3REVB

Crystal structure of human alloreactive tcr nb20
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
GVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSYVSQNNEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCR NB20 ALPHA CHAIN
publication title Structural and energetic evidence for highly peptide-specific tumor antigen targeting via allo-MHC restriction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 58
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2011-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3revB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3revB02
5F1SA 1KN4L 5GHWL 3UTSD 5CMAA 3VRIA 3SKJL 1P53A 4OZIA 4PV8A 3RUGE 2H2SC 2OI9B 4B5EA 2F8VA 1K5NA 3O3EB 1Q9OA 2VIRB 4MJ5B 1Z0MA 3P0VL 2OL3L 4BKLB 5C07E 2D4DA 1QBLL 5GSVB 5EB9A 1MFEL 4JY5H 5TF0A 1JWUB 3FFCD 4WFED 4WU7B 3ORJA 5MI0C 4LVHB 5F7HA 4JN2B 5D7JA 3RGVB 3QZWG 4UDTB 5D7LB 4XHQA 3VXNB 5MEOA 3UJJH 4RSVA 4Y8DC 1JZ8A 5SWSE 3WFCL 3DV4B 4XX1E 1FFNB 1QLFA 4TVPL 4U1NB 3X3GL 4AEFA 3DRTB 5I74C 2DWEA 3BJLA 4LIQL 1BD2D 3ILQC 3L5WA 1M6OA 3IDNA 4LVNC 5DRXB 2QQLH 2J6EL 3BIAX 3MRIA 1I9RL 1S7WA 2YMXH 3ARFD 3PXJA 1XF2B 2RFXA 2O5YH 5GIRA 5C0BE 1LK3H 2EYTB 4NZTL 3OGOE 1V7NH 5FHBL 4O9HH 3U4BL 3UDWC 5HYSB 1K8DB 3R1GL 4J1UB 3SDAD 1SVCP 3I6KA 4YBLB 5CEZD 5DURD 4TUOB 1HSAA 5EOCL 4BFIB 4CJ0A 4HKBA 3VXQB 5D6CB 3RDTA 5BV7B 3Q1SL 3DX8B 1ZT1A 5C0CB 5K9QI 4IJ3C 1AXSA 1U8QA 3GMOB 4FQXC 5DDHB 2Y1VA 2AEPH 3VFPB 1JYVA 3WFHB 2DQDH 2J1KA 3CFCH 1J1PH 3MV8B 3SGJA 3QUYC 2A6JB 5AWNH 3ULUE 1MRCL 1U0QA 3B8YA 2UVEA 5DVOA 1QBML 3B9EA 5I1EH 4NT6B 2XACC 4Y4KA 4JDVA 2FX8L 4J3XA 4XAWH 1YNLL 4XNQA 5FDWB 1U36A 1GHFL 5C0AD 3T4AA 3S34H 3RWFA 4PIRF 3C9NB 4U1HB 3KPSA 5TFSL 3X3FL 3PHSA 4GJTB 1EXUA 3KNBA 3L3IB 3QUXB 5HHOD 1EFXB 1FO0B 1IGML 5IFAH 1NLDH 5C0JB 1QTYT 4FQHB 1I7ZA 3BYYA 3MACH 5A2FA 1A5FL 4JKPL 2BJML 5AUMB 4HK0A 4X6DA 3WD5L 3CXDL 1TETH 4R26L 3DMMC 1CLZL 1MJJA 3V6FA 3LEYL 1NEUA 2DQJL 5LXGH 4HD9A 3AXLB 1Q1JL 4GRMB 4N9GB 5BQ7A 3HE6B 4HKXB 4XCCH 4I18C 4NZRH 2HLFD 3VXSA 4XGZB 1KT2A 1MCNA 4JFOA 3KPQA 2J88H 3C8KA 4PV9B 1P7QA 1RZFL 3GMQA 2W9DL 4XNUL 4K3EH 5FYKU 2WK2A 4QHLA 4JQVA 4QRPA 5FV1L 4X7CC 1G9MH 3DECA 4P5KB 4BSVA 3AU1A 3DIFA 1FZOB 2ITCB 3WEXA 2JKXA 5F88A 4DAGH 3O9WA 2H2PC 2F5AL 2XWJA 3ILPB 3MUGB 4XWOC 2Q7YB 1AXTL 3ZE2F 4ZXBB 5JHDB 5CJXA 3EHBD 3H3KA 4MB4A 1I3VA 4X80L 3WHXA 3GSNL 3RNQA 4H88L 1D7FA 2P42B 3DX6A 4TOYL 3ZE1E 2PYEA 3MV8E 4JN1L 3LS5H 4TRPH 4KZEL 3AY4C 3UO1L 3T0VA 2DWDB 1GSMA 3HG1B 4QYOB 5GS0C 1XGPA 1LP9A 1A6UH 3U9UA 1XGTB 4ZTPL 3MOQA 3VXOA 4JPVL 3SGDH 2D9CA 2AK4B 4EDWH 2Y36L 3P30H 1QNZH 3J8F7 1T1XB 5MERA 2V7HA 1LO5A 1Z9MA 4HW6A 2IAMC 1ONQA 4K9EH 2WZPD 4IMKC 3O41A 3NN8B 1K4DB 3GM8A 4OV5A 1JPSL 1U3YA 4NN7B 3L3OA 1IARB 4ZD3L 4AM0B 5JORB 2VC2H 4WO4B 4XH2A 3OAYH 1CGXA 3MNWA 1P84J 4YWGH 2XA8L 2EIZB 5GGSY 3AGVA 1I4FB 1LQSR 2VZUA 4KFZC 2P8LB 4PJCF 3PG2A 3ARRA 5D7IA 2N1KA 3MRHA 1NKOA 2N56A 3S96B 3HPLB 4IBLT 5DHVA 1EBAA 2A74A 1BLNB 1S78D 3VFNA 5IGXL 3O3DB 3TN0A 3L7EB 4U6XB 1A9BB 3O4OC 1XGUA 1TITA 2LTQB 2X70A 4F7CB 4EQ3A 1H3VA 1KNOA 1DE4B 2OJZL 3FQUB 1SBBA 1SJEA 4GH7B 5D70L 4X4ME 1KF9B 1MHCB 5EUOE 3S4SB 4APQB 3IU3A 1FL6B 2X4RA 4HXBH 3SJVB 1Q9WB 1RJCA 4K3JL 5F7EL 5H94B 2Z0BA 5EO0B 2CIIA 1WUNT 1ZVHA 3MMEB 1QRNA 5HHQB 3NGBC 1P7KA 3SDYL 1GRWA 2CLVA 2BRRH 3N1PC 2BNQB 3QEUA 3RWCA 1WCQA 3ULUL 3FQRA 1JWSA 4YEFA 4I0KA 3TVMB 2E3VA 1BVKB 1U8MA 4MDIB 2I9LB 1CLOL 2CUMA 1TZHB 1UZ6F 5D7JD 4OT1L 3D18B 2A6DA 3LKQB 2APXA 3BJ91 2DBLL 4NC0B 3TJEH 1U8IA 5JR1H 2DLIA 3BGFC 3JV4A 3SBWA 2MQCA 4NO5A 2JJUA 4ALAH 2VZOA 2VZ3A 5IW1A 3UEZA 3STBA 1GIGH 4ZFOA 5LBSL 1AGFB 1TTFA 1TENA 4V1DB 1EHLL 1YY8A 3Q6FB 5J6HA 1Q72L 1W8OA 4J23A 3GJFA 3LRHA 1FZMB 2B4CH 2APTA 2W91A 4TTDC 1LHZA 5MHSD 3PL6B 3QCVL 2OP4L 4OQTA 3I6LE 1WZ1L 3DGGA 3IJHB 1VERA 4TUKH 3HE7B 4NO2B 4OF0A 1FVDA 4KHXH 1MCLA 4IEFB 4ETQB 5CCKL 4JM2D 2EDNA 4YK4B 1SY6L 4L4TA 1ACYL 3GMLA 5J56B 2HT4C 3OAUH 4WW2A 3U82B 3WO4C 2RR3A 4XZUA 3LHPH 4GAJH 2OZ4A 1FVEB 4L8CB 5DMJB 4WWID 4M6NH 4OD2A 2F54B 4FQCL 4YHNA 1Y18B 3BT2H 4JQIH 1NC4B 1U6AL 3QI9C 3B9KB 5BV7L 1P9MA 5EDXA 3EFDH 5DJYA 4YE4H 1A0QH 3VRJA 1Y0LA 2YS4A 2JCCA 3EBAA 1E28B 2J3SA 4J3VA 5DHVH 3FO9B 3BXNA 4Y5VB 2DOCA 5HI5C 5C86A 1RY7B 3RA7L 3QIWD 5C8JA 4PREB 4Z6AT 2YBRB 3N1MC 4Q9BA 3EZJB 3KPSD 3NACH 1CK0H 1T2XA 3BH9B 5FEBA 2FX7L 4J6RH 4XNMA 1RZGB 2BNRA 4J3TA 4Z7NE 1II4E 4K7PH 3V0WL 4PJBE 1UC6A 4YHMH 4HPOH 1OWRM 1CDIA 3VXMD 2FIKA 4ZFZA 3CFJA 3KGRA 3U6RA 2DQIL 4X9FA 1FO0L 4OCNC 2R2EB 4XP9L 1CFQB 4ZQKA 4DN3L 4NRYB 2VE6A 3PP4L 3VXSD 5FECA 5TQ2L 4JLRB 2IPTH 3UPAA 1MAML 2B0SL 1JPTL 2FATL 4Z95H 1IC4H 3K4DA 3F7YA 3G6DH 3N0PB 1OW0A 1L7TL 4RWHA 5BZWA 1VDGA 2WBJD 5BS0E 5GS1A 1HSBA 2GK0A 4RQQB 3LCYA 4JVPA 3F7PC 2A6KA 1DL7L 4D0DA 3WFEL 4H0IA 2FH6A 3KXFA 3WNPA 3TBTB 1K2DA 3O9WD 3NFNA 1XT5A 2GITB 2UY7A 1I8LC 1N64H 4C83B 3UTSB 1BIIA 4PJGA 3FO0L 5HGBB 3GJFH 2F54E 2P4AB 4P2RB 2H32B 2VRAA 5L7XH 1NCTA 4WY7L 1NGYA 2BCKA 3VMPA 1MCIA 5E5MB 3SDDA 1I1CA 3H8NA 4OQTH 3GGWB 3QDMA 3FFCB 5DRWA 3I2CL 3K2UH 4LRIA 2YWZA 2FBJL 4ZO7A 2EC9T 5IVZA 1ZGLP 1WSST 4HT1H 1LDPL 3W0WA 4QTIH 1I1AB 3C6LA 4FMFA 3UPRA 3QDGD 3NIGF 3K4ZA 4UI2A 1WFOA 1FCGA 1QO3A 3K80A 1WBYA 1C16B 1REIA 2HT2C 5E08H 1QFUL 2WIIB 4L1HA 2OZ4H 1AJ7L 2F5BH 4R0LA 2ZNXA 2GY5A 1RZKC 2BMKA 5C07D 1DBJH 2VDQL 1QPPA 2VUOA 1FNFA 2R1XA 4G9DB 4XP5L 4KUCD 5E4EC 2Q76B 1NCDL 2DQGH 3RY6A 3DX7A 5E8NA 5L0QC 1AD0A 1BFOA 2H26B 3DSFH 3ARGC 3VRLF 3QFJA 5ISZE 3QFDA 1WT5A 4OF3A 2NX5E 4ZNEE 1D9KC 2QQQA 3ZKXC 4JZJA 5HXMA 3PWUA 1S9XB 3IDJA 4HWBL 2ZKHH 4FQQA 3TN0D 1VB9A 4PRBB 4GG6F 3VGHA 4X6DF 3BP4A 4E5XB 1S7VB 5D1ZA 1F45A 2X9YA 4HWZA 3PUCA 2R29L 2GT9B 5CUSH 4QTHB 3FQNA 4GMSL 2DJUA 4WGWB 3RTQB 4L9LB 1C7SA 4UIKL 1A21A 3D87B 4B50A 1H0DB 5TE4H 4I77H 4S1SH 4XPAL 2ZG1A 2XZAH 3HC4H 4YDKH 2ZPKL 1OAQL 4NCDA 4NDMA 4GAYB 1FN4B 2JTDA 4R2GC 3TIDA 2P5WA 3OKDB 3QUZD 2NW3A 3SE3C 3TEUA 5B3NA 3UTQA 5J11C 2WUCL 3LN9A 1SJXA 3WJJC 1C08B 3AS2A 1YEJH 1I7UA 5IBTH 5C9KA 5H37H 3MRDB 4XBPA 1TJGH 5KVEH 1CZ8L 3CFBA 2B1AH 5L2KB 5I30L 4IRSC 3TBVA 4KKAC 4P2OC 2D03H 5EG6C 3KPPB 1KCRL 2R56H 2F19H 35C8H 1ZMYA 2DQUL 4X4XA 1IC5H 4M7JH 3WXVH 3BZDA 3I50H 1BVZA 5H37G 3QZWB 4X6BA 4KRPC 1Z0NA 4C59B 1KIQB 3T0EC 1NMBH 1MPAH 3HR5A 3ZE2E 2N7BA 1JGLH 1CFNA 2K7QA 1KJ2A 3Q5YA 1FZKB 4J3WA 1H8NA 2PR4H 3LSOB 5F8QC 4Y19A 1FGNH 1FNEA 2VDNH 1MUJA 3KYKL 3V5HB 4OD3L 4EI6B 1Y6NR 2BXZA 4KJPD 4PRPE 3FOMA 4KVNH 4HF5L 1A6WL 4JKKA 1N5YH 4QRRA 2O5XL 4X98B 3TIEA 4L4TD 3D9AH 1QSVA 4Y5YA 3DRQA 5C09A 3UTPD 2WNGA 5J13C 1RIVL 1NL0L 1PEZA 4JO1L 5IFHL 4P23A 5I1IH 3BQUA 1YMHB 3FO2B 4YLQT 3MREB 2IBBA 4X6CF 4HCRL 4F33B 3ZT7A 2AJUH 3PGFH 2OJEB 1RHFA 1C5BH 2BVTA 5FGSA 4CVWA 4N1CA 2FDBP 3ARDA 4LHUD 1YMMB 1H15A 1C5CL 2HRPL 3MYJA 1BEYL 2IALA 4EOWH 4PJCE 4FFWD 2VLME 2HAZA 4LP4A 4QRUA 4Z0BL 2FHCA 5FOBB 3V4PH 2P1YA 3E6HB 1IQDA 2YD2A 5IFJA 2MQ0A 3FN0H 3S36H 4AENA 4QWWC 3RIFK 3JWDL 4GXVH 5KOVC 1JNNL 4KK8D 2WINA 5KSUA 2OTUA 2NPLX 2X1OA 3OPZH 1UWXH 1IT9L 2IQAA 3HB3D 2CLRB 3BVNA 5E9DB 4LPUA 3T4YB 2WQ8A 4LEXH 4HFWA 4NQEA 5DQJB 4Y7MA 3PWNA 4JREB 1FJ1B 2HKFH 5AAMA 2XRAL 2JJVA 4K7PX 5ANMA 3NZHH 5CP7A 1TPXB 3C09B 4ZOBA 2NY5H 1FORH 5ITBL 3RWHA 4DK6A 1A7NL 4L4VB 3WLBA 3OX8A 3QP3A 2XKSA 2ARJQ 3QG6B 3BZ4A 4LCYB 5I15H 5LKNA 4P2QE 3DBXA 2AJSL 2EEAA 2D7OA 2GW5A 1JRHI 5J9PA 3VXRA 3ULVC 4PRHB 5E24E 4TVSa 3VFVB 3GSOB 4OKVA 3P9LB 1UZ6E 5EU4A 4RGMC 3CLEL 3VFWA 4MNQA 3VRIB 4OZIB 3LKPA 4PV8B 2F9BT 1U92A 4Q9QH 5I8KH 1K5NB 1Q9OB 4OF5A 1LE5A 4NZUL 1VKXA 3UTTE 4P5TA 3TZVC 2KBGA 2E5EA 3SDDD 4UBDD 4ENEC 1FNHA 3PP3K 4FTVE 4PG2A 1KJ2H 3IFNH 3A67L 4RIRA 3QDMD 4JHAH 2YD7A 3D3VA 3ZTNH 4WW2F 4PD4K 4J4PD 1IGFL 2AK1L 5DUMH 3I3BA 3W9DB 1MCSA 5D7JB 3UAJD 3C6LD 3F7VA 4M6MH 3E6FA 5FGBA 4G9FA 5D72H 5ADPH 1H3PL 5MEOB 1FBIH 5KS9F 3LEXA 4K71C 5D7KD 15C8L 4PRIA 4HBCL 4NM4H 2X4OA 5E03A 3KJ6H 4WTXA 1FNGB 2JCCF 2VDPH 3OB8A 2QL1A 4RMSA 3MLRL 2DWEB 3B2UC 2X10A 3L5WB 1M6OB 2XQYG 3IDNB 2CO6B 4L5FL 3MRIB 5IVXF 2QBWA 1S7WB 2RFXB 4AEEA 2R1YA 3LKOA 5GIRB 4M7KL 5CILL 4DKEH 1OD9A 1DVFA 3QFJD 3MLUL 2IPUK 4KROC 3I6KB 2IGFH 2KL6A 2VXVH 4U1JA 4YDIH 4AK1A 1RULL 1NC2A 1HSAB 2ARWA 3NCYS 4LNRB 1WIPA 4PGBA 4N1HB 1PSKL 4XPFL 3RDTB 5I71B 1RZ7H 3RWEA 1ZT1B 1AXSB 5J1SC 4GAGL 1ZA6A 4MSWA 2MCG1 1T5WA 4RISL 1E4KA 4NQDA 4YHZH 1WVZA 3WFZA 1XGRA 5FM4A 5IM7B 3BWUC 4MXQD 1CFVH 3BKCL 4Y4KB 4JDVB 3FZUD 5BVJA 1EX0A 5D2NE 1QA9A 4XNQB 4TYUA 1TVHA 2WAHA 1J10A 3T4AB 4P4KC 3L1OL 4JHZA 5DHXB 3RWFB 1HQRA 4LLWA 4Y5XA 2DQHH 2PO6A 5TE6L 5L6YH 1EXUB 3KNBB 5I8OL 5B22A 1T89A 1UJ3C 1PKQA 3MOBH 4M9PA 4X83A 5J0BA 2V17H 1CBVL 2Q86A 1I7ZB 1IBGL 1R3IL 5E8DH 2R2HA 1U8KB 1X5JA 3BGMA 4GG6B 4PBWD 4HK0B 5HBBA 4X6DB 5EU3A 1HHHA 4Z77A 2FLBT 4I2XE 4PJXE 3TO4C 4OCSH 2P49B 5JUEH 1MJJB 1X5FA 3V6FB 2I07A 4YHLL 3Q6GH 1MCOH 3MLSL 3QHZL 3ROOA 3BIKA 4U1SB 4F7PA 1CL7L 1FVCA 1QKZL 1P4IL 1HZHL 4JFHE 1F4WH 3VXSB 4LARH 1LEIA 3BKML 1KT2B 2MKLC 4AG4H 4JFOB 4XAKD 3KPQB 3C8KB 2Z8RA 3IFPA 1P7QB 2MJWA 5ID1A 3GMQB 4Y19D 2EIBA 1D5ZA 4Y4HD 5KSAB 4QHLB 1FGVL 4QRPB 3SQOH 2AEQH 3MCKB 4Y16A 4BSVB 3AU1B 3DIFB 3WEXB 5SX4H 4D8PB 1F6FB 1LO0H 5DVLA 3JUYA 4QRRD 5F88B 1OM3H 1FRGH 2E7CA 4JY5L 1Z5LA 2XWJB 5C09D 1N6VA 4X4YA 5FHAH 4LU5H 3NIGE 2HT3D 4NHCH 1RK1A 3BQUD 2ERJC 4FA8A 3WHXB 1A4KA 5F71A 3RNQB 2VLLA 2VR5A 3DX6B 2PYEB 1F4XH 3UJJL 3ARQA 4U6YA 2CDEB 3EYSH 4OIBA 1CXFA 3SDXF 3MLZH 5BS0D 3CSYA 4PG9A 1XGPB 1LP9B 3ARDD 3U9UB 5FB8B 3VXOB 3VXTA 2XA3A 3LQMA 3MXWL 5T5FH 4YEEA 5MERB 2GCYA 2V7HB 4J3SA 1LO5B 2ZP0T 1ONQB 2YMXL 3MRPA 4AYFA 1AR1C 3VRLE 2O5YL 3O41B 4UT6H 1SYSA 1LK3L 1U91A 1TXKA 2FSEA 1V7NL 4OV5B 4O9HL 3L3OB 4K7FA 2CSPA 1DR9A 1A6PA 3FOLA 4ZAKC 3MNWB 4GG6E 3EYQD 1DLHA 2EZ0C 3D5OF 3UZVB 4X6DE 3VI3F 1K85A 1F3RB 1T7ZA 4NQED 4PJDF 4I3SH 1X5AA 3VD3A 1KCVH 4M6OH 5D7IB 1I3UA 4EI5C 3MRHB 2AEPL 3IAGC 5DHVB 1UM5H 1E4XH 2C3VA 3CFCL 1J1PL 4HPYH 3VFNB 5AWNL 1Y6MR 4IM8A 3AM8A 1KELL 3TA3A 3QXDA 4LLAA 4MAYA 1M7IA 3O4LA 2A9MH 1WTLA 3RHWF 1XGUB 12E8H 1KNOB 4Q2ZA 3S34L 1SJEB 4ZPTA 3RU8H 3SE8H 2A1WH 1HI6A 5T3ZH 3VXRD 2F58L 4BFGA 2X4RB 5HHVH 5F96H 4QGTA 1J86A 2NX5D 1NLDL 4OUOA 4ZSOE 4ODHH 43CAB 5GXBB 3MACL 1UXWA 1OTUC 1F02I 1QRNB 1P7KB 3U1SL 2CLVB 4P5TD 1KPUA 3EZ8A 3QEUB 3KPOA 4CMHC 3RWCB 1TETL 1JJUA 2ICWI 3ELAT 1P7HL 1OGAE 3P0GB 3FQRB 1JWSB 4HJJH 5LXGL 3VXUE 3VFSA 3JTSA 1U8MB 3A6CH 4HWNA 3E2HB 2LU4A 3QXVA 4XCCL 4NZRL 2ID5A 1AR2A 2NCMA 4NNPH 1JNJA 2A6DB 2M8XA 2QTEA 2J88L 1U8IB 3OTTA 1QHPA 2IH3B 4LEOA 4G9FD 3JV4B 4XCNA 4NO5B 3T0XA 4K3EL 2QQNH 2VDRH 5D96C 5IW1B 1DUZA 3AVEA 3CVHL 4X5LA 3GRWA 4ZFOB 4NP4L 3VW3H 1FHGA 1G9ML 1S7TA 4I0PA 2YKLH 3NZ8B 3WUZA 1YY8B 5E8OA 4CAGA 5J6HB 3GJFB 4M7ZC 4P46C 3VGAC 2X2YA 5I1GL 4EN3A 2H1PL 1U3HC 1NANI 5DMIH 3WS3A 3DGGB 3D85B 4X6CE 3DNKA 2DM2A 3RGHA 1DVFD 5A2KH 5I2IA 1FVDB 2X4PA 1YEEH 3LS5L 2QSVA 4HKJA 4TRPL 4PLOB 3RVTD 1NC2D 5FYJE 1MEXH 5H2BA 2AJXH 4N90D 4WW2B 5I17A 3BSZL 2OX5A 4XZUB 5I1AA 3JSSA 4PP2A 1H3TA 1I3GL 3IDIA 4EDWL 2VDLL 3P30L 1KENH 5HYFA 1QNZL 4KTDH 4OD1L 4YDLC 1VGKA 4OD2B 3HAEA 4K9EL 4BFEA 5B38A 3ZMRA 4NQDD 5JO5A 3VGEA 3OB0H 3E1F1 4L1DA 3BMWA 5DJYB 4GW5A 3VRJB 1Y0LB 4ODVH 5EZIH 3C5ZD 4MQXC 2VC2L 2JCCB 4KVCH 4PRPD 3EOTL 2BERA 3BXNB 3H7LA 1ZT4B 5IVXB 5JNYA 3LPFA 4P49A 5C8JB 1CXIA 4D3CH 3FMGH 4NJAL 1QPXA 1IAII 3LOWA 1RU9H 5IWLC 4WEMB 2BNRB 3RVVD 1MAKA 2X4QA 3KLHC 5T3ZD 1KEGL 1PQZA 2FIKB 4ZFZB 3CFJB 3F65A 3U6RB 3T0EA 3LAFA 3JVGA 1NMCC 2WM0A 3MLWH 3AMKA 4HS3A 4CVXA 4EVNA 2R15A 4CVZA 1SEQL 2OTWA 2W0KA 1M05A 4ZQKB 1A9EA 3CFIC 2VE6B 3C5SA 1DFBH 2I25N 4KDVA 5ID0A 4HXBL 5ECJE 5EZJA 3VFMA 3FRPA 3T65A 2KZ1B 3LVEA 3F7YB 2PF6A 3WLWD 4Q7DA 5GGRA 4ZUSA 3EO0A 4Q6IA 3X12A 5GS1B 1HSBB 4M1CD 2GK0B 4UT7H 2YD1A 2A6KB 2ADIA 4X6FA 1KCKA 4KAQH 1KIRA 3QPQD 5D2LA 2BRRL 3KXFB 3KYOB 1MCQA 1G7QA 1K2DB 3T77A 3NFNB 1URLA 2ZSVA 2WUBH 4IRZH 5D71L 3PWPA 3DUUA 3GMPA 4OLZH 2AXFA 3V2AR 4M5YH 1P6FA 1BIIB 4PJGB 2D7TH 4I4WA 4M00A 5KS9E 3TJEL 5I9QC 3BPCA 3P2TA 2PXYC 4LCCC 1NGYB 2BCKB 4BZ1H 4ALAL 3SDDB 1GIGL 5KVDH 4YFLI 5DRWB 5FA3A 2NY1D 4P2QD 5IVZB 1U8NA 5IVXE 3W0WB 3C6LB 3UPRB 1CG9B 4LKXB 4ZUWA 2APWA 3TBSB 1DSFH 1IAOB 4QNPF 5FUCC 1EMTH 1QO3B 3U4EA 1WBYB 4HG4K 1BF8A 2P5EE 1QVOA 5IMOA 4GO6B 3MLTA 3RY4A 4TUKL 2F53A 1AP2A 3G5YA 3LD8C 3BP5A 5GJSH 4KHXL 3BO8A 4JQXC 4R0LB 4MQTB 5F9WB 5T1MA 1BECA 2BMKB 3HAEH 2R1XB 4F9LC 3OAUL 4UOW0 3DURA 4P0DA 3QEQA 1J0JA 1FYTA 1JCKA 3LHPL 5GRYA 3DX7B 4GAJL 5E8NB 3PJSA 1RUQL 1AD0B 1WC7A 1BFOB 2NXZC 3PE9A 4TSBH 3QFJB 4M6NL 3QQNA 3QFDB 3BT2L 4JQIL 3HAEG 4JZJB 2A9NH 2FGZA 4BQ9A 5B38G 3PWUB 3GI8H 3EFDL 3IDJB 4YE4L 4FQQB 1A0QL 1DP0A 4PJ8C 4EEEA 2C26A 5J12B 4URTB 3TA3D 4NQCA 1TTGA 5D1XC 4MAYD 3KPRE 4NN6B 3O6MH 3BP4B 4ONFL 3CH1A 5D1ZB 5D4QA 3BKYH 3LKSA 4HWZB 3T1FB 1XH3A 4YFLF 3MFGB 2FBOJ 4KQ3H 5E1AA 5FYJL 3FQNB 1MCCA 2C9AA 4JHWH 1OAYL 1XCQA 2YD8A 4R97B 3NACL 1CK0L 4MA3A 4CGTA 3ZHDA 2RB8A 1X4XA 2RIKA 1ZLSH 4QRQA 4J6RL 2EIDA 1GZPA 4JRYE 2R2CA 1RZIA 4K7PL 4NDMB 1VHPA 4F37F 4Z7UE 3VWJC 4KZDH 3TIDB 3QDJE 2P5WB 2NW3B 2Z31C 5CBEB 2EDJA 5ETUB 3UTQB 2BC4A 3O8XA 1HDMA 3MV9E 1M7DA 4HEPG 2WBKA 4NC2B 4CDGC 4UNTA 2CKBA 3IU4H 3AS3A 1I7UB 3LRGA 3ARBC 3Q3GA 4XBPB 1W0YT 4G6FB 3CZFA 3CFBB 2IPTL 2MFNA 4OZHE 4Z95L 2CJUH 1IC4L 4U1MA 4FP8H 5SX5K 3G6DL 1T20A 3H42H 3TBVB 3FRPG 4ACPA 5GSRA 4OBRA 5HD8D 5D6DA 4LVNB 4YIQA 2ICEA 1AO7E 4X4XB 2NR6C 3OF6D 3GDBA 4LSUH 5E2WH 5A16A 4UIMA 4X6BB 3HR5B 4E9LA 1CFNB 4XPBL 4S1RH 1BAFH 1KJ2B 1N64L 4Y19B 4EQ2A 1FNEB 1MUJB 1IJ9A 3SDXE 4XWGH 5L7XL 3TJHD 4R8WL 4Z7QF 3EOBA 3FOMB 2YD6A 5DFVD 1WWWX 4YBQC 5IOPB 4QRRB 4KTYA 3QJFA 1S7QA 3TIEB 1A7OH 4OQTL 1EO8H 2WWMC 3VG9C 2D31B 4Y5YB 5EBGA 2AS5M 5DK3A 5C09B 1IEBA 2IH1A 4JY4A 4HT1L 3CFEA 1C1EH 5EBLA 4P23B 4QTIL 3BQUB 4M61A 3D0LB 4WI8A 1HHJB 3ESVF 5C0FA 2OI9C 4L3EE 2MOVA 3WNKA 1U58A 2VYRE 1MCWM 4N0CC 3PWJB 5E08L 1GC1C 3S9DB 3LDBB 4YHOH 5CZXD 2F5BL 3ARDB 3KPTA 4NGHH 1MY5A 1S5IH 1FAIH 1CVSC 1K9TA 4LVHC 1J0ZA 1DBJL 3CDCA 3VI3E 4MS8D 1E6JH 2AEWA 3MYJB 4PJDE 1EEQA 2AI0H 3RGVC 5D1QA 1CE1H 3NVQA 3KLAA 2E8ZA 2VDKH 4H0GA 4QRUB 1MCDA 4HGKC 7FABH 3RBSA 2HJKA 3OAZK 1IQDB 5IFJB 3HKFA 1UEMA 4G80A 4AENB 3OKEA 1U9KA 4GUPA 1MJUH 2WINB 5KSUB 2OTUB 2AABH 3QIUA 2IQAB 4TTGA 4KKCC 4ZUUA 2ZKHL 3BVNB 3JZ7A 3VA6A 1A7BA 1U42A 1UM6H 2AJ3A 4TQEH 4U1KA 4XNZB 1V5JA 3HS0A 4I48A 1ERNA 3QUMA 2W1NA 4HFWB 5F21B 1UA6H 5JXEC 5IMMB 5CKAA 3PWNB 5IROA 4CU6A 3RVXD 5SWZA 5BO1H 5F1IA 3IS1X 5ANMB 5KTEH 4R4BA 1HHIA 5I6XC 4C57C 2DYPA 5CUSL 4YBLC 3RZWA 1V05A 1CLYH 2ORBH 2VLJE 3QQ9C 5CP7B 1JZ6A 3TBYA 4OI7A 1CDCA 4M1GH 4K07A 1VGEH 3RWHB 2J8HA 4IRJA 4S1SL 5I1JL 2XZAL 3HC4L 4YDKL 5BV7C 2JB5L 2HMID 3WLBB 2CKBH 3OX8B 2HTKC 4O2EA 4LDEB 3BZ4B 1AE6H 2NY3D 2OBGA 3GKWL 2BFVH 4U2ZA 4G8GE 3DBXB 3T2OA 4M8VA 5GRJH 5IW6A 1T3FA 1ED3A 4F3FA 5J9PB 3VXRB 1C5DA 4MQSB 4OKVB 5DTFA 1FC2D 1LO4H 3MGTA 4JRWA 4EUPA 2I24N 5ICYA 3VFWB 1ACZA 3BEWA 4XT1C 4MNQB 5KVEL 3QQ3A 2B1AL 3LKPB 1U92B 3G6JE 1J11A 5IMLA 1X4ZA 1VKXB 4P5TB 2D03L 1T6VN 1EERB 1W2KT 2R56L 2F19L 1DEDA 4HZLA 4RIRB 3D3VB 1T03H 4KKBD 2V5MA 1OGTA 1IC5L 4M7JL 3WXVL 4DGYH 3QUXC 4GG8A 1MCPH 1S9WA 1NMBL 2DQEH 1RUAH 3D39E 3F7VB 1JGLL 3Q48A 3E8UH 1J8HA 3E6FB 2XIDA 1FIEA 2CDFA 4G9FB 1IM9D 3MO1A 1FGNL 3LEXB 4HC1A 3PGCA 2VDNL 3D48R 4PRIB 2QQKH 2X4OB 1OAKH 4XC1H 3UPCA 2P7TA 3IKKA 4KVNL 5I18H 2AGJH 1ADQA 1N5YL 5FUOH 1NCNA 1T04A 4Y4FA 4B0MM 3HE6C 2FJGA 3D9AL 1P2CA 1P1ZA 5AZ2H 2BSSA 4Z9KB 3QEQD 5INDA 3VXUD 4RGNC 2IBZX 2R1YB 3LKOB 2E9BA 2OXGA 1DVFB 4FXKA 1VFBA 1I3RA 4XXDA 4YC2C 4U1JB 2K7PA 2AJUL 5FGRA 4U05A 4M93B 1NC2B 1JIBA 3O4OB 3PGFL 4XMPH 1C5BL 1UH2A 1ND0A 5IBUG 1CICA 2R4SL 5DZNA 4PGBB 5JW4N 4LSRH 5K9OA 3W11D 4XVJH 3OB0K 1EJOH 3RWEB 4S1DD 4PRDA 5ESQA 5A3ID 4MSWB 1FQ9C 1CU4L 4EOWL 4Y89A 1T5WB 5DA4A 2G60H 3V4PL 3QUMH 2ZUTA 1XGRB 3FN0L 2A0LD 3S36L 1XF5A 3VWKA 4GXVL 4OCLC 3T8XA 5BVJB 1FE8H 1QA9B 1OP5H 1TVHB 3RL1A 4LEXL 4LDLB 2ATKA 4N0UA 4KRLB 1HQRB 4LLWB 4Y5XB 5I75B 3EJYD 1ZOXA 2DDQH 2PO6B 3VGFA 3GSVA 4JPWH 5F72S 5GGSA 4NN7C 1J8KA 4E41E 3T2NH 2QADD 1PKQB 4WO4C 4Y2DA 1ZEAL 3NZHL 3MFFA 2Q86B 4XC3H 3MBED 4G6JL 5TF1H 2NY5L 1FORL 2R2HB 2ZCLH 4UTAH 2VLRE 3BGMB 5HI3C 4OCWH 4LASL 5EU3B 4Z77B 3ABZA 2VWEC 4EUPH 2DMBA 1JPFA 1O7VA 2I07B 4DVBA 4LFHG 1GH7A 5I15L 2F8XC 4O2FA 3BIKB 3ROOB 4F7PB 4LSTH 3ARPA 5HHMD 1FVCB 2JIXA 3SDCD 1EVTC 5BVPH 4DTGH 1LEIB 1INEH 5J3HD 3BPLB 3IFPB 5F1NA 5ID1B 2YUZA 4OI9A 2YN5A 3M1BA 4EUPG 1D5ZB 4P48A 4D9QD 2AJZA 4G42A 1TLKA 1IC7H 4Z7VA 4Q9QL 5KANG 2LTQC 4Y16B 2EXWD 1RIUH 1KJ2L 3IFNL 4APQC 2HJLA 1Z5LB 1BX2A 4HC1H 4JHAL 3ZTNL 4X4YB 5DUML 2VLKE 4R90H 1IKNA 1RK1B 4B7LA 4QNPE 1ADQH 4WIQA 1A4KB 1N5AA 2VLLB 5IQ7H 2VITA 4XXCA 5D72L 5ADPL 1CD0A 1FBIL 3L3HA 4RNRA 4U6YB 3ESUF 3N9GH 2AXHA 4QXGH 2DTSA 4NM4L 3MPCA 4K55A 2PKDA 3CSYB 4PG9B 4GBXA 1I8MA 3QT2A 3TVMC 2VDPL 1DANT 2NY1B 3VXTB 1BZQK 4OGAD 5KSBF 2YPLA 3ULVF 4PJFA 3FRUA 2GCYB 5D1QD 1MCEA 5BRZA 3EKCA 3MRPB 3U7YL 1CDYA 1SYSB 3DETC 1U91B 2FSEB 1JGVH 1ZAGA 5K59E 4K7FB 3UROR 4PJIF 2IGFL 3FOLB 2VXVL 4YDIL 2R0WH 4XCEA 1DLHB 5GRWA 2XTJB 1KSRA 4P9MH 1WWCA 5JZ7D 3U4AA 1RZ7L 2Q8AH 3IJSA 1M1SA 4U1GC 1D5IH 2CXKA 3KJ4B 2W0FA 3R0NA 3LS4L 5FYJU 5SWZD 2W92A 3HE7C 5EU6A 3ZT5A 3B3IA 4YHZL 5CEYA 1ZVYA 1AGCA 2C3VB 1OAZH 4ONHA 2KQMA 2P5ED 3K46A 1IGYA 3H3BC 4YK4C 4WHDA 1IGCL 4Q6YA 1AI1H 3TA3B 4IRJD 3QXDB 4P59H 4MAYB 1M7IB 1NUFA 3O4LB 5DJ0A 2NTSP 2C3WA 1E6OH 5ADOH 4F9PA 1AC6A 1R3LA 3MA9H 4XVUD 3SCMD 4Q2ZB 1OHQA 3OKOA 3BYTA 3V95A 2J8UF 1HI6B 3M45A 2DQHL 3B9KC 4LOUD 4H25A 3GSUA 5L6YL 7CGTA 4LQ1A 3MOBL 4JKMA 3MUJA 2V17L 3OJDA 5JOPD 4KK6C 1DBMH 1UXWB 5E8DL 3JWDC 4BQ6A 4Y5VC 1GL4B 1KPUB 4ZS7H 3KPRD 5JUEL 4UT9H 4IOIA 1MCOL 3VFSB 1ORQB 3JTSB 2DIBA 4OM0H 1YQVH 1OSZA 1CDHA 5GS0L 1F4WL 3PXHA 3ZO0A 2XKNA 1YQ2A 3JV5A 1TZGH 3C87A 3VDAA 1J8HD 4XVTH 4LEOB 3VDCA 25C8H 4WTZA 4R4FL 4DGIH 4JRYD 4PGCA 3UX9B 1DUZB 4Z7QE 3ALPA 3SQOL 3MRCA 2AEQL 1S7TB 3ALWA 4I0PB 1CGSL 3QDJD 5E8OB 1LO0L 1OM3L 1FRGL 1PY9A 2X05A 2HN7A 1JVKA 1XGYH 4PJHA 3MV9D 4EN3B 1MFCH 4NRXB 5FHAL 4U6VH 3STZA 3DO3A 3TCLA 4NHCL 5T33H 1UB5A 3FTGA 4PJAA 4K8RH 5I2IB 1F4HA 2X4PB 3DXAE 1F4XL 4PGDA 4ZODA 4HKJB 5GRVL 3EYSL 1JGUH 3S35X 3MLZL 1L0XA 4R4NC 4POYA 5H2BB 1NQBA 4KH2A 3X14A 1ZA3B 2EE3A 1CT8A 5I17B 4MJIE 1MQKL 3ARZA 1QRKA 4PP2B 3QG7H 3IDIB 5IR1A 1YY9D 1IAIL 4ELMA 5IW3A 1VGKB 3HAEB 4LCWA 2BSED 5B38B 5JO5B 4UT6L 4OUUA 4G6MH 4K23L 4GW5B 4YXKH 3VWKD 3VWJA 2Y07H 4R2GB 1GGCH 4JB9L 3WJLA 4OFYA 3RFZC 2E6JA 4O5LH 4ETYA 3BX7C 1YEFH 3AREA 5F9AC 1F4YH 3V6OC 1I1AC 5JNYB 3KHQA 1JPST 1IFHL 1ZKAA 2DS4A 4JAMA 3VU2A 3WDIA 1UFUA 1KCVL 4M6OL 3BWAA 1P4BH 4Q97A 1T66C 4QT5A 2F8OA 4FFVC 4LVOB 1E4XL 2XKUA 4L3ED 4HPYL 4R9HA 2H2SD 2XT1B 5C7XH 3SE4C 2CK2A 2X4QB 3CSBA 1AGBA 5HHPA 5IUSA 3IRPX 1A02N 1PQZB 2Y6SD 5IBLC 5C1MB 2VR9A 4OLUH 2Q8BH 5FCSH 1RZJH 3T0EB 12E8L 4HDIB 3OXRA 4HS3B 4PRNA 4EVNB 1L9MA 4CVZB 2OTWB 3RU8L 4POZD 3SE8L 1M05B 1A9EB 2VUYA 3C5SB 2VERN 1T83A 4J8RA 5ILTH 3P9WB 3ZZ1A 4FQ1H 5ID0B 4M4PA 4Y1AE 5ALBH 5EZJB 5HHVL 3VFMB 3T65B 5AAWA 1WBXA 4RAHA 5GGRB 1UKSA 5IVOA 1MCRA 4ZUSB 3EO0B 4Q6IB 4ODHL 2Y4SA 4YXHH 2ADIB 2CDGA 3ZYZA 4X6FB 4OCMC 1PLGL 5D2LB 5ENWA 5HYJE 1A8JH 1G7QB 1FPTH 3T77B 3KHOA 2ZSVB 4HJJL 4JDZA 3PWPB 3DUUB 3GMPB 4YUEH 1HWHB 2AXFB 3A6CL 3PQYE 2XYCA 3TGXA 5F7FA 4BZYA 4I4WB 1MI5B 2VLJD 3RIAF 4OKDA 5CGMA 5HPMA 3BPCB 3V9FA 1HKLH 2DAVA 2EDOA 1KPVA 2QQNL 2VDRL 4O00A 5KZCB 3VW3L 2YKLL 4GBXD 2FJFA 5FA3B 3P9MA 5EIIA 3GZKA 1U8NB 4GKZA 2YPLD 4FQXD 3TWCH 4HS6A 1MFDH 3HZYA 2J4WH 5DMIL 5KAQG 5IMOB 1J12A 3QUYD 2APFA 3MLTB 4M3JA 4A6YA 1KLGA 2F53B 3QA3A 1AP2B 3G5YB 3BP5B 1T0NA 1NBZA 3WMSA 1YEEL 3BO8B 3IJYA 1P5UA 3EO9H 3C08H 1G0YR 5H8DA 5T1MB 1JBJA 2DIJA 1MEXL 2HLFC 1UB6A 3DURB 3MJ9A 2X4NA 3QEQB 2ZG3A 1FYTB 1YEGH 5CSBA 3P0YH 3PJSB 3NABH 2ZOLA 4AZ8A 1KENL 3C60A 4MNHA 5HI4D 4KTDL 3MLPA 2GJZB 3D39D 5EU6D 3WNNA 3ECBB 4L8SA 4RA3A 2DJ4A 5E0QA 1DLFH 2EDBA 2JLLA 1L9NA 4ODVL 5EZIL 3RL2A 1XIWA 1YEKL 2C4FT 4NQCB 4KVCL 3DJ9A 3H2WA 4GW4A 3N1GC 3CH1B 3TO2A 2JF1A 5JTWA 1KIUA 2I60L 5E6IA 3L5XL 3LKSB 5KVGH 2YK1H 1XH3B 2CK0L 1UCBH 5E1AB 1M71A 3N06B 5C08A 1R6VA 5IHUH 4D3CL 1XCQB 3T3MF 4MA3B 1F58H 3ZKQD 1JNLH 4BZ2H 1RU9L 1MI5E 4ZO6A 1GZPB 5INCA 1RZIB 4KU1A 4Z7VF 3TFKD 4RBPH 1A2YA 3E0GA 1BQUA 4LSDA 3TM6A 4X7SL 4WNQA 5FK9B 2BC4B 3O8XB 3KAAA 3RKDC 4ODSH 1S8DA 1HDMB 1M7DB 3O2DA 5DC0A 3MLWL 4HUMB 4XMKH 1IAKA 2CKBB 4GQ9H 3LQAH 1MFBH 1DFBL 4EIGB 4K71B 3RWIA 3GEWB 3CZFB 2EDHA 4DZBA 3D6GA 2W9LA 4U1MB 4RWYH 2LU7A 1T20B 4TN9A 1YZZA 2UY6A 5AG9A 3P11H 1WFTA 4Q9RH 5H35A 5BXFA 4PGJA 4UT7L 4JREC 1QUNA 1QP1A 2ICEB 4KAQL 1GC1H 5HHMB 1GCFA 5A16B 4UIMB 1T4KA 4WHCA 1FNSH 1TPXC 4HJ0C 3C09C 4IRZL 4NCC2 4OLZL 2AXGA 5K9JH 2OYPA 3QWRD 4M5YL 2APVA 4NWTH 4Z7WA 1OTTC 4E41D 2X89A 5I1LA 2VZSA 1I1YA 2D7TL 5CP3A 2CKNA 2XNAA 1A1NB 2EDXA 1TNNA 3BD5A 3EOBB 4BZ1L 3FJTA 3QJFB 1S7QB 5KVDL 1CVRA 2VL5A 1FZJA 2P8MA 5LCVH 5KSBE 4PLKD 1IEBB 2IH1B 4JY4B 3ULVE 2NLJB 5I66A 3CFEB 1YDPA 3SE9H 3ZKNC 5FAAA 2BNUA 4GT7A 4M61B 3OKMA 1KXQE 4FG6D 1DSFL 5C0FB 1EMTL 1U58B 3MJ9H 5IBUB 4HUVA 1XZ0A 4GS7C 4PJIE 4U0RB 1NFDE 3M8OH 1YYLH 5GJSL 1UKQA 1EV2E 4OGYH 4R6UA 5TDOA 4JRXE 4KI5D 4OFYD 4PJEF 1K6QH 3BDYH 2OM5A 3IDYC 3R8BB 4LLDA 1WCBA 5D7JC 2C3GA 2BHYA 5D1QB 2GSGA 3KLAB 1KTLA 3EJZC 2WQRA 1JE6A 2HJKB 3W2DH 2HTLC 3WIHA 2VLKD 2BVQA 5DUBB 2R8SH 1NDGA 4G80B 4PLJD 3MJGX 3OKYA 3OKEB 4GUPB 3T0DA 4HZAA 3X11B 2A9NL 1OARL 3QIUB 3GI8L 4ZUUB 4P57A 2IMMA 3WV0A 1TIUA 2AJ3B 4MA8H 4U1KB 3WIIL 1IMHC 3HS0B 4I48B 3QUMB 4M1DH 1KLUB 3O6ML 4ZS6D 5JOEA 1A6AA 4P9HH 5SWZB 2B1HH 5F1IB 2J8UE 3BKYL 2PW2A 2A73A 3DO7A 4R4BB 1HHIB 2DYPB 4M6AA 4KQ3L 1L0QA 5ESAA 3K7UA 2IG2H 2HFTA 4HIIA 4LLQA 4P4RB 4K9EC 1L0YA 4XI5D 3NFSH 1X5XA 4IRJB 1CGYA 5IB5A 3DSNA 1Q9LA 3O2DH 3RDTC 5I71C 1VESA 1EUUA 2Q20A 5FYKE 2PYFA 4O2EB 5DD0H 3B5TA 1PG7H 4KZDL 4RDQG 4QOKA 2X42A 1MH5A 2XN9A 5IW6B 1T3FB 1ED3B 1ETZB 1EGJA 4TTDD 3GFUA 1C5DB 3SGJC 2NY7H 5DTFB 5ERWA 4KI1A 4PJHF 4RFOH 3MGTB 4EUPB 3TYGL 3IU4L 1BOYA 3RAJH 4C56A 4Y4KC 1D6VH 4JFFB 1I7TA 3T2QA 1JYNA 3QQ3B 2CJUL 5IMLB 1BBDH 3H42L 1RJYA 5DGRA 1GOHA 4DOHE 3UJTH 1LDSA 2D7NA 5GGQH 4JR9H 2HT4D 2LAAA 2NYYC 4HZLB 5D5MA 1OGTB 3CU1A 3TPKA 5EH1A 4PJ9A 4GG8B 1S9WB 1AGEA 2RHEA 1YYMH 1J8HB 4OZGE 3TH2T 2CDFB 4S1RL 1BAFL 1EZVY 3EYOA 3MO1B 4CRPA 4QKXB 1ES0A 3T04D 1GYAA 2A6IA 1HIMH 3PGCB 1J0HA 4Z5RA 4XWGL 5HGGS 3S37X 3LPGA 4G6AC 1BWWA 2P7TB 2IFGA 4ONGH 4I3RL 1T04B 3RZCA 4Y4FB 2FJGB 1IVLA 1P2CB 1P1ZB 2BOCA 3V7AE 2BSSB 5INDB 4U7KA 5HSFA 1E27A 2JELH 4IDJH 2OCFD 1C1EL 2ZUSA 4NUGH 4QHKJ 3C60D 4QCIA 3X13A 4FXKB 4JQVC 1VFBB 1I3RB 4XXDB 2H9GA 2C5DC 4NWUH 1BJ8A 4HAGA 3NCYP 3OR6A 4G8FA 1ND0B 4NO0A 1CICB 3O9WC 3F5WA 1B88A 3WIHH 5K9OB 4NGHL 1S5IL 4PY8I 5MENE 1FAIL 3BDBA 1F3JA 4PRDB 5ESQB 4IHOA 1E6JL 3NCEB 2AI0L 1CE1L 5JDSA 3SY0A 3WIFA 2VDKL 7FABL 2ESVA 2B4CC 5E2UH 3HMXL 4WI2A 1YNKH 5DC9B 2X4SA 4J2XA 1XF5B 1QLEH 1G7HA 2JJTA 1QFWI 2C1PB 1MJUL 4JFFE 5DMKA 3WXWH 3DXAD 2UZYB 2HA1A 2J8OA 2AABL 3T8XB 5DJ6A 4CMHB 1CFSA 3H9SA 1KC5L 2C4XA 1F8TH 3ARTA 4TQEL 3RL1B 3HMWH 2ATKB 4N0UB 1UA6L 2XZQH 4MJID 3T2PA 5IEHA 1B9ZA 1MJ7H 5BO1L 4IIQA 1TFHA 3GSVB 4LCIH 3NOIA 5GGSB 5HGHA 4WWKD 3RVUC 4Y2DB 1HXMA 1CLYL 2ORBL 4F15B 3MFFB 4CKVX 4M1GL 1EGJH 1VGEL 4EKXA 2Q7NA 5DUPL 4W6YB 2XWTA 1S9VA 2CKBL 1JPFB 4WI6A 4DVBB 1AE6L 1EPFA 2BFVL 4O2FB 1VENA 4OCYH 4KY1L 1YECH 1JZ4A 5GRJL 1AHWA 2JIXB 3C2AH 4CUCA 1MQ8A 1O7SA 1LO4L 1QSFB 5F1NB 2YZ1A 4G5ZL 1TZIA 3TN0C 1RPQA 2HT2D 4NUJA 3D1MC 3M1BB 4HLZH 4UZGA 1VFMA 2AJZB 4G42B 4Z7VB 1NFIA 3EIFA 1WWAX 4WUUE 4LSPL 1WAAA 2EDLA 2HJLB 3LKNA 1BX2B 3K8LA 3CPLA 2VSDA 3RJDA 4AL8H 5JIIA 1R0AH 4HLZG 1MCPL 3V8CA 3DROA 3ARGD 2DQEL 1N5AB 3E8UL 1ZS8A 4Y1AD 3WBDA 2VITB 3WDJA 5FDYA 3L3HB 4RNRB 2QQKL 5DVMA 1OAKL 3SKNA 4XC1L 3SN6N 1I8MB 5I18L 2K9UA 4N5EC 5FUOL 3E2HC 5HYJD 2YPLB 4PJFB 5DA0B 2FJHA 2E7HA 3FRUB 2GJ6E 1MVFA 2VZ1A 5AZ2L 4HGMA 5GRVK 2BOBA 5BRZB 2FR4A 1EAPA 2LQRA 3PQYD 4KKLC 4NCC1 2Y06H 3SBWC 5HYIA 3QIBA 1YC8A 1BD2A 2WLYA 1TMCB 4XCEB 4UMGA 3ARFA 5F6IB 1JK8A 3BH8A 4XMPL 4N0FA 1ZTXH 1S9KC 5D9SA 4FZEH 4LSRL 1ZHKA 2ZOKA 2FX9H 3MV01 5GRZA 3IJSB 4XVJL 1EJOL 3SDAA 4MNGA 1GZQA 5JPMA 2W0FB 2D0FA 5F6HI 4L29A 1JFQH 5EU6B 4KV5E 3T3ME 3B3IB 4KJPC 1XR8A 5CEYB 1AGCB 3QUML 3VGGA 1QSFE 3OZ9H 4ONHB 4JFQA 1IGYB 1YEIH 4JFZH 3S98A 2PNDA 2D0GA 1JHKH 4IRSD 4KKAD 4P2OD 4HG4J 4WW2C 1WWBX 4Z7VE 3PIQA 5T3XH 3CVIH 5DJ0B 5FKPA 5DJAA 1FE8L 3SOBH 1KJ3H 1R3LB 3IKCA 3NIDF 3OKOB 3QISA 1JF1A 5CJOH 3S97C 2XPGA 1F2XK 2DDQL 4H25B 1P9MC 4JPWL 3GSUB 4HUWA 3K3QA 2AV1A 2IQ9H 4L4JA 5DD6A 1PG7X 3T2NL 4MLSA 5L8KB 2HWZH 3ARSA 4LSSH 5M7QA 1SHMA 3OJDB 4MQ7A 4XC3L 5TF1L 1CN4A 2XZCH 4X5WA 4UTAL 3INUH 3OV6A 4NM8H 1I1FA 4OCWL 1J7VR 4RMRA 4KXZH 4PB9H 4TVPE 1IL1A 5HHOA 4XTRC 2J12B 1XF4A 1RVFL 2ENSA 4IOIB 2DI9A 2X6MA 4LNVA 3BRDA 1OSZB 1CXEA 1BJ1J 4UILH 4DTGL 4ODUA 3I75A 4N1EA 2D7MA 1INEL 3KDMA 3LD8B 3WNLA 3DVFA 2EIEA 3UBXA 2VKXA 4PGCB 4QRTA 2VXTH 1IC7L 1S7UA 3MRCB 4F37K 2CUHA 3C6SA 1BQLH 3AROA 5DRZA 2ATPA 5F3BA 1DQDH 1UQSA 1X5IA 3RZCD 5IF0A 4HC1L 2HN7B 4JY6A 4PJHB 1J0YA 1A3QA 3STZB 3L3DA 3MV7B 3TCLB 5DJ8A 1OW0C 1UB5B 4QWWD 3FTGB 1ADQL 4PJAB 5GS1C 1HOCA 4DUWA 3I02A 4PJ8B 1UG9A 2I26N 2NY6B 5C2BH 3P4MA 4PGDB 4PTTA 4MZ3A 4X0KA 3D0VA 1L7IL 1YPZA 3N9GL 4BM7A 4QXGL 3U7WH 1QSEE 3QULA 2GYSA 1OD7A 4PJEE 1CT8B 2BVEA 1S3KL 3P77A 2DKSA 2V5YA 3G5ZB 5GS2H 5IR1B 2EC8A 2G9HA 4ELMB 3CDFA 3NIFE 4LCWB 3HUJA 1KFAH 5CKGA 1NDMA 2ESVD 4YGVA 4YDVA 2IANE 3SDDC 4LGRB 5CEZH 4WTWA 4JFDE 2R39A 2OQJA 3VWJB 3MLXL 5LQBH 1D3CA 2R0WL 4LRIC 3N1QC 3CUPA 5DD5H 5FXCH 2VN4A 1OSPH 3TYFA 3AREB 1I85A 4JGUA 4HIJA 5LGJA 4P9ML 3C6LC 2Q8AL 3ARUA 3ULVD 3IT8D 5B4MC 1NBQA 4M4RA 3SGEI 3MNZA 5FUCE 4D9LH 4QT5B 5T3XD 6CGTA 2EDKA 4NBZB 5DVNA 4R0LC 4OCXH 4MB5A 4OLXH 1OAZL 5F9WC 4C54A 3WKMH 1MAJA 5EOQH 2HVJA 4GLRH 1AGBB 1AI1L 4R3SA 3TZVD 1T1ZA 1CGTA 5HHPB 2VQTA 4P59L 3BKJH 5J89A 3V7MA 2W9EH 3RY6C 1E6OL 2NTFA 5ADOL 1TQCC 4RRPA 3MA9L 4PJ5A 3G9AB 4PRNB 4BSJA 2YPVH 1WT5C 2ZUXA 4NZDA 3WS6C 1DQMH 4J8RB 4MD0A 5FKAB 3EDKA 5I1CH 2UZIH 3MV7E 4OZ4A 2ED9A 2ZZUT 1WBXB 5J12C 1CFBA 3LMJH 4JFEB 4KRNA 4NN6C 1DBML 5HDOA 2CDGB 4DKFL 5D1ZC 3UJIH 5AG8A 3CLFH 1UWGH 1HYSD 3FB8A 4ZS7L 4PJ7E 5ENWB 3B2UD 2O61A 1N4XL 4TUJA 4UT9L 2NZ9C 4JDZB 3JWOC 4OM0L 4R97C 2VXSH 1MCBA 3MJ6A 4GSDH 1NMAH 2D4FA 4AT6A 2GAZA 3FZUC 1TZGL 3KPLA 5KG9A 4KROD 4XVTL 5HPMB 3AAZA 3BP6A 3QSKB 1B6DA 2QHRH 1KPVB 4DGIL 3U0PB 4WHYH 1FFPA 2NY5C 3UBXG 5IQ9A 5AZEH 5FYKD 2FJFB 5T5NF 3P9MB 4KJYA 5EIIB 4GKSA 1UKTA 4GKZB 3H3PH 5JHLH 5CLTA 4YO0A 4HS6B 1XGYL 1G7PA 1MFCL 4U6VL 1FFRA 3HZYB 3LB6C 2ZCKH 4WHYG 4XNXH 5T33L 1KLGB 5C6WH 3QA3B 3QIBD 4K8RL 1T0NB 1NBZB 3LRSA 4OLYH 5E2TH 3IJYB 1FL3A 5GS2D 1A22B 1JGUL 3QNXA 2CRYA 4M7LL 1HYRC 4E0RA 4GRLA 3JV0A 4P4KD 1LD9B 2EDDA 2EH7H 1UB6B 4P5MA 2X4NB 2NY4B 5I6XB 4MHHG 3QG7L 4F8TA 1Z2KA 3D2UD 2AQ3A 1UH4A 2ZOLB 2J6EA 3FT2A 4JM2A 4W81A 3C60B 4MNHB 4B41A 3IB4A 2FYYB 3IS0X 2Z4QA 5E6YA 4L8SB 2XWBA 4G6ML 1RHHB 4JFEE 4YXKL 1ZK9A 1ZHLA 3A6BL 1GGCL 3RL2B 3VMNA 1XIWB 5B21A 4CJ1A 4Y5YC 4GW4B 1BZ9A 3SKMA 3TO4D 1T5XA 4O5LL 2AEIT 3TO2B 1F4YL 4I13B 4WJ5A 2HT3C 3U48A 4P23C 5E6IB 3BQUC 2VXQH 5CD5C 2EYRA 1T7XA 5IT2H 1M71B 5C08B 2XZZA 2ICCA 1MNUH 5AEAA 1P4BL 2R9HC 2UWEA 3BOVA 3LDBC 3MROA 4DW2H 3S5LA 4C58B 3ARDC 2P24A 5T1DH 4LHJB 5INCB 3QIWA 5J1AA 5C7XL 2A77H 3DVNA 2FIRT 5CZVL 1A2YB 2ZWLT 3LQZA 4OLUL 5MEND 1M4KA 1S8DB 1WAAF 5D7SH 1SQ2N 5D7LE 1EK3A 3B9VA 1IAKB 4HMEA 4NFBA 4RRPG 2FO4A 2GTZA 4Q0XH 1R24A 5ILTL 3VXMA 4FQ1L 5F1OB 3RWIB 5ALBL 4DZBB 2P48B 4C55A 2G5RA 1MSPA 3IDMA 4HWUA 4XNZC 3MR9A 5BXFB 4YXHL 5T1LD 1I9IH 2X1WL 3CC5A 3K1KC 2YD9A 3WE6A 4YH6A 4O58H 5DJZA 4RGNB 2FEDD 1E0OB 1X5GA 1KN4H 1T4KB 1FPTL 5JQ6H 3SKJH 2WBJA 2YN3A 1DN2A 2AXGB 1AR1D 4KWUA 4G3YL 4Z7WB 4YC2B 5I1LB 3BPOB 1I1YB 2ICES 3OJVC 2XNAB 1FG9C 4WU5A 1HKLL 2ZJSH 4ZAKD 5CEXA 5C0CE 4FS0A 1CL7I 2EZ0D 4LPWA 2VL5B 2VAAA 1FZJB 3C2SA 1I7RA 1KCUH 1U8OA 1YDPB 1MCFA 3QXWA 4PUBL 4S11A 2BNUB 4GMTL 2V2XA 4RAUA 3WFCH 4EI5D 3KR3L 3OKMB 3TWCL 4XBGA 5FM8A 1MFDL 1J1OL 2J4WL 3LN4A 5FYLD 3PNWA 4P5TC 5F7MC 1OL0A 3GSNA 4HUVB 4PGZA 4PG2C 1PVHA 1A7QL 4JG0L 4WCYH 3JTTA 3QDGA 5TDOB 3EO9L 3C08L 3UZQA 3K8KA 3QWQB 3LY6A 4WUUD 1NUGA 1WCBB 2L7JA 1U2HA 4P3DA 2GSGB 4YR6A 1KTLB 1S7XA 3EOAA 4N0YH 5FGBC 1YEGL 3RUGA 1V3LA 2R0ZL 1NH6A 3P0YL 5E56A 3NABL 4HUNB 1AQDA 2BVQB 1NDGB 5C07A 4WI3A 1NCWL 2HH0H 1JGEA 3S6CA 1ODAA 3TT3H 1OF2A 4D9RE 4XVSH 1OTUD 5JDJA 4KPHH 1MLBA 1U8PA 1DLFL 4OSUH 4P57B 5JW5A 3QNZA 3GSXA 3OG4B 1P4LA 3HTLX 1A6AB 3NIDE 4LBEA 4NQUA 4RGNE 4PJ5D 1MRCH 2PW2B 2A73B 5KVGL 3DO7B 5SWSA 1DVFC 2GJ6D 1YEDA 3VGBA 1UCBL 3FQWA 3U0TA 5ESAB 4XNYH 1W0VA 2W65A 1U8HA 3QXUA 3RVTC 4M93C 5J6GA 3HFMH 4HIIB 4S1QH 1F58L 2W38A 1GHFH 4LLQB 1A1OA 1JNLL 4ZTOH 1N6UA 5IB5B 1X5ZA 5E2VH 1Q9LB 3S5LG 2Z93A 2PYFB 5F9DC 3L95A 2IWGA 1LVEA 5C0BA 2EDWA 4QOKB 2FZ3A 1MH5B 2Z35A 5JHDE 2XN9B 4P46D 1E4KC 3W5NA 3ULSB 1A3RH 1HQ4A 1NCBH 3MGOA 4ODSL 3ZSSA 4U1LB 2GEEA 3ZL4H 3GSWA 5ERWB 4NYLA 1U3HD 4GQ9L 4OB5H 4P3WA 3LQAL 3C5ZC 3QUZA 4UNUA 1PZ5A 1MFBL 2BVPB 4C56B 5AD0B 1BQSA 2F15A 3HG1E 1I7TB 2CQVA 3E3QC 5T1KA 1DBBH 4RWYL 1RJYB 5DO2D 3EDDA 4WI4A 1KJVA 2AK4E 4Q9RL 5CD3A 4KJQD 4GOSA 5EU7C 4W6XB 4NJ9H 4Y5XC 5I75C 3PP3H 1T0MA 4YNYA 2PO6C 5D5MB 2G2RA 1GC1L 5CINH 1RZFH 1ZXQA 1IGIH 2YRPA 5FCUL 4PJ9B 1T89C 4XNUH 1FL5A 1AGEB 1FNSL 5GRXG 1H8OA 2LABA 2XG5A 1MCJA 5K9JL 3RVVC 4NWTL 3EYOB 3IVKB 1ES0B 3B83A 5JIPA 3FKUS 2A6IB 2ZUVA 4Z78A 4NOBA 3MTRA 1PJ9A 4Z5RB 2F5AH 2VWEE 2EE2A 4YHKH 2D0HA 1OPGL 1KGCE 3RZCB 4DQOH 1BOGA 4U1GB 4EJ1C 4TVPD 4GRLD 5LCVL 2BOCB 3GSNH 4NKIL 1YUHA 3BPLC 5DI8B 5DRNB 4LPCA 3SE9L 2VR4A 3WLWC 3B9AA 3HZKA 4NHUA 4QCIB 3WHE0 4M1CC 1QFWL 1MCWW 4W4OC 3X13B 2HVKA 3O2VH 4AIOA 2H9GB 3QPQC 4Y16C 3OR6B 4G8FB 3CX5K 2Y36H 4NO0B 4WFGE 3M8OL 2JB6A 1YYLL 3F5WB 2YXMA 4OGYL 3EO1A 4FABH 4J12A 1F3JB 1IEAA 1K6QL 4IHOB 3SJVE 3WO3B 4DKDC 1A6ZB 4DUVA 3WIFB 3SY0B 5JDSB 2IPUG 4LHUA 2X4SB 5C9JA 2R8SL 1A6VH 1G7HB 5KW9H 1MFAH 2XA8H 2NXYB 2BNQE 5DMKB 4H5SA 1QR1A 5J4MA 5DJ6B 2NY1C 1CFSB 3H9SB 1JP5A 1TNMA 3SGDI 1Q94A 1UM4L 4M1DL 1LMKA 1G0XA 4XHJD 5IEHB 4O2CA 1ZWIA 1OY3B 3IDXH 2B1HL 4IIQB 3IXAA 5LVEA 5HGHB 4OZIF 1QFOA 4M62H 1HXMB 4NT6A 1IM3A 3LN5A 4ZYKA 2IAND 4XX1G 5EC1A 4V1DE 2PXYD 2XTJC 1HHKA 1RD6A 3P40A 4JFDD 3GK8L 2R4RL 3O2DL 5ALCH 2XWTB 1S9VB 2BXYA 2EXYC 3C9NA 5DD0L 1U3ZA 3W39A 1PG7L 2WWKO 3KJ4C 1BGXL 5F7DA 1P6AB 3BI9X 3NPSB 3IYLW 1AHWB 3H9ZA 1P5VA 2DQTH 3DV6A 4JCMA 2KH2B 3OKLA 3MRMA 1NCCH 2NY7L 1TJHH 1UT9A 5DK2A 5EN2A 5TH2A 1TZIB 3AM8C 1QD0A 4H26A 5EFIA 4FMKA 3TA3C 1JPGA 4MAYC 4OJFL 1D6VL 4YHIA 2BDNH 3ULUH 3IRZA 3EJJX 1NFIB 1BBDL 1NCAH 3PGDA 4KC3B 3MOAH 1MF2L 4ZUVA 3UJTL 4PYGA 5B3JF 4ZFFA 1CLOH 1NGPH 5JXAH 5GGQL 4F7TA 3O0RL 3LKNB 2RGSA 4NBYB 4BQ8A 4UDUA 2P46B 5TGBA 1YYML 1GXEA 5HVFB 4F80A 3OJMB 4J4PA 4LKCA 1HIML 4MCYA 2X9WA 4X4MA 5EUOA 4CVUA 3SKNB 2ZUYA 3PDOA 3MUGA 1G1CA 2DTML 4ONGL 2AQ1A 4ZXBA 5DS8A 1BFSA 1WZ1H 3NH7H 1BMGA 2FJHB 5GPRA 1DQTA 3HC0B 2BOBB 4RFNB 5LWYH 2FR4B 2JELL 3B2VH 4W4NA 1EAPB 5CCKH 4NUGL 3VD9A 3QIBB 3RIAK 3U7AA 3V6ZA 1BD2B 5JW3H 4ERSH 4I0PC 4NWUL 2Q1EA 1CQYA 1OCWH 3ARFB 1JK8B 1AY1H 3BH8B 4N0FB 3QCTH 4CL7A 2Z31D 5I8CA 3QCUH 3T1WA 2ZOKB 4NSKA 4EN3C 3SDAB 3WS6A 4MNGB 5DURB 1GZQB 3NN8A 3VFGH 3LH2H 5JPMB 5GGVH 4PP1D 4L29B 5SWSD 1CGVA 1R3JA 3ARBD 5IJKA 5E2UL 4WFFE 1YNKL 1FNLA 1CF8H 5DFVC 3RPIA 1F00I 4JFQB 5FGCB 1QLEL 4LHUG 2KQNA 1GAFH 3WXWL 4HWEH 1RUPH 3PIQB 5FKPB 1DTUA 5DJAB 1QOKA 5FF6A 4H20H 3FN9A 4JZOA 3O6KH 1F8TL 2NR6D 5C0BD 3S96A 3IKCB 5CGYD 1JF1B 2MQ3A 2XZQL 3UTSE 3DPBA 4P2RE 1HCVA 5BCAA 4LCIL 5B39A 5CJBA 4HUWB 4BFBD 5DD6B 3L7EA 2VO5A 3UC0H 5C0AB 5CZXC 2AXJA 3CXHK 1RFDH 4KMTL 4MQ7B 2FB4H 2DQIH 3FFCE 4WFEE 5T1KD 4X5WB 5HYEA 4MS8C 1I1FB 2FL5A 4YBQD 3V6OE 4PBXA 1KCLA 3KWWA 5HHOB 4FQIH 2JJSA 3BD3A 4HUKB 1XF4B 3QWOA 3V5DA 8FABB 2B0SH 4OCYL 3Q2CA 4JO4H 3WN5C 3ULUD 4LVOC 3QXTA 4ODUB 3I75B 3NCJH 5F7NC 3ZDZF 5I1KH 3KDMB 4OLWH 1Z3GH 3CFDA 3WFEH 3PV7A 4N0CD 1LP9F 3UBXB 5DMGD 4RMWA 2VL4A 1G6VK 1VEOA 4QRTB 4DEPB 3KYNB 4YFEA 1KEMH 1IAIM 1LK2A 1S7UB 4MX7A 3RVXC 3JVGC 4LF3B 1MVUA 3GBNH 3C6SB 1JWMA 1CI5A 5DRZB 1P69B 2ATPB 4WENB 3EAKA 5F3BB 2I9LA 1UQSB 5IF0B 3RGVD 3FO0H 4Y4HA 1HEZA 4JY6B 4M3KB 3VFTA 4AQOA 3HZVA 4AL8L 3ZHLA 1KYOK 4XMLH 4PJBA 3L3DB 3RUGF 1R0AL 3GI9H 4OIAA 5DJ8B 4Q6IC 1HOCB 3I02B 3P4MB 1IZKA 1TJIH 4UTBL 4PTTB 5FGCE 3PWVA 2FBJH 4X0KB 3D0VB 1YPZB 4RGOH 1LDPH 4KKCD 1PD6A 4JJ5B 3K4AA 2V2TA 1WIUA 1ITBB 3PL6A 5D7IF 4PBVC 5EWIH 3U0WL 2EDTA 3P77B 2M2DA 4X9BA 2G9HB 2NY0D 5BS0A 5KSVA 3W9EA 3HUJB 1NDMB 3IFOA 3HI5H 2X4TA 3QQ9D 4YGVB 2Y06L 2J7LA 4YDVB 2VDQH 5EBMA 1LILA 5C0AE 1NUDA 2Y5TA 2OQJB 1X5HA 4BH8A 3H7BB 4CW1A 3CUPB 3TYFB 2LV4A 3DLQR 5A43C 4HIJB 2B2XH 3BFOA 4FZEL 5D8JH 5LGJB 4XPHH 2FX9L 2F54A 2IEPA 4LLYB 1T1YA 3MV8D 3FAWA 3MNZB 5L2KE 4KQ4H 2LVCA 1CDJA 1JFQL 3MQIA 4UAOB 1VACA 2A83A 4KUZH 4KTEH 4NFCA 3JWOH 3IAPA 3MUZ1 3OZ9L 3FO9A 1NUNB 1FLRH 1YEIL 2HVJB 4JFZL 1JHKL 4R3SB 1T1ZB 3ISWA 5IVNA 3QNYA 3H6JA 3FQTA 4PREA 2NTFB 1SJHA 4UV4H 3SOBL 1KJ3L 3V4UH 4PJ5B 4F8QA 1BP3B 3QUXD 5CJOL 2MMXA 5L88L 1EFXD 2I27N 4MD0B 3WNMA 4GRWH 2IQ9L 1N0XH 4HS8H 1U8LB 4LPYA 1YJDH 5B39G 2HWZL 4LLUA 2AW2A 4D9RD 4Y0GA 2XZCL 3INUL 2V5SA 1CD8A 2QKIA 4JO3L 3FB8B 2O61B 4PB9L 5ISZA 3HE6D 4TUJB 2NX5A 1KTKE 5E5UB 1DQQA 1CZ8H 4ZNEA 5CMAB 1LEKA 4LSQL 4UILL 2IFFL 1F6LL 1NKRA 3TH4T 3MUHL 5BW7C 4AT6B 2GAZB 4LSVH 3MLVH 1KCRH 3RWDA 4GS7B 4RQQA 3KPLB 3QJHA 3AAZB 1YMME 3R4DA 2DQUH 3BP6B 1A1MA 1G7JA 1FFPB 3IDYB 4BH7A 3O8XC 2VXTL 5IQ9B 1A7RL 4MJ2A 3CIQA 3EJYC 5ESVA 4KJYB 4GKSB 4ZXBD 5JHDD 1NLBH 3RY5A 3T0AA 4V2CB 1VPOH 4UQ3A 3GHBH 4YO0B 1EHNA 1G7PB 4OD3H 4AH2A 3GMNA 1QLFB 4DVRH 4UQ2A 3ZKMC 2XY2A 5E9DE 3GGWA 3LRSB 5C2BL 5D6DC 4W68A 1FL3B 2YZ8A 3QNXB 3RI5K 3RNKA 2AK4D 4E0RB 5ACMA 3MUY1 4GRLB 5DD3H 4P5MB 5C0DA 3MRQA 3FT2B 4JM2B 1HH9A 3RQ3A 3SPVA 2I5YH 4WO4D 1KFAL 4HKBB 2WIMA 4L4VE 2Z4QB 4CU8A 4ZUTA 2XWBB 1Q0XH 5CEZL 2MCPL 5C71A 1ZHLB 1XMWA 5HI3D 1BEYH 4RFEA 5J57B 1HK6A 5EZLA 5LQBL 1U8QB 1BZ9B 3SKMB 1T5XB 4PRHE 1OSPL 4BSWA 1BJ1H 1T80A 4WJ5B 5A2JH 1KGCD 2ED7A 4YHPA 1AH1A 3I6LD 4JCLA 1L4IA 4S0SD 3C5ZA 1R5VA 4OZIE 1EJ6A 3FONA 4PRPA 4XP1L 1IT9H 4D9LL 2UWEB 1S9XA 2CMRH 4U0RC 3V0VA 5IG7A 3MROB 4JEGB 5CAYB 1MRFH 3S5LB 1HXYA 4PS4L 4OCXL 2P24B 1NSNH 5AYUH 1J88A 3WCYA 1ZLUK 3QIWB 4LAJH 5J1AB 4OGAC 3MYZA 4ZPVA 3DVNB 5EOQL 2DM4A 4U7SA 3KPSB 4S0TD 5D1QC 3BKJL 3LQZB 2W9EL 3THMH 5ICZA 4NQTA 4YJZL 1KLFA 3S3JA 1VSCA 2GJJA 3RTQA 3OKNA 1CLCA 3NAAH 1UACH 5F70A 1G9NC 4PJGF 4UNVA 3SJVD 1MJ8H 2YPVL 4CN4A 4QRSA 1A14H 2FO4B 1DQML 2GTZB 1H5BA 1R24B 3VXMB 1ZT7A 4OZFA 5I1CL 3QIUC 2UZIL 4MVBC 4R7DA 4DKAA 1UVQA 3IDMB 3LMJL 1OLZA 2AJSH 3MR9B 1GVIA 5JZ7C 2BNQD 5HVHB 5SX5H 2PW1A 5BQ7B 4PJCA 5IROC 2IBGA 2ILLA 3UJIL 5B3JE 1D5MA 3TVMD 3WE6B 1UWGL 5DJZB 3CLEH 2PTTA 1G9EA 2WBJB 2NNAA 4TPRH 4W4OA 1MCKA 5ICXA 4GSDL 1NMAL 4IRJC 5FUZH 2J2ZA 1MRDH 1N0LA 3A67H 3O9WB 4WU5B 1ITCA 2IF7A 2ICWJ 2Q3AA 4ODWA 3SCMC 5CEXB 3NCMA 3IXTA 3V6BR 3DX9A 5AZEL 2VAAB 2EICA 2AJVH 3PL6D 4FOMA 1BZ7A 3OBAA 1I7RB 1U8OB 2ADJA 3H3PL 5JHLL 2V2XB 4RAUB 4JDTH 4FZ8H 3HE7D 1CXLA 4XBGB 4MWFA 3BPNB 1OB1A 3LN4B 4J3UA 2ZCKL 3GSNB 4XNXL 4P2QA 5CGTA 2FECL 4CNIA 4X7TA 1MREH 4OLYL 5E2TL 2QQLL 3JTTB 3QDGB 3H0TA 4HIEA 3KPSE 1T2QH 2EH7L 4P3DB 1CD9B 5DJCA 4NQXA 4YR6B 1S7XB 3BGAA 3EOAB 2F54D 3RUGB 1N6QH 4XH2B 5K9QG 2V9RA 1NC4D 1AFVH 1RULH 3B9KD 1AQDB 3QXAA 3UTTA 5C07B 1SJVA 4OFPA 1HE7A 3OAZH 1E4WH 4FTVA 3ZTJH 3VXME 1JGEB 1PSKH 2RQ8A 5MP6H 1OF2B 2IC2A 4KK6D 1MLBB 1U8PB 4JFXA 1G6RA 4Y4FC 4GAGH 5JW5B 3LEVH 1QR4A 5ACZA 3QNZB 3GSXB 1P4LB 5FOBA 1K4CA 3VXSE 2DQDL 4X9IA 4D0CA 4GRWF 4OI8A 4LBEB 2A74B 1VCAA 2O26U 4NIKB 2VXQL 3MRFA 1UENA 3CFKA 3ZTJG 4AIZA 1YEDB 1EFQA 1VEMA 4X7EC 1ZLVK 3TN0B 1SBSH 3VA2C 5IT2L 3FQWB 3U0TB 4KHTH 3V79C 5I1EL 1T1WA 1W0VB 2OR9H 2W65B 1U8HB 4NOFA 4QRPE 5LJYH 1MNUL 4XAWL 5J6GB 1LO3H 1MHEA 3IFLH 1CICC 2X70B 4DW2L 1X5KA 2RBLA 5A1AA 1FJ1A 1SEBA 2Z93B 3VD4A 1UH3A 2A77L 5IHZA 3IU3B 5C0BB 2COQA 1YY9C 3BZFA 1BM3H 2FZ3B 2VMFA 2Z35B 4OZFH 4PR5A 4DWHA 4WEBH 5ISZD 1HQ4B 3MGOB 3FT4A 5IFAL 4S2SA 2V5TA 5D7SL 2C3HA 1IBGH 2YA2A 2PYEE 1T2JA 3GSWB 2CIIB 4NYLB 3VWKC 4HXAH 3ZDZE 3QUZB 1PZ5B 3NFPA 3CAFA 3R06A 4Q0XL 3U2SA 4LVEA 6FABH 4U2YA 5T1KB 1LP9E 3QG6A 4YHLH 2BVYA 3G08A 3MLSH 4OZFG 3BRGC 1KJVB 4N8PA 1HZHH 4R4ND 1G7MA 3OXSA 1I9IL 4DZ8A 2RJMA 1T0MB 4YNYB 1BVLA 2G2RB 5C70A 1FL5B 4Y2DC 5JQ6L 4QXUH 4F15C 1IKFH 4P2RD 1FGVH 5D2NA 4OLVH 1YN7A 3LKRA 3N1FC 2OSLA 1OVZA 3W81A 2KUTA 3OF6A 2Y6SC 4Z78B 2QLVB 4DAGL 5CLWA 2ZJSL 1OT1A 3DYPA 2ENYA 4XCFH 3CVHA 4POZC 3JBG7 3BN9C 1BOGB 5D7IE 3VFRA 3W9DA 4HKZA 5CJ5A 2ZUUA 1NGQH 3RBGA 1I1AD 4F2MA 3EGSA 1YUHB 1H9VA 3MXVH 2D3VA 1WQVT 1KCUL 4H1LA 3GBMH 4MXWH 4NQSA 3WDHA 4N8VA 3HZKB 4NHUB 1T66D 4X4ZA 1FG2A 1ZANH 4XCYA 4I2XA 4L4TB 2HVKB 4FFVD 4PJXA 3GMLB 1FNGA 1J18A 1A6UL 1QHOA 2E9WA 3OMZA 1UXSA 1B90A 3MXWH 5SX4I 1ZSDA 2JB6B 1CE6A 2A38A 4WCYL 3EO1B 5IBLD 5DT1H 1NGWA 2WWKT 3QAZB 2VISA 4Y2OA 4JGMA 1IEAB 4YHNB 4ZO8A 3VH8A 1IKNC 2NY0B 2R1WA 4WV1A 1JYWA 1G6RH 2DBJA 4N0YL 4XXCC 4LHUB 3HZMA 4NC1C 5C9JB 3PHQA 1QRNE 4ZOAA 1ZV5A 4LNRA 3SKOA 3P73A 2EH8H 2HH0L 4XP6H 4YWGL 4EXPX 3O45A 4GBXC 4H5SB 3TT3L 1U95A 1QR1B 1BJMA 4XVSL 1RMFH 4KPHL 4OSUL 1HCFX 5EZOH 4K8RC 1Q94B 2RCSH 1W8NA 1FYHB 3WN5A 4QO1A 3BRFA 1WGOA 2H6PA 4O2CB 5JOFA 1ZWIB 2AP2A 4XNMB 3RTQD 2EDYA 3IXAB 5IM7A 4CADA 1KELH 1HNFA 4OFVA 4XNYL 1IM3B 3G04A 3LN5B 4OFIA 5F6IC 4ZYKB 3HFML 5EC1B 4K94C 4S1QL 4LCUA 4ZTOL 1HHKB 1JTTA 5E2VL 2MHAA 1QG3A 1DBKH 3W39B 2F58H 2VLMD 3NA4A 5FECB 3C8DA 5HI4C 5F7DB 1GGYA 1KTDA 1A3RL 1BFTA 5JIKA 3DV6B 1NCBL 3F7QA 3HNVH 2UV3A 1E4XI 5BZWB 1CS6A 3OKLB 3ZL4L 3MRMB 5L2KD 1U8KA 1TQBB 5DK2B 5EN2B 1UADC 5TH2B 2Q6WA 4GG6A 4OB5L 5DYOA 3U1SH 4D0DB 4H26B 2VTFA 5EFIB 1G0DA 1JPGB 4P2YA 5CSZA 1ZLWK 4L4TE 4YHIB 5F9JA 4RMQA 2NW2A 1DBBL 3UTPE 4F9PC 3PGDB 4U1SA 2R2BA 1B4RA 2B5IB 4ZUVB 5ACLA 4ZFFB 3GRWH 4BA8A 4F7TB 4KJWC 4NJ9L 5B8CA 2VZVA 5CINL 1IGIL 5JR1L 5F7LB 3NBNA 1WISA 4KDTA 1RZJC 4UDUB 5KSAA 3GKZA 5TGBB 3CVHH 2JCCE 4NP4H 3MCKA 3WYRA 1NAKH 3TFKC 3QDMB 4MXVF 5FV2A 1NGXA 2J5LB 4D8PA 1D5XA 2KZWA 4LKCB 1JZ7A 1PBYA 2CPCA 5I1GH 4H1LH 4MCYB 1K8IA 4MJ4A 5HDLA 5EUOB 2B4CL 3AUVA 3PDOB 4QHNA 4G7YH 5A2IH 1ZGLA 2YXFA 2H1PH 4YHKL 5EO1A 4KRMB 3DI2B 2X41A 1JHLH 1TCRA 1IM9A 4KKNA 5CJQH 5DS8B 4DQOL 5C2UB 1KOAA 2VABA 4ZSOA 2L4OA 5K93A 3MJ8A 2BNRE 2I9TA 2W07A 2CDEA 2QSCH 4H1LG 3UTTD 1AQKH 1HN1A 4N8VG 3V6ZB 3QQ4A 3O2VL 4FTVD 1OGAA 9CGTA 1CYGA 3BSZH 1YMMD 5FB8A 1T21A 3VXUA 2HLAA 5IMKA 1PGRB 5TQ0H 1I3GH 1TQCB 2VDLH 3U30B 5I8CB 4M43H 4OD1H 1NBYA 4NSKB 4FABL 5JPNA 5J7CC 3RKDD 4ZO9A 2VDMH 2LU3A 3QH3A 1JTOA 3VH8G 1KB5A 2NY6C 4M8QA 1R3JB 3DTXA 3BZEA 4JVWA 3EOTH 3RPIB 3TC9A 1OP3K 3EFFA 1A6VL 4IDLA 5KW9L 1MFAL 5E9DD 3KXFE 1EAJA 4PLKC 2X5PA 2EDFA 3O3BA 5FF6B 5DLMH 4JZOB 1WBZA 2FH8A 3DOSA 4NJAH 2UUDK 4FG6C 4E42A 3MLYH 4X6CA 5E95B 1DN0A 5BW7A 4PJGE 1U93A 4HJ0D 3TESA 3IDXL 3D69A 1PDKA 2FNBA 5B39B 1C8PA 1OTTD 4YHML 4HPOL 1KEGH 4M62L 3WJLC 2HKHH 3QYCA 4KI5C 1F3DJ 4L4VD 2DM3A 3QDME 4NKOA 3AREC 1YEHH 5C0IA 4J7RA 2FL5B 5CS7A 1SEQH 5ALCL 4GRWB 5EIVA 1LE9A 3WSQH 3CMGA 3KWWB 3W0WE 3SEPA 4PRHD 1R5WA 3QWOB 4KGLA 3V5DB 3MBEA 4NFDA 4PLJC 3CZJA 3ZKND 2E7LA 2DQTL 5D7KE 4ZMAT 43CAA 3IAQA 5IB1A 1B0RA 1NCCL 5FO9A 1TJHL 2H41A 2YSSA 3CFDB 2Y5EA 5F3HA 1GJIA 2BDNL 3SDCA 3DHMA 1EEZA 4ZS6C 3P4LA 1LK2B 3G9VA 4MX7B 1NCAL 3MODH 1MVUB 5D71H 3MOAL 1JWMB 2CRIA 3OQ3B 1YA5A 3HRZA 4ZFOL 1Q9KA 4EIZC 4QHMA 1NGPL 5JXAL 1T83C 3QFJE 4Y4HB 1CGWA 1HEZB 2YD4A 3VFTB 1JHTA 3EJZD 2CR6A 2IH3A 3HZVB 2EO1A 3D25A 4XI5C 5HHXH 4PJBB 5E2JA 2HTLD 3NTCH 3O6LH 3H9YA 3LQAC 3NZ8A 1V3JA 3GIZH 4O51A 3DRQB 3CGTA 3PWVB 5KJRH 3K2UL 1SMAA 5C0ND 4U3CA 4JFHD 1EZVX 2V2TB 5F7WC 4GXUM 5ITFA 3ETBF 2GKIA 3QPXH 3FL7A 2BVOA 3NH7L 3D85A 5GZOC 2NZIA 5LWYL 5BS0B 3B2VL 2OZ4L 5KSVB 3W9EB 4CN1A 5DGQA 2HJFA 3IFOB 2X4TB 2OTPA 2X1XR 2P45B 1H15B 5EBMB 2P5WE 2Y5TB 5JW3L 1FSKB 2IALB 4BH8B 4ERSL 3RDTD 1Z9OA 4CW1B 2CO7B 1OCWL 4R96A 2DQGL 1KB5H 1AY1L 1AXIB 1RUQH 3QCTL 4HK3N 1IGJA 1QFPA 3QCUL 4GRWE 4ELKA 1IRAY 3DSFL 3N85H 1EO5A 5KS9A 1RUKH 3EDJA 1T1YB 3VFGL 3LH2L 5CBAA 4JFYA 1WZMA 5GGVL 4MAUH 4HAFA 3KYMA 1VACB 2A83B 5C3TA 4Y4KD 4HEME 4NQEB 1CF8L 2MTPA 4ONFH 4POUB 2HFGH 1ZT4A 1GAFL 5IVXA 4HJGA 1G7LA 4HWEL 5CHNA 1RUPL 2NY4C 3GO1H 3QNYB 3FQTB 5FYJH 2NYYD 4XAKE 4H20L 3LV3A 1SJHB 1KB9K 1OAYH 3O6KL 3C8HA 2P5EA 4HV8A 3C60C 5TE4L 3MSPA 4Y19E 4QGYA 4I77L 3O6FA 1QBAA 3PWLA 4L8SC 3WHE1 2VSCA 4L9DA 4LHQB 5F89A 2O93L 4U6HA 3SO3B 3UC0L 4QRRE 3SCMA 1XIWC 2KKQA 4LLUB 1RFDL 4U7MA 2BX5A 2FB4L 4GW1A 4NBXB 4G6AD 5C09E 4MA1B 5E6IC 2QKIB 5EU4B 2DLEA 2MNUA 2BY2A 5ISZB 1YEJL 4NKQB 4M5ZH 5IBTL 2NX5B 4FQIL 1DQQB 1TJGL 1LEKB 1WICA 3MA7A 1P7QD 4JO4L 3SHSA 1LE5B 1W72A 3GHEH 4P9HC 5KSAD 3RWDB 3NCJL 3U9PH 1AD9A 5I1KL 4QRPD 1A64A 4OLWL 1Z3GL 1LEGA 3KPRA 2DLFH 3G6AA 3QJHB 4PJXF 35C8L 4OIIH 2BY3A 3KYOA 3I50L 1A1MB 1G7JB 4BH7B 3VD5A 1V3KA 1BPVA 1KEML 2OS7A 5HDQH 1MPAL 3MZTA 5DZLA 3GBNL 5ESVB 1DANU 4XPBH 2AV7A 1B0WA 1B0GA 4WWKC 2AVGA 2H3NA 2PR4L 2Z91A 4UQ3B 2ZCHH 4JRYA 5E4IA 4AH2B 2PYED 3GMNB 4XMLL 4R8WH