3RFNA

Epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
151
structure length
151
Chain Sequence
b'YSIEVRTHSALHVVKGAVVKAAGSAAKWTTSTYVKGNKGVLIVKAALELDKWAWAAMEALANEKVKENAPIKIYELPREEAEKMFGEDMYDLFPVPEDVRILKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRFRKSKGLLEIHFELLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BB_1wnu_001
publication title Computational design of high-affinity epitope scaffolds by backbone grafting of a linear epitope.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags De novo protein
total genus 46
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2011-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.54.20 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 3rfnA02
3.30.980.10 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-trna Synthetase; Chain A, domain 2 3rfnA01
3WQZA 1TKGA 1TKYA 3RHUA 1NYRA 2ZZEA 2ZZGA 3RFNA 1WNUA 1V4PA 1V7OA 1TKEA 2ZZFA 1TJEA 1WXOA 1NYQA 2E1BA 2ZTGA 1QF6A 3KEWA
chains in the Genus database with same CATH superfamily
3WQZA 1TKGA 4XR0A 2B5MA 2Y3UA 2IUSA 2ZZEA 4AR1A 2EWJA 3I7PA 3EI1A 4A09A 2Y50A 4E5ZA 4A08A 4AR8A 2B5LA 5FQDA 3ZWKA 1TJEA 3ZTWA 3I89A 2HYEA 3ZU6A 3ZW7A 4A0BA 2I06A 2ZTGA 4AREA 4A11A 3I7OA 4CI1A 3KEWA 4CI2A 1NYRA 1WZCA 2ZZGA 3ZX5A 3ZTYA 3I7LA 3EI4A 4XR3A 3RFNA 1WNUA 3I8EA 2ZOSA 1ECRA 1TKEA 4A0AA 3I7KA 3ZWDA 1WXOA 1NYQA 4XR2A 2IUUA 2Y6IA 3RHUA 3EI2A 4CI3A 4E54A 2I05A 1XVIA 1V4PA 1V7OA 2ZZFA 3ZX4A 3E0CA 3ZUPA 2E1BA 2IUTA 3I7NA 3I7HA 4AR9A 4XR1A 1TKYA 4ARFA 3EI3A 3I8CA 4TZ4A 1QF6A
chains in the Genus database with same CATH topology
3I7OA 4CI1A 2Y6IA 4AR9A 3WQZA 4XR1A 3I7HA 4A11A 1TKGA 2IUUA 4XR0A 2B5MA 2Y3UA 1TKYA 4CI2A 3RHUA 2IUSA 1NYRA 2ZZEA 4AR1A 2ZZGA 4ARFA 3EI2A 2EWJA 3I7PA 4CI3A 3EI1A 4E54A 3I7LA 3EI4A 4XR3A 3RFNA 2I05A 4A09A 1WNUA 3I8EA 2Y50A 4E5ZA 1V4PA 1V7OA 1ECRA 3EI3A 3I8CA 4TZ4A 4A08A 1TKEA 4A0AA 4AR8A 2B5LA 2ZZFA 5FQDA 1TJEA 3I7KA 1WXOA 3I89A 3E0CA 2HYEA 1NYQA 4A0BA 2E1BA 2IUTA 2I06A 3I7NA 2ZTGA 4XR2A 1QF6A 4AREA 3KEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WQZ A;  1TKG A;  1TKY A;  3RHU A;  1NYR A;  2ZZE A;  2ZZG A;  3RFN A;  1WNU A;  1V4P A;  1V7O A;  1TKE A;  2ZZF A;  1TJE A;  1WXO A;  1NYQ A;  2E1B A;  2ZTG A;  1QF6 A;  3KEW A; 
#chains in the Genus database with same CATH topology
 3WQZ A;  1TKG A;  4XR0 A;  2B5M A;  2Y3U A;  2IUS A;  2ZZE A;  4AR1 A;  2EWJ A;  3I7P A;  3EI1 A;  4A09 A;  2Y50 A;  4E5Z A;  4A08 A;  4AR8 A;  2B5L A;  5FQD A;  3ZWK A;  1TJE A;  3ZTW A;  3I89 A;  2HYE A;  3ZU6 A;  3ZW7 A;  4A0B A;  2I06 A;  2ZTG A;  4ARE A;  4A11 A;  3I7O A;  4CI1 A;  3KEW A;  4CI2 A;  1NYR A;  1WZC A;  2ZZG A;  3ZX5 A;  3ZTY A;  3I7L A;  3EI4 A;  4XR3 A;  3RFN A;  1WNU A;  3I8E A;  2ZOS A;  1ECR A;  1TKE A;  4A0A A;  3I7K A;  3ZWD A;  1WXO A;  1NYQ A;  4XR2 A;  2IUU A;  2Y6I A;  3RHU A;  3EI2 A;  4CI3 A;  4E54 A;  2I05 A;  1XVI A;  1V4P A;  1V7O A;  2ZZF A;  3ZX4 A;  3E0C A;  3ZUP A;  2E1B A;  2IUT A;  3I7N A;  3I7H A;  4AR9 A;  4XR1 A;  1TKY A;  4ARF A;  3EI3 A;  3I8C A;  4TZ4 A;  1QF6 A; 
#chains in the Genus database with same CATH homology
 3I7O A;  4CI1 A;  2Y6I A;  4AR9 A;  3WQZ A;  4XR1 A;  3I7H A;  4A11 A;  1TKG A;  2IUU A;  4XR0 A;  2B5M A;  2Y3U A;  1TKY A;  4CI2 A;  3RHU A;  2IUS A;  1NYR A;  2ZZE A;  4AR1 A;  2ZZG A;  4ARF A;  3EI2 A;  2EWJ A;  3I7P A;  4CI3 A;  3EI1 A;  4E54 A;  3I7L A;  3EI4 A;  4XR3 A;  3RFN A;  2I05 A;  4A09 A;  1WNU A;  3I8E A;  2Y50 A;  4E5Z A;  1V4P A;  1V7O A;  1ECR A;  3EI3 A;  3I8C A;  4TZ4 A;  4A08 A;  1TKE A;  4A0A A;  4AR8 A;  2B5L A;  2ZZF A;  5FQD A;  1TJE A;  3I7K A;  1WXO A;  3I89 A;  3E0C A;  2HYE A;  1NYQ A;  4A0B A;  2E1B A;  2IUT A;  2I06 A;  3I7N A;  2ZTG A;  4XR2 A;  1QF6 A;  4ARE A;  3KEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...