3RFNA

Epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
151
structure length
151
Chain Sequence
YSIEVRTHSALHVVKGAVVKAAGSAAKWTTSTYVKGNKGVLIVKAALELDKWAWAAMEALANEKVKENAPIKIYELPREEAEKMFGEDMYDLFPVPEDVRILKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRFRKSKGLLEIHFELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational design of high-affinity epitope scaffolds by backbone grafting of a linear epitope.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags De novo protein
molecule keywords BB_1wnu_001
total genus 46
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2011-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.54.20 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 3rfnA02
3.30.980.10 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-trna Synthetase; Chain A, domain 2 3rfnA01
1WNUA 1TKEA 1QF6A 1TKYA 1NYQA 1TKGA 1NYRA 2E1BA 3KEWA 2ZTGA 2ZZFA 3RHUA 3WQZA 2ZZGA 3RFNA 2ZZEA 1WXOA 1TJEA 1V4PA 1V7OA
chains in the Genus database with same CATH superfamily
1WNUA 1ECRA 4AR9A 1TKEA 3I7HA 3ZUPA 4A0BA 1TKGA 3ZWDA 2E1BA 3I7LA 4AREA 4CI2A 3EI2A 4CI3A 4XR2A 2B5MA 3EI3A 4A11A 5FQDA 3I7NA 4AR8A 2Y50A 1QF6A 4ARFA 4CI1A 4XR1A 4A08A 3I89A 2EWJA 4XR3A 3KEWA 3WQZA 3I7KA 2ZZGA 4XR0A 2HYEA 3EI1A 2ZZEA 3I7PA 3ZWKA 2I05A 2IUUA 3ZX5A 3ZX4A 4A09A 3I8EA 2B5LA 2ZTGA 3RHUA 3I7OA 3ZU6A 2ZOSA 2IUTA 3E0CA 3RFNA 1WXOA 1TJEA 2I06A 2IUSA 2Y3UA 3I8CA 4E54A 3ZW7A 4AR1A 4E5ZA 1TKYA 1NYQA 1XVIA 3ZTWA 2Y6IA 4A0AA 2ZZFA 3ZTYA 1WZCA 3EI4A 4TZ4A 1NYRA 1V4PA 1V7OA
chains in the Genus database with same CATH topology
1WNUA 1ECRA 4AR9A 1TKEA 3I7HA 4A0BA 1TKGA 2E1BA 3I7LA 4AREA 4CI2A 3EI2A 4CI3A 4XR2A 2B5MA 3EI3A 4A11A 5FQDA 3I7NA 4AR8A 2Y50A 1QF6A 4ARFA 4CI1A 4XR1A 4A08A 3I89A 2EWJA 4XR3A 3KEWA 3WQZA 3I7KA 2ZZGA 4XR0A 2HYEA 3EI1A 2ZZEA 3I7PA 2I05A 2IUUA 4A09A 3I8EA 2B5LA 2ZTGA 3RHUA 3I7OA 3E0CA 2IUTA 3RFNA 1WXOA 1TJEA 2I06A 2IUSA 2Y3UA 3I8CA 4E54A 4AR1A 4E5ZA 1TKYA 1NYQA 4A0AA 2Y6IA 2ZZFA 3EI4A 4TZ4A 1NYRA 1V4PA 1V7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WNU A;  1TKE A;  1QF6 A;  1TKY A;  1NYQ A;  1TKG A;  1NYR A;  2E1B A;  3KEW A;  2ZTG A;  2ZZF A;  3RHU A;  3WQZ A;  2ZZG A;  3RFN A;  2ZZE A;  1WXO A;  1TJE A;  1V4P A;  1V7O A; 
#chains in the Genus database with same CATH topology
 1WNU A;  1ECR A;  4AR9 A;  1TKE A;  3I7H A;  3ZUP A;  4A0B A;  1TKG A;  3ZWD A;  2E1B A;  3I7L A;  4ARE A;  4CI2 A;  3EI2 A;  4CI3 A;  4XR2 A;  2B5M A;  3EI3 A;  4A11 A;  5FQD A;  3I7N A;  4AR8 A;  2Y50 A;  1QF6 A;  4ARF A;  4CI1 A;  4XR1 A;  4A08 A;  3I89 A;  2EWJ A;  4XR3 A;  3KEW A;  3WQZ A;  3I7K A;  2ZZG A;  4XR0 A;  2HYE A;  3EI1 A;  2ZZE A;  3I7P A;  3ZWK A;  2I05 A;  2IUU A;  3ZX5 A;  3ZX4 A;  4A09 A;  3I8E A;  2B5L A;  2ZTG A;  3RHU A;  3I7O A;  3ZU6 A;  2ZOS A;  2IUT A;  3E0C A;  3RFN A;  1WXO A;  1TJE A;  2I06 A;  2IUS A;  2Y3U A;  3I8C A;  4E54 A;  3ZW7 A;  4AR1 A;  4E5Z A;  1TKY A;  1NYQ A;  1XVI A;  3ZTW A;  2Y6I A;  4A0A A;  2ZZF A;  3ZTY A;  1WZC A;  3EI4 A;  4TZ4 A;  1NYR A;  1V4P A;  1V7O A; 
#chains in the Genus database with same CATH homology
 1WNU A;  1ECR A;  4AR9 A;  1TKE A;  3I7H A;  4A0B A;  1TKG A;  2E1B A;  3I7L A;  4ARE A;  4CI2 A;  3EI2 A;  4CI3 A;  4XR2 A;  2B5M A;  3EI3 A;  4A11 A;  5FQD A;  3I7N A;  4AR8 A;  2Y50 A;  1QF6 A;  4ARF A;  4CI1 A;  4XR1 A;  4A08 A;  3I89 A;  2EWJ A;  4XR3 A;  3KEW A;  3WQZ A;  3I7K A;  2ZZG A;  4XR0 A;  2HYE A;  3EI1 A;  2ZZE A;  3I7P A;  2I05 A;  2IUU A;  4A09 A;  3I8E A;  2B5L A;  2ZTG A;  3RHU A;  3I7O A;  3E0C A;  2IUT A;  3RFN A;  1WXO A;  1TJE A;  2I06 A;  2IUS A;  2Y3U A;  3I8C A;  4E54 A;  4AR1 A;  4E5Z A;  1TKY A;  1NYQ A;  4A0A A;  2Y6I A;  2ZZF A;  3EI4 A;  4TZ4 A;  1NYR A;  1V4P A;  1V7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...