3RFEA

Crystal structure of glycoprotein gpib ectodomain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
PCPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quaternary organization of GPIb-IX complex and insights into Bernard-Soulier syndrome revealed by the structures of GPIbbeta and a GPIbbeta/GPIX chimer
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Platelet glycoprotein Ib beta chain
total genus 33
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01463 LRRCT Leucine rich repeat C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3rfeA00
4R58A 1OTMA 2IFGA 3G06A 4GLPA 4MN8B 1XCDA 3W3NA 5AWAA 3WN4A 3FXIA 3GOZA 2OMZA 1A9NA 3ULVA 4LI2A 4L3FA 3BZ5A 4BV4R 3ZYIA 5HDHA 4KNGA 4TZHA 4R09A 2Z63A 3C6OB 5D3IA 3CIYA 4Z79A 1XECA 3OJAA 1P8TA 4LSXA 4LXRA 4I6JB 5FTTB 1W8AA 2Z7XB 1FQVA 4XSQA 3WPFA 4FCGA 4RWTC 2FT3A 4CP6A 4J0MA 4C2BB 3WPGA 3W3KA 1IO0A 3CVRA 4M7EA 2R9UA 4R5DA 3W3GA 3WPEA 1DS9A 4U7LA 4XOSA 5CMPA 4Y61B 2P1OB 4CC4C 5IJCA 3VQ1A 2OMVA 3OJAB 1G9UA 4WYKA 4ECOA 1WWLA 2UZXA 3RJ0A 4Q62A 5CMNA 3G04C 4R6FA 5LFNA 4LSXC 3P72A 2JE0A 1YRGA 3OGKB 4BSSA 5HZLB 3E4GA 1K5GC 1O6SA 1GWBA 2OMUA 3M18A 4P8SA 4RCWA 3RFSA 3UL7A 3UL8A 2WQVA 4Z8GA 3ULUA 3E3ZA 4U08A 4LXSA 1FS2A 1XWDC 2UZYA 1OZNA 4R6GA 4RCAB 1OTOA 4UFRA 5GMGA 2P1PB 2WFHA 5AZ5A 2V9TB 4NKGA 4R6AA 4Z61C 3OGMB 1FO1A 5IJDA 4CNMA 1KOOA 2P1QB 1OOKG 5B0NA 3C6PB 2Z62A 4ARNA 3RFJA 5A5CA 2ELLA 3KJ4A 5AWBA 4V2CA 2Z66A 1P9AG 4R07A 3W3LA 1O6VA 2O6QA 4PSJA 2OMWA 2ID5A 2Q4GW 4OQTA 3WPBA 4KXFB 1U0ND 3RW7A 3REZA 4LSAA 3JB9j 5GQRK 1M10B 2BEXA 4U09A 1XEUA 3CIGA 3RGXA 4AW4A 4PKIG 4V2EA 4U06A 4EZGA 2Z82A 2WQWA 3ZYNA 4BSRA 4MQWX 5GMFA 1O6TA 2JE1A 2A0ZA 1DFJI 4QXEA 5B0TA 5AWCA 3RW6A 4ECNA 4M7EC 1DCEA 2Z64A 4C2AB 1PGVA 4FDWA 3TSRE 1JL5A 2OMTA 2O6RA 1FT8A 1SQ0B 1P8VA 2BNHA 4PQ8A 4GT6A 5IJBA 3ULAA 4Z64C 3E6JA 3RFEA 5IYXC 4R5CA 3UN9A 3O6NA 4WP6A 3PMHG 2P1MB 4Q3IA 2V70A 4K17A 4LI1A 2RR6A 4FD0A 1Z7XW 4HQ1A 2V9SA 2WQXA 4AY9X 4CNCA 4PERA 1M9LA 4QBZA 5GS2B 2XWTC 5B4PA 3DZEA 4FS7A 2Z7XA 4QC0A 4L3AA 4XGOA 3O53A 4BSUA 4PEQB 4CC4A 3WPHA 5AWDA 4B8CD 4YEBB 3SB4A 1D0BA 1H6TA 2ASSB 2CA6A 1H6UA 2WQUA 3C6NB 4KT1A 4R6JA 3ZYOA 3WPDA 1KOHA 4G8AA 4H09A 3WPIA 2Y5QA 3OGLB 4LSCA 2O6SA 4IM6A 2OMYA 1ZIWA 2ASTB 1M9SA 1XKUA 2RA8A 3A79B 4V2DA 3ZYJA 3G3BA 1OTNA 2Z65A 4FHOA 4ARRA 1QYYA 3G3AA 3WPCA 4NKHA 1LTXA 4R08A 5GMHA 4P91A 3W3MA 1OGQA 2Z81A 4R0AA 3RGZA 1A4YA 2XOTA 3RIZA 3VQ2A 1M0ZA 2OMXA 3E2JA 3G39A 4CILA 3W3JA 5GS0A 2JQDA 3UL9A 4FMZA 1K5DC 4J4LA 2P1NB 3M19A 4Z94G 4Q3GA
chains in the Genus database with same CATH superfamily
4R58A 1OTMA 2IFGA 3G06A 4GLPA 4MN8B 1XCDA 3W3NA 5AWAA 3WN4A 3FXIA 3GOZA 2OMZA 1A9NA 3ULVA 4LI2A 4L3FA 3BZ5A 4BV4R 3ZYIA 5HDHA 4KNGA 4TZHA 4R09A 2Z63A 3C6OB 5D3IA 3CIYA 4Z79A 1XECA 3OJAA 1P8TA 4LSXA 4LXRA 4I6JB 5FTTB 1W8AA 2Z7XB 1FQVA 4XSQA 3WPFA 4FCGA 4RWTC 2FT3A 4CP6A 4J0MA 4C2BB 3WPGA 3W3KA 1IO0A 3CVRA 4M7EA 2R9UA 4R5DA 3W3GA 3WPEA 1DS9A 4U7LA 4XOSA 5CMPA 4Y61B 2P1OB 4CC4C 5IJCA 3VQ1A 2OMVA 3OJAB 1G9UA 4WYKA 4ECOA 1WWLA 2UZXA 3RJ0A 4Q62A 5CMNA 3G04C 4R6FA 5LFNA 4LSXC 3P72A 2JE0A 1YRGA 3OGKB 4BSSA 5HZLB 3E4GA 1K5GC 1O6SA 1GWBA 2OMUA 3M18A 4P8SA 4RCWA 3RFSA 3UL7A 3UL8A 2WQVA 4Z8GA 3ULUA 3E3ZA 4U08A 4LXSA 1FS2A 1XWDC 2UZYA 1OZNA 4R6GA 4RCAB 1OTOA 4UFRA 5GMGA 2P1PB 2WFHA 5AZ5A 2V9TB 4NKGA 4R6AA 4Z61C 3OGMB 1FO1A 5IJDA 4CNMA 1KOOA 2P1QB 1OOKG 5B0NA 3C6PB 2Z62A 4ARNA 3RFJA 5A5CA 2ELLA 3KJ4A 5AWBA 4V2CA 2Z66A 1P9AG 4R07A 3W3LA 1O6VA 2O6QA 4PSJA 2OMWA 2ID5A 2Q4GW 4OQTA 3WPBA 4KXFB 1U0ND 3RW7A 3REZA 4LSAA 3JB9j 5GQRK 1M10B 2BEXA 4U09A 1XEUA 3CIGA 3RGXA 4AW4A 4PKIG 4V2EA 4U06A 4EZGA 2Z82A 2WQWA 3ZYNA 4BSRA 4MQWX 5GMFA 1O6TA 2JE1A 2A0ZA 1DFJI 4QXEA 5B0TA 5AWCA 3RW6A 4ECNA 4M7EC 1DCEA 2Z64A 4NZTM 4C2AB 1PGVA 4FDWA 3TSRE 1JL5A 2OMTA 2O6RA 1FT8A 1SQ0B 1P8VA 2BNHA 4PQ8A 4GT6A 5IJBA 3ULAA 4Z64C 3E6JA 3RFEA 5IYXC 4R5CA 3UN9A 3O6NA 4WP6A 3PMHG 2P1MB 4Q3IA 2V70A 4K17A 4LI1A 2RR6A 4FD0A 1Z7XW 4HQ1A 2V9SA 2WQXA 4AY9X 4CNCA 4PERA 1M9LA 4QBZA 5GS2B 2XWTC 5B4PA 3DZEA 4FS7A 2Z7XA 4QC0A 4L3AA 4XGOA 3O53A 4BSUA 4PEQB 4CC4A 3WPHA 5AWDA 4B8CD 4YEBB 3SB4A 1D0BA 1H6TA 2ASSB 2CA6A 1H6UA 2WQUA 3C6NB 4KT1A 4R6JA 3ZYOA 3WPDA 1KOHA 4G8AA 4H09A 3WPIA 2Y5QA 3OGLB 4LSCA 2O6SA 4NZRM 4IM6A 2OMYA 1ZIWA 2ASTB 1M9SA 1XKUA 2RA8A 3A79B 4V2DA 3ZYJA 3G3BA 1OTNA 2Z65A 4FHOA 4ARRA 1QYYA 3G3AA 3WPCA 4NKHA 1LTXA 4R08A 5GMHA 4P91A 3W3MA 1OGQA 2Z81A 4R0AA 3RGZA 1A4YA 2XOTA 3RIZA 3VQ2A 1M0ZA 2OMXA 3E2JA 3G39A 4CILA 3W3JA 5GS0A 2JQDA 3UL9A 4FMZA 1K5DC 4J4LA 2P1NB 3M19A 4Z94G 4Q3GA
chains in the Genus database with same CATH topology
4R58A 1OTMA 2IFGA 3G06A 4GLPA 4MN8B 1XCDA 3W3NA 5AWAA 3WN4A 3FXIA 3GOZA 2OMZA 1A9NA 3ULVA 4LI2A 4L3FA 3BZ5A 4BV4R 3ZYIA 5HDHA 4KNGA 4TZHA 4R09A 2Z63A 3C6OB 5D3IA 3CIYA 4Z79A 1XECA 3OJAA 1P8TA 4LSXA 4LXRA 4I6JB 5FTTB 1W8AA 2Z7XB 1FQVA 4XSQA 3WPFA 4FCGA 4RWTC 2FT3A 4CP6A 4J0MA 4C2BB 3WPGA 3W3KA 1IO0A 3CVRA 4M7EA 2R9UA 4R5DA 3W3GA 3WPEA 1DS9A 4U7LA 4XOSA 5CMPA 4Y61B 2P1OB 4CC4C 5IJCA 3VQ1A 2OMVA 3OJAB 1G9UA 4WYKA 4ECOA 1WWLA 2UZXA 3RJ0A 4Q62A 5CMNA 3G04C 4R6FA 5LFNA 4LSXC 3P72A 2JE0A 1YRGA 3OGKB 4BSSA 5HZLB 3E4GA 1K5GC 1O6SA 1GWBA 2OMUA 3M18A 4P8SA 4RCWA 3RFSA 3UL7A 3UL8A 2WQVA 4Z8GA 3ULUA 3E3ZA 4U08A 4LXSA 1FS2A 1XWDC 2UZYA 1OZNA 4R6GA 4RCAB 1OTOA 4UFRA 5GMGA 2P1PB 2WFHA 5AZ5A 2V9TB 4NKGA 4R6AA 4Z61C 3OGMB 1FO1A 5IJDA 4CNMA 1KOOA 2P1QB 1OOKG 5B0NA 3C6PB 2Z62A 4ARNA 3RFJA 5A5CA 2ELLA 3KJ4A 5AWBA 4V2CA 2Z66A 1P9AG 4R07A 3W3LA 1O6VA 2O6QA 4PSJA 2OMWA 2ID5A 2Q4GW 4OQTA 3WPBA 4KXFB 1U0ND 3RW7A 3REZA 4LSAA 3JB9j 5GQRK 1M10B 2BEXA 4U09A 1XEUA 3CIGA 3RGXA 4AW4A 4PKIG 4V2EA 4U06A 4EZGA 2Z82A 2WQWA 3ZYNA 4BSRA 4MQWX 5GMFA 1O6TA 2JE1A 2A0ZA 1DFJI 4QXEA 5B0TA 5AWCA 3RW6A 4ECNA 4M7EC 1DCEA 2Z64A 4C2AB 1PGVA 4FDWA 3TSRE 1JL5A 2OMTA 2O6RA 1FT8A 1SQ0B 1P8VA 2BNHA 4PQ8A 4GT6A 5IJBA 3ULAA 4Z64C 3E6JA 3RFEA 5IYXC 4R5CA 3UN9A 3O6NA 4WP6A 3PMHG 2P1MB 4Q3IA 2V70A 4K17A 4LI1A 2RR6A 4FD0A 1Z7XW 4HQ1A 2V9SA 2WQXA 4AY9X 4CNCA 4PERA 1M9LA 4QBZA 5GS2B 2XWTC 5B4PA 3DZEA 4FS7A 2Z7XA 4QC0A 4L3AA 4XGOA 3O53A 4BSUA 4PEQB 4CC4A 3WPHA 5AWDA 4B8CD 4YEBB 3SB4A 1D0BA 1H6TA 2ASSB 2CA6A 1H6UA 2WQUA 3C6NB 4KT1A 4R6JA 3ZYOA 3WPDA 1KOHA 4G8AA 4H09A 3WPIA 2Y5QA 3OGLB 4LSCA 2O6SA 4IM6A 2OMYA 1ZIWA 2ASTB 1M9SA 1XKUA 2RA8A 3A79B 4V2DA 3ZYJA 3G3BA 1OTNA 2Z65A 4FHOA 4ARRA 1QYYA 3G3AA 3WPCA 4NKHA 1LTXA 4R08A 5GMHA 4P91A 3W3MA 1OGQA 2Z81A 4R0AA 3RGZA 1A4YA 2XOTA 3RIZA 3VQ2A 1M0ZA 2OMXA 3E2JA 3G39A 4CILA 3W3JA 5GS0A 2JQDA 3UL9A 4FMZA 1K5DC 4J4LA 2P1NB 3M19A 4Z94G 4Q3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R58 A;  1OTM A;  2IFG A;  3G06 A;  4GLP A;  4MN8 B;  1XCD A;  3W3N A;  5AWA A;  3WN4 A;  3FXI A;  3GOZ A;  2OMZ A;  1A9N A;  3ULV A;  4LI2 A;  4L3F A;  3BZ5 A;  4BV4 R;  3ZYI A;  5HDH A;  4KNG A;  4TZH A;  4R09 A;  2Z63 A;  3C6O B;  5D3I A;  3CIY A;  4Z79 A;  1XEC A;  3OJA A;  1P8T A;  4LSX A;  4LXR A;  4I6J B;  5FTT B;  1W8A A;  2Z7X B;  1FQV A;  4XSQ A;  3WPF A;  4FCG A;  4RWT C;  2FT3 A;  4CP6 A;  4J0M A;  4C2B B;  3WPG A;  3W3K A;  1IO0 A;  3CVR A;  4M7E A;  2R9U A;  4R5D A;  3W3G A;  3WPE A;  1DS9 A;  4U7L A;  4XOS A;  5CMP A;  4Y61 B;  2P1O B;  4CC4 C;  5IJC A;  3VQ1 A;  2OMV A;  3OJA B;  1G9U A;  4WYK A;  4ECO A;  1WWL A;  2UZX A;  3RJ0 A;  4Q62 A;  5CMN A;  3G04 C;  4R6F A;  5LFN A;  4LSX C;  3P72 A;  2JE0 A;  1YRG A;  3OGK B;  4BSS A;  5HZL B;  3E4G A;  1K5G C;  1O6S A;  1GWB A;  2OMU A;  3M18 A;  4P8S A;  4RCW A;  3RFS A;  3UL7 A;  3UL8 A;  2WQV A;  4Z8G A;  3ULU A;  3E3Z A;  4U08 A;  4LXS A;  1FS2 A;  1XWD C;  2UZY A;  1OZN A;  4R6G A;  4RCA B;  1OTO A;  4UFR A;  5GMG A;  2P1P B;  2WFH A;  5AZ5 A;  2V9T B;  4NKG A;  4R6A A;  4Z61 C;  3OGM B;  1FO1 A;  5IJD A;  4CNM A;  1KOO A;  2P1Q B;  1OOK G;  5B0N A;  3C6P B;  2Z62 A;  4ARN A;  3RFJ A;  5A5C A;  2ELL A;  3KJ4 A;  5AWB A;  4V2C A;  2Z66 A;  1P9A G;  4R07 A;  3W3L A;  1O6V A;  2O6Q A;  4PSJ A;  2OMW A;  2ID5 A;  2Q4G W;  4OQT A;  3WPB A;  4KXF B;  1U0N D;  3RW7 A;  3REZ A;  4LSA A;  3JB9 j;  5GQR K;  1M10 B;  2BEX A;  4U09 A;  1XEU A;  3CIG A;  3RGX A;  4AW4 A;  4PKI G;  4V2E A;  4U06 A;  4EZG A;  2Z82 A;  2WQW A;  3ZYN A;  4BSR A;  4MQW X;  5GMF A;  1O6T A;  2JE1 A;  2A0Z A;  1DFJ I;  4QXE A;  5B0T A;  5AWC A;  3RW6 A;  4ECN A;  4M7E C;  1DCE A;  2Z64 A;  4C2A B;  1PGV A;  4FDW A;  3TSR E;  1JL5 A;  2OMT A;  2O6R A;  1FT8 A;  1SQ0 B;  1P8V A;  2BNH A;  4PQ8 A;  4GT6 A;  5IJB A;  3ULA A;  4Z64 C;  3E6J A;  3RFE A;  5IYX C;  4R5C A;  3UN9 A;  3O6N A;  4WP6 A;  3PMH G;  2P1M B;  4Q3I A;  2V70 A;  4K17 A;  4LI1 A;  2RR6 A;  4FD0 A;  1Z7X W;  4HQ1 A;  2V9S A;  2WQX A;  4AY9 X;  4CNC A;  4PER A;  1M9L A;  4QBZ A;  5GS2 B;  2XWT C;  5B4P A;  3DZE A;  4FS7 A;  2Z7X A;  4QC0 A;  4L3A A;  4XGO A;  3O53 A;  4BSU A;  4PEQ B;  4CC4 A;  3WPH A;  5AWD A;  4B8C D;  4YEB B;  3SB4 A;  1D0B A;  1H6T A;  2ASS B;  2CA6 A;  1H6U A;  2WQU A;  3C6N B;  4KT1 A;  4R6J A;  3ZYO A;  3WPD A;  1KOH A;  4G8A A;  4H09 A;  3WPI A;  2Y5Q A;  3OGL B;  4LSC A;  2O6S A;  4IM6 A;  2OMY A;  1ZIW A;  2AST B;  1M9S A;  1XKU A;  2RA8 A;  3A79 B;  4V2D A;  3ZYJ A;  3G3B A;  1OTN A;  2Z65 A;  4FHO A;  4ARR A;  1QYY A;  3G3A A;  3WPC A;  4NKH A;  1LTX A;  4R08 A;  5GMH A;  4P91 A;  3W3M A;  1OGQ A;  2Z81 A;  4R0A A;  3RGZ A;  1A4Y A;  2XOT A;  3RIZ A;  3VQ2 A;  1M0Z A;  2OMX A;  3E2J A;  3G39 A;  4CIL A;  3W3J A;  5GS0 A;  2JQD A;  3UL9 A;  4FMZ A;  1K5D C;  4J4L A;  2P1N B;  3M19 A;  4Z94 G;  4Q3G A; 
#chains in the Genus database with same CATH topology
 4R58 A;  1OTM A;  2IFG A;  3G06 A;  4GLP A;  4MN8 B;  1XCD A;  3W3N A;  5AWA A;  3WN4 A;  3FXI A;  3GOZ A;  2OMZ A;  1A9N A;  3ULV A;  4LI2 A;  4L3F A;  3BZ5 A;  4BV4 R;  3ZYI A;  5HDH A;  4KNG A;  4TZH A;  4R09 A;  2Z63 A;  3C6O B;  5D3I A;  3CIY A;  4Z79 A;  1XEC A;  3OJA A;  1P8T A;  4LSX A;  4LXR A;  4I6J B;  5FTT B;  1W8A A;  2Z7X B;  1FQV A;  4XSQ A;  3WPF A;  4FCG A;  4RWT C;  2FT3 A;  4CP6 A;  4J0M A;  4C2B B;  3WPG A;  3W3K A;  1IO0 A;  3CVR A;  4M7E A;  2R9U A;  4R5D A;  3W3G A;  3WPE A;  1DS9 A;  4U7L A;  4XOS A;  5CMP A;  4Y61 B;  2P1O B;  4CC4 C;  5IJC A;  3VQ1 A;  2OMV A;  3OJA B;  1G9U A;  4WYK A;  4ECO A;  1WWL A;  2UZX A;  3RJ0 A;  4Q62 A;  5CMN A;  3G04 C;  4R6F A;  5LFN A;  4LSX C;  3P72 A;  2JE0 A;  1YRG A;  3OGK B;  4BSS A;  5HZL B;  3E4G A;  1K5G C;  1O6S A;  1GWB A;  2OMU A;  3M18 A;  4P8S A;  4RCW A;  3RFS A;  3UL7 A;  3UL8 A;  2WQV A;  4Z8G A;  3ULU A;  3E3Z A;  4U08 A;  4LXS A;  1FS2 A;  1XWD C;  2UZY A;  1OZN A;  4R6G A;  4RCA B;  1OTO A;  4UFR A;  5GMG A;  2P1P B;  2WFH A;  5AZ5 A;  2V9T B;  4NKG A;  4R6A A;  4Z61 C;  3OGM B;  1FO1 A;  5IJD A;  4CNM A;  1KOO A;  2P1Q B;  1OOK G;  5B0N A;  3C6P B;  2Z62 A;  4ARN A;  3RFJ A;  5A5C A;  2ELL A;  3KJ4 A;  5AWB A;  4V2C A;  2Z66 A;  1P9A G;  4R07 A;  3W3L A;  1O6V A;  2O6Q A;  4PSJ A;  2OMW A;  2ID5 A;  2Q4G W;  4OQT A;  3WPB A;  4KXF B;  1U0N D;  3RW7 A;  3REZ A;  4LSA A;  3JB9 j;  5GQR K;  1M10 B;  2BEX A;  4U09 A;  1XEU A;  3CIG A;  3RGX A;  4AW4 A;  4PKI G;  4V2E A;  4U06 A;  4EZG A;  2Z82 A;  2WQW A;  3ZYN A;  4BSR A;  4MQW X;  5GMF A;  1O6T A;  2JE1 A;  2A0Z A;  1DFJ I;  4QXE A;  5B0T A;  5AWC A;  3RW6 A;  4ECN A;  4M7E C;  1DCE A;  2Z64 A;  4NZT M;  4C2A B;  1PGV A;  4FDW A;  3TSR E;  1JL5 A;  2OMT A;  2O6R A;  1FT8 A;  1SQ0 B;  1P8V A;  2BNH A;  4PQ8 A;  4GT6 A;  5IJB A;  3ULA A;  4Z64 C;  3E6J A;  3RFE A;  5IYX C;  4R5C A;  3UN9 A;  3O6N A;  4WP6 A;  3PMH G;  2P1M B;  4Q3I A;  2V70 A;  4K17 A;  4LI1 A;  2RR6 A;  4FD0 A;  1Z7X W;  4HQ1 A;  2V9S A;  2WQX A;  4AY9 X;  4CNC A;  4PER A;  1M9L A;  4QBZ A;  5GS2 B;  2XWT C;  5B4P A;  3DZE A;  4FS7 A;  2Z7X A;  4QC0 A;  4L3A A;  4XGO A;  3O53 A;  4BSU A;  4PEQ B;  4CC4 A;  3WPH A;  5AWD A;  4B8C D;  4YEB B;  3SB4 A;  1D0B A;  1H6T A;  2ASS B;  2CA6 A;  1H6U A;  2WQU A;  3C6N B;  4KT1 A;  4R6J A;  3ZYO A;  3WPD A;  1KOH A;  4G8A A;  4H09 A;  3WPI A;  2Y5Q A;  3OGL B;  4LSC A;  2O6S A;  4NZR M;  4IM6 A;  2OMY A;  1ZIW A;  2AST B;  1M9S A;  1XKU A;  2RA8 A;  3A79 B;  4V2D A;  3ZYJ A;  3G3B A;  1OTN A;  2Z65 A;  4FHO A;  4ARR A;  1QYY A;  3G3A A;  3WPC A;  4NKH A;  1LTX A;  4R08 A;  5GMH A;  4P91 A;  3W3M A;  1OGQ A;  2Z81 A;  4R0A A;  3RGZ A;  1A4Y A;  2XOT A;  3RIZ A;  3VQ2 A;  1M0Z A;  2OMX A;  3E2J A;  3G39 A;  4CIL A;  3W3J A;  5GS0 A;  2JQD A;  3UL9 A;  4FMZ A;  1K5D C;  4J4L A;  2P1N B;  3M19 A;  4Z94 G;  4Q3G A; 
#chains in the Genus database with same CATH homology
 4R58 A;  1OTM A;  2IFG A;  3G06 A;  4GLP A;  4MN8 B;  1XCD A;  3W3N A;  5AWA A;  3WN4 A;  3FXI A;  3GOZ A;  2OMZ A;  1A9N A;  3ULV A;  4LI2 A;  4L3F A;  3BZ5 A;  4BV4 R;  3ZYI A;  5HDH A;  4KNG A;  4TZH A;  4R09 A;  2Z63 A;  3C6O B;  5D3I A;  3CIY A;  4Z79 A;  1XEC A;  3OJA A;  1P8T A;  4LSX A;  4LXR A;  4I6J B;  5FTT B;  1W8A A;  2Z7X B;  1FQV A;  4XSQ A;  3WPF A;  4FCG A;  4RWT C;  2FT3 A;  4CP6 A;  4J0M A;  4C2B B;  3WPG A;  3W3K A;  1IO0 A;  3CVR A;  4M7E A;  2R9U A;  4R5D A;  3W3G A;  3WPE A;  1DS9 A;  4U7L A;  4XOS A;  5CMP A;  4Y61 B;  2P1O B;  4CC4 C;  5IJC A;  3VQ1 A;  2OMV A;  3OJA B;  1G9U A;  4WYK A;  4ECO A;  1WWL A;  2UZX A;  3RJ0 A;  4Q62 A;  5CMN A;  3G04 C;  4R6F A;  5LFN A;  4LSX C;  3P72 A;  2JE0 A;  1YRG A;  3OGK B;  4BSS A;  5HZL B;  3E4G A;  1K5G C;  1O6S A;  1GWB A;  2OMU A;  3M18 A;  4P8S A;  4RCW A;  3RFS A;  3UL7 A;  3UL8 A;  2WQV A;  4Z8G A;  3ULU A;  3E3Z A;  4U08 A;  4LXS A;  1FS2 A;  1XWD C;  2UZY A;  1OZN A;  4R6G A;  4RCA B;  1OTO A;  4UFR A;  5GMG A;  2P1P B;  2WFH A;  5AZ5 A;  2V9T B;  4NKG A;  4R6A A;  4Z61 C;  3OGM B;  1FO1 A;  5IJD A;  4CNM A;  1KOO A;  2P1Q B;  1OOK G;  5B0N A;  3C6P B;  2Z62 A;  4ARN A;  3RFJ A;  5A5C A;  2ELL A;  3KJ4 A;  5AWB A;  4V2C A;  2Z66 A;  1P9A G;  4R07 A;  3W3L A;  1O6V A;  2O6Q A;  4PSJ A;  2OMW A;  2ID5 A;  2Q4G W;  4OQT A;  3WPB A;  4KXF B;  1U0N D;  3RW7 A;  3REZ A;  4LSA A;  3JB9 j;  5GQR K;  1M10 B;  2BEX A;  4U09 A;  1XEU A;  3CIG A;  3RGX A;  4AW4 A;  4PKI G;  4V2E A;  4U06 A;  4EZG A;  2Z82 A;  2WQW A;  3ZYN A;  4BSR A;  4MQW X;  5GMF A;  1O6T A;  2JE1 A;  2A0Z A;  1DFJ I;  4QXE A;  5B0T A;  5AWC A;  3RW6 A;  4ECN A;  4M7E C;  1DCE A;  2Z64 A;  4C2A B;  1PGV A;  4FDW A;  3TSR E;  1JL5 A;  2OMT A;  2O6R A;  1FT8 A;  1SQ0 B;  1P8V A;  2BNH A;  4PQ8 A;  4GT6 A;  5IJB A;  3ULA A;  4Z64 C;  3E6J A;  3RFE A;  5IYX C;  4R5C A;  3UN9 A;  3O6N A;  4WP6 A;  3PMH G;  2P1M B;  4Q3I A;  2V70 A;  4K17 A;  4LI1 A;  2RR6 A;  4FD0 A;  1Z7X W;  4HQ1 A;  2V9S A;  2WQX A;  4AY9 X;  4CNC A;  4PER A;  1M9L A;  4QBZ A;  5GS2 B;  2XWT C;  5B4P A;  3DZE A;  4FS7 A;  2Z7X A;  4QC0 A;  4L3A A;  4XGO A;  3O53 A;  4BSU A;  4PEQ B;  4CC4 A;  3WPH A;  5AWD A;  4B8C D;  4YEB B;  3SB4 A;  1D0B A;  1H6T A;  2ASS B;  2CA6 A;  1H6U A;  2WQU A;  3C6N B;  4KT1 A;  4R6J A;  3ZYO A;  3WPD A;  1KOH A;  4G8A A;  4H09 A;  3WPI A;  2Y5Q A;  3OGL B;  4LSC A;  2O6S A;  4IM6 A;  2OMY A;  1ZIW A;  2AST B;  1M9S A;  1XKU A;  2RA8 A;  3A79 B;  4V2D A;  3ZYJ A;  3G3B A;  1OTN A;  2Z65 A;  4FHO A;  4ARR A;  1QYY A;  3G3A A;  3WPC A;  4NKH A;  1LTX A;  4R08 A;  5GMH A;  4P91 A;  3W3M A;  1OGQ A;  2Z81 A;  4R0A A;  3RGZ A;  1A4Y A;  2XOT A;  3RIZ A;  3VQ2 A;  1M0Z A;  2OMX A;  3E2J A;  3G39 A;  4CIL A;  3W3J A;  5GS0 A;  2JQD A;  3UL9 A;  4FMZ A;  1K5D C;  4J4L A;  2P1N B;  3M19 A;  4Z94 G;  4Q3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...