3RFEA

Crystal structure of glycoprotein gpib ectodomain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
PCPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quaternary organization of GPIb-IX complex and insights into Bernard-Soulier syndrome revealed by the structures of GPIbbeta and a GPIbbeta/GPIX chimer
pubmed doi rcsb
molecule keywords Platelet glycoprotein Ib beta chain
source organism Homo sapiens
molecule tags Cell adhesion
total genus 33
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01463 LRRCT Leucine rich repeat C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3rfeA00
4FMZA 4R5DA 4UFRA 4BSRA 1XEUA 5GQRK 3OGKB 4U06A 3RFJA 4R6GA 4LSXC 3OGLB 2WQWA 4NKHA 2Z62A 3E2JA 4GT6A 4Q3GA 4RCWA 4I6JB 4J4LA 5IJCA 5GMFA 1M0ZA 1WWLA 2Z81A 5AWDA 4R09A 3E4GA 4KNGA 2WQXA 3P72A 2JQDA 5D3IA 1M9SA 4YEBB 1Z7XW 2FT3A 3JB9j 3DZEA 3OJAB 5A5CA 4V2CA 2WQVA 4KXFB 3FXIA 3G3AA 4R5CA 2Z66A 2Z82A 1P8TA 2OMUA 1W8AA 1XWDC 1M10B 4U08A 4CC4C 2P1OB 1O6VA 1O6TA 2BEXA 1U0ND 1SQ0B 3UL7A 4PERA 3VQ1A 2OMWA 3G04C 4U7LA 4IM6A 4LI2A 2V9TB 4FS7A 3C6NB 2Z63A 2RA8A 4M7EA 2OMVA 3WPDA 2OMYA 2O6RA 4FHOA 4QC0A 5HZLB 4FDWA 1GWBA 1G9UA 3RGZA 4R6AA 1YRGA 3ZYOA 1FS2A 4BSUA 3RJ0A 4PEQB 2Z65A 2P1MB 1P8VA 4Q62A 4FD0A 2UZYA 3M18A 3OGMB 4P91A 4Z64C 2R9UA 2OMXA 1OGQA 5LFNA 3G06A 2ID5A 4Z8GA 1DCEA 4PSJA 3ZYNA 1DFJI 4G8AA 4GLPA 3RIZA 1FT8A 2ELLA 4WYKA 1KOOA 5IYXC 4U09A 4CP6A 4LSXA 4CILA 1A9NA 3WPIA 2CA6A 4Z79A 4AY9X 1OOKG 5CMNA 5AWCA 1FQVA 3ULUA 2P1PB 4AW4A 3RW6A 1XECA 3A79B 1OTOA 5GMGA 4RCAB 3RFEA 4ARNA 4QBZA 2XWTC 3UL9A 1O6SA 3OJAA 3RFSA 4BV4R 4OQTA 1QYYA 3C6PB 3BZ5A 3E3ZA 1K5GC 2Z7XB 3W3MA 4K17A 3ZYJA 4CNMA 4XSQA 3UL8A 2UZXA 2ASTB 3TSRE 3KJ4A 4CC4A 4Y61B 5B4PA 1JL5A 1D0BA 4R08A 3W3GA 4LSCA 4B8CD 1H6TA 2P1NB 3PMHG 3VQ2A 2O6QA 2O6SA 3ULAA 3C6OB 4H09A 3ZYIA 4P8SA 4KT1A 2P1QB 2RR6A 5B0NA 2OMTA 4MQWX 5IJDA 1K5DC 1LTXA 4R0AA 5AZ5A 4R07A 4V2EA 4Z61C 3RGXA 4EZGA 5AWAA 2V9SA 3WPBA 4RWTC 1OTNA 1XKUA 4ECOA 3O6NA 3WPCA 4LXRA 5HDHA 1FO1A 2V70A 3ULVA 3M19A 4LXSA 3CIYA 3W3KA 3O53A 4L3FA 4R6JA 3UN9A 1KOHA 3WN4A 2A0ZA 3WPEA 3RW7A 3W3NA 4R58A 2XOTA 3REZA 1H6UA 1DS9A 4C2AB 1OTMA 3G3BA 4R6FA 2WQUA 2BNHA 3WPGA 5FTTB 4HQ1A 4V2DA 2ASSB 3CVRA 3WPHA 3GOZA 4QXEA 4Q3IA 2IFGA 1P9AG 4LI1A 4XGOA 4WP6A 1OZNA 2Y5QA 1A4YA 2Q4GW 5IJBA 4PQ8A 3SB4A 4ARRA 4L3AA 5GS2B 2JE1A 1PGVA 4M7EC 5B0TA 4FCGA 3G39A 2WFHA 2OMZA 3WPFA 3E6JA 5GMHA 4PKIG 4Z94G 4MN8B 4J0MA 4CNCA 1M9LA 4TZHA 2Z7XA 4ECNA 1IO0A 5GS0A 4BSSA 3CIGA 5AWBA 4NKGA 3W3JA 1XCDA 2Z64A 4C2BB 4XOSA 5CMPA 2JE0A 4LSAA 3W3LA 1ZIWA
chains in the Genus database with same CATH superfamily
4FMZA 4R5DA 4UFRA 4BSRA 1XEUA 5GQRK 3OGKB 4U06A 3RFJA 4R6GA 4LSXC 3OGLB 2WQWA 4NKHA 2Z62A 3E2JA 4GT6A 4Q3GA 4RCWA 4I6JB 4J4LA 5IJCA 5GMFA 1M0ZA 1WWLA 2Z81A 5AWDA 4R09A 3E4GA 4KNGA 2WQXA 3P72A 2JQDA 5D3IA 1M9SA 4YEBB 1Z7XW 2FT3A 3JB9j 3DZEA 3OJAB 5A5CA 4V2CA 2WQVA 4KXFB 3FXIA 3G3AA 4R5CA 2Z66A 2Z82A 1P8TA 2OMUA 1W8AA 1XWDC 1M10B 4NZRM 4U08A 4CC4C 2P1OB 1O6VA 1O6TA 2BEXA 1U0ND 1SQ0B 3UL7A 4PERA 3VQ1A 2OMWA 3G04C 4U7LA 4IM6A 4LI2A 2V9TB 4FS7A 3C6NB 2Z63A 2RA8A 4M7EA 2OMVA 3WPDA 2OMYA 2O6RA 4FHOA 4QC0A 5HZLB 4FDWA 1GWBA 1G9UA 3RGZA 4R6AA 1YRGA 3ZYOA 1FS2A 4BSUA 3RJ0A 4PEQB 2Z65A 2P1MB 1P8VA 4Q62A 4FD0A 2UZYA 3M18A 3OGMB 4P91A 4Z64C 2R9UA 2OMXA 1OGQA 5LFNA 3G06A 2ID5A 4Z8GA 1DCEA 4PSJA 3ZYNA 1DFJI 4G8AA 4GLPA 3RIZA 1FT8A 2ELLA 4WYKA 1KOOA 5IYXC 4U09A 4CP6A 4LSXA 4CILA 1A9NA 3WPIA 2CA6A 4Z79A 4AY9X 1OOKG 5CMNA 5AWCA 1FQVA 3ULUA 2P1PB 4AW4A 3RW6A 1XECA 3A79B 1OTOA 5GMGA 4RCAB 3RFEA 4ARNA 4QBZA 2XWTC 3UL9A 1O6SA 3OJAA 3RFSA 4NZTM 4BV4R 4OQTA 1QYYA 3C6PB 3BZ5A 3E3ZA 1K5GC 2Z7XB 3W3MA 4K17A 3ZYJA 4CNMA 4XSQA 3UL8A 2UZXA 2ASTB 3TSRE 3KJ4A 4CC4A 4Y61B 5B4PA 1JL5A 1D0BA 4R08A 3W3GA 4LSCA 4B8CD 1H6TA 2P1NB 3PMHG 3VQ2A 2O6QA 2O6SA 3ULAA 3C6OB 4H09A 3ZYIA 4P8SA 4KT1A 2P1QB 2RR6A 5B0NA 2OMTA 4MQWX 5IJDA 1K5DC 1LTXA 4R0AA 5AZ5A 4R07A 4V2EA 4Z61C 3RGXA 4EZGA 5AWAA 2V9SA 3WPBA 4RWTC 1OTNA 1XKUA 4ECOA 3O6NA 3WPCA 4LXRA 5HDHA 1FO1A 2V70A 3ULVA 3M19A 4LXSA 3CIYA 3W3KA 3O53A 4L3FA 4R6JA 3UN9A 1KOHA 3WN4A 2A0ZA 3WPEA 3RW7A 3W3NA 4R58A 2XOTA 3REZA 1H6UA 1DS9A 4C2AB 1OTMA 3G3BA 4R6FA 2WQUA 2BNHA 3WPGA 5FTTB 4HQ1A 4V2DA 2ASSB 3CVRA 3WPHA 3GOZA 4QXEA 4Q3IA 2IFGA 1P9AG 4LI1A 4XGOA 4WP6A 1OZNA 2Y5QA 1A4YA 2Q4GW 5IJBA 4PQ8A 3SB4A 4ARRA 4L3AA 5GS2B 2JE1A 1PGVA 4M7EC 5B0TA 4FCGA 3G39A 2WFHA 2OMZA 3WPFA 3E6JA 5GMHA 4PKIG 4Z94G 4MN8B 4J0MA 4CNCA 1M9LA 4TZHA 2Z7XA 4ECNA 1IO0A 5GS0A 4BSSA 3CIGA 5AWBA 4NKGA 3W3JA 1XCDA 2Z64A 4C2BB 4XOSA 5CMPA 2JE0A 4LSAA 3W3LA 1ZIWA
chains in the Genus database with same CATH topology
4FMZA 4R5DA 4UFRA 4BSRA 1XEUA 5GQRK 3OGKB 4U06A 3RFJA 4R6GA 4LSXC 3OGLB 2WQWA 4NKHA 2Z62A 3E2JA 4GT6A 4Q3GA 4RCWA 4I6JB 4J4LA 5IJCA 5GMFA 1M0ZA 1WWLA 2Z81A 5AWDA 4R09A 3E4GA 4KNGA 2WQXA 3P72A 2JQDA 5D3IA 1M9SA 4YEBB 1Z7XW 2FT3A 3JB9j 3DZEA 3OJAB 5A5CA 4V2CA 2WQVA 4KXFB 3FXIA 3G3AA 4R5CA 2Z66A 2Z82A 1P8TA 2OMUA 1W8AA 1XWDC 1M10B 4U08A 4CC4C 2P1OB 1O6VA 1O6TA 2BEXA 1U0ND 1SQ0B 3UL7A 4PERA 3VQ1A 2OMWA 3G04C 4U7LA 4IM6A 4LI2A 2V9TB 4FS7A 3C6NB 2Z63A 2RA8A 4M7EA 2OMVA 3WPDA 2OMYA 2O6RA 4FHOA 4QC0A 5HZLB 4FDWA 1GWBA 1G9UA 3RGZA 4R6AA 1YRGA 3ZYOA 1FS2A 4BSUA 3RJ0A 4PEQB 2Z65A 2P1MB 1P8VA 4Q62A 4FD0A 2UZYA 3M18A 3OGMB 4P91A 4Z64C 2R9UA 2OMXA 1OGQA 5LFNA 3G06A 2ID5A 4Z8GA 1DCEA 4PSJA 3ZYNA 1DFJI 4G8AA 4GLPA 3RIZA 1FT8A 2ELLA 4WYKA 1KOOA 5IYXC 4U09A 4CP6A 4LSXA 4CILA 1A9NA 3WPIA 2CA6A 4Z79A 4AY9X 1OOKG 5CMNA 5AWCA 1FQVA 3ULUA 2P1PB 4AW4A 3RW6A 1XECA 3A79B 1OTOA 5GMGA 4RCAB 3RFEA 4ARNA 4QBZA 2XWTC 3UL9A 1O6SA 3OJAA 3RFSA 4BV4R 4OQTA 1QYYA 3C6PB 3BZ5A 3E3ZA 1K5GC 2Z7XB 3W3MA 4K17A 3ZYJA 4CNMA 4XSQA 3UL8A 2UZXA 2ASTB 3TSRE 3KJ4A 4CC4A 4Y61B 5B4PA 1JL5A 1D0BA 4R08A 3W3GA 4LSCA 4B8CD 1H6TA 2P1NB 3PMHG 3VQ2A 2O6QA 2O6SA 3ULAA 3C6OB 4H09A 3ZYIA 4P8SA 4KT1A 2P1QB 2RR6A 5B0NA 2OMTA 4MQWX 5IJDA 1K5DC 1LTXA 4R0AA 5AZ5A 4R07A 4V2EA 4Z61C 3RGXA 4EZGA 5AWAA 2V9SA 3WPBA 4RWTC 1OTNA 1XKUA 4ECOA 3O6NA 3WPCA 4LXRA 5HDHA 1FO1A 2V70A 3ULVA 3M19A 4LXSA 3CIYA 3W3KA 3O53A 4L3FA 4R6JA 3UN9A 1KOHA 3WN4A 2A0ZA 3WPEA 3RW7A 3W3NA 4R58A 2XOTA 3REZA 1H6UA 1DS9A 4C2AB 1OTMA 3G3BA 4R6FA 2WQUA 2BNHA 3WPGA 5FTTB 4HQ1A 4V2DA 2ASSB 3CVRA 3WPHA 3GOZA 4QXEA 4Q3IA 2IFGA 1P9AG 4LI1A 4XGOA 4WP6A 1OZNA 2Y5QA 1A4YA 2Q4GW 5IJBA 4PQ8A 3SB4A 4ARRA 4L3AA 5GS2B 2JE1A 1PGVA 4M7EC 5B0TA 4FCGA 3G39A 2WFHA 2OMZA 3WPFA 3E6JA 5GMHA 4PKIG 4Z94G 4MN8B 4J0MA 4CNCA 1M9LA 4TZHA 2Z7XA 4ECNA 1IO0A 5GS0A 4BSSA 3CIGA 5AWBA 4NKGA 3W3JA 1XCDA 2Z64A 4C2BB 4XOSA 5CMPA 2JE0A 4LSAA 3W3LA 1ZIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FMZ A;  4R5D A;  4UFR A;  4BSR A;  1XEU A;  5GQR K;  3OGK B;  4U06 A;  3RFJ A;  4R6G A;  4LSX C;  3OGL B;  2WQW A;  4NKH A;  2Z62 A;  3E2J A;  4GT6 A;  4Q3G A;  4RCW A;  4I6J B;  4J4L A;  5IJC A;  5GMF A;  1M0Z A;  1WWL A;  2Z81 A;  5AWD A;  4R09 A;  3E4G A;  4KNG A;  2WQX A;  3P72 A;  2JQD A;  5D3I A;  1M9S A;  4YEB B;  1Z7X W;  2FT3 A;  3JB9 j;  3DZE A;  3OJA B;  5A5C A;  4V2C A;  2WQV A;  4KXF B;  3FXI A;  3G3A A;  4R5C A;  2Z66 A;  2Z82 A;  1P8T A;  2OMU A;  1W8A A;  1XWD C;  1M10 B;  4U08 A;  4CC4 C;  2P1O B;  1O6V A;  1O6T A;  2BEX A;  1U0N D;  1SQ0 B;  3UL7 A;  4PER A;  3VQ1 A;  2OMW A;  3G04 C;  4U7L A;  4IM6 A;  4LI2 A;  2V9T B;  4FS7 A;  3C6N B;  2Z63 A;  2RA8 A;  4M7E A;  2OMV A;  3WPD A;  2OMY A;  2O6R A;  4FHO A;  4QC0 A;  5HZL B;  4FDW A;  1GWB A;  1G9U A;  3RGZ A;  4R6A A;  1YRG A;  3ZYO A;  1FS2 A;  4BSU A;  3RJ0 A;  4PEQ B;  2Z65 A;  2P1M B;  1P8V A;  4Q62 A;  4FD0 A;  2UZY A;  3M18 A;  3OGM B;  4P91 A;  4Z64 C;  2R9U A;  2OMX A;  1OGQ A;  5LFN A;  3G06 A;  2ID5 A;  4Z8G A;  1DCE A;  4PSJ A;  3ZYN A;  1DFJ I;  4G8A A;  4GLP A;  3RIZ A;  1FT8 A;  2ELL A;  4WYK A;  1KOO A;  5IYX C;  4U09 A;  4CP6 A;  4LSX A;  4CIL A;  1A9N A;  3WPI A;  2CA6 A;  4Z79 A;  4AY9 X;  1OOK G;  5CMN A;  5AWC A;  1FQV A;  3ULU A;  2P1P B;  4AW4 A;  3RW6 A;  1XEC A;  3A79 B;  1OTO A;  5GMG A;  4RCA B;  3RFE A;  4ARN A;  4QBZ A;  2XWT C;  3UL9 A;  1O6S A;  3OJA A;  3RFS A;  4BV4 R;  4OQT A;  1QYY A;  3C6P B;  3BZ5 A;  3E3Z A;  1K5G C;  2Z7X B;  3W3M A;  4K17 A;  3ZYJ A;  4CNM A;  4XSQ A;  3UL8 A;  2UZX A;  2AST B;  3TSR E;  3KJ4 A;  4CC4 A;  4Y61 B;  5B4P A;  1JL5 A;  1D0B A;  4R08 A;  3W3G A;  4LSC A;  4B8C D;  1H6T A;  2P1N B;  3PMH G;  3VQ2 A;  2O6Q A;  2O6S A;  3ULA A;  3C6O B;  4H09 A;  3ZYI A;  4P8S A;  4KT1 A;  2P1Q B;  2RR6 A;  5B0N A;  2OMT A;  4MQW X;  5IJD A;  1K5D C;  1LTX A;  4R0A A;  5AZ5 A;  4R07 A;  4V2E A;  4Z61 C;  3RGX A;  4EZG A;  5AWA A;  2V9S A;  3WPB A;  4RWT C;  1OTN A;  1XKU A;  4ECO A;  3O6N A;  3WPC A;  4LXR A;  5HDH A;  1FO1 A;  2V70 A;  3ULV A;  3M19 A;  4LXS A;  3CIY A;  3W3K A;  3O53 A;  4L3F A;  4R6J A;  3UN9 A;  1KOH A;  3WN4 A;  2A0Z A;  3WPE A;  3RW7 A;  3W3N A;  4R58 A;  2XOT A;  3REZ A;  1H6U A;  1DS9 A;  4C2A B;  1OTM A;  3G3B A;  4R6F A;  2WQU A;  2BNH A;  3WPG A;  5FTT B;  4HQ1 A;  4V2D A;  2ASS B;  3CVR A;  3WPH A;  3GOZ A;  4QXE A;  4Q3I A;  2IFG A;  1P9A G;  4LI1 A;  4XGO A;  4WP6 A;  1OZN A;  2Y5Q A;  1A4Y A;  2Q4G W;  5IJB A;  4PQ8 A;  3SB4 A;  4ARR A;  4L3A A;  5GS2 B;  2JE1 A;  1PGV A;  4M7E C;  5B0T A;  4FCG A;  3G39 A;  2WFH A;  2OMZ A;  3WPF A;  3E6J A;  5GMH A;  4PKI G;  4Z94 G;  4MN8 B;  4J0M A;  4CNC A;  1M9L A;  4TZH A;  2Z7X A;  4ECN A;  1IO0 A;  5GS0 A;  4BSS A;  3CIG A;  5AWB A;  4NKG A;  3W3J A;  1XCD A;  2Z64 A;  4C2B B;  4XOS A;  5CMP A;  2JE0 A;  4LSA A;  3W3L A;  1ZIW A; 
#chains in the Genus database with same CATH topology
 4FMZ A;  4R5D A;  4UFR A;  4BSR A;  1XEU A;  5GQR K;  3OGK B;  4U06 A;  3RFJ A;  4R6G A;  4LSX C;  3OGL B;  2WQW A;  4NKH A;  2Z62 A;  3E2J A;  4GT6 A;  4Q3G A;  4RCW A;  4I6J B;  4J4L A;  5IJC A;  5GMF A;  1M0Z A;  1WWL A;  2Z81 A;  5AWD A;  4R09 A;  3E4G A;  4KNG A;  2WQX A;  3P72 A;  2JQD A;  5D3I A;  1M9S A;  4YEB B;  1Z7X W;  2FT3 A;  3JB9 j;  3DZE A;  3OJA B;  5A5C A;  4V2C A;  2WQV A;  4KXF B;  3FXI A;  3G3A A;  4R5C A;  2Z66 A;  2Z82 A;  1P8T A;  2OMU A;  1W8A A;  1XWD C;  1M10 B;  4NZR M;  4U08 A;  4CC4 C;  2P1O B;  1O6V A;  1O6T A;  2BEX A;  1U0N D;  1SQ0 B;  3UL7 A;  4PER A;  3VQ1 A;  2OMW A;  3G04 C;  4U7L A;  4IM6 A;  4LI2 A;  2V9T B;  4FS7 A;  3C6N B;  2Z63 A;  2RA8 A;  4M7E A;  2OMV A;  3WPD A;  2OMY A;  2O6R A;  4FHO A;  4QC0 A;  5HZL B;  4FDW A;  1GWB A;  1G9U A;  3RGZ A;  4R6A A;  1YRG A;  3ZYO A;  1FS2 A;  4BSU A;  3RJ0 A;  4PEQ B;  2Z65 A;  2P1M B;  1P8V A;  4Q62 A;  4FD0 A;  2UZY A;  3M18 A;  3OGM B;  4P91 A;  4Z64 C;  2R9U A;  2OMX A;  1OGQ A;  5LFN A;  3G06 A;  2ID5 A;  4Z8G A;  1DCE A;  4PSJ A;  3ZYN A;  1DFJ I;  4G8A A;  4GLP A;  3RIZ A;  1FT8 A;  2ELL A;  4WYK A;  1KOO A;  5IYX C;  4U09 A;  4CP6 A;  4LSX A;  4CIL A;  1A9N A;  3WPI A;  2CA6 A;  4Z79 A;  4AY9 X;  1OOK G;  5CMN A;  5AWC A;  1FQV A;  3ULU A;  2P1P B;  4AW4 A;  3RW6 A;  1XEC A;  3A79 B;  1OTO A;  5GMG A;  4RCA B;  3RFE A;  4ARN A;  4QBZ A;  2XWT C;  3UL9 A;  1O6S A;  3OJA A;  3RFS A;  4NZT M;  4BV4 R;  4OQT A;  1QYY A;  3C6P B;  3BZ5 A;  3E3Z A;  1K5G C;  2Z7X B;  3W3M A;  4K17 A;  3ZYJ A;  4CNM A;  4XSQ A;  3UL8 A;  2UZX A;  2AST B;  3TSR E;  3KJ4 A;  4CC4 A;  4Y61 B;  5B4P A;  1JL5 A;  1D0B A;  4R08 A;  3W3G A;  4LSC A;  4B8C D;  1H6T A;  2P1N B;  3PMH G;  3VQ2 A;  2O6Q A;  2O6S A;  3ULA A;  3C6O B;  4H09 A;  3ZYI A;  4P8S A;  4KT1 A;  2P1Q B;  2RR6 A;  5B0N A;  2OMT A;  4MQW X;  5IJD A;  1K5D C;  1LTX A;  4R0A A;  5AZ5 A;  4R07 A;  4V2E A;  4Z61 C;  3RGX A;  4EZG A;  5AWA A;  2V9S A;  3WPB A;  4RWT C;  1OTN A;  1XKU A;  4ECO A;  3O6N A;  3WPC A;  4LXR A;  5HDH A;  1FO1 A;  2V70 A;  3ULV A;  3M19 A;  4LXS A;  3CIY A;  3W3K A;  3O53 A;  4L3F A;  4R6J A;  3UN9 A;  1KOH A;  3WN4 A;  2A0Z A;  3WPE A;  3RW7 A;  3W3N A;  4R58 A;  2XOT A;  3REZ A;  1H6U A;  1DS9 A;  4C2A B;  1OTM A;  3G3B A;  4R6F A;  2WQU A;  2BNH A;  3WPG A;  5FTT B;  4HQ1 A;  4V2D A;  2ASS B;  3CVR A;  3WPH A;  3GOZ A;  4QXE A;  4Q3I A;  2IFG A;  1P9A G;  4LI1 A;  4XGO A;  4WP6 A;  1OZN A;  2Y5Q A;  1A4Y A;  2Q4G W;  5IJB A;  4PQ8 A;  3SB4 A;  4ARR A;  4L3A A;  5GS2 B;  2JE1 A;  1PGV A;  4M7E C;  5B0T A;  4FCG A;  3G39 A;  2WFH A;  2OMZ A;  3WPF A;  3E6J A;  5GMH A;  4PKI G;  4Z94 G;  4MN8 B;  4J0M A;  4CNC A;  1M9L A;  4TZH A;  2Z7X A;  4ECN A;  1IO0 A;  5GS0 A;  4BSS A;  3CIG A;  5AWB A;  4NKG A;  3W3J A;  1XCD A;  2Z64 A;  4C2B B;  4XOS A;  5CMP A;  2JE0 A;  4LSA A;  3W3L A;  1ZIW A; 
#chains in the Genus database with same CATH homology
 4FMZ A;  4R5D A;  4UFR A;  4BSR A;  1XEU A;  5GQR K;  3OGK B;  4U06 A;  3RFJ A;  4R6G A;  4LSX C;  3OGL B;  2WQW A;  4NKH A;  2Z62 A;  3E2J A;  4GT6 A;  4Q3G A;  4RCW A;  4I6J B;  4J4L A;  5IJC A;  5GMF A;  1M0Z A;  1WWL A;  2Z81 A;  5AWD A;  4R09 A;  3E4G A;  4KNG A;  2WQX A;  3P72 A;  2JQD A;  5D3I A;  1M9S A;  4YEB B;  1Z7X W;  2FT3 A;  3JB9 j;  3DZE A;  3OJA B;  5A5C A;  4V2C A;  2WQV A;  4KXF B;  3FXI A;  3G3A A;  4R5C A;  2Z66 A;  2Z82 A;  1P8T A;  2OMU A;  1W8A A;  1XWD C;  1M10 B;  4U08 A;  4CC4 C;  2P1O B;  1O6V A;  1O6T A;  2BEX A;  1U0N D;  1SQ0 B;  3UL7 A;  4PER A;  3VQ1 A;  2OMW A;  3G04 C;  4U7L A;  4IM6 A;  4LI2 A;  2V9T B;  4FS7 A;  3C6N B;  2Z63 A;  2RA8 A;  4M7E A;  2OMV A;  3WPD A;  2OMY A;  2O6R A;  4FHO A;  4QC0 A;  5HZL B;  4FDW A;  1GWB A;  1G9U A;  3RGZ A;  4R6A A;  1YRG A;  3ZYO A;  1FS2 A;  4BSU A;  3RJ0 A;  4PEQ B;  2Z65 A;  2P1M B;  1P8V A;  4Q62 A;  4FD0 A;  2UZY A;  3M18 A;  3OGM B;  4P91 A;  4Z64 C;  2R9U A;  2OMX A;  1OGQ A;  5LFN A;  3G06 A;  2ID5 A;  4Z8G A;  1DCE A;  4PSJ A;  3ZYN A;  1DFJ I;  4G8A A;  4GLP A;  3RIZ A;  1FT8 A;  2ELL A;  4WYK A;  1KOO A;  5IYX C;  4U09 A;  4CP6 A;  4LSX A;  4CIL A;  1A9N A;  3WPI A;  2CA6 A;  4Z79 A;  4AY9 X;  1OOK G;  5CMN A;  5AWC A;  1FQV A;  3ULU A;  2P1P B;  4AW4 A;  3RW6 A;  1XEC A;  3A79 B;  1OTO A;  5GMG A;  4RCA B;  3RFE A;  4ARN A;  4QBZ A;  2XWT C;  3UL9 A;  1O6S A;  3OJA A;  3RFS A;  4BV4 R;  4OQT A;  1QYY A;  3C6P B;  3BZ5 A;  3E3Z A;  1K5G C;  2Z7X B;  3W3M A;  4K17 A;  3ZYJ A;  4CNM A;  4XSQ A;  3UL8 A;  2UZX A;  2AST B;  3TSR E;  3KJ4 A;  4CC4 A;  4Y61 B;  5B4P A;  1JL5 A;  1D0B A;  4R08 A;  3W3G A;  4LSC A;  4B8C D;  1H6T A;  2P1N B;  3PMH G;  3VQ2 A;  2O6Q A;  2O6S A;  3ULA A;  3C6O B;  4H09 A;  3ZYI A;  4P8S A;  4KT1 A;  2P1Q B;  2RR6 A;  5B0N A;  2OMT A;  4MQW X;  5IJD A;  1K5D C;  1LTX A;  4R0A A;  5AZ5 A;  4R07 A;  4V2E A;  4Z61 C;  3RGX A;  4EZG A;  5AWA A;  2V9S A;  3WPB A;  4RWT C;  1OTN A;  1XKU A;  4ECO A;  3O6N A;  3WPC A;  4LXR A;  5HDH A;  1FO1 A;  2V70 A;  3ULV A;  3M19 A;  4LXS A;  3CIY A;  3W3K A;  3O53 A;  4L3F A;  4R6J A;  3UN9 A;  1KOH A;  3WN4 A;  2A0Z A;  3WPE A;  3RW7 A;  3W3N A;  4R58 A;  2XOT A;  3REZ A;  1H6U A;  1DS9 A;  4C2A B;  1OTM A;  3G3B A;  4R6F A;  2WQU A;  2BNH A;  3WPG A;  5FTT B;  4HQ1 A;  4V2D A;  2ASS B;  3CVR A;  3WPH A;  3GOZ A;  4QXE A;  4Q3I A;  2IFG A;  1P9A G;  4LI1 A;  4XGO A;  4WP6 A;  1OZN A;  2Y5Q A;  1A4Y A;  2Q4G W;  5IJB A;  4PQ8 A;  3SB4 A;  4ARR A;  4L3A A;  5GS2 B;  2JE1 A;  1PGV A;  4M7E C;  5B0T A;  4FCG A;  3G39 A;  2WFH A;  2OMZ A;  3WPF A;  3E6J A;  5GMH A;  4PKI G;  4Z94 G;  4MN8 B;  4J0M A;  4CNC A;  1M9L A;  4TZH A;  2Z7X A;  4ECN A;  1IO0 A;  5GS0 A;  4BSS A;  3CIG A;  5AWB A;  4NKG A;  3W3J A;  1XCD A;  2Z64 A;  4C2B B;  4XOS A;  5CMP A;  2JE0 A;  4LSA A;  3W3L A;  1ZIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...