A 3CXDL 2WP3T 1JNLH 1AGCA 4XNUL 2MCPH 4U1NB 1II4E 3MMEA 5E7BA 4XPHL 3O0RH 2AK4D 2GITA 4GAFB 1CD0A 3B5HA 4RGOL 4YGVA 1V7MH 4DZ8A 3EO1A 1KCRL 3WBDA 5HHNB 5FYKU 3MLSH 4ODSL 1ZK9A 3D1MC 3T77B 4Z7WF 2C1PB 1KPUA 3QCUH 4ENEC 4Y19D 2D9QB 4RIRB 5JXAH 1BWMA 5E94A 3GSRA 4K94L 3V6ZB 1FFNA 3BH8B 3WMSA 5I1DA 4HUUB 3B9AA 4ZAKD 1TLKA 3MRIB 5BS0B 2VZTA 4ODHH 1NAMA 1WEJH 3TBTB 1BBDL 1CF8L 2BNUB 4Z7VA 2CQVA 2QQNL 1TJIL 2CUHA 3OKNB 5HYQA 1OVZA 5AD0A 5F44A 1TVBA 4R90L 2A74A 5LGHL 4JZOA 4U6HA 4H1LG 1CD1B 3BEWB 1CDBA 3MROB 3ARGB 3FFCB 1C16B 1K9TA 1MIML 3GKZA 4MMZC 5J0BA 2Z92A 4M7KH 3ZKMD 3KPPA 4BH8B 5F3BB 1AO7E 3O6ML 4OZHA 3AGVA 3WFCL 4EN3D 4OI8A 3T1FB 4MJ6B 3BD3A 4Z7NE 4QT5A 2OMBA 4OZIE 5IW3A 3GGWA 4W81A 3MGTA 4YAQA 1Q94A 3C60A 5F71A 4H8WC 4K3GA 5H2BA 5F9WC 3MV01 4UI2A 5TDOB 3CFJA 3ECBA 5F9WB 1QBBA 1JMZA 4OLEA 3OJDB 1PD6A 4EI6A 1A6TB 1OAUH 4BZYA 1FH5H 4P4KA 4QYOB 3LN4A 5JXEC 4P5MB 5LVEA 3TYGH 4NQDA 4OZFH 5GPRA 2FHCA 3TYGL 4NQXA 1MFDL 3FB7B 4X6DF 3MBED 3CFKB 2IG2H 2XXCB 3LSOA 2IQAA 1A9BA 1CFBA 3PL6D 4YJZL 2P7TA 1N5YL 4PRIA 4XP5L 5FDWA 5I76A 3FRPA 2G5BB 1WAAA 5ESAB 4KROC 4AL8H 2PO6A 1M05B 3ZE2E 4M6AA 3CVHA 4XI5D 3RJQB 1D6EB 2FEEI 4UT6H 2XA8H 1M7IB 4Z7QF 3WKML 5IFHH 3QO1A 4AIZA 2Z91B 1QUNA 3MODH 3E6HB 1QBAA 5D93B 3SE3C 3U0TA 1UWEL 2RFXB 4J4PD 1UWEH 4EIGB 3RL2B 1XF2A 4U1KA 4POUB 5BO1H 3LEXA 1T0NB 2R1XA 5CZKA 4ELMB 1EFXB 5HXMA 3GEWB 3SKJL 1CFNB 4LGRB 5I16B 1JV5A 3MLRH 1IGML 2OR8A 3V9FA 5CBEA 3QXUA 3WNPA 3BGMA 4RISL 4WY7L 1ES0A 1QBMH 4ZTPH 3QI9B 35C8H 5GSRA 2H32B 1QVOB 5E6ID 4HH8A 1H3PH 4ELME 4HWNA 1HIML 3ULVC 4CJ1A 1PZ5A 3HG1E 1VENA 4HPOH 1D5BA 1MSPA 3HUJA 4LU5L 4M8VA 3A6CL 4OBRA 4IS6A 3O6FA 2VN7A 4Q6IB 5HHVH 1OAUL 3ARBB 4W6XB 4ZS7L 2R8SH 4U6YA 1MLBA 4XTRD 1LILA 1D9KA 4I18A 1QFHA 2A77L 4PJDF 4TTDC 2IPKA 3TO2B 3GBNL 3RP1A 3ETBF 3FQTB 3KYMB 3QAZB 3CDCA 2YPLB 5B3JE 3E6FA 1R3LB 1RUKL 3QCVH 1LP9F 5C09B 4WTZG 3BKJL 1AE6H 4F57H 1F4WL 2VC2L 3UJIL 2AJ3A 1JWUB 2CRZA 1M71A 2XWJB 4X0KA 4PGCA 3MV7A 5I8CB 5HHOE 3VA6A 2X7LB 4QRUA 4Y16B 4NN7C 4UTBH 4PLKC 1S9WB 1EBPA 2IAMA 2VR5A 3GJFK 3OHXB 4XI5C 1FCCA 1HNFA 2WINB 4G6FD 4R0LB 3P9WB 1GGCL 4NWUH 1WZLA 2YA1A 4N9GA 1U8JA 3D2UD 1FV1A 3FQNA 3HRZB 3ZYIA 1F00I 1GOFA 5JXEA 1FL5B 1FVDB 1QZ1A 4I0PA 1KJ2A 1PG7L 2OJEB 4L4JA 1A8JH 1CGUA 2VDOL 3O6KL 1PKOA 1G7PA 1JHTA 4PJ8A 3AB0C 2WUCL 4H1LH 2B1HH 4RAHA 5BW7C 3C87A 4IMLA 1DANT 5FEBA 1MFBH 2GJ6E 1QBLL 4XGZA 1E28B 5DO2D 4DN4H 3C60C 3GSVA 4DZBB 3U9UA 3KJ6H 4XCFL 2CMRH 2VKXA 5D7JB 3MUGB 4FTVB 5C0CD 1QLRA 4EI5C 3WDJA 5EUKB 2YKLH 3O6FC 2B1AH 3DV4B 5EFIA 4UQ2A 3P4NA 5F7NC 4JO1L 1NGQH 3PABB 1KIPB 3QUKB 3MRNB 1SY6L 1UJTA 2KKQA 4KFZC 5IVXA 2GTZA 3NA9H 2Z0BA 5GS3A 4W4NA 3ROLB 3RNQA 2CUMA 1PKQA 3IDGA 3PWLA 4G8GB 4PJDA 2EDQA 5IB4B 3GHEH 1QFPA 4GJTB 3QR2A 4MQXD 5EB9A 4K7PH 1PEZA 1YNTA 4K7PL 3V6OC 5I17A 3NN8B 4ZDHA 2D7TL 3WN5B 2XWBB 4IRJA 4W70A 5LBSH 3KVQA 5CJOL 2DLTA 1LEGB 1DLHB 1Z9MA 3W0WB 3BGFB 1JGDA 2B39A 4Y2DC 4KY1L 3FZUD 3CZFB 3DVNA 1R3KA 5C0AD 2I9TA 4BZ1L 4HC1A 2XY2A 5I2IB 1P5UA 3O3UN 3VXOA 1TCRA 5K9KB 2AXHA 4U1SB 5CEZH 2FSEA 5KSBF 4I1NB 2DKUA 2EICA 3UTOA 1INEL 3VRLE 5J13B 4Z8FH 1D5XB 2ICWB 3KPSB 3BAEH 4OV5B 1BBDH 1D5ZB 3BKCH 4Y4FA 5JMOC 4XB7A 2ARJB 2JLLA 2B2XL 2PXYD 5L2JB 2FJHB 4JFEA 4MQTB 1I8IA 5EORH 4UDTB 3JUZA 4ZFFB 5HGDA 4KDWA 1T1WB 3S37L 4GG6F 3TV3L 3IDJB 4PB0H 1F3RB 2WANA 1CG9B 3SDCC 2IANE 3CMOH 1EHAA 5IM7B 4O02L 4X6CF 1OPGH 1DUZA 1TJHH 3HMWH 4I77L 2OK0H 2H26B 5FYJH 3QHZL 1MWAL 3IU3B 4KTDH 4PRPA 4LFHD 2DBLH 3OKNA 5KVFH 4AQOA 4NT6B 1F6AB 1CD1A 3BEWA 3QUYC 4IOSD 2IBGA 3MJGX 1NMAL 3AREC 1P7QB 4UNVA 4LCYA 3OL2A 2BNQB 3BT2H 3OKLA 2H9GB 4K7FB 4AG4H 1LO0L 3ZE1E 4JGJA 3BEVA 5KSBB 5I73B 3BHBA 1HQRB 3I84A 1CBVH 2ESVD 3CSYA 4Q7DA 1BIHA 5LCVL 4W68A 3SDXA 4KZEL 5DEFA 5CZVL 5GS0C 3VFUB 1A2YB 2Q1EA 1XGTA 4BZ2L 5E08H 3BUYA 1R3IH 3N0PB 3H3BC 3E0GA 3TJEH 1HXYB 2PYEB 1AO7B 1NFKA 1F4HA 3ECBB 4N8CL 4XPTL 1RJZB 1NBZA 2OTUB 4G8IA 5E2TH 3AROA 4XCNA 5D72H 1OLLA 2GUOA 2UV3A 5D7KE 1FO0L 5EPMB 3EDDA 3ZDZF 1MRDL 4YDIH 5B38G 2I07A 2VR4A 3KYKL 4JCLA 3FJTA 4LKXB 4PYHA 2O61B 1V3LA 1KN2H 3VXUB 2AXGB 4FTVE 1KPVA 1SEQL 4JRXA 4MD4A 4NRXA 2X1OA 4WI5A 2VYRE 1KYOK 1MJJA 5KSUA 4LCWA 1H5BC 5A16B 3EBAA 3V6OE 4GKZA 1MUJA 1KENH 1NUFA 4UDUA 2X40A 4WO4D 5ACZB 4J3WA 2ZZUT 3CUPA 4N0RA 3IAGC 1RI8A 4IDJH 1P6FA 4B53A 1WCQA 4HD9A 4K3JL 1V7NL 2ATKA 1S7SA 3QEGL 1P4LA 43CAB 2H45A 3H3PL 4KK6D 5IFHL 3RGVB 2YZ1A 5I1CH 4BA8A 1JHKL 2H2PC 3CX2A 1MCDA 4RMWA 2XTJD 5T3ZE 1UWGL 4PJ9D 3WE6A 2VUYA 3L6FB 2YN3A 5EIQA 4P57B 1ZS8B 3RUGB 1LE5A 1A6AA 4LEXL 4ODXB 5J57B 2OTPA 4I2XE 1JE6A 1MHHA 3GMRA 1Z0MA 5BJTA 1DP0A 2NMSA 3G6JB 4UV4H 4HQQL 3KLHD 1GGUA 3HNSL 1EA9C 3QIUC 4F37F 5SWZE 1AIFB 2Y36L 1F4YL 1NAKL 3CVIL 5E00A 4F7MA 4RFOH 1SBSL 4KC3B 5JUEH 3K8LA 5DYOA 1BFTA 3GI9H 5C07A 5T3XH 1NGWA 2HJLB 1A64A 2HVJB 3S7GA 5IMMB 1U58A 1R3JB 3WO3B 3IFOA 2XZQL 2XFXB 2YD5A 2Y07L 3C9NA 4U49A 4EXKA 4PRDA 4HCRA 1ND0B 1C8PA 5EBLA 2AEWA 3T0EC 1DN0A 1U42A 2Z31A 3EHBD 1JZ5A 4K23L 4Y5VA 3UZVB 5K9QG 1OTUC 2BMKA 2R4RL 5SWSE 1F2XK 1E6JL 3TBSA 4JY6A 4GAYA 3L3KA 2IMMA 5D1XC 15C8L 4FXKB 5EO9A 5TQ0H 3MV8B 3L3IB 4J4PA 4XNXH 3FL7A 4KAQH 3C5SB 5E5UB 5FHBL 3JWNC 2DD8H 2AAVA 4QHUA 4PR5A 1JPFA 3EO9L 5DC0A 2HFEB 1VADB 3GJFH 4S10A 3NAAL 4WHTB 3EZ8A 3P30H 4JM2B 4MAYA 3PHQA 2HMID 4V1DB 4WFGD 2AK1L 1T03H 2VDQH 4WI8A 4FQHA 3JXAA 3LKPA 4LHUA 4GG8A 4BKLB 4DUWA 1I85C 2R56L 2Q7NA 3LRSB 5KANG 1V7ML 3D0VB 3S36X 3CX5K 3F58H 4P23C 4ODTL 2FX7L 5DD5H 1A47A 1E27B 4LVEA 2NTFA 1N5AB 3MBEA 4ZPTB 2SEBB 5JXAL 2D7MA 1BAFL 2A6JB 3D5OF 3B9DA 4RGND 4WEBH 5HI5C 5IV2B 4JFOB 3ARQA 3IKCA 1BMGA 4HWZA 1U8HA 2ZSWA 3TH2T 2Y25A 5DHVB 3RWHB 4HZLA 2AEQH 2LU3A 1B0GB 1CLYH 5D71H 3IS0X 4R3SA 1XIWC 4D3CL 4HPOL 4OFKA 4DW2L 3OXSA 5SWSA 1F58L 2EYSA 3MXVH 5K9OA 1EAPA 5ADPL 2ZUQC 3U2SB 5JR1H 2VQ1A 3K80A 3QI9C 1T80A 4CBPA 1ZSDA 4PJ7B 4Y8AA 3FTGA 4HK3J 1BM3H 1DVFB 4NRZA 3LZFL 3SGKC 1MIMH 3GHBL 1F2QA 3SPVA 4LLMB 1ZT7A 3SJVE 4RWYL 2BHZA 3PWVA 4Q6YA 3SE4A 3BE1L 3B9VA 2NY5L 5ID0A 2NW3B 1AGBB 4EXPX 2EXWC 4PJDE 1A7QL 3MR9A 2VXSH 2G2RB 3TCLB 4YPGB 2JTDA 3EYFB 1JPSL 1F97A 1NCCL 4YO0B 1E4KC 4RFNC 5BV7H 3HA0A 1NCBL 1OTTC 2YXMA 3ROOB 1B4JL 3ARDD 4JY5L 5HPOA 4XT1C 4L3ED 5I66A 1IGTB 4GLRI 2H8PB 5GGVL 3O3EB 1SMAA 1U36A 1D5MA 2AABL 3ULUE 2MHAA 3NFSL 2V2WA 2UVEA 3RWEA 4A6YA 2AV7B 4WW1A 3WS6A 2FX7H 1T22B 1IGIH 1H3TA 5IBUB 3MLSL 4KY1H 3LKSA 5I1AA 4WTWA 3IETA 4RRPG 2AJSL 3C2AL 4NBYB 2G75B 5FKAA 1I8IB 1KB9J 3IFPB 5EO1B 4Y0GA 3KPLB 1JZ8A 1J0KA 5IMLB 4ODHL 1QQDB 4XPAL 5F7HA 2X1PA 1V3KA 4L8BA 1U3HB 3MLPA 3MLVH 5BZDB 2IGFL 5J4MA 1CICB 1UACH 3JVGC 1CGYA 3HAEH 3BSZH 5HYSA 4PGBA 3REVA 1TVBB 2A74B 1HI6B 5C0BB 1RU9L 5D5MA 2X4NA 1S8DB 4XX1G 4CU7A 2H41A 1F3JB 3CC5B 3T0VA 4MCYB 4GRLA 5KOVC 4ZMAT 2EEDA 3CH1B 4RQQB 1QFWI 3L9RB 3SOBL 5T3XD 1U8PB 3ALPA 2OMNA 2H6PB 4WY7H 3PGCB 3KYNB 4AIOA 4Z0BL 1I1YB 3ARRA 2DJUA 4WNQB 2LFGA 5C0AA 3S4SB 2Y4SA 3QO0A 1LEKB 1MHEA 1WBZB 5MEPB 3B4NA 3BW9B 2GK2A 4NKDB 5DI8B 1Q9WB 4FQ2L 3SDXE 1SYSB 1TFHA 1B2WH 3CFEB 4P2OC 2E7LC 2QV2A 3MJ7B 2R1WB 4XWGH 3ILPA 1T2XA 4XP9H 3QQ9D 1YYLH 2XPGA 5EIIB 3O9WA 2J4WL 3SE8L 3IDXL 5JA9A 4OKVB 2BVPA 2YA0A 4XNMB 1XR9A 1A7PH 1H8SA 2I24N 4LASH 2NY6B 5IVNA 5GIRB 1A9BB 1BIIA 4LMQE 4HLZH 5F1NA 1QNZL 3WUWB 4R4NC 1CFVL 4WV1C 2OX5A 2FNBA 3K2UL 2VH5H 2I9LA 3VXPA 4JFPB 4F9PC 5LKNA 1V3MA 4BQ6A 5F7UA 3S3PA 4WCYH 2FO4A 2FGWH 2XA8L 5J56B 3FHQA 3INUL 3UTTE 4OLWL 3V4UH 2Z8VC 1FO0H 1N2RB 2APWA 2ZPKH 4M61A 1FZMB 4UB0L 4FQXC 3SO3B 2X09A 5KSAA 5BO1L 4IMKA 4LPUA 3X14A 5E9DD 5JOPE 1FNSH 4NO0D 1G6RB 1WBXB 5J11B 4Y4KD 3U4EA 3MLWH 1XR8B 1AGFA 1BBJB 2CKBB 1JFQL 5C8JA 3OJ2C 3QDGD 2V5SA 4MSWA 3IFLH 5DQDH 1OY3B 3VFNB 3EFFB 1HHKB 1Q38A 2UYLB 4ESKA 1NFIB 1HIMH 3EYUL 2JJSA 5JDSB 2ED8A 4YEEA 4X99A 3TA3C 2ADIA 1J1PL 4M48L 1EK3A 3KNBA 4PJIB 3OZ9H 3LH2H 1B2WL 5HHVL 3PDOA 3RVTD 1FGNL 2AS5M 4NFDA 1ZTXH 2E9JA 2X41A 5DFWH 5C0EA 2C26A 4LVHB 2P5WB 1SEBB 1CDCA 5JNYB 3QIWB 5ESQA 3DX7B 1QR1B 2L4OA 3PWNA 5I0DA 1PZUB 3MLUL 4M8QB 5I73C 3LS4L 2J8HA 5GSVA 5I8CA 5FYJD 2VXUL 3ZL4H 2BMKB 1S78C 1T03L 3LV3A 1BJMA 2M26A 2R2HB 4HEPG 1WZMA 4OFDA 1N4XL 1WAAE 4Q2ZB 4DGIL 5LXGH 3VFVA 4OJFH 1K8DB 4PY7B 4GS7C 2CIIB 5IMOA 1Y6KR 4NZRL 1W0VA 1FNSL 2FEEL 3CFBB 1ZANH 4NQDE 1HOCB 2K1MA 1EEZB 2BNRA 4FQXD 3EHBC 4WHTA 1CS6A 1A6ZB 5FOBA 2Q8BH 4NNXA 1BVKA 3OR6A 4HK0B 5DSCA 4KRPC 1JVKA 3UZQA 4AYFA 1A14L 2FB4L 1MPAL 3LD8B 1E28A 3BQUA 2BZDA 1BECA 2ITCB 1U8QB 4LSRH 4PB9L 4HKJB 4X8JA 3JWOH 1ZLVK 2YD1A 1YMME 2V9RA 1G7MA 1DQLL 1A02N 4U1IB 4G6AC 5EULV 3BP5A 3KYOA 3LSOB 4NCC2 1N6UA 3NACH 1RZJL 3OWEA 3VDAA 1V8HA 4NBXB 3U2SA 3L7FB 2N7BA 1QFWL 4JN1L 2YPVL 7CGTA 4IIQA 4LCWE 1EVTC 1FL6B 2VXQL 4F58H 4HC1L 1GIGL 3MNWB 3NIDE 3G6JF 3CVHB 1EMTH 1T20B 2OQJA 4XVSL 4MNQB 1J88A 1I9IL 2FATH 1RVFL 1CVSC 4MJ2A 4P2OD 1NCWL 3WV0A 5FO8B 4YXKH 2N7AA 3MJ6A 4P3CH 2YPKB 2WK2A 1FZJB 4XRCA 3LEVH 5FCSH 5AG8A 2J6EH 4YIQB 1GYAA 3O41B 2HT2C 3ZSTA 1CLOH 2FBJL 1CLOL 2VSCA 4Y88A 3ROOA 1RZ7L 2VISA 1DTUA 2BSTA 4F7TA 3QFDA 3UBXB 1R5WB 4PJIF 4MAYD 1W72B 2GITB 4P9MH 5B4MD 2VE6B 2NYYC 4Y2DA 3VFPB 1HEZA 3HZKA 3DMMD 1A0QH 2H32A 1YEFH 3IVKB 4X7EC 5HHNA 4G42B 4EUPH 2WIIB 2E9BA 2UZXB 1A6WL 1U8LA 2IANA 3MRFB 4PG2A 4R97B 5IEHA 4LRIA 2NXYB 4HJ0C 1UCBL 3ZKSD 3OKKB 1BEYH 4ODVH 1DLFL 1MWAA 4ODVL 1G9NC 3IFPA 3PWJA 5EO1A 1MRDH 2X10A 2VIRA 3VJ6A 3HNTL 3QULB 1AC6A 4R96B 2ENSA 2ZG2A 5FXCH 3VW3H 2DRUA 1L0YA 4PGJA 1PSKH 3L3JB 5AYUL 2IH1B 1CICA 3EOBB 3RPIA 1DL7H 2P8LA 3NACL 1Y18B 1Q8MA 3QCUL 3QEUA 4OIIH 4DQOL 5F89B 3UO1L 3REVB 2C3HA 2YPVH 5AD0B 2XQBH 4QEGA 1CFSB 5I6XB 3VWKD 3T3ME 4GW4A 3ARGA 3PQYD 4GS7B 1S8DA 1C12A 5EU6E 3RGVC 5I18H 1J8HE 3S88H 3IRPX 4JKWA 3IDIA 4Y4KB 2BNQA 2D7TH 2BC4A 4N90D 3RVWD 4BH8A 5F3BA 4CW1B 3MXVL 3QNZA 1OM3H 2VOTA 1Q0XL 3MCG1 4KRLB 3BHBB 5GJSL 5BVJA 4B7LA 2MNUA 3L3DA 3NCCB 1FVCB 3V5DB 1CBVL 2ATPA 5A40E 1K85A 3D9AL 5EBWB 3ARFD 3OKDB 1KJMB 4WHDA 4X4XB 1QTYT 5JHLL 1G7IA 3Q6FB 2JCCE 2D2OA 4J1UA 1EEYB 1YEHH 1ZAGA 3FO2A 4OGYL 5GHWL 2F19L 5L0QC 4P9ML 4XBGA 3CK0H 1RJZA 4DAGL 2VITB 5I1IL 4FQJH 4EI6B 3RIFF 4MCZB 4ELKA 4GQ9H 1EPFA 1XF4A 1N3NA 4KMTH 4LCUA 5DQ9B 5I74C 2BVPB 1LK2A 2P42B 4NJ9L 1OAZH 3FB7A 3MRHB 5T33L 4GRLC 1I1AB 1UB5B 3DNKA 3TIDA 3VU2A 4Y8DC 3GSOA 4PRAA 2DM7A 3UTSB 1IQDB 3QHTC 5IIEA 4HKXB 3QIWD 4D9RE 1JYXA 1WFTA 3RJDA 1SEQH 4PJAB 1S9VB 1KCRH 5ENWB 3HC0B 4N0UA 4L3CA 1S7UA 3VMOA 2R9HC 3RWIB 3O6LH 1PX3A 3U0WL 4TRPH 3RZWA 4QTIL 3H9ZA 3QDGE 3VXTB 1QNZH 1NLDL 2H1PL 4DK3A 3S88L 3BXNA 3UDWC 4ZSOB 3RL1B 1AXSB 3MNZA 3RHWK 3BRGC 4U1MB 5CHNA 2F58L 3TBYA 1I9RL 1I7TB 2XOTA 5GS1B 3TVMB 5HHPA 3LH2L 5CBAA 1G9MH 2OSLA 2YZ8A 3WN5A 2Q86A 2YMXH 4KROB 3KPRD 4Y4HD 4S2SB 3X12B 3P4MB 3QEHB 1K3ZA 1CE6B 5DJDA 1HHIB 3NCJH 3IXTA 5IR1A 4V2CB 5FM8A 5L8LB 4U1JA 4C56A 3HUJB 3ES6B 5CEXB 5TE7L 3HCVB 4OLYH 4LLYB 4GBXB 4XVUC 5C0DB 1UFUA 3RRQA 5GGUA 3DXAD 1J05A 1IAOB 3VGFA 4CN4A 3TT3L 2FR4A 3O4OB 3BQUD 3CVIH 3GMOB 4Y2DD 4NZUL 5EZJB 3DETC 5DUBA 1HSAA 2QSQA 3D69B 3FQTA 3WNMA 5LXGL 3SKMA 4EN3C 4WI7A 4X4YB 3F6LA 3OZ9L 5IBLC 5D7IB 3EJJX 2EXYC 1MJ7L 1T2JA 1I1RA 3ZMRA 4HUNB 3QDMB 1EJ6A 3FO1A 3OB8A 3Q0HA 2J7LA 4NNYB 3UTZB 1A7PL 4RGNC 4YHKH 1QSFE 4QRUB 4Y16A 1QFUH 4EDXB 4CAGA 4RGNB 5MI0B 4NUGH 4LLUA 2WWKT 2X2YA 3L3KB 3W2DH 4WW2F 3RIFK 1X4YA 2WINA 1XIWD 2BCKA 1BREA 4XZUB 1T1XB 3GJEB 3L3IA 2NY5H 2DAVA 1TXKA 2FD6L 2PCPB 1U8JB 1VB9A 4XB8A 1RIVH 5FV2A 2ZNWA 3PL6C 5C9JA 2DQHL 1NEZG 1IC7L 4HS3B 4PRHB 5IT2L 1G6RL 1NPUA 5I19L 1UCTA 4CJ0A 1JZ3A 2CO7B 1E4XL 4KUZL 4NNXB 1F90L 4E0RA 2V9TA 2ADJB 3F12A 4PGDB 4X8XA 1K6QL 1NGXB 1I1CA 4LPCA 2B8OT 4ZTOH 3HAEG 2ICWI 2CSPA 2YUZA 2B4CC 5JHDD 1JRHL 1SY6H 5MENE 3MV8D 3BWAA 3AS2A 4HCRH 5TJWK 1A1MB 2A6JA 1KGCD 1PBYA 5DJ2B 4X98B 1OTTD 2FH6A 4Y5YB 3OAUL 3WNNA 2DLGA 5D1ZA 1UQSB 1ZHBB 3BP5B 1UH3A 3TNMA 2BY2A 3AREB 2P7TB 3BKML 3O8XA 2FHBA 1IGJB 3N1GC 1X5JA 2ZJSL 2DS4A 4O51B 5GGTH 5IUSA 4PJ7F 2ID5A 1BLNA 2NX5D 3MLXH 4HGWB 4RNRB 2XQYK 3L5WA 4PTTA 3TYFB 2D7QA 1VSCA 3GUTB 5CGTA 5D7LE 2IF7A 1MEXL 5ICXA 4XC1L 3I6GA 3FQRA 3BE1H 1YEFL 2F8OA 2YRPA 1L6XA 4JHWL 3MLTB 1HSBB 4MA7L 5DRXA 3CZFA 3DVNB 3LEXB 1X5IA 2DMBA 2DOCA 2IWGA 3HR6A 1QPXA 3K8KA 2A73A 5K9KA 4DGYH 3W5NA 2PKDA 4DGYL 5HI5D 5FGCB 2HJFB 4U1HB 2BY0A 2KBGA 4KK8D 4DFHA 3ULVF 3MNVA 1A9EA 5EBMB 3NFSH 4I3RH 2YD4A 5TQ2H 3Q3GB 3CMOL 5DVMA 5L6YH 3B8SA 4PJFA 1INDH 3VXSD 2EDJA 1GSMA 1M6OA 1YEDA 3F7YA 4K9EH 3OF6A 1NH6A 4HDIB 2FX8H 1F8TH 3NGBC 4TYUA 3B3IA 5ICYB 4JFEB 4O2EA 3SDAD 3CJJA 3SO3C 5IVXE 5HD8D 1IEBA 2AVGA 3MA9H 3RVUC 3QULA 1GZQA 4Z77B 2IGFH 2X4QA 3STLB 2NQCA 5CJXA 2IPUG 1I7UB 4OD1H 3U0PB 4B50A 3KXFB 1HK6A 3BKMH 3ZE0E 1RJYB 1S5HB 4ONHB 1B3JA 1U58B 3LAFA 3FT3A 4JZOB 4NKIH 5DGQA 5I0ZA 1IGCL 1W0WB 1IGCH 2NY3B 2XWJA 3SKUD 3DUUA 2E6QA 4ZUVA 2VERN 4XXCA 2NY4B 5AYUH 4TPRL 3VWJC 2V2XB 4ODBD 1TVHB 2Z93B 2ZNXA 3FQWB 3O3BA 3ZSSA 3ZTNH 5FA3B 1BOGA 5FYJL 1MWAH 3QHZH 4KTDL 4OTXH 4TUKL 5SX4H 3IFLL 5DQDL 4QT5B 3S3JA 5D7JC 1FFRA 4LQ1A 1KJMA 2DM2A 2C3VB 3EJZD 2GJZA 3S4SA 4PBXA 5HGAB 1IAIM 2F5BL 2LU4A 3I3EA 4JEGB 5DUMH 1LO0H 1OCWH 5JHDE 5FGSA 2P49B 3WIHH 2VDKL 5ITBL 5DI8A 3JV6B 5AAWA 1H3UA 2OTUA 1GJIA 5F72S 2WQ8A 4JFDB 3SQOL 3GSNL 2E6JA 3MZTA 2NNAB 3MACL 3D9AH 1N3NB 3O6LL 3U0WH 4CL7A 4N8VA 2APXA 1LK2B 5IG7A 1KB9K 5GIRA 3WLBB 1F02I 4HUVB 2FYYB 5SX5H 1E0OB 3VXPB 4PJXA 3UTPE 5C6TL 1VESA 3VFSA 1U8IB 1AD9B 3U83A 5D9SA 4GQ9L 4OD3L 1UVQB 3VXME 5C6WH 3P4NB 3V0VB 2BNQE 5C07D 1MUJB 3RAJL 5K59F 3O6FD 1GC1H 2NY1C 4LCWD 2G60L 2VMFA 2R0KL 5F9JB 1VPOL 4HIEA 4OCWH 3MCKA 5CD3B 1RPQA 4JRXE 2L7JA 2ZUXA 1X7QB 2VQ1B 5GRXG 4H26A 5FB8B 2BOCA 4GKNA 5DQJB 4R8WH 3LMJL 4PG2C 2YEZA 3WIHA 1SYVA 5KBNC 4EUPB 3WXWH 3NN8A 4ZDHB 2V5TA 1TTFA 2BNRE 4CVWA 2PYED 3AXLB 3BVNA 2VUOA 3V2AR 2D0FA 4K9EC 3UPRB 1LEGA 1JWSA 1QBML 3MXWL 2CDEA 2AJUL 4PV8B 1CD9B 1W72L 5SWQA 3FN0H 2VDML 1RZJC 1KXVC 1OARL 1CQKA 1MAML 3O2DA 2D31B 5I1GH 3SGJC 5CGYD 4HUXA 1V7NH 4L3AA 4D9LH 1RUAH 3GMPB 1BQHA 3MRMB 4JFXA 2PNDA 1MLBB 1SEBA 3KPNA 4YH6A 2VN4A 1X9QA 4MNGE 3TFKC 1ZLVH 3SJVD 5C6PB 3OQ3B 1Q9OB 3IDUA 5K9JL