3RFEA

Crystal structure of glycoprotein gpib ectodomain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
PCPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Platelet glycoprotein Ib beta chain
publication title Quaternary organization of GPIb-IX complex and insights into Bernard-Soulier syndrome revealed by the structures of GPIbbeta and a GPIbbeta/GPIX chimer
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 33
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01463 LRRCT Leucine rich repeat C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3rfeA00
4P8SA 4G8AA 1GWBA 4EZGA 4LSCA 5HZLB 4R5CA 4CC4C 2UZYA 4K17A 4KXFB 3E2JA 3RFJA 3RFSA 1A9NA 2V9TB 1O6VA 3E3ZA 4ECOA 4R6AA 4PEQB 2WQUA 4KNGA 1O6SA 4YEBB 4RCWA 1XWDC 5IJBA 4ARRA 3OGKB 3RIZA 2Z7XA 4CNMA 4B8CD 1M10B 2Z7XB 4ARNA 1YRGA 2FT3A 3WPEA 4Q3GA 4LXRA 2OMTA 4CC4A 4HQ1A 3RW6A 4CNCA 2WQVA 4BSRA 3DZEA 3CIGA 4M7EC 2OMVA 1OZNA 2Y5QA 2P1PB 4R6JA 3KJ4A 4BV4R 2A0ZA 2BEXA 1DCEA 3OGLB 5AZ5A 1H6UA 2OMUA 1K5DC 4QXEA 2OMWA 5IJCA 4WP6A 3PMHG 4XSQA 2WQWA 1XKUA 3C6NB 4LXSA 4LI1A 3ULAA 5AWBA 4UFRA 4FMZA 1D0BA 3ZYJA 1P9AG 3SB4A 4M7EA 3WPGA 1OOKG 3O53A 4WYKA 3GOZA 2Z64A 2O6QA 5HDHA 1W8AA 4BSUA 1LTXA 2ELLA 3ZYOA 2IFGA 1PGVA 4BSSA 2P1OB 3REZA 1M9LA 3P72A 4R09A 2JE1A 4Z79A 1KOOA 5AWAA 2P1NB 5FTTB 4MQWX 2Z63A 3OJAA 3E6JA 1FO1A 3M19A 5B0NA 3UN9A 4OQTA 3OJAB 4ECNA 4FD0A 1FT8A 3A79B 3RW7A 1M0ZA 4Y61B 5GS0A 3RFEA 3VQ1A 3ULUA 3ZYIA 2OMXA 4I6JB 5CMNA 5B4PA 1O6TA 3C6OB 4H09A 4QBZA 1G9UA 4PSJA 4PQ8A 3O6NA 2Z66A 5A5CA 2ASTB 1ZIWA 4RWTC 5GMGA 5IYXC 4R6FA 5GQRK 5B0TA 3JB9j 1KOHA 3WPHA 4Z94G 5GS2B 3FXIA 4U7LA 3W3NA 3RJ0A 3G04C 4NKGA 4CILA 3UL9A 4Q3IA 1FS2A 4L3FA 5GMHA 3E4GA 4Q62A 4R08A 4FCGA 2UZXA 1OTNA 4J4LA 3BZ5A 4AY9X 3WPFA 4V2CA 3WPBA 2JE0A 4PERA 4R6GA 4LSAA 3G3BA 4U06A 5CMPA 3WPCA 3ZYNA 1XCDA 1Z7XW 2P1MB 3C6PB 1U0ND 2XOTA 5AWDA 4PKIG 3M18A 5D3IA 3W3KA 4V2DA 3W3GA 4RCAB 4IM6A 3WPIA 2Z62A 2WFHA 4C2BB 3CIYA 3G06A 1OTMA 3CVRA 4QC0A 4FHOA 4R58A 2OMYA 4C2AB 2R9UA 1XEUA 1IO0A 2P1QB 3W3LA 1P8TA 4XGOA 1XECA 4R5DA 4XOSA 3RGZA 1OTOA 4Z61C 4Z64C 4J0MA 2XWTC 2OMZA 2Z65A 4LSXC 2O6SA 2RA8A 4V2EA 3RGXA 4FDWA 2Z82A 1SQ0B 4LI2A 2O6RA 5LFNA 1FQVA 2Q4GW 1M9SA 4GLPA 5IJDA 2CA6A 3W3JA 2ASSB 1JL5A 4NKHA 3ULVA 3VQ2A 3WPDA 1DFJI 4L3AA 1K5GC 3W3MA 3G39A 4FS7A 4GT6A 4P91A 1P8VA 4LSXA 1DS9A 1QYYA 2JQDA 4U09A 2V9SA 4AW4A 4TZHA 2WQXA 4CP6A 1H6TA 4U08A 5GMFA 3UL8A 3UL7A 2V70A 1A4YA 4MN8B 3TSRE 2ID5A 3WN4A 2Z81A 2BNHA 4KT1A 5AWCA 4R07A 3OGMB 3G3AA 1WWLA 2RR6A 4R0AA 4Z8GA 1OGQA
chains in the Genus database with same CATH superfamily
4P8SA 4G8AA 1GWBA 4EZGA 4LSCA 5HZLB 4R5CA 4CC4C 2UZYA 4K17A 4KXFB 3E2JA 3RFJA 3RFSA 1A9NA 2V9TB 1O6VA 3E3ZA 4ECOA 4R6AA 4PEQB 2WQUA 4KNGA 1O6SA 4YEBB 4RCWA 1XWDC 5IJBA 4ARRA 3OGKB 3RIZA 2Z7XA 4CNMA 4B8CD 1M10B 2Z7XB 4ARNA 1YRGA 2FT3A 3WPEA 4Q3GA 4LXRA 2OMTA 4CC4A 4HQ1A 3RW6A 4CNCA 2WQVA 4BSRA 3DZEA 3CIGA 4M7EC 2OMVA 1OZNA 2Y5QA 2P1PB 4R6JA 3KJ4A 4BV4R 2A0ZA 2BEXA 1DCEA 3OGLB 5AZ5A 1H6UA 2OMUA 1K5DC 4QXEA 2OMWA 5IJCA 4WP6A 3PMHG 4XSQA 2WQWA 1XKUA 3C6NB 4LXSA 4LI1A 3ULAA 5AWBA 4UFRA 4FMZA 1D0BA 3ZYJA 1P9AG 3SB4A 4M7EA 3WPGA 1OOKG 3O53A 4WYKA 3GOZA 2Z64A 2O6QA 5HDHA 1W8AA 4BSUA 1LTXA 2ELLA 3ZYOA 2IFGA 1PGVA 4BSSA 2P1OB 3REZA 1M9LA 3P72A 4R09A 2JE1A 4Z79A 1KOOA 5AWAA 2P1NB 5FTTB 4MQWX 2Z63A 3OJAA 3E6JA 1FO1A 3M19A 5B0NA 3UN9A 4OQTA 3OJAB 4ECNA 4FD0A 1FT8A 3A79B 3RW7A 1M0ZA 4Y61B 5GS0A 3RFEA 3VQ1A 3ULUA 3ZYIA 2OMXA 4I6JB 5CMNA 5B4PA 1O6TA 3C6OB 4H09A 4QBZA 1G9UA 4PSJA 4PQ8A 3O6NA 2Z66A 5A5CA 2ASTB 1ZIWA 4RWTC 5GMGA 5IYXC 4R6FA 5GQRK 5B0TA 3JB9j 1KOHA 3WPHA 4Z94G 5GS2B 3FXIA 4U7LA 3W3NA 3RJ0A 3G04C 4NKGA 4CILA 3UL9A 4Q3IA 1FS2A 4L3FA 5GMHA 3E4GA 4Q62A 4R08A 4FCGA 2UZXA 1OTNA 4J4LA 3BZ5A 4AY9X 3WPFA 4V2CA 3WPBA 2JE0A 4PERA 4R6GA 4LSAA 3G3BA 4U06A 5CMPA 3WPCA 3ZYNA 1XCDA 1Z7XW 2P1MB 3C6PB 1U0ND 2XOTA 5AWDA 4PKIG 3M18A 5D3IA 3W3KA 4V2DA 3W3GA 4RCAB 4IM6A 3WPIA 2Z62A 2WFHA 4C2BB 3CIYA 3G06A 1OTMA 3CVRA 4QC0A 4FHOA 4R58A 2OMYA 4C2AB 2R9UA 1XEUA 1IO0A 2P1QB 3W3LA 1P8TA 4XGOA 1XECA 4R5DA 4XOSA 3RGZA 1OTOA 4Z61C 4Z64C 4J0MA 2XWTC 2OMZA 2Z65A 4LSXC 2O6SA 2RA8A 4V2EA 3RGXA 4FDWA 2Z82A 1SQ0B 4LI2A 2O6RA 5LFNA 1FQVA 2Q4GW 1M9SA 4GLPA 5IJDA 2CA6A 3W3JA 2ASSB 1JL5A 4NKHA 3ULVA 3VQ2A 3WPDA 1DFJI 4L3AA 1K5GC 3W3MA 3G39A 4FS7A 4GT6A 4P91A 1P8VA 4LSXA 1DS9A 1QYYA 2JQDA 4U09A 2V9SA 4AW4A 4TZHA 2WQXA 4CP6A 1H6TA 4U08A 5GMFA 4NZTM 3UL8A 3UL7A 2V70A 1A4YA 4MN8B 3TSRE 2ID5A 3WN4A 2Z81A 2BNHA 4KT1A 5AWCA 4R07A 3OGMB 4NZRM 3G3AA 1WWLA 2RR6A 4R0AA 4Z8GA 1OGQA
chains in the Genus database with same CATH topology
4P8SA 4G8AA 1GWBA 4EZGA 4LSCA 5HZLB 4R5CA 4CC4C 2UZYA 4K17A 4KXFB 3E2JA 3RFJA 3RFSA 1A9NA 2V9TB 1O6VA 3E3ZA 4ECOA 4R6AA 4PEQB 2WQUA 4KNGA 1O6SA 4YEBB 4RCWA 1XWDC 5IJBA 4ARRA 3OGKB 3RIZA 2Z7XA 4CNMA 4B8CD 1M10B 2Z7XB 4ARNA 1YRGA 2FT3A 3WPEA 4Q3GA 4LXRA 2OMTA 4CC4A 4HQ1A 3RW6A 4CNCA 2WQVA 4BSRA 3DZEA 3CIGA 4M7EC 2OMVA 1OZNA 2Y5QA 2P1PB 4R6JA 3KJ4A 4BV4R 2A0ZA 2BEXA 1DCEA 3OGLB 5AZ5A 1H6UA 2OMUA 1K5DC 4QXEA 2OMWA 5IJCA 4WP6A 3PMHG 4XSQA 2WQWA 1XKUA 3C6NB 4LXSA 4LI1A 3ULAA 5AWBA 4UFRA 4FMZA 1D0BA 3ZYJA 1P9AG 3SB4A 4M7EA 3WPGA 1OOKG 3O53A 4WYKA 3GOZA 2Z64A 2O6QA 5HDHA 1W8AA 4BSUA 1LTXA 2ELLA 3ZYOA 2IFGA 1PGVA 4BSSA 2P1OB 3REZA 1M9LA 3P72A 4R09A 2JE1A 4Z79A 1KOOA 5AWAA 2P1NB 5FTTB 4MQWX 2Z63A 3OJAA 3E6JA 1FO1A 3M19A 5B0NA 3UN9A 4OQTA 3OJAB 4ECNA 4FD0A 1FT8A 3A79B 3RW7A 1M0ZA 4Y61B 5GS0A 3RFEA 3VQ1A 3ULUA 3ZYIA 2OMXA 4I6JB 5CMNA 5B4PA 1O6TA 3C6OB 4H09A 4QBZA 1G9UA 4PSJA 4PQ8A 3O6NA 2Z66A 5A5CA 2ASTB 1ZIWA 4RWTC 5GMGA 5IYXC 4R6FA 5GQRK 5B0TA 3JB9j 1KOHA 3WPHA 4Z94G 5GS2B 3FXIA 4U7LA 3W3NA 3RJ0A 3G04C 4NKGA 4CILA 3UL9A 4Q3IA 1FS2A 4L3FA 5GMHA 3E4GA 4Q62A 4R08A 4FCGA 2UZXA 1OTNA 4J4LA 3BZ5A 4AY9X 3WPFA 4V2CA 3WPBA 2JE0A 4PERA 4R6GA 4LSAA 3G3BA 4U06A 5CMPA 3WPCA 3ZYNA 1XCDA 1Z7XW 2P1MB 3C6PB 1U0ND 2XOTA 5AWDA 4PKIG 3M18A 5D3IA 3W3KA 4V2DA 3W3GA 4RCAB 4IM6A 3WPIA 2Z62A 2WFHA 4C2BB 3CIYA 3G06A 1OTMA 3CVRA 4QC0A 4FHOA 4R58A 2OMYA 4C2AB 2R9UA 1XEUA 1IO0A 2P1QB 3W3LA 1P8TA 4XGOA 1XECA 4R5DA 4XOSA 3RGZA 1OTOA 4Z61C 4Z64C 4J0MA 2XWTC 2OMZA 2Z65A 4LSXC 2O6SA 2RA8A 4V2EA 3RGXA 4FDWA 2Z82A 1SQ0B 4LI2A 2O6RA 5LFNA 1FQVA 2Q4GW 1M9SA 4GLPA 5IJDA 2CA6A 3W3JA 2ASSB 1JL5A 4NKHA 3ULVA 3VQ2A 3WPDA 1DFJI 4L3AA 1K5GC 3W3MA 3G39A 4FS7A 4GT6A 4P91A 1P8VA 4LSXA 1DS9A 1QYYA 2JQDA 4U09A 2V9SA 4AW4A 4TZHA 2WQXA 4CP6A 1H6TA 4U08A 5GMFA 3UL8A 3UL7A 2V70A 1A4YA 4MN8B 3TSRE 2ID5A 3WN4A 2Z81A 2BNHA 4KT1A 5AWCA 4R07A 3OGMB 3G3AA 1WWLA 2RR6A 4R0AA 4Z8GA 1OGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P8S A;  4G8A A;  1GWB A;  4EZG A;  4LSC A;  5HZL B;  4R5C A;  4CC4 C;  2UZY A;  4K17 A;  4KXF B;  3E2J A;  3RFJ A;  3RFS A;  1A9N A;  2V9T B;  1O6V A;  3E3Z A;  4ECO A;  4R6A A;  4PEQ B;  2WQU A;  4KNG A;  1O6S A;  4YEB B;  4RCW A;  1XWD C;  5IJB A;  4ARR A;  3OGK B;  3RIZ A;  2Z7X A;  4CNM A;  4B8C D;  1M10 B;  2Z7X B;  4ARN A;  1YRG A;  2FT3 A;  3WPE A;  4Q3G A;  4LXR A;  2OMT A;  4CC4 A;  4HQ1 A;  3RW6 A;  4CNC A;  2WQV A;  4BSR A;  3DZE A;  3CIG A;  4M7E C;  2OMV A;  1OZN A;  2Y5Q A;  2P1P B;  4R6J A;  3KJ4 A;  4BV4 R;  2A0Z A;  2BEX A;  1DCE A;  3OGL B;  5AZ5 A;  1H6U A;  2OMU A;  1K5D C;  4QXE A;  2OMW A;  5IJC A;  4WP6 A;  3PMH G;  4XSQ A;  2WQW A;  1XKU A;  3C6N B;  4LXS A;  4LI1 A;  3ULA A;  5AWB A;  4UFR A;  4FMZ A;  1D0B A;  3ZYJ A;  1P9A G;  3SB4 A;  4M7E A;  3WPG A;  1OOK G;  3O53 A;  4WYK A;  3GOZ A;  2Z64 A;  2O6Q A;  5HDH A;  1W8A A;  4BSU A;  1LTX A;  2ELL A;  3ZYO A;  2IFG A;  1PGV A;  4BSS A;  2P1O B;  3REZ A;  1M9L A;  3P72 A;  4R09 A;  2JE1 A;  4Z79 A;  1KOO A;  5AWA A;  2P1N B;  5FTT B;  4MQW X;  2Z63 A;  3OJA A;  3E6J A;  1FO1 A;  3M19 A;  5B0N A;  3UN9 A;  4OQT A;  3OJA B;  4ECN A;  4FD0 A;  1FT8 A;  3A79 B;  3RW7 A;  1M0Z A;  4Y61 B;  5GS0 A;  3RFE A;  3VQ1 A;  3ULU A;  3ZYI A;  2OMX A;  4I6J B;  5CMN A;  5B4P A;  1O6T A;  3C6O B;  4H09 A;  4QBZ A;  1G9U A;  4PSJ A;  4PQ8 A;  3O6N A;  2Z66 A;  5A5C A;  2AST B;  1ZIW A;  4RWT C;  5GMG A;  5IYX C;  4R6F A;  5GQR K;  5B0T A;  3JB9 j;  1KOH A;  3WPH A;  4Z94 G;  5GS2 B;  3FXI A;  4U7L A;  3W3N A;  3RJ0 A;  3G04 C;  4NKG A;  4CIL A;  3UL9 A;  4Q3I A;  1FS2 A;  4L3F A;  5GMH A;  3E4G A;  4Q62 A;  4R08 A;  4FCG A;  2UZX A;  1OTN A;  4J4L A;  3BZ5 A;  4AY9 X;  3WPF A;  4V2C A;  3WPB A;  2JE0 A;  4PER A;  4R6G A;  4LSA A;  3G3B A;  4U06 A;  5CMP A;  3WPC A;  3ZYN A;  1XCD A;  1Z7X W;  2P1M B;  3C6P B;  1U0N D;  2XOT A;  5AWD A;  4PKI G;  3M18 A;  5D3I A;  3W3K A;  4V2D A;  3W3G A;  4RCA B;  4IM6 A;  3WPI A;  2Z62 A;  2WFH A;  4C2B B;  3CIY A;  3G06 A;  1OTM A;  3CVR A;  4QC0 A;  4FHO A;  4R58 A;  2OMY A;  4C2A B;  2R9U A;  1XEU A;  1IO0 A;  2P1Q B;  3W3L A;  1P8T A;  4XGO A;  1XEC A;  4R5D A;  4XOS A;  3RGZ A;  1OTO A;  4Z61 C;  4Z64 C;  4J0M A;  2XWT C;  2OMZ A;  2Z65 A;  4LSX C;  2O6S A;  2RA8 A;  4V2E A;  3RGX A;  4FDW A;  2Z82 A;  1SQ0 B;  4LI2 A;  2O6R A;  5LFN A;  1FQV A;  2Q4G W;  1M9S A;  4GLP A;  5IJD A;  2CA6 A;  3W3J A;  2ASS B;  1JL5 A;  4NKH A;  3ULV A;  3VQ2 A;  3WPD A;  1DFJ I;  4L3A A;  1K5G C;  3W3M A;  3G39 A;  4FS7 A;  4GT6 A;  4P91 A;  1P8V A;  4LSX A;  1DS9 A;  1QYY A;  2JQD A;  4U09 A;  2V9S A;  4AW4 A;  4TZH A;  2WQX A;  4CP6 A;  1H6T A;  4U08 A;  5GMF A;  3UL8 A;  3UL7 A;  2V70 A;  1A4Y A;  4MN8 B;  3TSR E;  2ID5 A;  3WN4 A;  2Z81 A;  2BNH A;  4KT1 A;  5AWC A;  4R07 A;  3OGM B;  3G3A A;  1WWL A;  2RR6 A;  4R0A A;  4Z8G A;  1OGQ A; 
#chains in the Genus database with same CATH topology
 4P8S A;  4G8A A;  1GWB A;  4EZG A;  4LSC A;  5HZL B;  4R5C A;  4CC4 C;  2UZY A;  4K17 A;  4KXF B;  3E2J A;  3RFJ A;  3RFS A;  1A9N A;  2V9T B;  1O6V A;  3E3Z A;  4ECO A;  4R6A A;  4PEQ B;  2WQU A;  4KNG A;  1O6S A;  4YEB B;  4RCW A;  1XWD C;  5IJB A;  4ARR A;  3OGK B;  3RIZ A;  2Z7X A;  4CNM A;  4B8C D;  1M10 B;  2Z7X B;  4ARN A;  1YRG A;  2FT3 A;  3WPE A;  4Q3G A;  4LXR A;  2OMT A;  4CC4 A;  4HQ1 A;  3RW6 A;  4CNC A;  2WQV A;  4BSR A;  3DZE A;  3CIG A;  4M7E C;  2OMV A;  1OZN A;  2Y5Q A;  2P1P B;  4R6J A;  3KJ4 A;  4BV4 R;  2A0Z A;  2BEX A;  1DCE A;  3OGL B;  5AZ5 A;  1H6U A;  2OMU A;  1K5D C;  4QXE A;  2OMW A;  5IJC A;  4WP6 A;  3PMH G;  4XSQ A;  2WQW A;  1XKU A;  3C6N B;  4LXS A;  4LI1 A;  3ULA A;  5AWB A;  4UFR A;  4FMZ A;  1D0B A;  3ZYJ A;  1P9A G;  3SB4 A;  4M7E A;  3WPG A;  1OOK G;  3O53 A;  4WYK A;  3GOZ A;  2Z64 A;  2O6Q A;  5HDH A;  1W8A A;  4BSU A;  1LTX A;  2ELL A;  3ZYO A;  2IFG A;  1PGV A;  4BSS A;  2P1O B;  3REZ A;  1M9L A;  3P72 A;  4R09 A;  2JE1 A;  4Z79 A;  1KOO A;  5AWA A;  2P1N B;  5FTT B;  4MQW X;  2Z63 A;  3OJA A;  3E6J A;  1FO1 A;  3M19 A;  5B0N A;  3UN9 A;  4OQT A;  3OJA B;  4ECN A;  4FD0 A;  1FT8 A;  3A79 B;  3RW7 A;  1M0Z A;  4Y61 B;  5GS0 A;  3RFE A;  3VQ1 A;  3ULU A;  3ZYI A;  2OMX A;  4I6J B;  5CMN A;  5B4P A;  1O6T A;  3C6O B;  4H09 A;  4QBZ A;  1G9U A;  4PSJ A;  4PQ8 A;  3O6N A;  2Z66 A;  5A5C A;  2AST B;  1ZIW A;  4RWT C;  5GMG A;  5IYX C;  4R6F A;  5GQR K;  5B0T A;  3JB9 j;  1KOH A;  3WPH A;  4Z94 G;  5GS2 B;  3FXI A;  4U7L A;  3W3N A;  3RJ0 A;  3G04 C;  4NKG A;  4CIL A;  3UL9 A;  4Q3I A;  1FS2 A;  4L3F A;  5GMH A;  3E4G A;  4Q62 A;  4R08 A;  4FCG A;  2UZX A;  1OTN A;  4J4L A;  3BZ5 A;  4AY9 X;  3WPF A;  4V2C A;  3WPB A;  2JE0 A;  4PER A;  4R6G A;  4LSA A;  3G3B A;  4U06 A;  5CMP A;  3WPC A;  3ZYN A;  1XCD A;  1Z7X W;  2P1M B;  3C6P B;  1U0N D;  2XOT A;  5AWD A;  4PKI G;  3M18 A;  5D3I A;  3W3K A;  4V2D A;  3W3G A;  4RCA B;  4IM6 A;  3WPI A;  2Z62 A;  2WFH A;  4C2B B;  3CIY A;  3G06 A;  1OTM A;  3CVR A;  4QC0 A;  4FHO A;  4R58 A;  2OMY A;  4C2A B;  2R9U A;  1XEU A;  1IO0 A;  2P1Q B;  3W3L A;  1P8T A;  4XGO A;  1XEC A;  4R5D A;  4XOS A;  3RGZ A;  1OTO A;  4Z61 C;  4Z64 C;  4J0M A;  2XWT C;  2OMZ A;  2Z65 A;  4LSX C;  2O6S A;  2RA8 A;  4V2E A;  3RGX A;  4FDW A;  2Z82 A;  1SQ0 B;  4LI2 A;  2O6R A;  5LFN A;  1FQV A;  2Q4G W;  1M9S A;  4GLP A;  5IJD A;  2CA6 A;  3W3J A;  2ASS B;  1JL5 A;  4NKH A;  3ULV A;  3VQ2 A;  3WPD A;  1DFJ I;  4L3A A;  1K5G C;  3W3M A;  3G39 A;  4FS7 A;  4GT6 A;  4P91 A;  1P8V A;  4LSX A;  1DS9 A;  1QYY A;  2JQD A;  4U09 A;  2V9S A;  4AW4 A;  4TZH A;  2WQX A;  4CP6 A;  1H6T A;  4U08 A;  5GMF A;  4NZT M;  3UL8 A;  3UL7 A;  2V70 A;  1A4Y A;  4MN8 B;  3TSR E;  2ID5 A;  3WN4 A;  2Z81 A;  2BNH A;  4KT1 A;  5AWC A;  4R07 A;  3OGM B;  4NZR M;  3G3A A;  1WWL A;  2RR6 A;  4R0A A;  4Z8G A;  1OGQ A; 
#chains in the Genus database with same CATH homology
 4P8S A;  4G8A A;  1GWB A;  4EZG A;  4LSC A;  5HZL B;  4R5C A;  4CC4 C;  2UZY A;  4K17 A;  4KXF B;  3E2J A;  3RFJ A;  3RFS A;  1A9N A;  2V9T B;  1O6V A;  3E3Z A;  4ECO A;  4R6A A;  4PEQ B;  2WQU A;  4KNG A;  1O6S A;  4YEB B;  4RCW A;  1XWD C;  5IJB A;  4ARR A;  3OGK B;  3RIZ A;  2Z7X A;  4CNM A;  4B8C D;  1M10 B;  2Z7X B;  4ARN A;  1YRG A;  2FT3 A;  3WPE A;  4Q3G A;  4LXR A;  2OMT A;  4CC4 A;  4HQ1 A;  3RW6 A;  4CNC A;  2WQV A;  4BSR A;  3DZE A;  3CIG A;  4M7E C;  2OMV A;  1OZN A;  2Y5Q A;  2P1P B;  4R6J A;  3KJ4 A;  4BV4 R;  2A0Z A;  2BEX A;  1DCE A;  3OGL B;  5AZ5 A;  1H6U A;  2OMU A;  1K5D C;  4QXE A;  2OMW A;  5IJC A;  4WP6 A;  3PMH G;  4XSQ A;  2WQW A;  1XKU A;  3C6N B;  4LXS A;  4LI1 A;  3ULA A;  5AWB A;  4UFR A;  4FMZ A;  1D0B A;  3ZYJ A;  1P9A G;  3SB4 A;  4M7E A;  3WPG A;  1OOK G;  3O53 A;  4WYK A;  3GOZ A;  2Z64 A;  2O6Q A;  5HDH A;  1W8A A;  4BSU A;  1LTX A;  2ELL A;  3ZYO A;  2IFG A;  1PGV A;  4BSS A;  2P1O B;  3REZ A;  1M9L A;  3P72 A;  4R09 A;  2JE1 A;  4Z79 A;  1KOO A;  5AWA A;  2P1N B;  5FTT B;  4MQW X;  2Z63 A;  3OJA A;  3E6J A;  1FO1 A;  3M19 A;  5B0N A;  3UN9 A;  4OQT A;  3OJA B;  4ECN A;  4FD0 A;  1FT8 A;  3A79 B;  3RW7 A;  1M0Z A;  4Y61 B;  5GS0 A;  3RFE A;  3VQ1 A;  3ULU A;  3ZYI A;  2OMX A;  4I6J B;  5CMN A;  5B4P A;  1O6T A;  3C6O B;  4H09 A;  4QBZ A;  1G9U A;  4PSJ A;  4PQ8 A;  3O6N A;  2Z66 A;  5A5C A;  2AST B;  1ZIW A;  4RWT C;  5GMG A;  5IYX C;  4R6F A;  5GQR K;  5B0T A;  3JB9 j;  1KOH A;  3WPH A;  4Z94 G;  5GS2 B;  3FXI A;  4U7L A;  3W3N A;  3RJ0 A;  3G04 C;  4NKG A;  4CIL A;  3UL9 A;  4Q3I A;  1FS2 A;  4L3F A;  5GMH A;  3E4G A;  4Q62 A;  4R08 A;  4FCG A;  2UZX A;  1OTN A;  4J4L A;  3BZ5 A;  4AY9 X;  3WPF A;  4V2C A;  3WPB A;  2JE0 A;  4PER A;  4R6G A;  4LSA A;  3G3B A;  4U06 A;  5CMP A;  3WPC A;  3ZYN A;  1XCD A;  1Z7X W;  2P1M B;  3C6P B;  1U0N D;  2XOT A;  5AWD A;  4PKI G;  3M18 A;  5D3I A;  3W3K A;  4V2D A;  3W3G A;  4RCA B;  4IM6 A;  3WPI A;  2Z62 A;  2WFH A;  4C2B B;  3CIY A;  3G06 A;  1OTM A;  3CVR A;  4QC0 A;  4FHO A;  4R58 A;  2OMY A;  4C2A B;  2R9U A;  1XEU A;  1IO0 A;  2P1Q B;  3W3L A;  1P8T A;  4XGO A;  1XEC A;  4R5D A;  4XOS A;  3RGZ A;  1OTO A;  4Z61 C;  4Z64 C;  4J0M A;  2XWT C;  2OMZ A;  2Z65 A;  4LSX C;  2O6S A;  2RA8 A;  4V2E A;  3RGX A;  4FDW A;  2Z82 A;  1SQ0 B;  4LI2 A;  2O6R A;  5LFN A;  1FQV A;  2Q4G W;  1M9S A;  4GLP A;  5IJD A;  2CA6 A;  3W3J A;  2ASS B;  1JL5 A;  4NKH A;  3ULV A;  3VQ2 A;  3WPD A;  1DFJ I;  4L3A A;  1K5G C;  3W3M A;  3G39 A;  4FS7 A;  4GT6 A;  4P91 A;  1P8V A;  4LSX A;  1DS9 A;  1QYY A;  2JQD A;  4U09 A;  2V9S A;  4AW4 A;  4TZH A;  2WQX A;  4CP6 A;  1H6T A;  4U08 A;  5GMF A;  3UL8 A;  3UL7 A;  2V70 A;  1A4Y A;  4MN8 B;  3TSR E;  2ID5 A;  3WN4 A;  2Z81 A;  2BNH A;  4KT1 A;  5AWC A;  4R07 A;  3OGM B;  3G3A A;  1WWL A;  2RR6 A;  4R0A A;  4Z8G A;  1OGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...