3RGFB

Crystal structure of human cdk8/cycc
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
266
structure length
266
Chain Sequence
b'KAMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 8
publication title The Structure of CDK8/CycC Implicates Specificity in the CDK/Cyclin Family and Reveals Interaction with a Deep Pocket Binder.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase,transcription
total genus 100
structure length 266
sequence length 266
ec nomenclature
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF16899 Cyclin_C_2 Cyclin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3rgfB02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3rgfB01
2B9RA 3EOCB 3H4CA 1H1RB 2C4GB 4F6SB 4EOKB 5EFQB 4UN0A 1N4MA 5CYIB 4CFUD 3MIAB 1FINB 1JOWA 3BHTB 3TNWB 2I53A 2W9ZA 3M03A 4YOSA 5LQFB 1ZP2A 1O9KA 4ROCA 1VINA 1D3UB 2F2CA 4BCGB 2WEVB 2PK2A 4ROEA 1UNGD 4CFUB 4BCJB 2I40B 1FVVB 1H26B 2W9FA 5IDNB 3POMA 5HQ0B 5HBJB 3EIDB 4EOLB 2W2HA 4EOPB 1GUXB 1H1PB 3QHRB 4F6WB 2UZEB 1JSTB 2QDJA 4KRCB 4OGRB 4EOJB 5L2WB 4EOMB 2IVXA 4F70B 3BLHB 1OI9B 4YC3B 2WIHB 3RGFB 4BCKB 3BHUB 4CXAB 1W98B 1OIUB 1XO2A 4BCQD 4BCHB 2X1NB 2WHBB 2WXVB 1PKDB 3BLRB 3QHWB 4EC9B 1AD6A 1H1SB 4YOZA 4IMYB 4RODA 2C5XB 2CCHB 4BCND 1H4LD 1VYWB 3MI9B 5HBHB 4EOSB 2EUFA 2JGZB 2WMAB 1GY3B 2PMIB 4EOQB 4BCIB 5BNJB 2C6TB 2UZBB 4CFXB 1C9BA 1OKVB 2CCIB 4CFMB 4KRDB 4BCOB 4BCPB 1OL1B 1OKWB 1URCB 4G6LB 4Y72B 3TN8B 4BCNB 4EC8B 5I5ZB 3MY5B 1H27B 1VOLA 5LMKB 2G9XB 1OGUB 2WPAB 3BLQB 2PK9B 1F5QB 4FX3B 2BKZB 2PHGA 4F7JB 2UZLB 3BHVB 1JKWA 5HNBB 5HVYB 2IW9B 3LQ5B 1JSUB 5ICPB 1AISB 4F7NB 1UNLD 1H28B 2CJMB 2BPMB 2WMBB 1UNHD 1OL2B 1GUXA 2IW6B 4F7SB 2WIPB 4YOOA 4NSTB 1H25B 5IDPB 1O9KB 2R7GA 4EOOB 4F7LB 4ELJA 4BCQB 2C5NB 3DOGB 2C5VB 3DDQB 3EJ1B 1OIYB 4I3ZB 4CFVB 4EONB 4CFNB 1KXUA 3DDPB 4BCMD 4CFWB 3K7AM 2UZDB 4EORB 2UUEB 2W96A 1BU2A 1H24B 1P5EB 5FGKB 5ACBA 2IW8B 5IF1B 1TFBA 3F5XB 3O0GD 4OR5B 2V22B 3TNHB 2WFYB 4II5B 3TNIB 1H1QB 1E9HB 2C5OB 4BCFB 4BCMB 5HBEB 3MY1B 5CEIB 4CRLB 2W99A 3G33B 1G3NC 4EOIB 1QMZB 4TTHA 1GH6B 4ELLA 4F6UB
chains in the Genus database with same CATH superfamily
1QLBA 3EOCB 2BS2A 3BG9A 3PO3S 4MFEA 2CZ7B 1N4MA 4CFUD 3X24B 2DXBB 1ZP2A 4ROCA 1D3UB 2F2CA 4OB2B 1FVVB 4M6VA 3DL1A 3POMA 2W2HA 4AKHA 3QHRB 4Z6YA 2UZEB 3DTOA 4KRCB 4EOJB 3BLHB 1OI9B 3QZ5B 4YC3B 3BHUB 3X26B 3TW6A 1OIUB 2BS3A 4BCQD 3BLRB 4NC6A 3GTMS 4IMYB 3B57A 2CCHB 5DQWA 4EOSB 1H4LD 5HBHB 4BBSM 2DXCB 1OL1B 1OKWB 1URCB 4BCNB 2ZPHB 3BLQB 4F7JB 2UZLB 5ICPB 2WJ9A 3HHTB 4BY1X 2LW4A 4NSTB 1H25B 5IDPB 4MIMA 3EJ1B 4I3ZB 3X20B 4CFVB 3BG5A 4CFNB 3DDPB 4BCMD 3QYGB 4CFWB 2QF7A 1H24B 3QYBA 3A8MB 2IW8B 3F5XB 3TNHB 2WFYB 4BCFB 3MY1B 3G33B 2ZCFB 1G3NC 2CYZB 1GH6B 4F6UB 2B9RA 3H4CA 1H1RB 1JOWA 2CZ0B 3M03A 4YOSA 2ZPIB 3QXEB 1FKMA 1UNGD 3HBLA 4BCJB 4JX4A 3QWLA 1AHJB 4EOLB 1GUXB 4OB3B 5L2WB 2QDJA 4OGRB 2IVXA 4BCKB 4ZGDB 2WIHB 3VKHA 4CXAB 3QZ9B 1UGQB 1XO2A 2WXVB 3QHWB 1AD6A 1H1SB 2ZPBB 1VYWB 2DD4B 2EUFA 2JGZB 2WMAB 1GY3B 2ZPGB 4EOQB 5BNJB 1C9BA 2IN3A 4KRDB 3QYEA 1H27B 2WPAB 2PK9B 4FX3B 2BKZB 3BHVB 5HVYB 3VYHB 1JSUB 1AISB 4F7NB 2WMBB 1UNHD 1OL2B 1GUXA 4YOOA 1O9KB 2R7GA 4EOOB 4ELJA 2KR6A 2PJQA 2C5NB 3DOGB 2ZPFB 4EONB 3K7AM 4EORB 5FGKB 1TFBA 3WVDB 4OR5B 3KHIA 2QQ8A 4EOIB 4HL4A 1QMZB 4ZGEB 2CZ1B 1UGSB 2C4GB 2DMEA 4EOKB 5EFQB 4UN0A 2G77A 1FINB 2BS4A 2I53A 3BG3A 1O9KA 1VINA 4ROEA 2PK2A 4CFUB 2W9FA 2AHJB 5IDNB 4OB0B 5HQ0B 5HBJB 3WVEB 1H1PB 3DJBA 1JSTB 4EOMB 3A8OB 4F70B 2D0QB 3NDQA 4FM4B 1W98B 3TW7A 4BCHB 3A8GB 4YOZA 4RODA 2C5XB 4BCND 3MI9B 4BCIB 4CFXB 1OKVB 2CCIB 4HNVA 4BCOB 4BCPB 3VYGB 4G6LB 3TN8B 5I5ZB 3MY5B 3A8LB 2G9XB 1OGUB 3X28B 2PHGA 2QFZA 1JKWA 5EJCA 1IREB 1H28B 2BPMB 2CJMB 4MFDA 4JX5A 2WIPB 1E7PA 2KMGA 4F7LB 4BY7X 2UZDB 2UUEB 5IF1B 2DPPB 4II5B 3TNIB 1H1QB 2C5OB 4BCMB 4ZGJB 4BBRM 4HNTA 5CEIB 4CRLB 2W99A 4AKGA 1UGRB 4ELLA 5IHYA 4F6SB 1UGPB 5CYIB 2ZZDB 3MIAB 3BHTB 3TNWB 2W9ZA 5LQFB 4BCGB 2WEVB 1V29B 2I40B 2ZPEB 3X25B 4AKIA 1H26B 4HLQA 3EIDB 4EOPB 4F6WB 3HB9A 1TD6A 3RGFB 3HZJA 2X1NB 2WHBB 1PKDB 4EC9B 2DD5B 4JX6A 4QSHA 3HO8A 2PMIB 1ENWA 2C6TB 2UZBB 4CFMB 3QYHB 4Y72B 4EC8B 1VOLA 5LMKB 4HNUA 1F5QB 2CZ6B 5HNBB 4BXXX 2IW9B 3LQ5B 1UNLD 2IW6B 4F7SB 4LOCA 4BCQB 4OB1B 2C5VB 3DDQB 1OIYB 1KXUA 2W96A 1BU2A 4AI6A 1P5EB 5ACBA 3O0GD 2V22B 2QDYB 1E9HB 5HBEB 5DQVA 2QGSA 3VKGA 4TTHA 3A8HB
chains in the Genus database with same CATH topology
2B9RA 3EOCB 3H4CA 1H1RB 2C4GB 4F6SB 4EOKB 5EFQB 4UN0A 1N4MA 5CYIB 4CFUD 3MIAB 1FINB 1JOWA 3BHTB 3TNWB 2I53A 2W9ZA 3M03A 4YOSA 5LQFB 1ZP2A 1O9KA 4ROCA 1VINA 1D3UB 2F2CA 4BCGB 2WEVB 2PK2A 4ROEA 1UNGD 4CFUB 4BCJB 2I40B 1FVVB 1H26B 2W9FA 5IDNB 3POMA 5HQ0B 5HBJB 3EIDB 4EOLB 2W2HA 4EOPB 1GUXB 1H1PB 3QHRB 4F6WB 2UZEB 1JSTB 2QDJA 4KRCB 4OGRB 4EOJB 5L2WB 4EOMB 2IVXA 4F70B 3BLHB 1OI9B 4YC3B 2WIHB 3RGFB 4BCKB 3BHUB 4CXAB 1W98B 1OIUB 1XO2A 4BCQD 4BCHB 2X1NB 2WHBB 2WXVB 1PKDB 3BLRB 3QHWB 4EC9B 1AD6A 1H1SB 4YOZA 4IMYB 4RODA 2C5XB 2CCHB 4BCND 1H4LD 1VYWB 3MI9B 5HBHB 4EOSB 2EUFA 2JGZB 2WMAB 1GY3B 2PMIB 4EOQB 4BCIB 5BNJB 2C6TB 2UZBB 4CFXB 1C9BA 1OKVB 2CCIB 4CFMB 4KRDB 4BCOB 4BCPB 1OL1B 1OKWB 1URCB 4G6LB 4Y72B 3TN8B 4BCNB 4EC8B 5I5ZB 3MY5B 1H27B 1VOLA 5LMKB 2G9XB 1OGUB 2WPAB 3BLQB 2PK9B 1F5QB 4FX3B 2BKZB 2PHGA 4F7JB 2UZLB 3BHVB 1JKWA 5HNBB 5HVYB 2IW9B 3LQ5B 1JSUB 5ICPB 1AISB 4F7NB 1UNLD 1H28B 2CJMB 2BPMB 2WMBB 1UNHD 1OL2B 1GUXA 2IW6B 4F7SB 2WIPB 4YOOA 4NSTB 1H25B 5IDPB 1O9KB 2R7GA 4EOOB 4F7LB 4ELJA 4BCQB 2C5NB 3DOGB 2C5VB 3DDQB 3EJ1B 1OIYB 4I3ZB 4CFVB 4EONB 4CFNB 1KXUA 3DDPB 4BCMD 4CFWB 3K7AM 2UZDB 4EORB 2UUEB 2W96A 1BU2A 1H24B 1P5EB 5FGKB 5ACBA 2IW8B 5IF1B 1TFBA 3F5XB 3O0GD 4OR5B 2V22B 3TNHB 2WFYB 4II5B 3TNIB 1H1QB 1E9HB 2C5OB 4BCFB 4BCMB 5HBEB 3MY1B 5CEIB 4CRLB 2W99A 3G33B 1G3NC 4EOIB 1QMZB 4TTHA 1GH6B 4ELLA 4F6UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B9R A;  3EOC B;  3H4C A;  1H1R B;  2C4G B;  4F6S B;  4EOK B;  5EFQ B;  4UN0 A;  1N4M A;  5CYI B;  4CFU D;  3MIA B;  1FIN B;  1JOW A;  3BHT B;  3TNW B;  2I53 A;  2W9Z A;  3M03 A;  4YOS A;  5LQF B;  1ZP2 A;  1O9K A;  4ROC A;  1VIN A;  1D3U B;  2F2C A;  4BCG B;  2WEV B;  2PK2 A;  4ROE A;  1UNG D;  4CFU B;  4BCJ B;  2I40 B;  1FVV B;  1H26 B;  2W9F A;  5IDN B;  3POM A;  5HQ0 B;  5HBJ B;  3EID B;  4EOL B;  2W2H A;  4EOP B;  1GUX B;  1H1P B;  3QHR B;  4F6W B;  2UZE B;  1JST B;  2QDJ A;  4KRC B;  4OGR B;  4EOJ B;  5L2W B;  4EOM B;  2IVX A;  4F70 B;  3BLH B;  1OI9 B;  4YC3 B;  2WIH B;  3RGF B;  4BCK B;  3BHU B;  4CXA B;  1W98 B;  1OIU B;  1XO2 A;  4BCQ D;  4BCH B;  2X1N B;  2WHB B;  2WXV B;  1PKD B;  3BLR B;  3QHW B;  4EC9 B;  1AD6 A;  1H1S B;  4YOZ A;  4IMY B;  4ROD A;  2C5X B;  2CCH B;  4BCN D;  1H4L D;  1VYW B;  3MI9 B;  5HBH B;  4EOS B;  2EUF A;  2JGZ B;  2WMA B;  1GY3 B;  2PMI B;  4EOQ B;  4BCI B;  5BNJ B;  2C6T B;  2UZB B;  4CFX B;  1C9B A;  1OKV B;  2CCI B;  4CFM B;  4KRD B;  4BCO B;  4BCP B;  1OL1 B;  1OKW B;  1URC B;  4G6L B;  4Y72 B;  3TN8 B;  4BCN B;  4EC8 B;  5I5Z B;  3MY5 B;  1H27 B;  1VOL A;  5LMK B;  2G9X B;  1OGU B;  2WPA B;  3BLQ B;  2PK9 B;  1F5Q B;  4FX3 B;  2BKZ B;  2PHG A;  4F7J B;  2UZL B;  3BHV B;  1JKW A;  5HNB B;  5HVY B;  2IW9 B;  3LQ5 B;  1JSU B;  5ICP B;  1AIS B;  4F7N B;  1UNL D;  1H28 B;  2CJM B;  2BPM B;  2WMB B;  1UNH D;  1OL2 B;  1GUX A;  2IW6 B;  4F7S B;  2WIP B;  4YOO A;  4NST B;  1H25 B;  5IDP B;  1O9K B;  2R7G A;  4EOO B;  4F7L B;  4ELJ A;  4BCQ B;  2C5N B;  3DOG B;  2C5V B;  3DDQ B;  3EJ1 B;  1OIY B;  4I3Z B;  4CFV B;  4EON B;  4CFN B;  1KXU A;  3DDP B;  4BCM D;  4CFW B;  3K7A M;  2UZD B;  4EOR B;  2UUE B;  2W96 A;  1BU2 A;  1H24 B;  1P5E B;  5FGK B;  5ACB A;  2IW8 B;  5IF1 B;  1TFB A;  3F5X B;  3O0G D;  4OR5 B;  2V22 B;  3TNH B;  2WFY B;  4II5 B;  3TNI B;  1H1Q B;  1E9H B;  2C5O B;  4BCF B;  4BCM B;  5HBE B;  3MY1 B;  5CEI B;  4CRL B;  2W99 A;  3G33 B;  1G3N C;  4EOI B;  1QMZ B;  4TTH A;  1GH6 B;  4ELL A;  4F6U B; 
#chains in the Genus database with same CATH topology
 1QLB A;  3EOC B;  2BS2 A;  3BG9 A;  3PO3 S;  4MFE A;  2CZ7 B;  1N4M A;  4CFU D;  3X24 B;  2DXB B;  1ZP2 A;  4ROC A;  1D3U B;  2F2C A;  4OB2 B;  1FVV B;  4M6V A;  3DL1 A;  3POM A;  2W2H A;  4AKH A;  3QHR B;  4Z6Y A;  2UZE B;  3DTO A;  4KRC B;  4EOJ B;  3BLH B;  1OI9 B;  3QZ5 B;  4YC3 B;  3BHU B;  3X26 B;  3TW6 A;  1OIU B;  2BS3 A;  4BCQ D;  3BLR B;  4NC6 A;  3GTM S;  4IMY B;  3B57 A;  2CCH B;  5DQW A;  4EOS B;  1H4L D;  5HBH B;  4BBS M;  2DXC B;  1OL1 B;  1OKW B;  1URC B;  4BCN B;  2ZPH B;  3BLQ B;  4F7J B;  2UZL B;  5ICP B;  2WJ9 A;  3HHT B;  4BY1 X;  2LW4 A;  4NST B;  1H25 B;  5IDP B;  4MIM A;  3EJ1 B;  4I3Z B;  3X20 B;  4CFV B;  3BG5 A;  4CFN B;  3DDP B;  4BCM D;  3QYG B;  4CFW B;  2QF7 A;  1H24 B;  3QYB A;  3A8M B;  2IW8 B;  3F5X B;  3TNH B;  2WFY B;  4BCF B;  3MY1 B;  3G33 B;  2ZCF B;  1G3N C;  2CYZ B;  1GH6 B;  4F6U B;  2B9R A;  3H4C A;  1H1R B;  1JOW A;  2CZ0 B;  3M03 A;  4YOS A;  2ZPI B;  3QXE B;  1FKM A;  1UNG D;  3HBL A;  4BCJ B;  4JX4 A;  3QWL A;  1AHJ B;  4EOL B;  1GUX B;  4OB3 B;  5L2W B;  2QDJ A;  4OGR B;  2IVX A;  4BCK B;  4ZGD B;  2WIH B;  3VKH A;  4CXA B;  3QZ9 B;  1UGQ B;  1XO2 A;  2WXV B;  3QHW B;  1AD6 A;  1H1S B;  2ZPB B;  1VYW B;  2DD4 B;  2EUF A;  2JGZ B;  2WMA B;  1GY3 B;  2ZPG B;  4EOQ B;  5BNJ B;  1C9B A;  2IN3 A;  4KRD B;  3QYE A;  1H27 B;  2WPA B;  2PK9 B;  4FX3 B;  2BKZ B;  3BHV B;  5HVY B;  3VYH B;  1JSU B;  1AIS B;  4F7N B;  2WMB B;  1UNH D;  1OL2 B;  1GUX A;  4YOO A;  1O9K B;  2R7G A;  4EOO B;  4ELJ A;  2KR6 A;  2PJQ A;  2C5N B;  3DOG B;  2ZPF B;  4EON B;  3K7A M;  4EOR B;  5FGK B;  1TFB A;  3WVD B;  4OR5 B;  3KHI A;  2QQ8 A;  4EOI B;  4HL4 A;  1QMZ B;  4ZGE B;  2CZ1 B;  1UGS B;  2C4G B;  2DME A;  4EOK B;  5EFQ B;  4UN0 A;  2G77 A;  1FIN B;  2BS4 A;  2I53 A;  3BG3 A;  1O9K A;  1VIN A;  4ROE A;  2PK2 A;  4CFU B;  2W9F A;  2AHJ B;  5IDN B;  4OB0 B;  5HQ0 B;  5HBJ B;  3WVE B;  1H1P B;  3DJB A;  1JST B;  4EOM B;  3A8O B;  4F70 B;  2D0Q B;  3NDQ A;  4FM4 B;  1W98 B;  3TW7 A;  4BCH B;  3A8G B;  4YOZ A;  4ROD A;  2C5X B;  4BCN D;  3MI9 B;  4BCI B;  4CFX B;  1OKV B;  2CCI B;  4HNV A;  4BCO B;  4BCP B;  3VYG B;  4G6L B;  3TN8 B;  5I5Z B;  3MY5 B;  3A8L B;  2G9X B;  1OGU B;  3X28 B;  2PHG A;  2QFZ A;  1JKW A;  5EJC A;  1IRE B;  1H28 B;  2BPM B;  2CJM B;  4MFD A;  4JX5 A;  2WIP B;  1E7P A;  2KMG A;  4F7L B;  4BY7 X;  2UZD B;  2UUE B;  5IF1 B;  2DPP B;  4II5 B;  3TNI B;  1H1Q B;  2C5O B;  4BCM B;  4ZGJ B;  4BBR M;  4HNT A;  5CEI B;  4CRL B;  2W99 A;  4AKG A;  1UGR B;  4ELL A;  5IHY A;  4F6S B;  1UGP B;  5CYI B;  2ZZD B;  3MIA B;  3BHT B;  3TNW B;  2W9Z A;  5LQF B;  4BCG B;  2WEV B;  1V29 B;  2I40 B;  2ZPE B;  3X25 B;  4AKI A;  1H26 B;  4HLQ A;  3EID B;  4EOP B;  4F6W B;  3HB9 A;  1TD6 A;  3RGF B;  3HZJ A;  2X1N B;  2WHB B;  1PKD B;  4EC9 B;  2DD5 B;  4JX6 A;  4QSH A;  3HO8 A;  2PMI B;  1ENW A;  2C6T B;  2UZB B;  4CFM B;  3QYH B;  4Y72 B;  4EC8 B;  1VOL A;  5LMK B;  4HNU A;  1F5Q B;  2CZ6 B;  5HNB B;  4BXX X;  2IW9 B;  3LQ5 B;  1UNL D;  2IW6 B;  4F7S B;  4LOC A;  4BCQ B;  4OB1 B;  2C5V B;  3DDQ B;  1OIY B;  1KXU A;  2W96 A;  1BU2 A;  4AI6 A;  1P5E B;  5ACB A;  3O0G D;  2V22 B;  2QDY B;  1E9H B;  5HBE B;  5DQV A;  2QGS A;  3VKG A;  4TTH A;  3A8H B; 
#chains in the Genus database with same CATH homology
 2B9R A;  3EOC B;  3H4C A;  1H1R B;  2C4G B;  4F6S B;  4EOK B;  5EFQ B;  4UN0 A;  1N4M A;  5CYI B;  4CFU D;  3MIA B;  1FIN B;  1JOW A;  3BHT B;  3TNW B;  2I53 A;  2W9Z A;  3M03 A;  4YOS A;  5LQF B;  1ZP2 A;  1O9K A;  4ROC A;  1VIN A;  1D3U B;  2F2C A;  4BCG B;  2WEV B;  2PK2 A;  4ROE A;  1UNG D;  4CFU B;  4BCJ B;  2I40 B;  1FVV B;  1H26 B;  2W9F A;  5IDN B;  3POM A;  5HQ0 B;  5HBJ B;  3EID B;  4EOL B;  2W2H A;  4EOP B;  1GUX B;  1H1P B;  3QHR B;  4F6W B;  2UZE B;  1JST B;  2QDJ A;  4KRC B;  4OGR B;  4EOJ B;  5L2W B;  4EOM B;  2IVX A;  4F70 B;  3BLH B;  1OI9 B;  4YC3 B;  2WIH B;  3RGF B;  4BCK B;  3BHU B;  4CXA B;  1W98 B;  1OIU B;  1XO2 A;  4BCQ D;  4BCH B;  2X1N B;  2WHB B;  2WXV B;  1PKD B;  3BLR B;  3QHW B;  4EC9 B;  1AD6 A;  1H1S B;  4YOZ A;  4IMY B;  4ROD A;  2C5X B;  2CCH B;  4BCN D;  1H4L D;  1VYW B;  3MI9 B;  5HBH B;  4EOS B;  2EUF A;  2JGZ B;  2WMA B;  1GY3 B;  2PMI B;  4EOQ B;  4BCI B;  5BNJ B;  2C6T B;  2UZB B;  4CFX B;  1C9B A;  1OKV B;  2CCI B;  4CFM B;  4KRD B;  4BCO B;  4BCP B;  1OL1 B;  1OKW B;  1URC B;  4G6L B;  4Y72 B;  3TN8 B;  4BCN B;  4EC8 B;  5I5Z B;  3MY5 B;  1H27 B;  1VOL A;  5LMK B;  2G9X B;  1OGU B;  2WPA B;  3BLQ B;  2PK9 B;  1F5Q B;  4FX3 B;  2BKZ B;  2PHG A;  4F7J B;  2UZL B;  3BHV B;  1JKW A;  5HNB B;  5HVY B;  2IW9 B;  3LQ5 B;  1JSU B;  5ICP B;  1AIS B;  4F7N B;  1UNL D;  1H28 B;  2CJM B;  2BPM B;  2WMB B;  1UNH D;  1OL2 B;  1GUX A;  2IW6 B;  4F7S B;  2WIP B;  4YOO A;  4NST B;  1H25 B;  5IDP B;  1O9K B;  2R7G A;  4EOO B;  4F7L B;  4ELJ A;  4BCQ B;  2C5N B;  3DOG B;  2C5V B;  3DDQ B;  3EJ1 B;  1OIY B;  4I3Z B;  4CFV B;  4EON B;  4CFN B;  1KXU A;  3DDP B;  4BCM D;  4CFW B;  3K7A M;  2UZD B;  4EOR B;  2UUE B;  2W96 A;  1BU2 A;  1H24 B;  1P5E B;  5FGK B;  5ACB A;  2IW8 B;  5IF1 B;  1TFB A;  3F5X B;  3O0G D;  4OR5 B;  2V22 B;  3TNH B;  2WFY B;  4II5 B;  3TNI B;  1H1Q B;  1E9H B;  2C5O B;  4BCF B;  4BCM B;  5HBE B;  3MY1 B;  5CEI B;  4CRL B;  2W99 A;  3G33 B;  1G3N C;  4EOI B;  1QMZ B;  4TTH A;  1GH6 B;  4ELL A;  4F6U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...