3REVB

Crystal structure of human alloreactive tcr nb20
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
GVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSYVSQNNEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and energetic evidence for highly peptide-specific tumor antigen targeting via allo-MHC restriction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords TCR NB20 ALPHA CHAIN
total genus 58
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2011-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3revB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3revB02
1GC1C 1NUDA 4KKBD 1X5ZA 5DEGB 5I30L 4QCIB 4D0BA 3DUSB 4OF5A 4KVNH 2H2PC 3RZCC 1LDPH 3S35H 1MFEL 1A1MA 4TVPD 4YXHH 2DMKA 4PGDA 1O7VA 4ZTOL 4KQ3H 4MJ5B 3BO8B 5LGHH 1AGCA 1BZQK 3STLA 3ZYIA 3DVGB 2V2TB 4DZ8A 1D7FA 5DJAA 4FQLL 4XPAL 3EYOB 4LARL 3O45B 3TA3A 2AJUH 4M8VA 4CVUA 1INDH 3UBXI 1XR9A 2P5EA 3OPZH 4K9EC 4X7DC 4KKBC 5IEKA 3MR9B 3QFJE 2PETA 1N0XH 5FUZH 2JJVA 1P2CA 3NGBC 4X7TB 4E42B 35C8L 1IEAA 4GW4B 4OFVA 3VXNB 2VITA 1HZHL 2ICEA 2H26B 1N6QH 4U3XA 1N8ZB 4LPWA 3WNPA 1I8MB 4NKDB 4WJ5B 1BX2B 1RZ8A 3EDJA 4UQ3A 1YY9D 3VH8A 2FD6L 1A3LH 1MCRA 3KHOA 2YEZA 1AFVH 4RWHA 4WTZA 2X89A 2ARJA 2MCPH 3TN0A 5GQBA 1IC4H 1WTLA 4NOBA 2Y6SD 1MCFA 1H5BA 3I2CL 4PD4J 4QF1B 4F2MB 3DO3A 3MXWL 4XBPA 2BP3A 1AC0A 1X4XA 3NFSH 4W68A 3H6JA 4JVUA 3DUHA 2A1WH 3HC4L 3MFFB 3BSZH 2EDBA 5I1JH 4OBRA 4PJEE 4MGXA 1T7WA 5ETUB 4LVHC 4NJAL 3UYOD 2HVJA 2EDLA 3TNMA 1JNNH 4OCXL 4WFFD 1JZ8A 2OMBA 1U42A 4MNQA 4GW4A 1DUYA 3WJLA 4FQQB 4RBPH 3V7AG 4J8RA 4GKSB 4LHQB 4X80L 5KG9A 3I6KB 1JZ4A 4OUUA 4JN1H 5T1KA 5T1KD 1ZVYA 4F37F 4TPRH 3E6FA 2Y06H 2XWJB 3ARFB 3MRLA 1G84A 1NCNA 5ADPL 4XNUL 1N2RA 2VLMD 1KUMA 3V6OC 1IGCL 2FIKB 4R3SA 5IESH 2PCPB 4LHUG 4Y4FD 1R5WA 4ZOAA 4FXKB 5HGAA 5B21A 4BFEA 3RVXC 1KCVH 3DROA 1CFNA 2HJLB 1HQ4B 1WEJH 4R8WH 5IFJB 3RIAF 4IRSB 2CO6B 2G9HB 3F58H 2IBZY 5DHXB 3VWKD 3WKML 4QCIA 5DJ0B 1IMHC 1Q9WA 2R2HB 3IFPA 1X9QA 3SEPA 1P6AB 3UTOA 4NZUL 3SGKA 5IB2A 2W92A 2QEJA 3UROR 3OBAA 1G7JA 1BOYA 4LLUA 5JLZB 2IAMD 3HRZB 1HOCB 2LAAA 2V5MA 1PX3A 3I6GB 3BRFA 4CRPA 4F9LC 4IDJH 3TH4T 3WO3B 2B1HH 2P24B 5C6TL 5ENWA 5DJ8A 1MRFL 3DSFH 3HKFA 3V5HB 1RZJH 4E5XA 2HA1A 4PP1C 3MUJA 4XVSL 3QQ9C 3T4YB 1HINL 3OJVC 3BW9B 1VGEH 4PYHA 1H3UA 2VDRH 2JJUA 2YN3A 2XQBL 1SBBA 3QI9A 5IBUG 1YY9C 2FBJH 1CD8A 5DC4B 5JXEA 3QQ4A 1A7RH 3VWKC 2NX5D 5D1QC 2R1YB 4QT5B 4H88H 5KSAB 3QDGA 4JLRA 4MVBC 3EYVA 1HCVA 4Y5VC 3L3GA 1TJGH 1F6LL 4W4OC 4Z7WF 1FIGL 4PBXA 3QXTA 4MZ2A 3INUH 1FG9C 5ICXA 4D0CB 3QULB 5JDSA 3JWOC 3I3BA 3I02A 4V1DB 3NZ8B 2XN9E 4XC1L 4XP9H 1FFOB 2HVKA 1IZKA 4L5FH 3S6CA 3B2UC 1GGBH 3W0WB 3N0PB 4L8DB 1HEZB 1BM3L 4IRSD 2XWTB 1IQDA 5FYJE 5FYJL 3DVFA 1S7XA 3AREA 3SCMA 1E4WL 3OGCA 5DJ0A 2AV7A 1KCLA 1GJIA 4MXQD 2FO4B 2DQJH 3W81A 5DLML 1A4KA 5GGTL 2R1YA 4PY8J 3MPCA 4BSJA 5EO9B 3FO0H 3W9DB 4K71C 2EEDA 2PR4L 2Y9RT 4UV4H 1F2QA 3A0OA 3C5ZD 3DX9B 3G5VB 43C9B 4GRLC 4JO2L 3KXFE 1WBYB 2L0DA 2DQUL 3HE7D 1E6OH 4JZJA 4KAQL 4ESKA 3O6LL 3O6ML 2YK1L 4B7LA 4LSTL 5E5MA 2IADA 5GS0H 1IAMA 5J4MA 1UQSA 3GK8L 3WV0A 1AFVL 1T80A 3QPQD 4F15C 5BJTA 3PWLA 3TVMB 3MREB 3AMLA 4I0PA 4KI1A 4Y5XB 1OTTD 4UT6L 4N8CH 4JPWH 2GHWB 3LPGA 4K7PX 4G9DA 5DHVB 4Z18A 1DUZB 1KELL 2QKIA 5HHOB 1LNUB 3TWCH 4KPHH 3QHFH 3TIEA 4I77L 3MGOB 4TVPE 2ZUSA 5FYLE 4GLRI 5DJ2B 3BXNB 1QSEA 2J3SA 5CSBA 3MCLL 4MD0A 4GKZA 4LCYB 3OKEB 2RIKA 4WW1B 3V5DB 1VGEL 1MJJA 3DRQA 4WO4B 4WFED 1YECL 4NO0A 2E7CA 2Z35A 4HIJA 1FZKA 3FFDA 1JWUB 4UV4L 4X6EA 2AV1A 5C6TH 3SE8L 3F7YB 3U9PH 1ZEAL 1JGUH 2X4RA 4OZIA 4F9PC 5EBLA 1FO0A 3FO0L 2YUWA 4E41E 4Q2ZA 1FL5A 1JUFB 3SOBH 5EOCJ 3O8XD 1W0VA 2GYSA 4BH8B 2NW2B 3MRPB 4XXDA 3AMKA 5I30H 1ADQH 1OGAB 2XZCL 4PJ7A 5ERWB 1KBGH 2VLJA 3EYFB 3G6JB 3AU1B 4P2OC 1WBXA 5AUMB 3TC9A 2JK5B 1UM4L 3HAEA 3ULUE 5E6IB 1UYWL 4OGYH 2EYTA 1XT5A 4OIAA 1LWRA 5C09B 2NY7L 1QKZL 2GT9A 1FVEA 4GXUN 4JY6A 4OLWH 3ZE1E 2CUMA 5KVGL 2M26A 3P4OA 3FQUB 1C12A 1JL8A 1OAUL 4OZHE 3GB7A 4JG1L 4M4RA 4X4YB 5J6GA 2IBZX 3K8KA 4JDZB 1HHIB 2QADC 1T1ZB 5DVOA 2WIIA 1WSST 4NQVA 4R90H 5C07E 5JOPE 4PV9B 1RULH 4Z76B 2B0SL 1HH6A 2AXGA 5DEGA 1QR4A 2VDQL 2QV2A 5GS2H 5K93A 4EZMA 1QTYT 1U8LA 4LLAA 3V5KB 1FP5A 4NQUA 1RJYA 4PRNB 3ZLQC 1D6VH 4G42B 4OZHB 4YFLF 1IC7H 1VHPA 1AGDA 5T1KB 4IMKC 4YHYC 4DKAA 4F3FA 3M8OL 4YDKH 4TUOB 3DVGA 3O6LH 5DFWH 1OTSC 3H9SB 3MXWH 5JIPA 4KROC 3DECA 3ULVE 1E4JA 1VFMA 1YMME 4LRIC 4OLVL 5GGSB 3TBVA 5T5NG 1CVSC 2IAMB 3LEXB 5GXBB 5T5FH 1KTLB 2CXKA 3VFUA 3A67H 4PG9A 1T83A 4KMLB 3NCJH 4NQVB 5GRWA 4J23A 4QRRA 1TTFA 3B9VA 1A5FL 1EEYA 1UWEL 4X83A 4N90E 3VGAB 1IAOA 3DO7A 5DD3L 4TVPL 3MLYH 1FVEB 2BDNL 4JY6B 3UBXA 3Q1SH 2Q20A 1I3UA 3UZEA 3I50L 2AGJL 4BK4A 4DN4H 5EIIB 5C0DB 3HNSL 4KXZI 5E8DL 4LDOB 3EDDA 5D71L 4G6FD 5JPMA 1U8HB 3OR6A 4HUNB 2R2EB 3TT3H 4ONGL 1FV1A 4OAWB 1PKQA 4U3CA 3G6JA 3QUXC 1RULL 3RHWK 3REVA 4WEBL 4B41A 1RURH 3AS3A 5CP7A 5JW4R 1D9KD 1UCTA 3KYNB 4WI9A 4WCYH 3SCMD 3VXNA 4HJJH 4IJ3B 1KCSH 3PP4H 4PJIE 4M5ZL 4CVZA 5BXFB 4ODVH 1R5IA 3JBG7 5CILH 4DEPB 5IEHA 3Q48A 1MHHB 5DMJB 2GITA 3IKCB 4AEHH 3N50A 1LP9A 4X6DA 3TA3B 2PKDA 5D1XC 5ILTH 1T21A 4KK6D 3QZWG 2DQGH 5D7SH 2AEIT 5DQDL 5FYLD 5C70A 2E3VA 1YEIH 1UXWA 1H9VA 1T1XB 3FZUC 4QY8A 5IGXH 2D7TH 4CW1B 1D6EB 3RKPA 4JANA 5C86A 3M17B 5DR5H 1G7HB 2NXYB 1C08A 3U0TA 4LQFH 3W9EB 1E4KA 1WWBX 1KPRB 5BOZG 4I0PD 5CWSA 5AAWA 2EH8H 3MJ8A 2V17L 4RRPG 3RPKA 5SV4A 4NWUH 3D87B 5TDOA 4YXLH 5SWSB 1ZLWH 4J1UA 3CAFA 3PWLB 2HN7B 2ZSVB 1A6WH 1NFDE 1WEJL 1J0IA 2PXYB 4K2UL 2AP2A 1FZKB 5DI8A 1T1WA 3GBNL 4NZRH 2I60L 4YFDB 4ZAKB 3T0VA 3IDUA 3OKMB 1YYLH 3FOLA 5JMOC 4UOJA 4CVXB 5GSVB 4PB9H 3S96A 3GSRB 1W72B 4FQHA 5JLZA 3BMVA 1X5YA 4MMXC 3LN5B 1CGTA 3BUYA 3NFPA 3KPRD 3MUZ1 4UT6H 4YNYA 1NGPH 1W0YT 4P2YA 1BIIB 3MNZB 3GJEB 5J8OA 5DGRA 2D03H 3ESVF 4LKCB 2IFFL 1Q0XH 1OAQL 1N4XL 4U4BA 2COQA 4QTIL 4Z7QE 2KH2B 4NGHH 5F9JB 4PPTA 4XBGB 5ACZA 1NGYB 1F6AB 1PQZB 1KB9K 2OK0H 4KJPD 3QUXD 5JDJA 2GUOA 4OQTH 1XF4B 3SE4A 4PJ5A 1RUKH 4DFHA 2W38A 3D25B 4GFTB 4APQD 5BS0E 5FB8B 2BHZA 3JZ7A 2AEWA 3VXMB 1VGKB 2BSSA 4KRPC 4PJDF 1FN4A 2C3GA 3IU3A 1NBZA 2WWKT 3RWCB 1KBGL 4AT6B 1KCRH 3SO3C 1ADQL 4PJFA 2FIRT 4NIKB 3CH1A 5E5RB 3HCVA 3QQ4B 3O6FD 3RTQB 4L8CB 4GSDL 1GGTA 1S7RB 3JSSA 1ORQB 1NGPL 4R8WL 3Q6FB 1X5JA 1OGAD 2Y4SA 5C0RL 3UTSA 4XP1H 3UTSD 4I8DA 5D1ZD 3DRTA 2Y5TB 4ZFGL 4PB9L 5ESQA 3BE1L 5DO2D 2WUBL 1T04B 4IRJB 1EX0A 4RIRB 1S9VA 2EDXA 4QXGL 3MRFA 1QBLL 2BX5A 3CH8A 5HI3C 2QTEA 1C5CL 5CZVH 4IMKA 1VENA 2GW5A 4POZD 1ZKAA 4L4TE 5E2VH 5I0DA 2C9AA 4OI7A 3U4AA 4K94C 5CHNA 3FOMB 3D9AL 5DUPH 8FABB 5CINH 4QHNA 4LP4A 5FXCH 3GIVA 4XNYL 1E28B 1I1AA 2DYPB 1RVFH 2I5YL 4ZD3L 3BPNC 1Y6KR 2P43B 1U8PB 2DKMA 2VAAA 4NN5C 2FWOB 3MRLB 3OHXB 1BLNB 1AR1D 2P8LA 4XPHH 5BS0A 3QCUH 1GOHA 2ADFH 5E08L 3QUMB 1OP5K 4D3CL 4ODSH 2VLLA 1V3JA 1IC4L 4PIRF 3P4LA 3BN9D 4L8SC 4ODSL 3DO7B 2Q76B 4KKAC 4GAJL 3BAEL 4GS7B 5BV7L 1HYSC 3GKWH 5LXGL 4H20L 1OSPL 3UCRA 1JPFB 5J57B 3DTXB 1KPUB 3GSOA 3K3QA 4YAQA 5DRNB 2WQRA 1JGUL 4HZAA 4NHUB 3TNNA 3D2UD 4YHPB 4AIOA 1MCIA 3REVB 3TCXA 5J06A 5EIVA 4HCRL 3T0ED 4CMMA 4PV8B 5EIQA 3IVKA 2Q3AA 3CUPB 1CR9H 4GKOA 2VJXA 5EC1A 1IGMH 3U7WL 3RVXD 4U1GB 1U91B 1MVFA 4FQXB 4Y16A 4TUKL 3DETD 1F11B 3U6RB 4ZS6C 3QNXB 4N8CL 5I1GL 3LRGA 5DVKA 4Z77B 3OXRB 1ACZA 4X6FB 4QRSA 3HPJB 4HFUL 1S7VA 4G9FD 4XWOD 1KEMH 1RZ7L 1FVCA 1ZTXH 2EC8A 2IFGA 2YUVA 5C0IB 3T0BA 2GSIB 4XNQB 3H3BC 4PJBF 5GRUH 1WQVT 3EZJB 2OR9L 4B50A 43CAB 5F7MC 4Z7UB 3VWJB 3QEGL 3WD5H 4J3SA 4NM4L 2ERJB 1NCAH 2DQCL 5DWUL 3FMGH 1DP0A 4YDLB 3M1BB 3QEUB 5HHNA 1OP3K 2F58H 4JG0L 4ERSH 3QCVL 4IOFD 3BPOB 1LP9E 4QGTA 1TZIB 1JNLL 2XWBB 3R06A 5C9JB 1QFOA 1PGRB 4U6HA 2IG2L 4ELKB 3S97C 1JYNA 3T4AA 2AJYL 1A64A 2OP4H 2VDOH 3FT3A 5EUOF 5GS0D 3WIHH 1P6FA 1EA9C 5F7FA 2PXYD 4HFUH 4D9LL 1RZKC 2DAVA 4QWWD 4F15B 3ULUH 4XP1L 4OGYL 4IOFC 1G7QB 2NTSP 3PHQB 3TO2B 4YGAB 1MCNA 5BV7C 1WVZA 5JW4M 1G7MA 4Y4KB 3PWVB 3FB7B 8CGTA 1A9BB 3IETB 4W4OA 2Z8SA 3QO1B 2W65B 5ESVA 5FO8A 3VJ6B 3SE3C 1VKXA 4LIQE 1KN2H 3FO2B 1DVFB 4HF5H 3SDCB 4FA8A 4NQTA 4ERSL 5JXED 1TVHA 1QBBA 2PTVA 1LEGA 3T3PF 2FJGA 1Z9MA 4RWYH 3ZDZE 2IBGA 1FAKT 3ARBB 5E00A 1DBJL 3DURB 5IQ7L 4UT7H 4PRPA 3DRTB 1EK3A 3CLEH 1PBYA 4TNVK 5JNYB 1EGJL 1MQKL 3VFSA 4JKLA 4GXVL 1KIQB 1B9ZA 3O2WH 1BD2E 1A7PH 5CJ8A 2KQMA 2XZQL 5IESL 1VACB 4WU7A 2H6PA 3CH1B 4ZSOE 1WJ3A 5EC2A 2G75A 4MXWL 3B9KA 3RU8H 2ZPKH 4LCWA 1FL3A 4EI6A 3W11D 2XZAH 1KC5H 4X7SH 2E9WA 4KGLA 1FRGH 1MCBA 3KLSA 1NAKL 5IIEB 3G5XA 4X80H 4PJGB 5JMRA 1TVHB 2QQKH 5F7KC 2F74A 3QQ3B 1MH5A 5H37G 1MAML 3MLRH 3TCLB 3TYFA 4OT1H 5IFAH 5E8DH 4LVNB 1AIFB 4BA8A 3C2AL 2V17H 1E4KC 4I5BA 1UACL 4JHAH 4YHZH 1N5AA 2OQJB 4P99A 4NUJB 4UIKH 4OLYL 4R4BB 1B0RB 4LCIH 5T1LA 5F8QC 5FOBA 5DD6A 3CVIL 2CIIA 4ZAKC 1CFTA 2OSLB 1HI6B 4HMCA 4KVCH 1HEZA 2B1AH 5DMKB 1D6EA 2QQNL 1B2WH 1M6OB 5C3LD 2P24A 3GSNH 4Q58C 1K3ZA 5ANME 1K8DA 1I9EA 2VUYA 5F6HJ 4G6ML 4M1CC 3KLAB 1T83C 4FMKA 5HYEA 1KYOJ 1CLOL 2BCKB 5C0FB 1PDKA 5KSAA 4G6JH 4DQOH 4M7LL 1CICD 3VXSA 1XF2A 2YD8A 3RWCA 3KYNA 2OR8A 4X4ZA 1Q1JH 3UJIH 5HHME 4PJXE 4PRPB 1I85C 4G43B 5DMIL 3TPUA 4YIQA 4BQBA 1J1PL 1UH4A 5CIPH 4D9RD 3FAXA 5JPMB 1DCLA 2O5ZL 3MA7B 1FBIL 2WZPD 1IFHH 4K3EH 2A6IA 3BD4A 5HVGB 5B39B 4I1NB 4PJ7F 1P4LB 2DM3A 5IMLB 2X9WA 5B38B 3MUY1 1MHEA 4XXCC 4YHKH 3SPVB 3QO0A 4W81A 4HKZA 2V7NB 1PVHA 1IE5A 5I1IL 1NMAL 2ZG2A 5EG6C 1U8NB 1FHGA 4OKVB 3RI5K 5L8JB 1U0QA 4HMDA 1J8HB 1HYRC 4APQA 5D96B 4IRSA 5DFVD 5DSCB 2NY6B 3WEXB 3LKSB 3HHRB 1UC6A 1VFBA 5EZLB 4HK3N 4BM7A 3RZCA 4OFYD 1UKSA 5CJXC 4LBEA 4OB5L 1QA9A 2Y7QA 1FV1B 2VXQH 4PJIA 4HIHB 1QYGH 2RFXB 3Q5OA 2BC4A 4HIXH 1IAIH 4U6YB 4DCQB 1AJ7L 4O2CA 4U31A 2ED7A 2EYRB 3PL6C 2XICA 3QUML 4JN1L 4P0DA 3WFCH 5CD5C 5T1MB 1KJ2B 3NIDE 4WCYL 3EFFB 4LNRB 3RJDA 2R2CA 4OZFA 32C2B 2LU4A 1OPGH 3HZYA 5KVDH 2M1KA 3RVWD 1KB5B 5KZCB 4W6WB 4ZPVB 5KVFH 2L4OA 3FONB 1QEWA 4PJ7E 3LKNB 1MJ8L 3HA0A 3MODL 2HT4D 4WWKD 3BGFC 5I1AB 2FGWH 5DK2B 2IG2H 3GBML 3FHQA 3BX7C 4PJHA 32C2A 3NACL 3K4AA 5T5NF 5HYJE 4EXPX 1CF8L 3S4SB 4KRNA 3BGMB 1G6RA 3NFSL 1MI5B 4QHKI 4ZUUA 5MEOB 5IB4A 3LKRB 5FV2A 3BH8A 4BH7A 5D5MB 2ICES 1H5BB 2X4SB 4LK4A 4UV7L 2HJFA 2AI0H 2HAZA 4FFVD 5EA0L 4HKJA 3C6LA 2EYTB 3ARYA 4M43L 4HK0B 4PGZA 4RGNB 3Q2CA 4G8FB 3LPWA 3SDCD 2NY6C 3JWDL 2VXUL 4BSVA 1UM5H 5DURB 2PYEE 1ZXQA 5TQ0H 2BDNH 2BY3A 4OZGA 3MRRB 3V8OA 5C08B 4EUPG 5DS8A 3TV3L 3OKLB 3RNKA 5I1EL 4DN3L 4LU5L 3ARSA 4TTDD 1MUJA 4M7LT 4JAMB 2H41A 4GRWB 3HG1A 4M5YH 1PZ5A 3EO9L 1MFAL 4JZJC 1AGFA 1M05B 2LVCA 3FFDB 5BVJA 1DEEB 3IU4H 3U9UB 1I1FB 2BNUA 4RA3A 1DANT 4KY1H 4DJMA 3TBTA 5IV2A 3O2DA 5KSBB 4HX1A 5IB4B 5FHBH 1F02I 4DK3A 1U95B 1YJDH 2DQGL 2X4QB 3OXSA 3T1FA 4XGZA 4WHYH 4FOMA 1IGTB 5DA0B 5IVNA 2HT3C 1H3GA 3H9SD 2VYRE 1S78D 3RU8L 2P5WA 5JHDA 1DLFH 3S34H 4F7EB 2X1PA 3OX8A 1QQDA 1G7IA 4KKLC 2FJFB 2X70A 3GIZL 3F6LA 4PJEA 2B0SH 5FF6A 4U7KA 4YWGL 5SX4H 2HTKD 3OQ3B 5JPNA 5HGHA 2A83A 1CU4H 1BHGA 1IL1B 4G9FA 1NBQA 2HKFL 4ZSOA 4HGWA 4N8VB 4XMLH 3UC0L 3KXFD 1DBKH 4I3SL 1AJ7H 3PL6A 5MP6L 1ED3A 3IGAB 2BRRL 3B9DA 3CUPA 3Q1SL 3DV6A 3IYLW 1RSFA 5FYKU 3PDOA 3BGFB 5I1EH 3LV3A 4KMTH 3K1DA 4UNUA 2RQ8A 4ZS7L 1OY3B 1E28A 3U7YL 4APQB 4EQ3A 2XTJB 3BDXA 3DX8A 5K9JH 5LAXB 3BQUC 1S9WA 2JB5L 3T0EA 3ZTJH 1QLFB 1BAFL 1JGLL 1REIA 1EAPB 1QRNB 1G7LA 4IRSC 5AYQA 3RUGE 2HLAB 4ODBD 3E8UL 3A67L 4X6BA 1UWXH 5ID1A 3PJSB 4JEGB 1U3HC 4XHQA 4RQQA 5JW5A 3PF2A 4U6XA 3V8CA 3VXTA 3QUMA 3MV8E 4KPHL 4K07A 5KVEH 3T3MF 4X7SL 3VFWB 1KT2B 1PG7X 4POUB 2IQ9L 3KPTA 1GOFA 5L7XH 1P7QD 5DC0A 3PWPE 4NUGL 4GRLD 2ICWA 4Y1AA 2DD8H 3ZKNC 4QYOB 1MVUB 4FQ2H 5FGSA 2BSTA 3HE7C 4RMSA 3MRDA 1A4KB 4G8GD 4O51B 4JJ5B 5JNYA 2Z8VC 5I17B 4L1HA 3GI9L 2JJSC 5I9QB 4Y88A 5C0CE 1K6QH 3L3KA 1EZVX 3STBA 5EORH 4LPUA 4KHXH 1LEKA 3V0VB 5HHQA 3VD9A 1JF1A 4MVBD 5IT2H 3ARBC 3VXUA 1MELA 2QR0A 3D6GA 1F00I 2C1OA 5D93C 3UO1L 4OSUL 1A0QL 1MFBH 2YPLD 4OTXL 3GJFH 4K9EL 2HT2C 1A7QH 4OCWL 1S78C 1QFHA 2RB8A 5HJ3B 4A2LA 2CLVA 5FGBC 1QFWL 3T09A 1E4WH 1BF8A 1YEJH 1ZGLA 3B2UD 3JV4A 1AO7E 1NL0L 2EC9T 4QTIH 5DK0B 3MUGB 4XNZB 2ADGA 4NKQB 1R24A 5I1IH 3MRDB 2FB4H 4HC1H 4YPGA 2R0KH 3K80A 2Z0BA 2R4SH 1CGSL 3SE9H 3JV5A 3ECBA 2FIKA 4ZOEA 4AM0A 4XNXL 3DV6B 4UU9B 1YC8A 5I1LB 5D7IA 5C92A 4KQ4L 2NXZC 3G08A 3U9PL 3Q0HA 3WCYA 1ZA6B 5GS1A 1TXKA 2DWEA 3QQ9D 3B8SA 4UILH 5KG9B 2FBJL 1DLHA 3PGDB 5BRZB 4QNPE 5EN2A 4UINL 3LN9A 2CLRB 3BZEA 2AVGA 5SWSA 4NQCE 3KYKL 5AAMA 4FFWC 4MJ6A 1TDQA 3NZHL 1CDJA 2ZPKL 2E5EA 1TETL 4P59L 1MCOH 3IJYB 5C9KA 4N1CA 3O2WL 4LGPB 4BSVB 1P5VA 4L9LB 3U4BL 2PTUA 3P11L 3VI4E 2WUCL 3ROLA 2VR4A 3WNMA 1W72A 4FQHB 2FB4L 3V95A 5C0EB 3I02B 4U0QB 2IPTL 4EDXB 2X10A 3KPSB 3EJYD 2MCG1 3CMOL 1AGFB 2DQUH 3EKCA 4NQEB 3HG1B 4UQ3B 5FGRA 3FKUS 3VH8B 2BVOB 3T3ME 4PJCB 3S3SA 1MCWW 2PR4H 3BMWA 3KGRA 5L9DL 4P48A 2ZUQB 2NXZB 3UO1H 1CDCA 3NH7H 5E2UH 3DSNA 4CKVX 4OD2B 1YQVL 2MQ0A 3RUGF 2HTLD 4PBVC 3C5ZC 5CINL 5J9PA 1MWAA 1YNKH 3PIQA 4NCDA 3EFFA 2VXTH 4UILL 3WN5A 1F4HA 1G0DA 1FAIH 3LKQB 3P4OB 2ATKB 2HJFB 2NY2D 3A6BH 3RAJH 3KDMB 3MRQB 2DQDH 4U1MB 5DZLA 4CU8A 4YHIB 3BJLA 4WTWA 4X7FC 5TFSL 3WN5B 5E6IA 3Q3GA 5I8CA 1CL7I 1FLRL 5HSFA 5D8JH 4OM0H 3TZVC 1OTTC 3JWNC 3EYQD 3WS3B 1HKFA 3RGVD 5EO1B 1RZKL 3S7GA 1U8IA 4LGRB 4DKDC 4P49A 3MRJB 4JVPA 3TH3T 3G6AA 3GHEH 4MYWB 1K5NA 3UTTB 4AQOA 2XN9D 3E0GA 4RFEA 3ZYZA 2Q8AH 1S7UB 4PJ9C 1EO8H 3KVQA 4DKEH 3NOIA 3KPSA 4QHLA 5INDA 3WNOA 1GPOH 1URLA 3KPSD 3EO9H 4JFQB 1DQQA 4Y5YB 4WO4A 4DCQA 3SGEH 3AVEA 4KMTL 3S5LA 3MLSH 5EUOA 3IF1B 3BO8A 1RJLB 3T2QA 1CTNA 2NY5H 1P7QA 3IDNB 2VLRA 4IIQA 3TFKD 3UTQA 2MFNA 1OTUC 2Z8WC 4PJ8B 3NAAH 1MLBB 1EHNA 2IF7A 3NCMA 3D3VB 4UINH 5L2KA 3HFMH 4AZ8A 2CK0H 1YDPA 4M02A 4YEFA 5HYQB 3BT2H 4JRXB 2FLRT 4MAYC 4Z77A 5F1IB 1AO7D 1IT9H 1DQMH 4RAUB 3K1KC 2J7LA 3V6BR 1FNEA 5DHYB 3PQYD 4U1MA 3EO0A 3MACH 4M7KL 1KJ2A 4PRDB 2DTMH 5GS1B 5HYSA 3KPSE 4M3KB 3TF7C 3CZJA 3HNTH 5IR1A 4B7IA 4MDIB 4G42A 5E03A 3EO1B 1ND0A 2FEDD 2ICCA 1CLZH 4H25A 1ZSDA 1F4YH 1PSKL 2Y7QB 5I1CL 1EHLL 1BECA 4FQIL 1F97A 2A73A 1O0VA 1NBVH 3SGEI 4MQSB 3P0VH 2VL4A 3RDTB 4ZXBB 1OPGL 1XF2B 4MWFA 3GMNB 4QHNB 3BZ4A 4JRYB 3T77A 1NQBA 5I76A 1JNLH 1J9CT 2NY2C 2XG4A 4XZUA 1BGXL 1WIOA 5I73C 5E5UB 3LHPH 2A9NL 1HNFA 5I8EB 2XWTA 4LCUA 1C5DB 1OF2A 3C6LB 5DUBA 4AEFA 2X7LB 1MCDA 2ZCLH 3MLSL 2A9NH 4O9HH 3FQWA 1A6VL 4RNRB 5M94B 5IT2L 1HQRA 1NCTA 3LZFL 3GUTA 2WINA 3O2VH 2VDKL 1OW0A 4D9QD 5HD8C 1OTSD 4J6RH 1OCWL 2L7JA 3GZKA 1E4XH 4JFFB 1CD9B 5E1AB 1Q0YH 2VE6A 4BQ9A 3VD4A 3FT4B 3IJYA 2AI0L 4TSAL 1INQA 4H26B 2XY1A 3H9HB 3LMJL 4MJ2A 4ODUA 4OI9A 4LCCA 4NZDA 3L9RA 4XHJD 3TEUA 4BZ2L 1HHHA 4M93C 4O51A 3QDGB 1AO7B 3LEVH 2I5YH 4MHHI 2D7MA 3QDGE 1FC2D 3RVUC 4A2MA 4M6NL 2WV3A 3GMLB 2ZZUT 5ITBH 2FJHB 1RJCA 1I1AC 2CLRA 3GJFA 5GS3A 3H0TB 5SX4I 1DBAH 1OVZA 2FRGP 4CNIB 2AXFA 4R0LB 3QI9C 5HD8D 4U6YA 4PJIF 5EU7C 3B2VH 1GXEA 3DX9A 1IGYA 3SDCA 2X4UA 5J1SC 4GAYA 1QVOA 2H32H 5DC9B 3MLXL 4XI5D 1CFQA 3GMQA 5IQ9A 5HI5D 1YMMB 5KSVB 2P8MA 5DQ9A 4HPYH 3QCTL 4Y4HA 4HWEH 5HI3D 2H45A 1T2QH 1TQCC 4LRIA 4ODUB 1ZT7A 3PABA 1T6WA 1JGEA 3JWDH 5T3XL 1NCBH 4NSKA 3WXVL 4LVEA 1QBAA 1UWGL 5C0AB 4JM2F 5FB8A 3IGAA 3PGCB 3KJ4B 4H1LA 4AEIL 3DX6B 5E1HB 1GZQA 2MPAL 4Z8FH 4X5XB 2ICWI 3GSQA 3E6HA 2C1OB 4JDVB 4HH8A 1N6UA 1X5LA 1M7IA 4LEXL 3HNTL 1KN4L 5DJXB 1RVFL 2KL6A 4OLYH 2NPLX 4K3EL 4J8RB 2OI9B 4LVOB 1T0PB 5IM7A 3WLWC 3MODH 4YFEA 4OCRH 3MJ8B 2H6PB 3MRRA 4U6HB 3P9MB 5HVHC 3LAFA 1IBGH 4I13B 4P23D 3TBYB 3WMSA 1QFUL 5KVDL 3EYSH 2ESVA 1XF3B 4KHTH 5DUMH 1H3XA 2BY2A 4R26H 4NRXA 3HFML 1ZHNA 4XH2A 5CD3A 2YPKB 4HS8H 4H5SB 1YYMH 3BWUC 1OAUH 4ORGA 2EECA 1R3KB 1TTUA 3LIZH 4RNRA 4X7EC 5BO1L 3MLYL 3IDJA 3FQXB 5B8CA 2P47B 4X6BB 1HWHB 5C0IA 3OV6A 5KVEL 2ZSVA 4KK8C 4NDMA 2UY6A 2F19H 2ZJSH 4XNMB 1CGSH 4LLYB 1HXMA 3MV9B 4HD9A 3KPLA 3MV9E 4MA3A 4O02L 5DEFB 1YZZA 5J13C 4XWGH 1CLYH 4MSWA 5FA3B 1INEL 1T20B 2VLKA 5DJDA 1IQWL 3QG6B 1JPGA 1ADQA 3O4OB 3TJEL 3BW9A 4LFHG 3UYRL 3KPNB 1OP9A 2UYLB 3M1BA 3QEUA 5HHNB 3U7YH 3EO1A 1WZKA 2DJ4A 3M8OH 4RGOL 4PGJA 3C8KB 1CWVA 3P4NB 3QWOA 4JRXD 2X1QA 5D7JD 4JHAL 5EFIA 2DYPD 4U6XB 1J1PH 5IVXF 5C0EA 4N9GA 2FCBA 3U0PB 2X09A 4E41A 5I1DA 1JI1A 4RGNE 4JPKH 2E27L 4EN3B 4KHTL 5DUML 4G8GA 3W39A 1XCTB 5B3JE 1F4XL 5IHUL 3FB8B 5I6XC 4QRSB 3CX2A 2VDNH 4YDLC 4WUUB 4P4RB 2X9XA 2N4IA 4JPWL 2P5ED 2Q8BL 4MXVF 5ANMB 3SKJL 3OKKA 5HGDA 4E41B 5I1DB 5I75B 2EXYD 1OAKH 1QLRB 2DQTL 2A6JB 4OZFB 1Q38A 1D5XB 2FDBP 5BRZA 1KN4H 3L1OL 2XNAA 5C08E 1ACYL 3JUZA 3MNVB 3TT3L 1IZJA 3P4NA 3QWOB 1YJDC 4Z7UA 2VAAB 4DUWA 4K2UH 1GZPA 2O26U 2P4AB 3HAEB 4TQEH 3O6MH 4PJEB 3IFOB 4TOYH 3ZL4L 3TM6A 3VJ6A 4XPFL 2C3XA 5IJVA 1MF2H 1Z5LA 3OKLA 1N3NA 4HEPG 5FYLL 4MSWB 2VITB 3WDHA 1MFAH 4I2XB 3D0LB 1L7IL 1WAAE 4JDZA 4JN2A 4P59H 3U82B 3S36H 3T08A 4XWOC 1W2KT 3W5NA 3D48R 5LGKA 1HKLL 2NTFB 5IHZA 1P4LA 3GFUA 5KW9L 4CJ0A 5IW1A 2EE3A 4XBPB 1S7WA 4G8EA 5FGCB 5J3HD 3BUTA 5ILTL 5BW7A 4I4WA 5FYKH 4S1RH 2XZAL 2W0FB 3ARGB 3MRBB 4FQLH 4PLKC 2E8YA 1OOAA 4G43A 2APFA 4NKDA 4NWTH 2NX5B 2J88H 4I9WE 4AY0A 5GHWH 3HI1B 3X3FL 5I75C 1JGDA 5L7XL 1JHTB 5HHMD 5GHWL 1TQBB 3RTQA 1PD6A 3PHOA 4V2CB 1TJHL 2NW3B 4TSCL 2VLME 3LS4L 5MEPB 1QSED 2NY0B 3S35X 1ULVA 3WHE1 4KRLB 3WSQL 2XKNB 4EVNB 3CSGA 4CJ1A 4QYOA 1A7RL 3LVEA 5E56A 1B2WL 5FDWA 2WQ8A 4HPOL 1U58B 4F9LA 5E94A 1AE6H 1AC6A 2IH1A 1MJUL 5CEYB 4RIRA 1AGEB 1QRNE 1NLDL 4HXAL 5BW7C 4TTGA 1VFAA 2DF3A 4LBEB 4OCSH 5ACZB 4WV1A 1T2QL 3WFZA 2ESVB 1ORQA 1MREH 4NHCH 3U46A 4WUUE 4WW2A 5C0ND 4JKPL 4JZNB 1ZK9A 1Z6JT 5GRUL 1TITA 4PRID 2B2XL 4M93B 2AJ3A 1ZGLB 1OARH 1J7VR 3MROB 4FQ1L 1NGQL 3QXUA 4XCYB 3ZYJA 1A6PA 4O2FA 4JFED 3PGDA 1UB5B 4CGTA 3FO9B 5B8CB 3H7BA 2ZNWA 4JO1L 2N1KA 5B3JF 3HTLX 3WDJA 4JQVC 3DRQB 4OLXH 2Q6WA 1LDSA 4Y7MA 2ZG3A 5EOCH 4EBQL 2IALA 4U2ZA 1X6NA 1T0NA 2AEPH 1EMTH 3NCYP 3FN9A 5D2LF 1AXTH 4L9LA 1VDGA 2XT1B 5GGUB 5FK9B 3X12B 3PWPA 1DUZA 2QKIB 3MMEB 4P9HC 2YR3A 1QO3A 3U36B 1HE7A 2K3TA 3LKOB 1EHAA 3UTPD 1RZJC 3RHWF 4YHML 4OCRL 1Q0YL 2YWYA 4X9IA 1Z3GH 4G5ZH 3RWIB 4MA1B 4L4TB 3V0WL 2AXHA 4EI5B 2E7HA 2D3VA 2VDKH 1FDLL 5HJ3A 3B6SA 2P8PB 1ETZB 3BSZL 3TN0C 3QUMH 3RWFB 4RGMB 3FCTB 1YQ2A 3QWQB 4MLSA 1WBYA 2OXHA 3D85B 1QYGL 4R0LA 1T1WB 3VXOB 2J8UB 1ZT4B 4W4NA 5C0CD 1JWSB 3CDGA 3KJ4C 1JBJA 4FFZL 3P73A 5A2FA 1DL7H 2MQ3A 3OSKA 3R8QA 1U2CA 5DDHB 5C07B 4XZUB 1NLBH 4E41D 1GC1L 3LEYL 4PB0L 4LDLB 5IK3A 2R0ZH 4JFZH 4X4XB 3HE7A 3MGTA 1AO7A 2YA1A 5CGMA 4P2OB 2YUXA 4P2QA 4QOKB 5BRZE 5MI0C 1X7QB 3KPOA 3IFLL 1KNOB 1BWWA 3QI9B 5L2KE 1BIIA 4MNGE 3GRWL 5F1OB 1QFWI 4YNYB 3MJGX 1I3GL 1PKQB 3MLTA 4XC3L 3MRNA 2NX5E 4OFDA 1C5BH 3PV7A 3L5HA 1I9JL 2YD4A 1ZHKA 3H9ZA 4ZFZA 4OF6A 1KCKA 3I6GA 3H9SE 3MYJA 5CEYA 2AJXL 1ZLVK 1OF2B 1E6JH 5DUBB 2NY4C 5H94A 5T3XE 1MHCB 1Q9WB 5H37H 1K8IB 4YX2L 2FJHA 3ZSTA 2CUIA 4AEEA 5TDOB 2DL9A 4HHAB 2X89D 4YHLL 4OLUH 3CXHJ 1OSPH 1AD9A 1T5XA 5JW3H 2EKJA 3P77A 1WF5A 1KF9B 3GO1H 3HG1E 5C8JB 1QBML 1Z5LB 2BNQD 5M95B 1NMBL 2C4FT 3OJ2C 5EUOB 4Z8FL 3IDIB 5IW6A 4E5XB 4NO2A 4UB0H 4Y4HD 2BSED 2YPLB 1FNFA 4ETQB 2R9HD 1EJOL 2QADD 3BIBX 1BQLL 1L0QA 2J1KA 4P4KD 3H7BB 3MNVA 2APXA 4PGEB 5DMGD 2AERT 3OZ9H 5JOFB 4PRNA 3RWHB 5I1HL 1UJTA 4JAMA 4KTDL 5ID1B 3TO4B 4R97B 3REWA 1QLEL 2NZ9D 3T0EE 2CDGB 1B4RA 1ERNA 4WV1C 1FCGA 4JZNA 3MUHL 4YAQB 5F21B 5GGTA 2DM2A 5D1ZA 1HQ4A 5IFJA 1P2CB 4LPXA 4I0CC 1I8KB 1G0YR 1IGTA 3VRJA 2BMKA 3IJHB 4U1NA 4XGZB 5D7SL 4ZUTB 5B38G 3UMTA 3O0RL 1UGNA 3RPIB 5DJAB 1IKNC 4LIQH 4Q9CA 1XGTA 5DI8B 3N1FC 4U1GC 1FFPA 5HHVL 5ELIA 2WANA 3MACL 4M7KH 2P44B 3SBWA 4P5MA 4TPRL 2GJ6E 3BPLB 4P2CG 3ULSA 3FRUA 3IJSA 5ANMA 3SJVE 4JFHE 1HH6B 2AXGB 3K7UA 3VH8G 5C8JA 1G9NH 3NCFB 1MCCA 3ARED 1JGDB 3GIVB 1BBJB 2XWBA 1JYWA 4OLEA 1FL5B 1JUFA 5ETUA 3W5MA 1FO0B 4IM8A 3QCUL 4EIZC 5CAYB 5DRZB 3MBED 3S5LB 4NRZA 4YGVB 1ZE3C 3VG0H 1S8DA 3FB5B 2APWA 1JZ2A 4NNXA 5IV2B 2Y72A 2OS7A 1WIPA 1CLCA 2WUCH 4HIHA 4PJDA 4QRRE 4RX4A 3RP1A 2X41A 4RMRA 2GITB 3IKCA 4GG6A 4Z9KB 5CFHA 1SJEB 1YA5A 5IB3B 1G7PA 2CK2A 5F7UA 3TIEB 3FTGA 5HHOA 3ILQC 4R2GC 1OAQH 3RNKB 1T20A 2VLKB 5DJDB 3QXWA 2NY6D 1A3RH 4P2QB 4QOKA 1SJXA 1U8QB 4LSDA 1F42A 5TDNA 1CCZA 4ODWB 2FHCA 3AAZA 1HHIA 5FCSH 1WT5C 2DQIH 4HUXB 5DMGC 3WXWH 2EEAA 5EOCL 5IUSA 1ZA3A 2IWGA 4Y16D 2AV1B 3SKOA 4OGXL 3V6ZA 5D7LE 4FN0A 2Z4QB 3IFLH 2R29L 2OTPA 4YEEA 2DICA 4BKLA 3VFOB 1HSBA 3SN6N 1MRCL 5E2WH 3OJMB 1NGXA 5BVPH 5FUCC 3C87A 2X42A 3AU1A 4P4RA 1BQUA 1LE5B 5DRNA 3IB4A 4KQ3L 1LK3H 1TTGA 1FFRA 1PG7H 1V7ML 1CGVA 2XV6B 1HYSD 2BCKA 2AJVH 4UNTA 5DT1L 2JB6B 4MAYA 1YEJL 2O5XL 3BISA 2BVQB 5I1JL 3TBVB 1P4IH 4XVTH 3SPVA 1FYTE 5D1ZC 4P4KA 4XAKE 3SHSA 1RUKL 3DI3B 4OQTL 5F8RC 2BK8A 2VZSA 1T5WA 1T03H 2FNBA 1F3DH 2QSTA 1EVTC 4EDWH 3KS0J 3FMGL 1VADB 4ZFOA 2YOCA 4ZOCA 1NCAL 1DFBL 2AKRA 4EKXA 3O4LB 5IFAL 1GAFH 1JN6B 4GMTH 4OZ4B 3G5YB 4L4VA 4Q9RH 3AS0A 4S2SB 4JFHD 3DIFB 1CE6B 4HUVA 1P53A 3ZE1F 1Q9LB 4PGCA 3WFBL 1JNHB 4Z7VA 2R1XB 4OFYA 1L6ZA 3CFDA 1SY6L 2PYFA 1G1CA 3RIAK 3BKJH 2YRZA 2HFTA 4F9PA 3QG7H 5IROA 5IK3B 4UT9L 1KPVA 2YXFA 2ITDA 2R23A 3HZKA 5HVWA 3GNML 3SCMB 1YYLL 4GW1A 4LCWE 1GIGH 5EN2B 4YX2H 2Q7YB 2Q3ZA 5EUKB 1AI1H 4FNLH 4OGAC 4K94H 1X5KA 1J12A 5TGBA 3T0XA 3RGHA 2UZXB 4R4FH 5E4EC 5L88L 2C7UB 3TT1H 1JMZA 3DYMA 4QTHA 5JTWA 3QBTB 5E9DA 3VXPA 5SX5H 3BQUA 1RIVH 4BK5A 2VC2L 2XKNA 1PYWB 2VERN 5I17A 1XGPA 2Y07H 2CR6A 1FL6A 1HCFX 4JLRB 5T1LB 3HPLA 3ZKND 4HWBL 4Z7NF 1BFTA 2NY3B 3CFEB 3RWDA 3BPNB 1UZ6E 1HHGA 3VI4F 1C1EL 3RI5F 2PO6D 1S5HA 1F3RB 1QSFB 4JM2C 3T4YA 5E99H 2HRPL 4H8WC 4ZOBA 4NYLA 2GY5A 3AROA 1J10A 2HWZH 4OM1H 5C0GA 3SOBL 1RHFA 2ZCLL 4JFFD 1HOCA 4HC1A 2P8PA 3VU2A 1RZFL 2ORBH 4WI3A 3BXNA 4JGUA 3UTSE 2BRQA 2ZP0T 5F71A 3OF6D 3GSXA 2VZVA 1R6VA 1Z9LA 1R5IB 5CJQH 5INCA 5IG7A 3V0WH 3SGKC 4GG6F 4XX1E 4JB9H 2E27H 4HWNA 4PRHD 4NGHL 5J12B 5AZ2H 3QPXH 4NC1C 5F1NA 3RVTC 2GTZB 2IFFH 1MCPL 2BSSB 4JDTL 5F6HI 3W0WE 5KS9A 1P9MA 2F5BH 2GI7A 1WFUA 2BOCA 4LGSB 2IALB 2FEEI 2IQ9H 1PW3A 4WVRA 3MV7B 2A74B 4JO3L 3QWRD 1VERA 4ZAKD 2WWMC 2KDGA 4ZAKA 2BNUB 3MJ9L 4U1LB 5HHPB 1WZ1H 1CVRA 4G7VL 5JR1H 2W9LA 3L95A 1UADC 4C57C 4BELD 3QDJB 1N5YL 3KPMB 4LHUA 2VABA 3SDXB 3T65A 4X4MA 2JB6A 1ZTXL 4AJ0A 5IB1B 3OAYK 1RZ7H 3S98A 2IPUG 2XQYK 3C9NB 3AREB 1QSFD 2AQ2A 2CLZA 3HUJB 2VE6B 3KR3L 3H3KA 4G8FA 4KV5F 4CAGA 3UTQB 5IEKB 4K9EH 3K46A 3LKPA 4UV7H 1H3PL 3CVHH 4LSUH 3GDBA 3VFOA 3U1SL 1WFNA 4D9QE 4YK4B 4KUCD 3HLAB 5FGBA 4Z7VF 1CIDA 3OKNA 5J1AB 2DQHL 4JKWA 1G6RB 5EU5A 2F5BL 5SWQA 1QHOA 2UWEF 4IRJD 4AIZA 3PG2A 3L3HB 2P46B 3L3OA 3FQTA 3D69B 5TE7H 4WJ5A 3KPNA 2EDQA 3ET9F 4KDWA 4LF3B 3OKOB 4PG2C 5DXWA 1BD2A 5EO0B 2ADIB 1YNTB 1KB9J 3DUSA 4EQ2A 2AEPL 3IAPA 2ZOLA 1LD9A 3W9EA 4UQ2B 3KPLB 3L3IB 5CHNB 4NOFA 1UM6L 2X1WL 1BJ1J 3VWKB 4XP4L 5IKCA 4HJJL 2NY7H 2R2EA 2Q1EA 3FQNB 4S10A 5E2JA 3MRHB 3X13B 1YJDL 3QFJD 3HMXL 4YHIA 2JCCE 1YEEH 3N1MC 4PGBA 3CDCA 2FZ3A 1F6FB 1M71A 3HRZA 3WFEH 4DKFH 1Q72L 2R39A 1KJVB 1W72L 3DBXA 1WC7A 3QFDA 1FSKB 1QSVA 1OWWA 5E6ID 3F7QA 3ARZA 3CX5K 4KXZH 4RGNC 3WFDL 3MOBH 4M1CD 4X9HA 4M1DH 4TVPH 3QAZC 1NEZG 2FSEB 3W39B 2C26A 3EYQC 1WV7T 3MNWA 5EO0A 3RL1A 2WBJA 4KZEH 2YA2A 2AJVL 4NPYB 2W9DH 4S0TD 4ZNCD 3CVHA 4LOUD 1XIWB 5JOFA 2IPTH 1WITA 1K2DB 3QDJE 4DTGH 4FABH 3CJJA 3MA7A 3ZL4H 1YEKH 3VRLF 3ARDA 2I24N 1CDIA 2XY2A 4MDJA 2JJWA 1BLNA 4NC2B 3RPIA 4ELMB 4X5XA 5EBGA 4UB0L 4PJFF 4F7TA 1TJHH 3I3DA 1KGCD 1KJMA 4UTBH 3BGMA 5EULV 3CC5A 3MV01 4LLDA 1KG0B 3X11B 1IGCH 2FATH 4JKMA 4M6MH 2DYPA 2BHYA 4PJDE 4XPTL 4K8RH 2FO1A 2HVJB 2BNQA 1T1ZA 2VQ1A 4D0BB 4LASH 4CBPA 5DFTA 4G6MH 3T65B 1RZIB 2YD1A 3TA3C 2OZ4L 3UYPA 1F4XH 4U1SA 5IHUH 5KAQF 1MHEB 1FZOA 1OCWH 3DXAE 4XPAH 3KPRE 4IRJC 2EEBA 3NA9H 3EGSA 4JCLA 1QG3A 3WXVH 3MYJB 5B3NA 3KDMA 4JG1H 5HVFB 3S36L 3N9GL 4GQPH 4NBZB 3MA9L 2HLFC 4D0DB 1LO2H 4RRPA 1BX2A 3D39B 3MV11 4NQEE 5D2NC 3BDBA 3K81A 2AJZB 4PUBH 4Y5VB 1BQHA 3WUWA 1RIHL 5ALCH 3AGVA 2G5BB 4LCCC 5ABDE 2DQFA 3C8HA 1CICB 1MRDH 5M7QA 4FQIH 3F12B 4PP2A 5EBWB 5A1AA 4YBLB 3X14A 3HE6C 1UJ3C 4RAVB 4PRPD 5DJXA 4ODTH 1B90A 3PNWA 5C0JA 1QPXA 1QFWM 1T4KA 1EIBA 1OM3L 3V4UL 3CNKA 4OCWH 1R3JA 4UAOC 4QOKD 4J2XA 4OJFL 4FTVA 3MRKA 4M6OH 3ZTNH 5EOTA 4OSUH 5ICYA 1NSNH 3ARGD 3PGCA 3B5TA 3H9YA 2FWOA 3OHXA 4K3DH 1PKQE 3NA9L 1NGYA 5DMKA 5GIRB 4YQXH 1YUHB 3PDDA 4PJAF 4YJZL 2DL2A 4Q9BA 3V4PL 4GW1B 4HSQA 5FAAA 1IARB 2EH7H 3IS1X 1X44A 1VACA 4M9OA 4HKXA 3U4EB 4HUUA 2DLGA 4LHUD 4PLNC 1I4FA 4HUWB 3O6KH 1F4WH 4XMKH 2ZCKL 5IM7B 3IU3B 5F7EL 3O11B 1FN4B 3LV3B 2EH8L 5L2JA 2PCPA 1RU9L 1ZHBA 3WLBA 3F7PC 2BY1A 4LL9A 2QJDA 2D31B 4D0DA 3PL6D 5CD5D 3OJDB 5H8DA 2CRIA 4DKEL 3O4LA 2DLHA 2BNRB 2V9TA 2Z31C 2YSSB 1J1XH 1F3JA 5I1LA 3FO9A 3FHAA 3UPCA 1DVFA 3BEWB 4ODXA 1EJOH 2IPKA 1MCQA 1QSEE 4J6RL 3P0YL 2JB5H 1CTOA 4AMKH 4KZDH 2XZCH 3CU1A 1RIUL 4PJFE 4MX7A 5DD6B 1RUQH 1N5YH 4KROB 4M7ZC 3MFGB 3H9HA 3MMEA 4HV8A 1MREL 4NHCL 5LGJA 2P7TA 1IILE 5JOPD 2J5LB 4YHLH 3V6FA 1SEQL 1U3ZA 2MJWA 2Z31A 2X05A 15C8L 1YN7A 3C09B 4L4VB 3H42H 3UBXG 3L7EB 1TZGL 2XACC 3WHE0 1Q1JL 3BP5B 2VOTA 5BVJB 4QRTA 3VFVA 3CCHA 3SDCC 4ZXBC 4L29B 4RCAA 2HFEA 3IXAB 3U7WH 5IMMB 1TFHA 3JWOH 4G6KL 5FF6B 3X14B 1A1NA 4TSBH 3KLHC 4FQQA 1CFBA 4RMTA 5MHSD 4U6TA 4GRWE 1T3FA 3TZVA 5TDNB 1A6AB 3EBAA 5C08D 1L0XA 2OI9C 1KIQA 4OCLC 1T7ZA 3NCCB 3GJEA 1QKZH 3BQUD 1BFOA 4NN6B 4JFZL 4H0IA 3T8XA 4ZG1A 1YUHA 1MWAH 3O4LE 1U3HD 1F2XK 1TVDA 1U3HA 4NQXA 4P9MH 4QEGA 5GRJL 5TPWH 4BKLB 1YY8A 3DPBA 4KVCL 2W9DL 4D0CA 5BQ7A 4HIIA 1JK8B 2EXYC 3D3VD 4NNPH 4OD1H 2X7LA 3S88L 2Q7YA 1D5MB 1TZHB 4MCZA 1A14L 5FCUH 3BIAX 1NC2A 3BVNB 4XT1C 2GFBB 4J1UB 5FKPA 4NQCD 1PY9A 3GO1L 4OZHF 1JWMB 3ZE2E 2UWEE 2DS4A 4Z95L 5C0CA 3GMNA 4G6KH 4JZOB 4HGKC 4XXDB 5E4IA 4Z7VE 2NW2A 2VXUH 4JQXA 3JTTA 3BPCB 4DGVL 5H35A 4YPJA 1TZGH 4FFVC 2YC1A 3KNBA 1AHWA 3V7MA 3B4NA 5D1QB 4CDGC 3M07A 1KIPA 1DQDL 1XGYL 1CE1L 1DBAL 2LE9A 4HS3B 5DJCA 1JPTL 4O2CB 1A7BA 4YHNA 2YZ1A 5GZOC 4XVUC 1T21B 1QD0A 4Q74A 2CRYA 1OW0C 2WUBH 4HQQL 4N90D 5GPRA 2R8SL 4RAUA 1B0WA 4Z7OF 3GBMH 1JFQH 3LH2L 3U0WL 3ZDZF 3WLWD 4TTDC 3VCLA 1KENL 2DQDL 4LSSL 2DDQH 2IAND 1H3WM 5IMOA 2G9HA 3DWTA 2WIIB 3HRPA 4MA1C 1IKFL 3BAEH 4L3CB 2E6QA 2CDGA 3QXAB 5I74B 1BZ9A 2Z91B 4JKPH 2BXYA 2JKXA 4OCXH 1GAFL 1YPZE 2EKSB 3CFJA 2HFFA 1LO2L 2PUQT 2W1NA 3ARDC 4G3YL 5C1MB 1MNUH 5I1KH 1KTDA 3SQBA 1QR1B 3QEQB 3U83A 1MCSA 3P4MB 4HS6A 4ZFFA 5IVZA 1DSFL 5L0QC 4PJIB 5FV1L 5FUOH 4AM0B 4CMMB 2XTJC 4J12A 5BZDB 4ODWA 5DS8B 1INEH 4OGAD 3EJJX 5JORB 4XC1H 3DI2B 4XP9L 2BFVL 1W0VB 1J8KA 3U48A 1XCTA 5KSAD 5IG7B 4GS7C 2H3NA 1LQSR 2ILLA 1SJEA 5IB3A 5D7IE 1MCOL 5EU5B 3RY5A 5CCKH 3H9SA 1L6XA 4K23L 5D7JC 4I48B 3L7EA 5T1DH 5A2IH 5MENA 3WE6B 1HILA 4GW5A 5ALBL 2FZ3B 4Y2DA 4NRZB 1YYML 4P5TD 3ARPA 3IS0X 3S4SA 3O3AA 4RGMC 4XCEA 4WO4C 3T2NH 4RMUA 5SWSE 4WENB 3VFGH 5KTEL 1ZVHA 1AD0B 5BS0D 2P7TB 4GT7A 4JM2D 4WUUD 2X1XR 4DK6A 1U8OB 4KJQD 4WHYG 3QCVH 3C5ZA 2ZNXA 3MC0A 4HHAA 4HH9A 5IP4A 4OF3A 5I2IB 4UUJB 1MNUL 1SBSH 1Z9OA 2OJZL 2DBJA 4OLZH 2XPGB 2OM5A 5FKAA 3TVMA 2DKUA 3TVMD 3UC0H 4X5WA 3F7YA 2HWZL 3EOTH 3AXLA 5BZWA 4D8PB 4X6CE 5EZOH 2E9JA 4XPFH 4JZJB 1MI5E 4DUXA 1S7QA 1ZANL 3SKUD 3UPRA 1WCBA 4LVHB 3BP6B 4OZIF 3ORJA 3MRNB 4GBXA 3S34L 4MA7H 2F5AL 3EYFA 1MLCB 4EEEA 3MLZL 2VR5A 5CZKA 3C9NA 1QRNA 4NZTH 4XXCA 4K7PY 5GGQH 3TZVD 3U36A 3O8XC 4Z0XB 3JWOL 5DUPL 3BIKA 2VDNL 1DR9A 3O6KL 2ESVE 4WU5A 1J0ZA 3PWUA 1IAKA 4PP1D 5CSZB 1CBVL 1AGBA 5FYKL 1CXKA 4NKMB 1OGTA 5L0QB 1AXSB 2DB8A 3UAJC 3E3QE 3BRDA 3DXAA 3I50H 4Z5RB 4I3RL 4H1LB 5JPNB 3UP1A 5KSAC 1FE8H 2DLFH 5GGRA 4QRQB 2W60A 4X4ME 4YXHL 1RZGB 4JFPB 1FCCA 5EU3B 1GGYA 5BRZD 4NZUH 2VIRB 4MD5B 3WHXA 1I8IB 2AV7B 1INQB 5GRJH 5TPWL 4F7PB 3DVNB 1VFUA 1FVDB 1I7ZA 1G7HA 4M1GH 5E08H 5FEBA 5BJTB 4XCEB 1F8TH 3BEWA 1A4JB 2VB5A 4GAGH 4WO4D 4U7MA 3T1FB 4MJ4A 3LQAL 3P11H 5E70A 3MV9D 2GCYB 4DGIL 4EI5C 5EOTB 1CFVL 3H8NA 1XF4A 4RA0C 3TN0D 3L5WA 4MXQC 5JW5B 2QSCH 1RMFH 3ZSSA 4NM8H 1BVKB 3DHJA 4N0YL 4RAHA 5IB2B 1D6VL 4U1HB 3L6FA 1S5HB 1F4WL 3DX7A 5I8KH 1KNOA 4KK6C 4PJEF 5HHXL 1X7QA 3KPOB 2IEPA 2G60L 3OPZL 1MFCH 1Z2KA 3QIBC 4BSWA 3F8UB 1K6QL 3DNKA 4N1HB 4P3CL 4UTAL 4LVOC 2IH3B 1GHFH 3WJLC 4X6CB 3BPOC 3P0VL 5FO9B 2BSTB 3MRIB 2IMNA 2PW2B 5ID0A 1N0LA 3WFCL 3TCLA 1DANU 5GIRA 4EBQH 4UIMB 4NN6C 4FG6C 2VL5A 2E7LA 1EUTA 2C1PB 2VN7A 4MDJB 2R8SH 3O45A 2A1WL 3HC4H 4U33A 4EXKA 2CKBB 3DMMC 3U79A 4KKCD 2HRPH 1RIUH 3IKKA 4X8JA 1GSMA 1ZLWK 4LCUB 1VEPA 5E8EB 5CBEB 5HPOA 1I9IL 1EAPA 4PGDB 5C7XH 1Y18A 1A8JH 2DI9A 2VQ1B 4WW2F 2KPNA 3BKYL 1FGVH 2NW3A 2NLJB 4FQXD 4JFOA 1T89A 4JHWL 4MJID 4YC2C 4C58B 3UAJD 5BZDA 1J0HA 5IBLD 5CZXD 1BBDL 4NN7C 5L8LB 3TV3H 1LO0L 4LSPL 1EVUA 3F62A 3O3AB 4NC1E 1QFPA 2HJKA 4TQEL 3UJJL 1XIWC 4S1DD 2V2XA 5HYSB 2AKRB 3RX5A 2XYCA 1UB5A 1X5HA 1NGWB 1RJYB 3SDYH 1LP9B 2FBOJ 5JW4Q 2ZUWA 4DKFL 5CGYD 1B0GA 5F7WC 3ZHKA 1SJHB 3EYSL 4N5EC 4P2OD 5JO5A 3KHQA 3CXDL 4I77H 4Z6AT 1LVEA 5FECB 1KV3A 4BQCA 3ILPA 4WUUA 1NC4B 4PTUB 2CDEA 4WNQA 1XZ0A 2FATL 4KUCF 4P46B 4AH2A 1FLRH 1TQCB 2YKLH 5TE4L 3L3OB 4M62H 3O6FC 1S7TB 2LQRA 4GMTL 4WEUD 4YXKH 4U1IA 3LKRA 2GK2A 5TE7L 1D5ZB 2ESVD 3VDAA 4QHLB 4LAJH 3MZGB 4UDTA 5FIEA 5INDB 1O7SA 1M05A 4EDWL 2DRUA 3BEVB 3H42L 3UTTE 4MB3A 2WLZA 4LQ1A 4RMQA 2PW1B 3K0WA 4EVNA 1A6ZA 3HE6D 1LO5B 4HEME 1BZ9B 4LCIL 4G7YL 3MRJA 1RAMA 4JM2B 3UYRH 4OLZL 4PV9A 1WAAA 5DEFA 3PWNB 4DVRL 5IMKB 3G04B 4FRWA 4WI7A 3TESA 4E42A 4KDVA 2C3HA 2YD6A 4EN3A 4OZIB 3MFFA 4NQCA 5F6IC 2FR4A 5D7JA 4JRYD 1IM9A 3QXVA 2I9TB 4ZDHB 1JK8A 4HIIB 1GOGA 4P4KC 3VFNB 4HPOH 4K8RD 1GIGL 1HHJB 3ZE0F 4GH7B 5TH2A 4QKXB 1FDLH 2GJJA 1UCBL 3C2SA 2NZIA 1BZ7A 3N1PC 5F7YC 3Q6FA 2ZCHL 5ITBL 3BKCL 2A0LC 4I0PC 5FA3A 3B9AA 1J1OH 4IIQC 4ALAL 1R3IH 4QGYA 4X4XA 4ZPVA 4POYA 1JZ3A 1N64H 4MQXD 1J1OL 2JLLA 4KMQA 5EZJB 3QDJA 2DQHH 3P9WB 2CH8A 4NDMB 3IU4L 1LILA 1HINH 4UDTB 2J8UA 5FUOL 1CDYA 3G9VA 1WT5A 3BP5A 1R3HB 2O61B 2A74A 1MHPH 5LQBH 2F8XC 1AXSA 1ZHLA 2LV4A 5EC1B 1J0JA 3ZKXC 4KJWD 1NCCH 4UIKL 3IDIA 1NFIB 5K9KA 4M6OL 1WWCA 2VDMH 1A4JA 4YDVA 4K3GA 5F3HA 1R3LB 1MAJA 4IJ3C 3V6FB 1NJ9B 2ATPA 2CKBL 3LKSA 4WDIA 1JGEB 3AREC 4YPGB 5F6IB 4MLIA 2D9CA 1ZAGA 5FYLH 3OAYH 5T3XH 1PG7W 4AENA 3NCEB 1RZGA 3MCKA 5BCAA 4MJ6B 4N8PA 4YR6B 1PFCA 3U0PA 2HFGL 4KI5D 3VWJC 3RWEB 1CK0L 1WWAX 4ONFH 1DQJA 4MS8C 4HJGA 5DTFB 3G5ZB 1RIVL 2FJGB 2O61A 3OL2A 4LAQL 4MQTB 4PJ9B 3FRPG 4K3HA 3B9EA 2VXSH 5KS9B 1A3RL 3PNWB 4Z7UF 5C0JB 1K9TA 5KVFL 2GTZA 3SGDI 3FFCE 4MJIE 2ZUQC 1U92A 4N0UA 4OZFG 1NFDB 3GMLA 3SJVB 5C2BH 1DBJH 5J7CC 4MA3B 8FABA 1AKJA 3KG5A 5IFHL 3C60B 3FB6A 3ULUF 2E8ZA 3B3IB 3KYOA 2P8MB 3MOAH 4XPTH 5H94B 5C6WH 5EU7E 5E1AA 1WZLA 3LY6A 1JP5A 2A38A 4FZEH 4QTHB 5CUSL 1FSKC 1KT2A 1NBYA 4XBEL 3FOLB 5DVNA 5C0GB 4UAOB 1ZT1B 2C1PA 3V52L 3LQAH 1NAMB 4FQ1H 1VADA 4ZFOB 3TGXA 4DUVA 5ADOH 4X6DB 4RZCA 5EUKA 3WLBB 3H0TA 4J3XA 4U1JB 3GMPB 4D2NA 2P48B 4HWBH 3QDMD 7FABH 1J18A 4MCYA 4KTYA 1SVCP 4JJ5A 4P2OA 1C1EH 2Y5EA 4PY7B 1T03L 2ZJSL 4PJ5D 4PRBB 2OLDA 4ZXBA 1SM3L 3O9WC 4AL8H 2V5YA 4U1JA 3ZTJG 2ITCB 4HT1L 3C5JB 4YHZL 4TRPH 4YUEL 2NX5A 5LWYH 2VTFA 3B2VL 1JIBA 1GYAA 1NEUA 1DBKL 5DD5H 4JGMA 1GCFA 1P7HL 2VMFA 4S1QL 1W72H 1A1OB 4PRIA 1UKTA 3J7HA 4JCMA 3VXTB 4I2XE 2C4XA 2JE8A 1LEIA 4L3ED 1YEEL 5F93C 5GRVL 3WL9B 3FL7A 4YR6A 4UT9H 1YQVH 2Z91A 2XN9A 1TJGL 1QQDB 5CEXA 4NP4H 2VZ3A 3QO1A 3RNQA 1QLEH 4KI5C 3VWJD 3KXFA 4ISVA 1HSAA 2A9ML 4JFPA 1S7VB 4M6AA 2IAMC 2H1PL 4L9LC 1MCWM 4GO6B 4JRYE 5IQ9B 3SDAA 1A7PL 2GJ6D 1A7OH 4AQ1B 1JJUA 3TO2A 1WC7B 5BMFL 2CKNA 1E6OL 2WBJD 4JQVA 4G6AC 3PL6B 4MQ7B 1OAXH 1N2RB 1BVLA 3WIHA 2R0LH 1JPSL 2ADJA 1CD1A 4MA8H 2H8PB 4HUMB 4ZNEA 5L2KD 2FD6H 1I1FA 5F7HA 1DEEA 2X2YA 4N9OB 1YEFH 4W6YB 3IDGB 4IMLB 4N0UE 2EKSA 2FX7L 3MCG1 4PJGF 2HKHL 3IVKB 4XNYH 1JE6A 2KZWA 4IDLA 4PR5A 3HE6B 5H35B 2MOVA 2XOTA 2R2HA 2UVFA 3C5ZB 5D72L 1EGJA 3C2AH 4AENB 3CDFA 2APBA 5IVXE 3B9KC 5CS7A 3ZT5A 3ZT6A 3TBSA 4M48L 4XVJL 1TENA 2BNRD 4Y4KA 4Y4KD 1H15B 1LHZA 4RGND 4R3SB 4QXGH 1HHKA 5SWQB 4Y89A 4M43H 4I4WB 2EE9A 3THMH 1XGTB 1EFXD 1R5VB 5BO1H 2DWDA 5DRWB 3KS0H 3MRKB 3BKML 3ZKMC 2AXJA 1JZ7A 4K23H 5T3ZH 1U3HB 4NQXB 1AGCB 3BKMH 1BEYL 1MY7A 2NCMA 1HHKB 3LKPB 2GKIA 1S7UA 2NQCA 1HXYB 3VGHA 1AHWB 4P46A 4YC2B 3ARFC 3O9WB 5MEPA 3EJZD 3EHBC 5IMKA 2G2RB 3BI9X 1KXTB 3ZDXF 2DIAA 2XA3A 3CD4A 3BESR 5IQ7H 3QP3A 2DI8A 3CFCL 4YLQT 5HHXH 4P23B 2J8OA 1N26A 3K2MC 3TYGL 1SEBB 2HYMA 4X7TA 5GGVY 5MHSE 4JJHA 1AD0A 1BWMA 3FN3A 4ZQKB 1V3MA 4X0KB 3MXVH 1XGRA 4NQEA 3GMOB 4M8QB 4R4ND 1NLDH 1KJVA 4QWWC 1N59A 1DN2A 4FQXA 3UEZA 5CSGA 3QDMA 4KK5C 1AE6L 2A77H 3EGSB 4XX1G 4I3GA 1PG7L 3GMMA 5F70A 2YEZB 5EZOL 3FQNA 3QRGL 4OV6F 4Y2DC 5FM5O 4E0RA 3F58L 1Q0XL 1FPTH 3AS1A 4D3CH 2D03L 5K9OA 6FABH 1T5XB 4B53A 1A7OL 2RR3A 4QRPE 3FO1B 3BN3B 4PTUA 4MD5A 3WHXB 1IVLA 5DJYA 2G2RA 4LDEB 1KENH 2B39A 4PJCA 2YRPA 25C8H 4R2GB 3IJSB 5KS9F 5E7FA 4JO1H 5F44A 4LIQL 1NGWA 3V79C 4Q97A 3SE4C 2P5EB 5IFHH 3VFGL 4HXBL 3W2DH 4PRIB 3AM8A 1ZVSB 2EDWA 1MAKA 4LMQI 1U41A 5LBSH 3QDME 4C54A 1MOEA 3DX6A 4TULH 4Z7OE 2YPVH 1LO3H 1R0AH 5CSZA 3GHBH 3HS0B 4JY4B 1LE9A 1H15A 3BPCA 3NH7L 1YNLL 4M3JA 5D4QA 4NO0D 2NZ9C 5AZEH 3MV8A 1ZLSH 4L4TD 1A6TA 2H9GB 4WI5A 4JQIH 1Y18B 2XXCB 1IAII 4M1DL 1OLZA 3GMPA 3KPMA 4MCZB 3HZMA 2RHEA 3O8XA 3VE0B 2B4CC 4HGMA 5IMLA 3GSUB 5I71C 3N9GH 3LSOB 3S9DB 1ES0A 1XAUA 4K7PH 4H1LH 3CSYA 3S3PA 4NQSA 4ZFZB 1DL7L 5GGSY 1MPAL 2DQEL 4L8SA 1ZHNB 4XH2B 4JY5H 1KFAL 5HHMB 5TGBB 3F6IA 5I71B 3EOBB 2MNUA 1SHMA 4Y16C 5I1KL 4JFXB 3TPUB 2AW2A 3KNBB 4CNIA 1OD9A 1QSFA 5DHVH 3V0VA 5F96L 2PW2A 1RZKH 5ID0B 4OLUL 4G8IA 1CIUA 1OL0A 4FFYL 1TJIL 4BFIA 4KHXL 1IGJA 2YWZA 4NWTL 2NLJA 4G8GE 3VXSB 4XAWL 3MTRA 5C0CB 2OK0L 1HN1A 3HNVH 5D2NB 1U8OA 3VXQB 3CSPA 3DX7B 1AH1A 2HFEB 3IXAA 1WTGT 3O41A 3PWPD 3DXAB 3OG4B 5FHBL 1T6VN 4TULL 2Y1VA 1MRCH 5E2WL 2Q6WB 5LWYL 3MLUL 5FHAH 5F97E 2JCCB 4HKBB 4GRWF 4PRHE 5CJXA 4DAGH 3LSOA 5TQ2L 4P9HH 1G9MC 5ICXB 1U3YA 3T8XB 4LQFL 3GJFK 4XCYA 1BFOB 4GAFB 1RK0B 2GEEA 2C3VB 4F58H 1QSFE 1IT9L 1DQML 5CZXC 5SWZD 4PLOB 4XWGL 1YMHB 4NC0B 1GGUA 4U2YA 4PJCE 4MX7B 2BNQB 3NIGE 5DQ9B 1I9IH 1MIEL 4WTXA 3NA4A 1N5AB 2OQJA 3AY4A 4FFZH 1RIHH 2R1XA 1KLFA 2GK0A 4IOIB 3EOYG 3KLHD 2C5DC 3PDOB 2O5YL 2VZUA 1TQBC 3CC5B 3TPKA 5GGVH 5A2JH 1UQSB 5K9KB 4RZCB 1F3JB 2YD9A 1RUAH 2RCSH 3D85A 1ONQB 3BPLC 3ZKXB 1DEDA 2Y36H 4FS0A 3SKNB 1G6RH 3J8F7 4NRYB 3MOAL 1MCJA 4LFHD 3H3PH 2A83B 2OL3L 4JO3H 1AGBB 1NCUA 2HKFH 3QQNA 3FO2A 3RTQC 3WYRA 3S5LG 2VSCA 2GJZB 2YHGA 4N8VG 1FZOB 3WKMH 5JW4N 1CL7H 3HZMB 1WCQA 1F90L 3LCYA 5I19H 3ULUD 1Z3GL 2BVQA 3GBLA 4F7EA 3KYKH 5JIHA 2YUZA 3F5WA 5DK0A 1AKJB 3OKDB 2W60B 2IANE 5D8JL 3V4PH 3PWPB 1CFNB 5GGUA 2WW8A 1TLKA 1ZS8A 4ORZC 1KJ2H 4OLWL 4PJHE 5DURD 4XP5H 2CLVB 4HWBA 4KC3B 5EOQL 2APVA 4PJCF 5CMAB 4UMGA 5DJZB 3MX0A 2RAMA 5DD0L 3ARDB 3MJ6A 2AK4A 2ZOKA 3LEYH 4OZHA 4PB0H 4PJAE 1UVQB 5TF1H 4RAVA 3VWKA 5IKCB 2A6DB 4DGVH 1MFDL 1RFDL 1I7TA 4FXGB 4X98A 5ESVB 1JF5A 5FO8B 1IGFH 2YBRB 2F54A 4LLMB 5ITFB 2HT3D 5CWSB 3HPLB 4OZGB 1KTRL 5E8NA 3IT8D 4OIBA 5KN5A 5GRXG 5BOPA 2VLJD 4YHKL 1A6ZB 4M00A 4FP8H 2I07A 1I1YA 4GBXB 3UJTH 3Q3GB 3VA6A 3MLVL 1OQOA 4JFFA 1T1XA 4QY8B 5EZIH 1KEGH 2BERA 4G5ZL 4HZLA 4HXAH 3QUKB 4R26L 2GIYA 3LS5L 5HDQL 2D7TL 3RGVB 2H2SD 4O5LL 4K7FB 3DUUB 2YD3A 1P7KA 1MCPH 3TN0B 2Y6SC 4NO5A 3TH2T 4OI8A 1GL4B 2H3NB 1G7LB 1GVIA 1VEMA 3IFPB 3MV7E 1KEML 4JREB 1AKJD 4MMZC 2QSQA 5F7LB 5D1ZB 1S9XB 2ZWLT 1N8ZA 5C07D 5HYQA 4UQ2A 4LEOA 5IMOB 5JIKA 2DQFB 3RZWA 5E8NB 5I15H 3LQZB 5HGBA 2P5WE 5DZOA 3QNZA 5JHDE 3S37H 1T3FB 1LE9B 1NGZA 4YDIH 4HW6A 3ABZA 5IJVB 3FTGB 3ULVL 4L3AA 2IC2A 5GS0L 1VPOL 5C6PB 5C2BL 1LK2A 2DLTA 3DGCR 2EDJA 1U8MA 1FFPB 3S37X 3ARQA 4TUKH 1SYSA 1KTKE 3SDYL 4ONGH 3BYTA 5IJKC 1KTDB 5E99L 3EOTL 4NZJA 4X6DE 5E9DD 3CPLB 1DBBH 4MNGB 4LSRH 4X7CC 1R5VA 1G6RL 4HJ0D 4LSUL 5EZIL 3F7RA 2GSIA 1KEGL 4U1SB 1G6VK 3VRJB 3QXAA 5I73B 1EEYB 1LDPL 5EU4B 3S35L 3SDAB 2FSEA 1P4IL 4XVTL 2A6KB 2IANA 3WS3A 4QRRD 4KZDL 3G6JF 5C7XL 5FECA 4H20H 2IAMA 3LEXA 4M4PA 1FGVL 3DV4A 1H5BC 3RX8A 4R96A 1KIRB 1XCQA 3ULSB 4RDQF 5K33A 3TT1L 3WJJC 3OTTA 2QQKL 3KYMA 3DUUA 4HS6B 4ZFFB 3FFCB 5HGGS 4ELMA 2DWEB 1J8HE 2RGSA 2BVPA 4GRLA 2F19L 3N06B 4JFQA 2BNRA 1UXSB 3GIZH 2QADB 1A47A 5JHLH 1DVFC 4NYLB 1X5GA 3PV6B 1S7TA 1NH6A 1T2JA 4JHBA 1JHLH 2JK5A 4OQTA 1XF3A 1FZJA 3OKKB 5HGDB 1PY4A 4ZD3H 2EE6A 3W82A 2FX9L 5HGBB 1D9KA 2ZUXA 2Q87A 2NY3D 2JCCF 2F8VA 3BFOA 2ADIA 5I16A 1I7TB 1MIML 4FXGA 3WFBH 5CKGA 5E6IC 4G8GB 3RNQB 5D1QD 1A1NB 2Z92B 3NN8A 1DE4B 4P46D 3O2VL 3NTCH 4X99B 4C56B 1NSNL 3FQXA 3RWHA 1CFVH 1BVZA 5CBAA 3C5SA 4GXUM 4YHNB 4KJYA 1P69B 4KGJA 2J4WH 4J3UA 2LABA 3HC3H 4FQCL 3VG0L 4HBQA 4ZFGH 4P2QD 4GKNB 1RJZB 2Z93A 3Q5TA 5D2LA 4ZO7A 4YO0A 2R0LL 3A6CL 1JPGB 3QG6A 2D4DA 4QHMB 5J12C 4WHCA 3VXRB 5LGJB 2NY3C 1I7RB 3TYGH 3N1QC 4ONHB 5CJ5A 2QHLA 5ESAB 5C09E 1KXVC 2DLIA 3HE6A 1A9EB 1I3RB 4GRWH 4ENEC 1X4ZA 2D0HA 3EUUA 4XNMA 3DETC 5C0AE 3FQTB 4DVRH 1QVOB 2DTML 5E8PB 3ARDD 3ZZ1A 1S3KL 3LDBB 2VZTA 4N5UA 1JWUA 3CXHK 4X6EB 4ZYKB 3ZKSD 2AK4B 4JFXA 2WWMD 5HXMA 2D7QA 4OZ4A 1LO3L 1R0AL 1V3KA 4ORGB 4PJGE 2WLYA 3CFBB 4UDUA 2WMPA 4XRCA 4LLUB 1ITBB 1L7TH 2WBWB 1FL3B 4AK1A 1KSRA 4HUWA 2R23B 4DWHA 3KPPB 1QLFA 4MXWH 1JV5A 4ZUSA 5CJQL 4JFDB 1AQKL 4XMPL 1WUNT 3GSXB 3BKCH 5AG9A 1JYVA 4EN3C 2MTPA 3P9LB 4PJXB 4PRPE 4FFYH 5EU6B 4DGIH 5HHOE 1J0KA 5GS1C 2NNAB 5DWUH 5GJSL 5FYKE 1IQWH 1JVKA 2NY0D 2VXVH 4UBDC 4GG8B 3VFRB 4OZGF 4UOW0 5F1SA 1NDMA 2XQBH 5EH1A 5CP3H 1MCHA 5BZWB 1DFBH 5E94B 5CGTA 4BQ8A 4WI2A 3MLVH 3PWUB 2X4OB 3QHTC 3BP7B 5K9JL 1E4XI 3UJJH 4IOIA 1FVDA 1HHGB 1NMBH 1A6UH 1I3RA 3GGWB 1QOKA 3CFEA 1FYHB 3BP4A 3O6FA 5J6HB 2BJML 2W0KA 2ED8A 2AK1L 1LK3L 2E7MA 4ELMF 2FYYB 1B88A 5L8KB 5DEZA 3LPFA 1E0OB 1IFHL 5E9DB 3FQRB 2NYYC 1UZ6F 3T2OA 4CL7A 3ARGA 1IKFH 1HSBB 3CFBA 5EA0H 4CVXA 1OHQA 1ZHKB 5LGHL 3H7LA 1X5FA 5CZVL 1KC5L 3SDAD 1PEWA 4NKMA 2OXGA 2D31A 2ZSWB 4XPGH 3MLPA 3QIWB 4TN9A 4WGVB 5L9DH 4U0RC 1S5IH 1P5UA 2C4FU 5FOBB 4LEXH 2HFGH 1BBJA 2Q8BH 5TF0A 4TSAH 3C6SB 1HIMH 4JO4L 5I66A 5JORA 5F96H 2HJLA 3DARA 3F65A 3S3JA 2ID5A 3CXDH 3U0TB 4HK3J 4LF3A 2R1WB 3QFJB 2MCPL 2ICWB 4N5ED 1II4E 2B4CH 2OZ4A 2CK0L 4PJ9A 1K4CA 2OL3H 4JRXE 2AJSH 2ORBL 3VXMD 1YEDA 2X4SA 2BVTA 1ETZA 3B6SB 4EI6B 4OM1L 5E4EB 3WS6A 4OV5B 2EIZA 3AXLB 3HI6L 4U49A 2BSRB 1KIRA 3MBXL 2CIKB 2MHAA 2OR9H 4KKCC 4PD4K 1FGNL 1K3IA 3LD8B 3MNWB 3RL1B 4PJ8D 2CLZB 3HUJA 5LCVH 1BM3H 4PJAA 4PTTA 5I74C 3MV8B 3JV6A 2GQHA 5J11C 2Q8AL 3TA3D 3VFUB 3D9AH 1K4DA 4MAUL 5HTSA 5GRZA 5C9JA 3OR7B 3EFDH 4FQXC 1UWXK 5GS2D 3DVIA 1WZ1L 3ARBA 1F58L 3MJ9H 1PSKH 3HZVB 5JHLL 2A2QT 3ALXA 2UZIH 3MQIA 1FBIH 3QDJD 5KSBA 1IC1A 3AS2A 1X6LA 3KYAA 4UNVA 2RJMA 2RFXA 1XIWD 4S1DC 1XIWA 2BOCB 5GGRY 2LAGB 3P40A 3O3DB 1CE1H 4WW2C 2OP4L 2VDOL 4K55A 3A6BL 1D5BA 1LD9B 3V9FA 4MAYB 4WY7L 3ZT7A 3QJHB 1E4XL 3C8DA 4N0CD 5FO7B 1JZ6A 3TNMB 3U46B 1FGNH 2AK4D 3CLEL 3AB0B 4D94A 1QUNA 1T89C 3HMXA 1K8IA 4G9FE 2CKBH 3B8YA 2GFBA 4IDJL 1I8LA 3L3HA 5LG1A 4DOHE 4HIXL 3GRWA 2IQAA 2X4PA 1TMCB 4JY5L 3ARGC 5IWLC 5DR5L 4OQ1A 3VFNA 1MQ8A 3VGAC 2MSPA 1T66D 4JPIA 5CD3B 4ETQA 4NBYB 3SGJC 2YPLA 3SKOB 4F33B 2X4TB 1UB6B 1EO8L 1RZ8B 2V5RA 4ZQKA 4YXKL 5F3BB 3ES6B 4HAGA 3FT3B 1XGQA 4HFWB 1OGAA 1QBMH 4MHHG 5ERWA 1CFSA 2WBJB 1ZLUH 1K4DB 1F4YL 2LFGA 3D2UB 1U8IB 3GSWA 4N0RA 4LLQB 5F7DA 3EDEA 1AXTL 5FYKD 3QUXB 3MV9A 1RD6A 1XGPB 3AY4C 4Y4FC 3BHBB 1UACH 4KK8D 5ACLA 3QIBA 1BMGA 3SO3B 1I9RH 5EWIL 3L95B 2DJUA 4OCYH 4Y1AD 3SO5A 1ZA6A 4I3RH 4PJDB 3WKNA 2LTQC 4PRAA 3RWFA 3V5DA 1AI1L 2FHFA 3QA3B 3UZVB 1QA9B 1FAIL 5C0AA 1JNNL 2BOBA 3O3EB 1EEUA 5E0QA 4R7NB 4F7PA 4RFNC 1OB1A 2CDEB 4WNQB 1C7TA 4ISVB 3GKWL 1F58H 1YNTA 2GSGB 4Q6IB 4WFGE 4BSWB 1AHWC 3IRZA 1UM5L 6FABL 1MFDH 3CFDB 4PJBB 2DQEH 3FJTA 3QNXA 3R0NA 4IBLT 4RFNB 4KI5E 1KCRL 1NC2B 1I1CA 3BVNA 3E3QC 4UZGA 3QI9D 4X8XA 4PGEA 1MEXH 2A6IB 4C4KO 3PE9A 2ZSWA 3H2WA 3BWAB 4IHOB 3GHEL 2EYSA 5DJZA 4TVSa 1YN6A 1CD1B 2V2WB 3CLFH 4NKOA 4XTRD 5D7IB 3G5VA 5D9SB 1RUML 2Y23A 2HT4C 3UTZB 3C5JA 4Y2OA 1A7QL 1A6VH 2OCFD 1ZMYA 1I8KA 4OTXH 4APQC 4TSCH 4ZUWB 1TETH 3B9KB 3WEXA 5C0BE 2XFXA 3CX5J 2HRLA 1IGIH 3L5IA 4ZUSB 1SYVB 4FTVE 4TUJA 5GSRB 3RY6A 2ADGB 3GHBL 2EDKA 1BD2D 3O6FB 3QWRA 3RAJL 1F90H 5I19L 5E2VL 5GGRB 4Y1AB 3L5JA 1NJ9A 3PUCA 4XP6L 1TNMA 4KJQC 1V5JA 3BUYB 1NGXB 1VFAB 2EIBA 5BV7B 1C16A 4QRTB 2I27N 3NZ8A 3VFVB 5HHPA 2JELL 1NBYB 4XTRC 4G80B 3BE1H 1YN6B 5T1DL 1RUAL 2Z4QA 4GRMB 4QRPD 3NFNB 2WP3T 3DGGB 5JUEL 1JF1B 5HHQB 2I60H 3LN4B 1I1AD 1JPTH 5F9JA 5F1NB 5T3ZD 3SE9L 3L7FA 2B2XH 1U8JA 3T0EB 2XTJD 4P23C 4QOKE 4XVJH 4W6XB 2FHBA 4DTGL 4ZNEE 1S7SB 3E8UH 4BFIB 3P2TA 4PUBL 5D72H 1GGCH 2AJZA 4RDQG 4OLVH 1MRDL 1JHKH 1BREA 4Y19B 1G7MB 1CE6A 2XG5A 3W0WA 2BVEA 2BOBB 3O3EA 3RKDD 4GKNA 2NY5L 4DAGL 4KTDH 2DIJA 3VFWA 3MBXH 4YZFE 1DDHA 5I1HH 1U8KB 1ZWIA 5HI5C 5FCUL 3OKMA 4GBXD 1BFVH 1ZGLM 1XMWA 3UDWA 2IH1B 5D5ME 4HS8L 4NRXB 4C4KT 1QRND 4TYUA 1C5DA 5FM8A 5JIIA 3UXFA 5HPMB 3HI5H 1ZHBB 3LRHA 4M61B 5EC2B 1RZIA 4BYHA 1ZV5A 4WU7B 4JM4L 3T0AA 4UUJA 4QT5A 2DKSA 2PF6A 1CICA 3VXSD 3ZYOA 4U0RB 2Q7NA 3QEQE 2GAZA 4XP4H 4GUPA 3ALPA 1R5WB 1FZMB 4KQ4H 2MQCA 1P7QB 4QHMA 1AY1H 1X3DA 2ED9A 2OTWA 4LAQH 1UA6L 3O3BA 3VXPB 3VXOA 3WO4C 4UOW1 3EOBA 4MS8D 3DXAD 4LRNL 3GSQB 4ZODA 5IR1B 4PJ5B 1Q8MA 3G5ZA 3VFMB 3BWAA 3SGJA 1G7JB 2NTFA 4HUKB 4M48H 4GSDH 4H0GA 4WFFE 5E8OB