3RGIA

Trans-acting transferase from disorazole synthase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
282
structure length
282
Chain Sequence
MKAYMFPGQGSQAKGMGRALFDAFPALTARADGVLGYSIRALCQDDPDQRLSQTQFTQPALYVVNALSYLKRREEEAPPDFLAGHSLGEFSALFAAGVFDFETGLALVKKRGELMGDARGGGMAAVIGLDEERVRELLDQNGATAVDIANLNSPSQVVISGAKDEIARLQVPFEAAGAKKYTVLRVSAAFHSRFMRPAMVEFGRFLEGYDFAPPKIPVISNVTARPCKADGIRAALSEQIASPVRWCESIRYLMGRGVEEFVECGHGIVLTGLYAQIRRDAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Mechanism of the trans-Acting Acyltransferase from the Disorazole Synthase.
pubmed doi rcsb
source organism Sorangium cellulosum
molecule tags Transferase
molecule keywords DisD protein
total genus 99
structure length 282
sequence length 282
ec nomenclature ec 2.3.1.39: [Acyl-carrier-protein] S-malonyltransferase.
pdb deposition date 2011-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3rgiA02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 3rgiA01
2G2ZA 3SBMA 5DZ6A 1MLAA 2C2NA 3TZZA 2G2YA 2QO3A 2UV8G 2VKZG 3HJVA 2VZ8A 2H1YA 3CJ8A 3TZXA 2HG4A 3TQEA 3IM9A 2CUYA 4RL1A 2G2OA 5DZ7A 5CZCA 3R97A 4RR5A 3TZYA 3G87A 3HHDA 1NM2A 2JFKA 3TZWA 3PTWA 2JFDA 2G1HA 3QATA 5CZDA 4QBUA 3IM8A 3HMJG 3BV8A 3H0PA 3RGIA 2VZ9A 3K89A 3R8YA 2QJ3A 2QC3A 2PFFB 3EZOA
chains in the Genus database with same CATH superfamily
2F5GA 2HNZB 1TV6B 5KFVA 4DL3A 3FVYA 2QZ8A 1Q4RA 2C2NA 2E5JA 4ZHRB 2RE1A 2VG6B 4NMXA 1NK5A 2BANB 2ZBQA 4CO2A 4DV6J 2B4OA 3HP6A 2Y8WA 4Q0BA 1TAUA 5HO4A 3KJVA 1S5ZA 2V94A 4ZVTB 1H0HB 5EX3A 4H4KA 4DMZA 4DF8A 3BGRB 1SL2A 1M1KT 1HNWJ 4OYAA 4LFAF 1BMQB 1WDTA 4V19J 2NUHA 3QBCA 1CS4A 3D5MA 4USTA 2GIRA 2HBRB 1Y0HA 3W9JA 4C0HA 2ZH8A 2YKPA 2HW3A 3KJQB 5A2QY 1IBCB 1KOOA 1YKWA 3CIMA 3LP2B 5CD4A 2MGZA 4PWDA 3TAMA 5KFEA 2ZH7A 1U1QA 4U8YA 4PR6A 2EFOA 1LWFA 1S1XA 3MEKA 5KG0A 2XS2A 5KFCA 4X65J 1NH8A 3HI9A 1F5CA 3S6EA 2BZ2A 4CLFA 1EETA 2ZH6A 1AUDA 3J80U 1HNZJ 1HW9A 1RT5A 4Z2XA 1BQMA 3OBIA 3GFHA 4DV4F 2B8QA 2E9RX 3MM9A 1RT3A 1UEVA 2QO3A 4NYOA 1LOUA 1FERA 1U0HA 3LGNA 3M30A 1FX2A 3OSNA 4PKDB 1X0FA 3QYYA 1Y10A 1UEKA 1X8DA 3K8WA 3NGTA 3HHLB 2B4UA 1VQNS 1FD8A 3IS9A 3R5DA 1ZM4A 3NRBA 5DG7A 3CD0A 4DHVA 2W9BA 3Q23A 3PRBA 3ZTQA 3G71S 2YVSA 1NDLA 2CQ3A 3K5PA 3QPIA 2HVEA 4M8LA 4I56A 2W2MP 5KFAA 1U47A 2FHMA 2Z2MA 3W3SA 1M5SA 2ZD1B 2AF6A 4NLSA 1RTHB 4IDKA 4U7UK 3ZC4A 5ETTA 4K0KF 2W2QP 1F1BB 4IO1A 2CDQA 5B0GA 2RVJA 3CCVS 4B3RF 1T9TA 2KKHA 4OZ5A 3C6TA 1OWXA 4LFAJ 3W9IA 2AQ4A 4M5DA 1SPBP 3CCTA 2CZ4A 4R8UB 4CLSA 4JI2J 4IQMA 2RDDA 5GVQA 1R0AA 2HNYB 1YSJA 3MCNA 2H1YA 2BE9B 3UR3C 1FKOA 3I5BA 4LBHA 4AT1B 5A8KA 5E3AA 4RL1A 3TRGA 5BYQA 1VISA 2COLA 2MKSA 2D41A 5HANA 4UOHA 5F8LA 4EEYA 1RHUB 4LJMA 2HFUA 4RZRA 4J9NA 3RTVA 2CQ2A 1FJEB 3AFGA 2CPZA 2MKIA 2UXDJ 3B6BA 1UL3A 1NM2A 4ID5A 4PG6A 4DV4J 3E01B 5HJXA 1XC9A 2HMIB 3OVBA 4OV1A 1IM4A 4HH0A 5E3PA 4LRDA 1S0OA 4QQBA 3F0NA 3N01A 3M8PA 2UV8A 4I7FB 1M90T 1IBMF 1AUSL 1FRKA 1OJ4A 4UTGA 4ZVFA 2QL9B 4FN5A 2GGPB 5AE2A 2LA6A 3M8SA 4WFZA 3KUGA 5LXRA 1FWKA 3NCPA 4FPIA 4IFYA 1J5OA 2BE2B 5DDRC 3DRSB 1FJCA 3SCKE 4WCEQ 3TZXA 2VG5A 1MWZA 2DNQA 3I0SB 2CQDA 4Y65A 1HNXF 1GH8A 1ZZNA 1MNEA 3HLUA 3T1YJ 1QSYA 1U09A 2UVVA 2C2ZB 3B4DA 3MECA 1T9VA 3OTDA 3VZIA 4D3HA 2DGSA 3CCES 3MAAB 2EFPA 2LP4A 5AXNA 2HS4A 3R5CA 4PCQA 1RQ0A 1CSJA 3IRWP 2XWYA 2V69A 3FCVA 4Y2IA 5SZTA 4ED1A 5C7PA 4C8MA 2XZWA 3FRYA 4C11B 1S1TB 2LXUA 2V63A 2BA9A 3UDCA 1D9FA 1IR2A 4W4MA 2C3OA 2OP5A 1UVJA 3GJTB 5A8RB 2R8JA 1REGX 1S1VA 3A12A 3TR5A 4V19X 3IR5B 5FLXY 2LCWA 4NZ7A 4WE1A 5AE3A 3BF4A 2HPUA 3IRXB 2A18A 3KJNB 3A13A 2ZNYA 2FHKA 2R9LA 3DGPB 4DX7A 3MPDA 3ILLA 1X9MA 4AL6A 5D77A 3U1MA 3E2EA 3DNCA 3BSCA 3GE9A 1LK7A 2GJ2A 3OJUA 1G3OA 2V68A 4NX9A 4ZP8A 2KT5A 1V5IB 4QIGA 4EK2A 4XPCA 3OL6A 1KQKA 2JFKA 3DU6A 1XTZA 4MYTA 4XDCA 1Q82T 3PIOQ 1R3NA 4DFPA 4Y2CA 3BV8A 1I51B 5IM0A 1YHQS 3OPKA 1PC4A 4JV0A 4X4QA 1PGZA 4TLRA 2IBKA 4A8XA 1LW0B 4HACA 3C19A 1O5JA 3AD8C 5FD1A 5HQLA 3V6DB 3D54A 3SBMA 1U45A 2QL7B 2ACMA 1Q7LB 1S57A 1VJQA 2F8HA 5KFMA 2KHDA 1TFWA 3RRGA 3C15B 2AJ2A 1QD1A 1T9XA 1U1KA 2DD8S 3M32A 1B99A 3DXBA 1W25A 2QT7A 4RNFA 4DV6F 1OIAA 3N6LA 3NP5A 4OYWA 4OYMA 3U27A 3RUBL 1MWYA 1UVKA 2YNIA 3P5BP 3CJRA 4IO9Q 1KVJA 1I5OB 2L08A 1PYTA 4I6AA 5A2QU 4HTJA 1RU1A 4RO0A 2ZBCA 5KFBA 4EBEA 3I6PA 3T5KA 4FF4A 4HKQA 3ZTOA 2JWNA 1K44A 2A6OA 1HWUA 1TR0A 4FKYA 4ED0A 2CQBA 1RKIA 1SXLA 2BJ3A 3IBWA 3NGUA 4E2FB 2XMTA 2YKMA 4IG3A 5C42B 4USHA 3J80Y 2V50A 1SC3B 4P6QA 2CNNB 2LECA 1GMVA 3WZ0A 4ECZA 1S4FA 1S6OA 4LSZB 2BQRA 2FVQA 1AFIA 3EMTA 2HWHA 1FXDA 1YJTA 1QSSA 3HT0A 2KT2A 4B17A 4DV7F 1YITS 3CO0P 4DUZF 2FVPA 4O3QA 2AGOA 4MMOA 2VUGA 2YQ0A 5I3PA 5BR8J 3KLFB 1VQMS 2FJXA 2W24A 2ZJPQ 2LDIA 1G2EA 4UQTA 2MTLA 5IT0A 2C28A 3NXZA 1ZA2B 4MFBB 3H4DA 2B9WA 2FHJA 1J5EF 1SL1A 1S9EB 1CJUA 1RWMB 1SIWB 4CLZA 1WELA 1UP1A 2KVQE 4KIAA 2N7YA 3EICA 1KVIA 4IRCA 4AQYJ 2PD1A 1S9EA 3FEZA 2E44A 4CH0S 1FKPA 1TL1A 3JSMA 4I0WA 2WONB 1N6QA 2UUBF 1RTDA 2ABYA 4FNHA 4I2QB 2B6AA 4F4XA 1NJWA 4DR3J 2FIUA 4EFAC 3DLHA 4NA1A 3MDFA 3TQ1A 1VQ5S 2JZ5A 2QL5B 3UNYA 1HHTP 1WEYA 2RSQA 3I56S 2W2OP 3VQTA 3TAQA 1U49A 4J9SA 2PMZD 2VZ8A 1XBWA 1VQPS 2IM0A 2WSEC 3NKYA 4TXSA 2C2EA 3OTOF 5HMYA 5JVGQ 2QA1A 4LREA 1M1GA 2O5DA 1GX5A 3T1YF 3Q2SC 3PNIA 4E98A 3CXCR 3BGRA 4RBUA 2VBZA 2WW8A 3KMQA 1VLYA 3OLAA 4PG8A 5J2PA 3KHHA 4FBUA 2AT1B 3ISNC 1GMUA 5KAKA 3GLJA 2MKYA 2L3MA 2NXJA 3SFGA 3T9ZA 4O44A 2GJFA 5GAGI 4YHHF 5KFFA 2MZSA 2DBBA 1R27B 3CWJA 3MMBB 4LF9J 4ZKAA 4ANCA 1REVB 5K8PA 2V4QA 2EK6A 3P96A 1XNQF 2IBOA 1TV6A 2DH9A 4L75A 3R3TA 3SXLA 5IFMA 1ZAXA 4C8YA 1EKSA 3V6DA 1NEEA 1IKXA 1KQSR 3UN3A 3QNWB 4H4OA 2XYPB 5KFWA 4WU2A 4OI2A 2VB6A 4F4KA 4BBYA 2SXLA 5KG7A 1LXJA 4FVMA 2LEAA 1VCTA 4H4OB 2N4DA 2RRBA 2VG7B 1M5OC 4P52A 1N56A 3N79A 2OAUA 3LP1A 1KTQA 4NI2A 2XI2A 1NZ8A 4ZS6A 3V6KA 2CJXB 1EJ7L 3MFHA 3KK1B 3GP9A 5EN1A 3KTQA 2VFVA 3M6VA 3CCQS 2BJ7A 5J2MA 3DN9A 4P73A 1SL0A 4CLPA 4F4ZA 4JI1F 1U1RA 3JTPA 5FLXU 3Q86A 4NLUA 5KFZA 4NXNF 4WKRA 3VAGA 2CQIA 2V4JB 1S4EA 2NYIA 4YY3J 2V4RA 4X4UA 2GZOA 4G1QA 1UVIA 2W9CA 4ECSA 2ROGA 1G4CA 4DN0A 1XQIA 4GKJJ 2RH3A 2HFNA 1GXTA 3KUEA 4IUFA 3KLVA 2PMHA 3MUVP 4YP3A 4PUOA 1U4BA 1WC5A 2H5IB 4LUBA 4ZP6A 2MZTA 1IN0A 2AEFA 2NYHA 3V4MA 2CQPA 2I2YA 1ICEB 2BRKA 3H98A 1EAYC 2DY1A 4RW6A 3LA0A 4ZVOB 4DV2F 2I8EA 2DISA 3OFEA 2UXCF 3D67A 2CPJA 4G6VB 1DY3A 4CP5A 2E9TA 4KTQA 4QIVA 3IO1A 4AXJA 4OHXA 5I42B 2FVCA 2QJ3A 3ENVA 1RT6A 5IV4A 1T9WA 4O4GA 3OUYA 1TU0B 5KFLA 4MIBA 4OX6A 2O3DA 1RTDB 2V2VA 4XAKA 4K4TA 2K1RB 1C1CB 3BEGB 1M5KC 5D0RA 1RTIA 1U8WA 3ZO7A 5F3TA 3PX6A 1MN7A 4NCAA 2DNNA 1SKUB 7FD1A 2BE7D 3T19A 2AKWB 3Q22A 2Y1JA 4NPOA 3PW2A 4ZCLA 2F9DA 3M6WA 3OFHA 4EWTA 1U2CA 4J9LA 4WU3A 4DEZA 2DR7A 1WOPA 2P9CA 4UQGA 2AZ3A 2JFDA 5CZDA 4J9RA 4TLQA 2BJDA 1X4FA 5C5JA 3V81B 2XCAA 2UVUA 2M4MA 4ZPDA 5KFXA 4BLGA 1U1NA 2E29A 3AD9C 4CH1A 2GAHC 4PQUA 1HQ2A 5L9XA 1OSDA 1H98A 1ZA1B 1RDRA 2AJQA 3H42A 3BO4A 2A2CA 2BDPA 5HQ8A 2J9CA 3G82B 4FF2A 1VRTB 1NU4A 1IQTA 1J5EJ 2A6MA 3MM6B 4LVNP 3TA1A 3MMBA 4J91A 2WRMA 3W65A 4MTPA 1PCAA 1FEEA 4QU7A 4O0IA 1IKWA 1RT1B 1NHVA 3FBFA 3P45B 3GFZA 4UW2A 3DI6B 4HT7A 3OTOJ 2XNQA 5L1IA 4MH8A 3CMAS 2BABA 3OFFA 3QLHB 5CA5A 1SQGA 5L46A 1C1BA 4PRFA 1RT6B 4YDXA 3NGSA 4CO1A 5HVHA 2AX0A 1BE4A 4CO5A 1RAFB 2HQGA 2ZEJA 3UDLA 2XSJA 1A0OB 4ILRA 1TK0A 4B3OA 1WF2A 2XLJA 2F4FA 4JI6F 4C98A 1QTMA 3D68A 3KOAA 3V6JA 1TKXA 2J9DA 2EBEA 2KO1A 2X7IA 4LMZA 5LL6d 4AMNA 3TX0A 3DRXA 2QX0A 3T1AA 2R8HA 2V9KA 5C42A 3KG1A 1R8BA 3I5CA 4LSLB 2F4VJ 4B3SJ 4I4BA 3FQKA 1BQMB 2EWHA 2Z0GA 1N5TA 3CJTA 2EKNA 3DYAB 4FZVA 2R8GA 3C2PA 4N5SA 3VGSA 4Q2LA 2XMKA 2KYXA 4ZVQB 4B08A 4KJIA 5GAHI 1FCAA 1HPZA 2M9KA 3FDSA 4L74A 4OYIA 5KG2A 5KT3A 2KJVA 2AW0A 3AQPA 1X0PA 3D7SB 3PTWA 3UQSA 3W2WA 2XO7A 3NNCA 1CS4B 3HFZB 3GJQB 1TMJA 3POTA 4NLWA 3GB0A 5FDLB 1JMTA 4LF5F 3G82A 2YX7A 4UOFA 1U6BA 1N52B 4DXLA 2PFFB 2LXFA 1ZH5A 1PSDA 1YJUA 2JLEA 1T7PA 4XTTA 3CC4S 4URSA 5I42A 1HHSA 1TAQA 4QWBA 1S10A 4DR6F 2V8GA 1O0PA 4WTYA 4M95A 2DXDA 3MOZA 3RB6A 3JYTB 4DQQA 1BGXT 1U25A 4NLQA 4PEOA 5HK4A 4TU7A 1VFJA 1JLQB 4BWMA 4B3RJ 3W60A 3ZTRA 2DNPA 1U7LA 4ZCKA 4ELUA 1RHKB 2PIIA 4ZN1A 1P27B 1UWBA 2DHAA 2CQCA 2X1BA 2XC9A 2MKJA 3TOQA 1KNZA 1B70B 5B0CA 4DL4A 1HBUB 1MU2B 4L6V3 5CAAA 5D0EA 3BREA 1SKRA 3BGLA 4K2JA 3VQSA 2C2RA 2YKAA 1JLGB 3UCGA 1Y7PA 2EXUA 4B9UA 2CZ9A 1HIYA 1WACA 2XZTB 1F5AA 4CLLA 4CTAB 1JWWA 4DR4J 5T14A 2QFJA 4YN3B 2CPHA 4EYIB 1OYEA 2VFRA 4CQ1A 4ED3A 4Q0BB 1Q8BA 3A4TA 4OFZA 4DR7J 2WVEA 2NSBA 3VGTA 4DQPA 1TUWA 3SCLE 3DLBA 2DH7A 1TELA 4FBTA 1EP4B 3HFVA 1T94A 3MUMP 1FRLA 1S7HA 1KP6A 1IJEB 2QG9B 1VBXA 1HWLA 3CTRA 3HO1A 1S49A 2VG5B 5DQHA 3CDEA 4IYQA 3MPWA 2GCFA 3E3XA 2B9YA 4U7CA 3R9LA 4BS2A 1IKXB 3BGOP 2YWFA 4WFYA 2XCPA 1KLMB 4FF1A 2BXJA 2HQ3A 2E66A 4OYOA 4OYPA 3WC0A 3CJ5A 3GR0A 3WX8A 2R7SA 4OJHA 2OPQA 4FYYB 4RW4B 1VC6A 4KO0A 2M8DB 1K0VA 2DIUA 2I1RA 5CH7B 2XMVA 2CXEA 3CD6S 3EGWB 4IOAQ 2G2ZA 2HQCA 1S1WB 1T05B 5ETSA 3I32A 4OLOA 2UVRA 3QRPA 3PHTA 2CG8A 4DJBA 2M0GB 5AE1A 5E41A 3VF0B 4O3OA 3M8RA 1FRMA 2DNLA 3BN7A 1YWXA 3I31A 1BWEA 5F0WA 3GSIA 1RGVA 2E1CA 1R8PA 2HFOA 3RB4A 1H2TZ 1WDDA 1K9MT 5DJBA 3D6HB 2E9ZA 2EC0A 4RWXA 3LPEA 1C4CA 3KWMA 3QSIA 4KBIA 1DHMA 2CQGA 2PFDA 3KK3B 3DDKA 3HVAA 4QPTA 4FP9A 1PAUB 1RBLA 2YNGB 4RW8A 2VJUA 1RSCA 2B9EA 2QC3A 3MM7B 4JI2F 2RQMA 1XJWB 4MK8A 3CJ2A 1FFSB 4EBCA 2JEFA 4B3MJ 2RD5C 4Y34A 1NUEA 1OQ6A 1HMVB 2OMLA 3KUHA 4FYVB 1UFLA 1UJ4A 1VDHA 3QQCD 4F67A 2VBWA 4DV3F 3S01A 3V6HA 3R1LA 3PRDA 1H2UX 2F65A 3KLHB 2XY5A 3QLHA 1VQSA 1AZSB 2LXIA 4ZLNA 1F2HA 5IV3A 1AROP 3GYGA 4PG5A 2VQFF 4RUHA 1NJZA 4J90A 2XQCA 2UXDF 2XS5A 4X62F 3A3OB 3I4PA 1AZSA 4U7UD 1VRQC 3M30B 3QT5A 3MUTP 1WSVA 3HHLA 1XEZA 3QGPA 3KLFA 4X4PA 2J0XA 4DSJA 3TZWA 1RHRB 3OXLA 2ASLA 1JLFA 1Y5IB 2DCUB 4WK1A 3FBBA 4DPTA 5ITHA 3PHEA 2F4VF 5U47A 2PMWA 4MKAA 3T1HF 1HD0A 1HQUB 2O1PA 4MK7A 3PW7A 2POKA 2CJQA 4JYAJ 5JVHQ 5F9NA 2UUAJ 1BQNB 3DLKB 1PBAA 4MKYA 3R7NB 4I2QA 4FXDA 1AB8A 2V8HA 3CEDA 2CADA 1TUVA 4QOTA 4RU9A 3TI0A 4K4ZA 1SBRA 2DRBA 4RLEA 1JNZB 2CVIA 3BR9A 1F0XA 1FRJA 1U8SA 2GQ2A 3PW0A 3V4IA 2K1RA 3KHRA 4LF5J 5AJ3J 4RR5A 3HCXA 2WVFA 4DV7J 3JS9A 3PEJA 1FX4A 2B5JB 2A10A 4NA3A 1Y5NB 1FESA 4GMKA 2OH2A 3VAJA 2G13A 2BW2A 2E1PA 1DLOB 1MROA 3TNVA 4PQAA 1VI7A 1FK9B 2VZ9A 2E5IA 1GQEA 1CULA 5MLCV 5J2NA 4DQRA 1FJGF 4C3MA 1F3FA 2XO6A 2CIMA 1QE1A 2DT9A 2H51B 5EGYA 1YJRA 2HVIA 2G0CA 4CLUA 3KLEB 1SC4B 4EMDA 1B3TA 4QW9A 4TYBA 1G7CB 4JUZA 3TUZC 1GFWB 1VHFA 3AAWB 2IJFA 1IR0A 1H72C 2LQ5A 3AODA 3DHWC 3O8WA 3HKWA 2YWEA 4LRAA 4IFYB 4NL5A 4PYAA 5B0EA 5B7WA 1VGYA 3CDUA 3GV7B 1NJYA 5CZCA 5DQGA 4JI7F 2XNRA 5DRKA 2ZOGA 2GVZB 3F41A 2DEIA 1HQEA 3NWRA 3K5NA 3BBBA 3VWSA 1X7VA 2QTWA 3EM1A 5JJBA 1NAQA 2HHWA 3RBZA 5KT2A 3B54A 3NNHA 4B9MA 4G1IA 1QUVA 4AL5A 4EO8A 5K5MA 2BRLA 3K0JA 2C3MA 1E6VA 2FY1A 3LP1B 4RWWA 3CCMS 2FJAB 1NSQA 3T41A 4C11A 5GAGU 2ZM6J 2OGUA 5J2MB 3PJXA 3T5HA 2VA3A 3QWUA 3W61A 2G4BA 2VODA 2JOQA 3THVA 4ED4A 3B82A 5KFHA 1IUJA 2B9XA 3DOMA 1KHVA 4NOHA 1RP5A 5J1PA 2F1FA 3MPVA 2XGQA 1JLQA 3UD5A 3M9MB 3GV8B 2DGTA 5CZVA 5SUHA 4TQRA 4MYUA 2WOMA 1WOOA 4GVLA 4UF4A 4R5PB 1QVFR 2C42A 3MM5A 1XMBA 4KC5A 3KYLA 1OS5A 1X9WA 2F7VA 1TVRB 1EARA 3BYRA 2GGPA 3FGVA 3I4HX 3LO3A 3R8YA 2GMHA 5J2PB 2ZH3A 3QJPA 2DHSA 3AT1B 1NPPA 2RMLA 3MD1A 2FTRA 1F60B 2UV8G 3W7BA 4C8OA 2FZKB 3NAHA 2DH8A 3QAEA 4JBCA 4TY8B 5KFPA 3MM8A 1E6YB 5KFQA 4QWDA 1PC5A 2AHOB 4KR0B 3HSGA 4PAAA 1KLNA 1T0TV 1W7WA 5H9FK 4EO6A 1UETA 2H65B 3M2VA 1K0TA 3RAMA 1R8AA 3ILOA 4X4TA 3RJMB 5DO2A 3HKZD 4TNOA 2L48A 4GC7A 1PJ7A 1V3RA 2HZCA 2IDEA 3ZTSA 3GIKA 2P8IA 5GMEA 2HNDB 3DOKB 5C25A 4KRWA 3AHPA 1KFSA 2JEIA 4X65F 1ZBTA 3UCZP 3DLJA 4USKA 2MGZB 1NK8A 3Q0AA 1K8AT 3NY0A 2LEBA 5CABA 3EYZA 1M5HA 2LLZA 3D0HE 1CULB 1WC4A 3FEYB 5A0YA 1BC6A 3C16A 4Y6IA 1UAWA 4HHUA 4LF8F 3EZUA 3GONA 4M1KA 5F9LA 2V2QA 2ZC3A 1PO6A 4ERDA 1YBTA 3DRRB 2JVRA 5D8HB 1YJ9S 1I94F 2UU9F 3PG9A 2FC9A 1LV5A 3CGIA 1DTQA 4J9UE 2FLNA 1XERA 4WIQA 1W26A 1RWXB 1ULRA 1XR6A 4ID8A 4Y2MA 2EEYA 4OV6A 1X31C 3PYDA 4O4RA 2EKYA 1H6KX 4CLYA 4ANDA 3GSDA 2VC1A 3ETOA 1QM9A 4ZJQA 4DZ6A 4OI0A 3O5TB 3OUYB 1PYSB 2OIHA 2CDRB 3EGVA 2BANA 1X4AA 1YZ6A 1KLMA 1FXRA 1J27A 2Q6CA 2HLTA 3CIZA 3VGVA 3CJSA 3PVXA 2W8LA 2KI2A 2RU3A 7FDRA 2DB1A 3HVTB 4Z7CA 1U48A 1F2GA 3MI7X 3JTNA 4IH5A 5AXMA 3LW5C 1VHIA 1HL6A 3PDNA 2JH3A 2OELA 1UW9A 1VBYA 4AMOA 5E3CA 3SDEB 1QY7A 3BDPA 2FJDB 2DRDA 2NZCA 2FD2A 3EUNA 3JAMY 2M2BA 1IBLJ 1IKVA 2E7WA 1OY6A 2FLPA 1GEHA 4M5LA 1FE0A 4FYWB 4LF7J 2ZNZA 4B3TF 1NO8A 1D8ZA 3TWZA 4MKVA 5HLFA 2W1BA 2ZVIA 4YFUA 1CC8A 2OSQA 4AUKA 5L38A 4F4WA 3EVWA 2H54B 2P9EA 2BW7A 5E7OB 3RGIA 3IAM9 4ZP7A 3W5ZA 1MWQA 3DKDA 2C3UA 4DWIA 4YHHJ 2HIYA 3V81A 3G2XA 2FGCA 2OPQB 4EGLA 5HP1B 3IR7B 1JLEA 2F8EX 2AJFE 2KG0A 4WXOA 5M2PA 4TYAA 3RR7A 2HHXA 1RE1B 2MYFA 3K8VA 4H54A 3K7RA 3R6LB 4R25A 1XMQJ 3AOAA 1U1LA 1ZPVA 4TU8A 4LF6J 3AOBA 4DV2J 2V8VA 3UPFA 2OKQA 3HHLD 1QAYA 4DCJB 1DRZA 2G1DA 5H9FJ 3TJ8A 2NS1B 1KFDA 4I7FA 1L3UA 2IJRA 3QGIA 2ZHOA 4ZPTR 5CYQB 5DGAA 1T05A 5CCMA 1S6UA 2QLBB 5IWAJ 4LF4J 1RLCL 4RUCA 1HNWF 3LAMA 3S7RA 1JJ4A 3ZTPA 4PABA 1JLGA 1SIZA 2KFZA 5L1JA 2VD3A 3G6XA 2G2YA 2JC0A 2V67A 4WPAA 1UW4A 1Y5LB 2OUGA 3THTA 3I0SA 3ZZTA 4NE9C 2M3DA 2OEKA 3LUYA 4ZVSB 3MURP 2D9PA 4CO0A 4CZCA 2VOOA 5HMWA 2L9NA 1FNXH 2HHHJ 1U6FA 3MAAA 5DDPC 1LXNA 3JQKA 4FKXA 3NGKA 4DU7A 3EVOA 4A8SA 4PG7A 5FDLA 5IZHA 2DRAA 3L7PA 4M5HA 2GV1A 4KHRA 2AIRB 3TEGA 5LXYA 2B7CB 1UEUA 3AJDA 5HAOA 4NLVA 2UXCJ 4RW9A 1H7WA 1REVA 4QR2A 4TN2A 3SSSA 3F56A 4DCPB 5IS2A 2K3KA 4FYXB 2DXEA 5M2UA 3OTCA 5KT6A 4C8ZA 1QSLA 4WE1B 2RHSB 2FLOA 4QIWD 5L9NA 2CPIA 2RNEA 1FVQA 3OVSA 4CTAA 2ZHAA 5GMDA 1UWAA 1WI6A 3CD5A 5MAOA 4OI3A 4DS5A 2QMUB 1KD1T 3QT8A 4XPEA 2DTJA 4K2XA 3AH6A 3H4BA 3TAPA 1UA0A 2NCKL 2CAJA 2G9OA 3KNGA 3OD2A 1HNVA 4O23A 2MQLA 4OZ2A 3DLLQ 1HBMB 3GYXB 1GXUA 5T7LB 5GAEU 1WKJA 3FRZA 1FRXA 1UCNA 4LQ9A 2PI4A 1CPZA 1RWOB 2XSJB 1S12A 3QFWA 4XK8C 1NCLA 1HQUA 3JSYA 3W2VA 1S6QA 3M7VA 4UOCA 2CJBA 4YB5A 8AT1B 5F0UA 2L41A 3BZQA 2RDIA 5CQGA 4DV1J 3GIRA 4OX9F 1JXVA 1VK3A 3D6TB 3ZZYA 1TL5A 5RUBA 2I5JA 3HHKA 4E0DA 5E2QA 3OTBA 5I3QA 1PJ6A 3CJ4A 3NGDA 3VAMA 3CC7S 4F8RA 4DSKA 3IS9B 2KXHA 3EPIA 3V4IB 2UUAF 3FZ2A 1LFWA 4GKKJ 2GQCA 1CQNA 3HF5A 3HHLC 1EQ0A 3TEHB 2Q79A 2OTJS 3RG6A 2Y1RI 4ZA1A 2UUWA 4RUBA 2FJEB 1FKAF 3R5BA 2P9GA 4ID5B 5IC4B 5F8IA 1IKWB 2DGXA 2RRAA 4QPXA 3SI8A 5LJ5Y 3DI6A 2OPRA 4B3SF 1NPRA 4X66F 3CCWA 2MKKA 2PT0A 3KG4A 5ETPA 1JLCA 5ETNA 3OL7A 2M5YA 4F50A 2IVFB 1FDNA 1VK8A 2OPRB 4WP8A 1G1XA 2OO4A 2IYGA 1DARA 2WBRA 3MEDA 4JI6J 2HNYA 4CLTA 3OR1B 7AT1B 3P8BB 1M0SA 4WYLA 2R7WA 5DZ6A 3WX4A 1FNMA 2HS0A 1RA6A 2HNDA 2XZDB 3DOKA 4OX7A 1NSKL 5E3QA 1QJHA 3BKTA 2QLXA 1Q8IA 4D3GA 2YNIB 2CQHA 3RU0A 3W63A 2DJWA 4CWBA 2KFYA 1C0UA 3C6UA 3JAMU 4MFBA 2BACA 2FVRA 2E1AA 5I4MA 4RNOA 4ED7A 1FO1A 1XMQF 4DPXA 3CMES 3FKBA 3U02A 2Z8QA 4LF6F 1DQAA 1SV5A 2JDJA 1SI9A 1B64A 1FEHA 4P72A 4CM0A 1AYEA 3VZHA 3GIIA 1NK7A 2CNLB 2HGMA 2B43A 2VQFJ 1BLUA 3I0RA 1R31A 2ZKUA 4UZCA 4LQ3A 4P2MA 3GILA 1SJ3P 1FDBA 1AW0A 3BM7A 5AT1B 2E7VA 5HN0A 1A9NB 2XMAA 2R8KA 2MY8A 4F3MA 2W2PP 4WYWA 1N34J 2LKZA 3R27A 4I64A 4IQXA 2YWHA 3CDBA 4DR6J 2EFNA 2AYEA 2YNFA 4DV5F 3LP0A 1NBEB 3DOMB 3ELHA 4OIXA 4DSLA 1YRUA 2W9AA 4USIA 4QR0A 2DNGA 1FA0A 1LEOA 3V5RA 1YRTA 1VS3A 3DM2B 1HNIB 2ZOFA 3U1NA 2AMCB 2KJWA 3HM9A 4M94A 1P9YA 3E51A 2ADCA 3OQ2A 2CFXA 2GW8A 3RB0A 2OPPB 2Z2ZA 3TUIC 2HGLA 5DM6Q 2VQEF 2Z58B 1GTEA 5IOLA 4DCOB 4YUDA 1SJ1A 1EHWA 4M5GA 1UMJA 2OPPA 3I5AA 3DRPA 1NHUA 2J6UA 1UJ6A 1EX8A 1R89A 2V4JA 5B0DA 2DR5A 4ATNA 1WJ9A 3KK1A 4XO0A 3J7ZT 3O3LA 2RQ4A 9ATCB 1KQGB 1FNOA 1X60A 3SMZA 4KHPJ 2JLGA 4I2PB 1HPZB 3TUPA 3EDRB 1PIEA 3VAKA 4IFVB 4C8KA 5KFDA 2X3DA 2H9ZA 3A3PB 4NLYA 5HP1A 1TK8A 4R8UA 4N56A 1QVGR 3PW4A 2OEMA 4ELVA 4IH7A 4FDFA 1HLWA 2DHHA 4ZPAA 4Q43A 5CZXA 5C24A 2EPIA 4J9PA 1NK4A 3EE3A 5HSPA 1RZMA 3DXSX 2BQ3A 4HHJA 4O44B 1RAAB 1YX2A 4ZVRB 3ZZRA 5KFNA 4J7CA 5A8RA 2DNKA 3UN2A 3CE8A 4LRCA 2R7QA 1QE1B 3DU5A 1H7XA 4Q45A 1VQLS 3GZ7A 3EDQB 4YDDB 4K4YA 1PAEX 1X4EA 3FSYA 4UZBA 3AXKA 3R5GA 5E3RA 3PX0A 2BMBA 4F02A 2AJ1A 4USUA 1HWIA 2RF2A 1YVFA 2MQOA 1HR0J 2MHNA 1GTHA 4Y3CA 4OL8A 2A3JA 2VPYB 4C0OC 5K8MA 1DBDA 1TL7B 2EFVA 5LMUJ 3PIPQ 3RRHA 2XWXA 4J5OA 2VG7A 1JLEB 3TQEA 1YG0A 4CI0B 1HBUA 1MU2A 3THPA 3CCRS 2ALZA 1VQ6S 2CWKA 3X1LB 3GQCA 2RAQA 4C7QA 2J7UA 1ZOTA 4MKBA 2WONA 2W4CA 2YKMB 3MMAA 3B4MA 4IG3B 2GJIA 5BR8F 1N6QB 4CH7A 2E5HA 3OHBA 3CDWA 3C6TB 1RHQB 2ZJQQ 1BQNA 2ASYA 3DLKA 3KK3A 2W4PA 3K89A 3MR7A 5HLFB 2AX1A 2J9EA 1MG7A 2JEJA 2Y3YA 1Q53A 2U2FA 4RJVA 1X4HA 5K8NA 2QMXA 1X4DA 2LU2A 2UUCF 5BYSA 1JLAB 1MLAA 3TVKA 4P2FA 4W92B 3IWNC 3JSMB 3E8OA 1RT1A 1YJNS 1T03A 4OHWA 2LA4A 5KTQA 1CJUB 2PGCA 2MLYA 3QAUA 1S6PA 3H5YA 1MSWD 5B0FA 3OL8A 2H5EA 3T6BA 4DV0J 1WHYA 1YJVA 2KU7A 3N0VA 4PWWA 1C0TA 4JI3F 4JYAF 1XWLA 4WFNQ 3AB2B 4CO3A 2GO8A 2PN6A 1IKYA 2RB7A 3P5TL 1FTCA 4KPYA 1C0TB 2DNOA 1TL3A 1URRA 3MGJA 4WP3A 4RPFA 5D78A 3S8SA 4J9QA 2MQMA 3CCSS 3DHXA 5KFSA 3MR3A 4X2BA 1X5SA 4LBPA 1TL7A 2VDIA 2LQBA 2YKOA 3FMWA 3GTYX 2IM1A 4KSEB 4QW8A 3W2VB 2VC0A 3NEKA 3FSIA 4K4WA 3OR2B 3H25A 2IM3A 3GJSB 3R5AA 2CNOB 1GXLA 1Q79A 2ZHBA 2HBZB 2FY8A 2HHUA 1HA1A 4UUXA 5F8HA 5ETVA 2Z57B 4LR7A 2MZJA 1BHNA 5E33A 3PX4A 1GMWD 4B9TA 2DNZA 2Q66A 3TUJC 3DMJB 5D4PA 1YTYA 1Y3JA 4EI2A 4WP9A 4N76A 4ICLA 3K59A 1UA1A 4JI1J 2IJNA 5C25B 4C2MA 1AXQA 3PM9A 4PXEA 2QV6A 4CYUB 2FDNA 2MJUA 2XMUA 2HWTA 1RUSA 3FBCA 4KH1B 4DV5J 1SJQA 2CVEA 3DCAA 2CKWA 2MZ1A 3KLGA 1PYOB 1SQEA 1FJGJ 5D3GA 2M52A 4F25A 4DDFA 1LWFB 2JNJA 2R42A 1FWPA 4ECUA 1WC6A 2FZCB 1WTBA 3VTIA 3DC2A 2KZZA 2J9DE 3KLIB 2LU1A 2CRLA 4DX5A 2D3ZA 4U95A 2VU5A 3M2RB 2KH9A 4DSFA 1S72S 1R43A 1UZDA 2WB1D 1JQGA 3L95X 3QGGA 3VAFA 3CCLS 3SIPB 4M5NA 1C1CA 1FDDA 1LWEB 1NNDA 4NYZA 4BC7A 3HVRA 2PSZA 4O0NA 1JJCB 1RT7B 5GADI 3NL0A 4K4VA 4DPYA 3HSDA 3TJ9A 1TVRA 4CRJA 4NEYA 3R5JB 4ECYA 1DZ5A 1M1HA 1UPPA 5EDWA 1FF2A 2ZWPA 2I9SA 2XYHB 4GO7X 4ECQA 4M63A 2R4FA 3IP0A 2MMYA 2OTLS 1YI2S 2R7RA 2MKHA 1UZHA 1XR7A 2A1BA 2AWZA 1HQEB 2DGOA 4GRSA 2KN4A 1Q5YA 4IFVA 2NQPA 1PJ5A 3NBPA 5D4OA 3JYTA 1Q8LA 5H9EK 1JKHB 1Y11A 2ZM6F 3BO2A 5K9FA 5DLFA 1Q78A 2PC6A 4HI1A 4O3PA 5A8KB 4ECRA 4PUOB 4LF7F 4C0BA 2GC8A 1OY9A 1LW2B 4RW6B 3BBFA 4A8QA 2I0XA 1HBNA 2ILYA 1EP4A 2PO4A 1VJWA 2KB2A 3MFIA 2IAJA 4USMA 1NJXA 2AP6A 1VIOA 3CT9A 4HR2A 2G0JA 3KLGB 1FD2A 4CLKA 1MN9A 2DIVA 5J2NB 1XMOF 1VQ8S 3IGVA 2VF3A 1FFGB 1U1PA 3L09A 4IOCQ 2D69A 3BH7B 5IXUA 1SV5B 4QWAA 2V6AA 1CJVB 1WG4A 3D2WA 4F7VA 3AXMA 4IG0B 2YQ1A 1HI1A 2GAGC 3MR5A 4M5IA 1I6JA 2C1EB 1PILA 1U2FA 3CULA 2WVDA 1CJTB 3L9ZA 2DHXA 2J0QD 3QZ7A 5EUHA 1IBKJ 4O3SA 2VKZG 1OMSA 4A47A 2JEGA 1FJ7A 3QIDA 1D8YA 1AT1B 2DO4A 3HD1A 5KOWA 4NASA 3MECB 4RX6A 3Q8RB 1V3ZA 2KT3A 1B0TA 4ETXA 4DL0C 1A6LA 2AYMA 2B8PA 2M70A 1C2PA 4NLGA 1KTVA 4FXVA 3GPAA 4PPZA 3MCOA 1APSA 3I96A 5KT4A 3C8YA 2RILA 3QRRA 1RK8A 1N5QA 2B6AB 2AGPA 1CEZA 2CPXA 4KGXB 2NXNA 9RUBA 6FDRA 4TU9A 3M8ZA 2BBEA 1U26A 3O1LA 3BKFA 4ICLB 4YQWA 3PFOA 1R0AB 4USWA 4F36A 2J6TA 3I0RB 4QIEA 2LQ9A 1UFKA 3POTB 4ZPVR 3EXCX 5HMXA 4NRUA 4X64J 4LFBJ 4KT0C 1D9DA 1MROB 4ZVGA 1RLDA 2CYYA 1S6PB 5BJRA 3ZXWA 5L1LA 1IKVB 2NR0A 3HK2A 3Q8QB 3G8QA 3NS5A 4DR5J 2AJ0A 1W2IA 2I6WA 4LBIA 5L8RC 2VICA 2AGQA 3SCIE 1TQLA 1RAOA 3L7UA 3A8EA 3OV7A 1VC5A 3C16B 1JK9B 3RBXA 3GU0A 3DRRA 2VIHA 2X1AA 4R5PA 4EUVA 2YKQA 1N54B 2BJ1A 4F26A 5IQ6A 1SKWA 3BKUA 4B9VA 1YQHA 3G87A 2HZVA 4RW8B 4U96A 1N0UA 3CJ0A 2AEJA 4NLXA 1TFYA 4Z37A 4M5KA 3A3NB 3KHGA 2CPFA 3NG8A 4HACB 4NLRA 2WSCC 4I68A 4DUZJ 2C22A 2LQJA 5T41A 3H0PA 2L9WA 2W7PA 3UNGC 1IBLF 3T1HJ 1D9AA 1V3SA 1WG1A 4QJVA 1VMBA 4MK9A 2KRBA 4IH6A 1JLCB 1FWLA 4GO5X 3K5LA 2XSFA 3AJ2A 3Q89A 3GV5B 2BOPA 3MCMA 1WNEA 1PBUA 4W90B 3CF5Q 3M2VB 1U6ZA 2I5JB 3VALA 1GX6A 5THWA 1JXEA 2YKNA 3CJ8A 1JLAA 2XI3A 1QUPA 3H5UA 4EZ9A 3C15A 1Z1ZA 4J9OA 4RW7A 3ENWA 1U02A 3GMGA 4OYZA 5AJ3F 3KXDA 4MT1A 1EQMA 1FFWB 3UE2A 3LPYA 3LWLA 1JLBA 4X64F 3PJ9A 1KR4A 1RAIB 4NI2B 4Q44A 2E5LF 1NXIA 1HI8A 4JV2A 2IAJB 3SV3A 2DY9A 4HTIA 4FS1A 3VAIA 3IFEA 2D3OR 1HMVA 1VQ7S 4K5SA 4ZDNA 3HJFA 4OI1A 3NMAA 2R7TA 2LDYA 1S6QB 2HEKA 2OFGX 2QLFB 4ZN3A 2W9CB 3PY8A 4B9SA 1VLOA 1NZAA 4KFBA 1XK8A 2HBYB 3NWGA 4Q2MA 1KSPA 2J0SD 3OFGA 1P9QC 5CCLA 5EWGA 2UXBF 1ZETA 3M8YA 2B51A 3CD7A 1NSAA 3ILIA 2F3JA 3FZBA 3M8QA 1Q95G 3Q8PB 1S9FA 1L3SA 1XN9A 5KFRA 1UJ5A 5GADU 1Z4UA 3QSYB 5IT9Y 3DRSA 3AA9A 1NPKA 1TKZB 3AB4B 3OTEA 3KHLA 5LMNJ 3C66A 3Q83A 3TVYA 4L72B 5J2QA 4DR2J 2DGVA 3D3CJ 2GFFA 2WW4A 2O67A 3NOCA 4G65A 3DDIA 1PG5B 1WUUA 2ZUGA 4WXWA 1OYDA 2OD4A 3MR2A 4NXMF 5ETKA 2NUUG 1S1WA 3KDOA 3BSOA 3OSPA 3RRKA 3B8HA 2V5HG 3PKYA 3QZ8A 2R7XA 2ZBPA 1ELOA 1HYSA 1XIQA 4N77A 2HRYA 3US5A 2KG1A 3KLEA 5DGBA 2GHWA 3VCDA 1LW2A 4KE5A 4OZLA 3DFEA 3J7YI 1UVLA 4KV8B 4JB8B 5DLGA 1NJIT 3IR6B 3MMCA 3Q8UA 4ZK7M 4LIRA 1RT2B 3MAQA 1Q7YT 3PO4A 3Q24A 3J7A1 2VFTA 3QO9B 2WVBA 2PEHA 4DFMA 3QRQA 2XULA 4ZOSA 1WWHA 4ZVUB 4OZ3A 4DUYJ 2FHJD 1FTRA 1WORA 2I38A 3GWCA 3SV4A 3W62A 1RA7A 4ER8A 1IBKF 1KRPA 3D1QA 4F04B 2NZ4A 4YOEA 2H4YB 3G6YA 1DTTB 2HBQB 4K50A 1WSRA 3TVZA 2R8IA 1HFEL 1U24A 5LT5A 3HHEA 2ATCB 3K57A 2UZAA 5CYMB 4GKKF 5L39A 5CHCB 2CPEA 4YMEA 2DHGA 4LFCF 1H2VZ 3PCOB 5KG1A 1RB0A 1S7IA 3CPWR 2D7SA 3IMQJ 4U9RA 4WFAQ 4C3KA 4OX9J 5DZ7A 4XIUA 4AMMA 1RTJB 3SQOP 4OI6A 3A8JA 2IM2A 4LIWA 1HBOA 8ATCB 4B3OB 1VC0A 4ZLJA 1IJFB 1BWVA 4QBUA 1KKHA 2XY6A 2A2DA 3JSBA 3T5JA 4DQIA 3KMSA 4KY3A 1X5PA 3JB9k 1RWVB 1GMWA 2E1RA 2CJ9A 2HFZA 3CSKA 3E01A 4L73A 4WF9Q 2VJVA 2WTFA 2EFGA 4GVBA 3MM8B 5K14A 3SCJE 4GC6A 2HHVA 2AU0A 4LF8J 3WBZA 1P8GA 5ETQA 4DX8H 3QT7A 3MD3A 4K59A 2ADBA 1HNZF 4ZVEA 1VQ4S 1ROFA 5D4NA 2PEBA 4ZVHA 3Q8SB 5EWEA 2HK3A 2YNGA 3AQOA 4DSIA 4LF9F 2FC8A 4N7TA 5BYRA 4OZNA 3PACA 4A48A 4I6WA 3EX7B 4I67A 4ZPBA 1S79A 1NK9A 2FYXA 1NSPA 4Y2KA 1N5YA 4BDPA 3ZZ0A 8RUCA 4EZ6A 3SFUA 1M5PC 1KHWA 2MDAA 3PEHA 1FE4A 2IYIA 1KQFB 2QLWA 4TY8A 1SJFA 1T9UA 3R1HA 1OY8A 2BYCA 3PW5A 5CD4H 3WHIA 2EFQA 2K7JA 4L3KA 4F4AA 2IRYA 1BD6A 2W01A 1RTIB 4JI4F 1S76D 3CCUS 5CYQA 5KFOA 2A0FB 3AA8A 2XM3A 3CUNA 4K4XA 5CXTA 4IG0A 2DO0A 4ZP9A 1MMLA 2FVSA 2ZZMA 1IVZA 1RHMB 3DGVA 2YNHB 2QA2A 5LSLA 1S1UB 2GO9A 2WHOA 2K06A 3JTOA 1N32F 3CDAA 4WBFA 2EG2A 3CVKA 1UVNA 1LQ9A 3EVMA 3MMCB 1R7IA 1VIXA 4CO4A 5DDOC 5ETLA 1T95A 1KEKA 2VQEJ 4B9LA 1TTHB 2JX2A 4CM2A 1N33F 2VPZB 6FD1A 3UN5A 3ADAC 1U2RA 1WHWA 3LGHA 1TUGB 2V8DA 3ITHB 4WJBA 1NKBA 2OSRA 3Q8YA 4GKJF 3H5SA 2H4WB 5J1EB 3M1VB 1YIJS 2YWWA 2DPIA 2QMWA 3FUYA 3ITHA 1VRUB 3QJJA 1FHTA 2XLKA 2MJNA 4P7TA 4B02A 3OW2R 4A8MP 1N48A 5JXSA 4DR3F 4OX8A 5IM0B 4OMFG 2RKIB 1ZTTA 1VRUA 3MR6A 2MZRA 5LMNF 1YBAA 3R7BB 5F8MA 1RWPB 4S0MA 3FCHA 1N8RT 2ZJRQ 1S1VB 3ZZZA 3TANA 3J7Z5 1E6YA 3FQLA 1P6TA 1CQMA 4USVA 1S97A 2Q1LA 3P3DA 1DLOA 2WOMB 3WQPA 1XR5A 3FK4A 1V9OA 4N8OA 3C46A 2C3PA 4JI4J 4A8YA 3AD7C 3IAS9 1QLNA 4RW4A 3N28A 3BSNA 1NDCA 4FS2A 2J6SA 3C14A 3W5YA 1N5SA 3X3UA 2YBVA 4DOZA 3K5OA 1D1UA 1HNXJ 3P49B 4P9SA 2YY3A 3IBCB 2B7BB 4WK3A 1X5TA 4PXCA 4U67Q 2AV5A 3ETMA 5KFTA 1S1TA 2BE2A 2DXFA 1L3KA 3MMJA 1ZM9A 2PA3A 2MSTA 4R0JA 1NRKA 5B0AA 4M5DB 3F73A 5IQQA 1SJ4P 4FYDA 2QGFB 3PRVA 2NXCA 4ZIVA 3CJKB 3MAHA 4FNIA 2Y0BB 3BGFA 4F2SA 1DJ0A 3PO5A 3I9ZA 4CYUA 3HHDA 1DTQB 1IWGA 2RUSA 5B08A 3DMJA 3OXGA 1U0SA 4DU8A 5EHHA 3HXMA 5LMUF 4ILMA 3HMJG 2R2TA 2O66A 5EWFA 5F8JA 4DR1J 1B7YB 3UWTA 3RW6A 3BGUA 3JQJA 2CQ4A 2HRUA 2KYZA 2N4CA 2W4DA 2ZDOA 3LALA 5AXLA 2BJ8A 1L3VA 1NH7A 2HMIA 3KLIA 2EI5A 4ECVA 4F2RA 5HQMA 1U0HB 3H2LA 4ED5A 2VPWB 3A8KA 1JNRB 1N34F 4WZQA 3BR8A 3OR1A 4NCGA 2YX1A 3N5BA 3D28A 2LEPA 4O3NA 1KS2A 3PXGa 3HD2A 1UVMA 1TKTB 4NRTA 3H2UB 2HURA 1F9FA 2WAQD 1NDPA 3R6GB 5KT7A 2R7VA 2LQ8A 4WZMA 4OZ0A 3RR8A 3Q8VA 2YPYA 1RWKB 4OYBA 3HFKA 4M5MA 1K1SA 2HK2A 2OD6A 2BX6A 1B4SA 2C2OB 4EU0A 3BDEA 1M5VC 4C8NA 4X4RA 2W9BB 2VKRA 1JB0C 2DNHA 3GJRB 4Z7YA 3ET6A 2HHSA 2KDOA 2XYGB 5DETA 1Q1KA 4YR0A 4UUWA 3VV2B 1N36F 1B0VA 3HSZA 1Q16B 3MZIA 1T11A 1RTHA 4IDKB 1KVKA 4LF1A 1FI4A 2CA9A 5KFUA 3BQ2A 4O3RA 3SDEA 4KKOA 4I1TA 2ZBIA 2CJKA 4IR9A 2MLXA 3MEGB 2HFVA 3Q2TC 5KG3A 3LGMA 4OZ1A 1S77D 4Q5VA 5LOQA 4ES1A 4CIOA 1DQ8A 1ZAVA 2HYIB 1VRTA 2ZH5A 4Q7AA 4IRDA 4MIAA 5GAEI 2YPZA 1N32J 2LMIA 1KC8T 2UUBJ 4K4SA 3RZAA 3MM6A 3R97A 3TAMB 3UW1A 3DLEA 3DRYA 5D0GA 3TZYA 4YB1P 1K47A 4YS2A 1SH0A 5H1SV 3CW2C 2ATLA 4B3MF 2LVWA 4JI0J 3M8WA 2HKEA 5KOXA 4NCBA 4DLEA 1EETB 2OLWA 2CJAA 3PR4A 1NMEB 3OHAA 2MY7A 4G1PA 4HHHA 4G3IA 3FEXB 3MCSA 3M6UA 5G0RA 4E8UA 1KDNA 2IMWP 2R2UA 5H9EJ 2R2RA 3C14B 4P75A 4MIWA 2Z30B 4LR9A 2W7AA 2VBXA 3PYEA 4LF2A 3JQMA 1RACB 3UVJB 4QWEA 4DS4A 3VVTA 2MHEA 2XMMA 1HYSB 1R6VA 2XGPA 3J7AN 1VYAA 4Y00A 4ECTA 1L3TA 2HNZA 5DS7A 2VG6A 4CLWA 4ZHRA 4DI6A 1U1MA 4OHYA 2GVZA 4OYXA 2Z2YB 4BHQA 1NKEA 4W98A 3ENQA 4H4MA 5G4DA 4DL5A 2AJ4A 2VPXB 1SJRA 5F41A 2ZH1A 4Y28C 4OQJA 3CJKA 2W25A 4PQUB 2CZVC 3N4WA 4BWJA 2Y0SD 1S9GA 1WOSA 3EJMA 3O2IA 5HROA 1YLXA 4QU6A 3SSQA 4C8LA 5C24B 2IIHA 4WKYA 3PV8A 2VDHA 1PKUA 2K8GA 3ILJA 2F9JA 3R2DJ 2CNKB 3LAKA 3TA0A 1F5BA 2IRXA 1Y00A 2RHQB 2AZ1A 4C6AA 3TZZA 2N82B 3CNQP 3HX9A 1Y9OA 1YDLA 4CNZA 4ES3A 4LFCJ 4NYPA 5KT5A 3UD3P 3CCJS 2BEFA 1H73A 1RAHB 1SCJB 1VQYA 4DQSA 4AXIA 5CYJA 3FFIB 3OT9A 2KTQA 2QEXS 1IXKA 2W7OA 5ETOA 3G8SA 4YB6A 3TW0A 2XY7A 2GMJA 3ENAA 3W5XA 1TP7A 1UFWA 2HSEB 4QZVB 3P6YC 4H4KC 1NB2A 3RAXA 1SUQA 3SQGA 1LWEA 2QFIA 1WC3A 4X4SA 4P71A 2ZC4A 4DPOA 2BM0A 3S1TA 3AY0A 4IR1A 5HBMA 2MQPA 3G96A 5HJYA 1T8EA 1NB7A 4ZJLA 5JUMA 1UWBB 2DK2A 3OR2A 5D0HA 3TX8A 1YJ7A 1ITPA 2RIJA 2JVOA 4HEA9 5GMKa 2RS8A 4I2PA 1N5YB 4QWCA 2RS2A 1WI8A 2ZE2B 2KHCA 1I1GA 2U1AA 2WBMA 2C2DA 2EC2A 2VA2A 2GHVC 4DL7A 4TKTA 3CB4A 2N3OA 4G1QB 1JLBB 3BH6B 3EGNA 3BQ1A 2ZH9A 4XDDA 4DR1F 3D6FB 2J7WA 4QYRA 3VVUA 4NZ0A 3GIMA 5L1KA 2DPJA 4DR7F 3VGUA 4OLPA 1FK9A 1WC1A 2YWKA 2X1GA 3T3FA 3GIJA 3M2UB 3B78A 2CJYB 4B9NA 2JL9A 4CCHA 4KGMA 3CJ3A 3LQVA 3SYZA 2J0WA 1LNQA 3ZNUA 2N7CA 3BJYA 4JI5J 1JX4A 2HLUA 2B56A 2ZZNA 2HHQA 2FPHX 5AXKA 1BUXA 2GHPA 3EWGA 2HVDA 3IG1A 1RI7A 3G8TA 1TKTA 2GQQA 3HZEA 5G0RB 3BS9A 1T3OA 2BKPA 1FXLA 1TL4A 1UKUA 2RRNA 4QR1A 2EBGA 1V5VA 4YR2A 4X84A 1N0VC 1Z2ZA 3MOJB 2NPFA 2FHOB 5LSOA 4L76A 1LWXA 3K17A 4RKUC 3HPOA 3K58A 2ZH4A 3VAHA 1VQOS 1VBKA 1QAIA 3OL9A 2JC1A 3TO8A 1VQ9S 3DLGB 1P1LA 1K1QA 4F3QA 3KK2B 1OO0B 1QTNB 3IXQA 4DR5F 1RXOB 3MEEA 4TVAB 1XNRJ 1ZM3A 4P74A 4KKOB 4ZLPA 4WWSA 1YGYA 2PDAA 3ZZPA 2IDLA 4TY9A 4YR3A 5J1NA 1QDUB 4JI8F 3CMQA 4MJKA 2Y1LB 3KK2A 3W2WB 1RKJA 2OI2A 2WCXA 4U6PA 4URGA 2UUCJ 1KWMA 2D74B 3N5FA 4EBDA 1KOHA 2B4PA 2MQ8A 1JJHA 5HI7A 2HVHA 3ONQA 2B4VA 1HBNB 3L3CA 4LSNB 3D9BA 4DFJA 3DLEB 3I87A 5KFJA 4K0KJ 2QRRA 2MXYA 3MM9B 1V6HA 1Y3KA 2V0NA 2E7XA 4HDHA 1O8BA 4J37A 5ETMA 5KFIA 4DV0F 3RBDA 4NCGB 4JI7J 4F0KA 4ED2A 1TL3B 2V8PA 3D4JA 1CC7A 1WHXA 2VBYA 1K73T 2IFXA 3BO3A 3IM8A 1JJ2R 2QLJB 4ES2A 4YEAA 3UI3A 1CJTA 2VASA 2DNYA 3W8PA 1O6XA 5B09A 5HBMB 4J9MA 2KFNA 1F3VA 4OJGA 1BXNA 3T9NA 1CG2A 2IVYA 3BSAA 3ET6B 3G4SS 5F3ZA 2GIFA 1OPIA 2L9DA 2ZD1A 3QJLA 5E5NA 1HD1A 1DTTA 3NOGA 1WKKA 4A8OA 2BOAA 4CDIA 2B3TB 3QWPA 1TKZA 3TYTA 1FVSA 3RW7A 2MQQA 1I94J 1WF0A 1MMNA 2ZE2A 1CBKA 3O44A 2ZH2A 2O01C 3FSXA 3I9V9 4KHMA 4UT4A 4ECWA 2VOPA 2QSFA 2J8AA 1HBOB 2BJEA 1HWKA 4C97A 2FQQB 3U1LA 2E5LJ 5KG4A 2NXEA 3P4UB 2MB0B 4ZIWA 4YB7A 4KGKA 4ZJOA 2V2KA 1GNKA 1I3OB 4RNHA 1ZS6A 4KQZA 2AD9A 4NLTA 2ZITA 5T7LA 1RT4A 4ZPCA 2ZVSA 2DGUA 2MLZA 4DBQA 3HVWA 3HSJA 4P2XA 2OEJA 4JOUA 4F3OA 2HZAA 2ZUAA 1TK5A 1RT4B 5A6PA 1DURA 2APOA 2HQIA 3MF5A 4P10A 2W8KA 3K5MA 1L5UA 3R7SB 4ENOA 3HT3A 3GG1A 4LT6A 2BJ9A 2K3IA 4HI2A 4USJC 2DNMA 5J1EA 5D3GB 4KYZA 1RYRA 3CCZA 6AT1B 1IBMJ 1HHQA 5LJ3Y 2QSWA 4QYZK 3M8PB 3DOLB 3BPDA 1SUQB 3SQGB 2HVZA 4L3NA 4WTOB 3QIPB 3QT6A 1YRXA 3FC9A 2MZQA 2NREA 1CLFA 4DUYF 1FDAA 3BB5A 2GVDA 2KVIA 2RQKA 4OZJA 5I3UA 1LW0A 1RT7A 4RNNA 3MPUB 2KXNB 1UTAA 1LK5A 3TARA 4ILLA 2BM1A 2EG1A 2XG8A 1RU2A 2J7KA 3N6MA 4NXMJ 2YQ3A 3W8GA 2YNFB 3UR0A 1JKHA 1WEXA 2ZOMA 3UDEA 4BCAA 5KFKA 2R7UA 1WEZA 2IC3A 3PYFA 2UP1A 2Q3PA 2RUGA 3AJ1A 2KRRA 2OPSA 1CVJA 5F8NA 5KFYA 3H5XA 4TQSA 1LWCB 2Q6BA 4P7VA 5ADZA 2X51A 3FBEA 3HJVA 2V2ZA 2WSFC 3SEOA 4Y0FA 4BC9A 4UY85 2B5JA 5D4LA 1EKRA 2DGWA 4CNYA 4DLGA 3GFYA 5HL7Q 4PXDA 2ZDPA 4LSNA 4NEZA 3G6VA 3CC2S 4UY8T 4C9DA 2J76E 3LWMA 1R0BG 1DAXA 3FFIA 3PKMA 3M05A 2DR6A 2CPDA 2CQ0A 2GA7A 1RJJA 2J5AA 1OPZA 3AOCA 2MSSA 3PFEA 3KDNA 5A0YB 2UU9J 4OJ1A 3ZNJ1 1XNRF 2ROEA 2CPYA 5C2GA 1P1TA 5M2RA 1EIYB 2NSCA 4P2SA 3M1VA 1FRIA 3T6JA 2DNRA 1B0PA 4NLPA 2MEWA 2FGOA 1RAGB 4N41A 1FKOB 3FCWA 2QA4S 3MM7A 2VHGA 2HFSA 2GIQA 4HYKA 4KH0B 4LR8A 1SKSA 4LSLA 3G9CA 1J5OB 3EZ5A 5K8OA 1ZYQA 5LSRA 4PZVA 1TKDA 2FJWA 1IKYB 2HWIA 2XBPA 3ISZA 5HVGA 2FJVA 4F4YA 4B3TJ 4JI8J 4X4VA 5B0BA 4ZPWR 1FKPB 1TL1B 1J2VA 4DV1F 1AFJA 2HGNA 1C4AA 2H3EB 3D0GE 1WC0A 2Z4PA 3V2UC 4X4NA 1VQKS 2YX4A 1BQXA 1C1BB 5A8WA 5BXIA 4DL2A 1BY9A 3UVJA 4DFKA 3H20A 2R2SA 1T03B 1RWUA 4Q8EA 2ASJA 4AMPA 3G86A 1Q81T 1C0UB 2MKCA 3C6UB 1Y4ZB 5A8WB 4OHVA 4PYDA 3I55S 1RT2A 3DYAA 3PR5B 2WK4A 3H59A 4ZLLA 4AQYF 3PJWA 3FNNA 3OLBA 1RT5B 3H7HB 4HT5A 2KM8C 3MXHP 3H40A 2PE8A 2G0IA 2HG4A 4NZ6A 4DUTA 1RT3B 3QO9A 4HLBA 1RADB 3D0IE 2HQFA 1RABB 4K5RA 2Y8YA 4FVCA 1F6TA 4ZMMA 1RBAA 2LFVA 1S99A 2LYVA 3M6XA 2NPIA 2K7KA 4IRKA 1HARA 5E0OA 2E5GA 3KJFB 2AYBA 2EK1A 1YJWS 2FLLA 3M4XA 2X3GA 1IR1A 3JXOA 3D6MB 2XLIA 4ZVPB 5I3UB 4X62J 2UUTA 2XB2D 1D09B 3GFXA 3TA2A 3O6QA 2Y9HA 2KZMA 2R3VA 2C2KB 4ZCMA 4KGZB 3DLGA 2IY5B 1S0MA 2GS8A 2BUNA 4LVOP 4RW9B 3M2UA 1WG5A 1HKAA 3LH2S 1Q5VA 5D15A 1WTFA 3M32B 1VR6A 4K8RA 1XNQJ 4DZDA 1N33J 4Y2AA 2MPUA 1HNIA 2GMLA 1R8CA 3W64A 2D9OA 1EB0A 1X4GA 1SH2A 2P6TA 3NLCA 4FXWA 2J8SA 4O4GB 4AD6A 1W2BR 3LANA 4ELTA 2OPSB 3IM9A 2VV5A 2HHHF 5HATA 3SZ2A 2AEMA 1LWCA 4ALZA 2EVZA 1RYSA 1JXLA 2AYGA 2DR9A 2RDJA 4PXBA 3G6ES 2QE5A 4KPCA 3BBCA 3H2VE 4AFFA 4CT8A 1RAEB 1RWWB 2RJZA 2V34A 2ZFHA 3D3BJ 3LF0A 3BYPA 4U8VA 5DQIA 4I6YA 4X4OA 3NCQA 2M8HA 5DG9A 3NS6A 4C3LA 3KNAA 1KN6A 1R6YA 3HZGA 2GNKA 3IC1A 3ZZUA 3KG0A 3K2YA 5IC6B 2BVZA 3IN5A 3IRXA 4RBVA 1Q86T 5HROB 3DOLA 2V9WA 3J81U 1FRHA 4PWUA 3D1HA 3DGPA 1D3WA 2H5JB 2QN6B 3QIPA 3IWXA 3VR1A 2VFSA 2ROPA 1NKCA 2YKNB 2HIQA 3CJQA 4PPDA 5IWAF 4JV1A 1MMDA 1NK0A 4AYBD 2ILZA 2ACYA 1E6VB 1XMOJ 1AA1B 4MAKA 2FUG9 2P5VA 2N3LA 3KKFA 2Y1IA 3RBEA 3NMRA 3GR1A 2OJ3A 3ISND 3M8QB 3D66A 5DG8A 4NXNJ 4NA2A 2ALYB 1QAXA 5LM7E 4YY3F 4DR2F 3EPGA 1GAOA 3H8YA 4A4JA 2M7SA 3MEDB 2KM8B 2IC3B 1T3NA 1ACMB 2DGQA 4ETZA 2BQUA 1EZZB 2JSXA 3HVTA 5FIIA 1Q8KA 1LFPA 4KFBB 5HVFA 4DV3J 1S0VA 2CWXA 4ZCIA 4KHPF 5FJ4A 2QYCA 2DEJA 5EX0A 2BR0A 5F8GA 2RT3A 2ZBRA 1N5VA 1S1UA 2BV3A 3NAIA 2QA4G 2D1CA 5IT4A 3DRPB 4Q8FA 1TKXB 3TP2A 1H74A 5IT9U 2GX8A 3LOUA 1S48A 3TJAA 3A1YG 2RQCA 1A7GE 5JMNA 1D0EA 3L4BC 1X4BA 2Z56B 3QFHA 3IA0A 1WKLA 3HULA 4H4MB 4DX6A 3ZZOA 4ZITA 1N88A 5K20B 4RNMA 2OHDA 2JHEA 1ZZFA 1SC1B 4IKAA 5HMZA 3M9NB 2IPOB 5A76A 3UD4P 3MTKA 2ASDA 4LFBF 4JV5F 3BPSP 4X66J 4DF4A 4N8NA 3VHQA 2IVMA 1O51A 2C2MB 1JIHA 2C3YA 4NWBA 1U1OA 1DFDA 1H3DA 3N6NA 2NXUA 3NCRA 2RKIA 3JSRA 4KAIA 2Q43A 2XMWA 3GYNA 4JP8A 5ETRA 1S9GB 2ZWOA 5GAHU 2IRUA 3A8IA 4ED8A 4AL7A 1CJKB 1GK8A 4ITSA 5DDQC 4K4UA 1ZPWX 1DQ9A 2B0GA 2IMOA 1S59A 3UFCX 1F9HA 2OMOA 2PI5A 3KFWX 2UVWA 4C4WA 1NHKL 1G6BA 2MQNA 3QGHA 3WC2A 4DPUA 1OQ3A 3CO9A 4A8WA 1VBZA 1Q0NA 2JRSA 2HQDA 2RU9A 1RHJB 2F63A 1KONA 1KBRA 4RUAA 1H38A 2HAFA 1UPMB 2FZGB 1RCXB 1RAJA 2ERRA 4WIIA 1T02A 1JLFB 2DITA 1CJVA 3DDNA 3SSRA 2YNHA 4AE5A 1HBMA 3UCUP 1QAJA 2JLFA 2YH0A 4J9KA 1HNVB 1HWJA 5D6GA 4NMLA 2H48B 3C3LA 3QATA 3HDSA 2XMJA 4IOBA 2JJ4D 2YH1A 3OVAA 3L7OA 2K2PA 4KGVB 4ECXA 1N36J 3EZOA 3D1OA 4R0EA 1X5OA 1RCOB 3HHNB 1OSCA 3UO0A 4A8KA 1VOMA 3KJVB 4OJ3A 1T9YA 1YZ7A 2D3O1 2QIFA 4RU2A 2ZKTA 3H90A 4JI0F 4M5JA 3W66A 4JV5J 3MPYA 3IG1B 1FT8A 2WZ1A 3BN4A 3IWLA 4DSEA 4ANEA 2IHR1 3RB3A 4JI5F 1F9EB 3EGZA 1RTJA 2PA8D 3GCXP 3OJSA 2R7OA 1NLKL 1ZM2A 4FF3A 3W1YC 2F8MA 2VFUA 3MEGA 1IM6A 3QMQA 1IWAA 4QCLA 2BKOA 2IA0A 3RYLA 1S1XB 2X1FA 1YK9A 2EW9A 3EXYA 3N9UC 3R2CJ 3MHYA 1NK6A 3WDOA 2HS3A 4DN9A 1CJKA 2XEXA 2YWGA 5KG5A 2E1MC 2P2CB 4FPRA 2DCLA 3NS7B 5CYMA 1URNA 4A46A 1MW7A 2M88A 4GVBB 4HVZA 5K14B 4V1Ak 2RF2B 1ZTWA 4N47A 3F44A 3MEEB 3FJ2A 3MTJA 3KLHA 3MM5B 2DVIA 4JI3J 3J81j 4RBTA 4K7QA 4CT9A 1B7FA 2VL1A 5A6WA 2HAIA 4PG4A 2WVCA 4KO0B 4C48A 4QYZJ 4DPWA 3M9OB 5C2CA 2IA6A 2CUYA 4KV8A 1S0NA 1IQZA 3NGRA 2CG4A 2G2OA 2YTCA 4NLDA 3IGNA 2KXFA 3MMAB 2OFHX 1TZ0A 2UXBJ 3WIUA 1RBOB 3PZPA 4KB7A 4URQU 1HW8A 1R0CB 1WHVA 2WB4A 2G1HA 3NBPB 2KL8A 3OXFA 3MWBA 4HH1A 3BQ0A 1X9SA 1X4CA 1RTZA 1WF1A 4WFBQ 2HHTA 2QYGA 4F0HA 4DR4F 2XHCA 1SC6A 3J81Y 1WD6A 3W9HA 3LP2A 2XTJP 2XS7A 4PWDB 1SB6A 2D3UA 2YXLA 4UOGA 4DL6A 3ZFVA 1SVDA 3ICLA 2DR8A 1Z2LA 4LRBA 4LRFA 3WIVA 4RW7B 3LTOA 2FJBB 2VH7A 3UDVA 2W2NP 3RAQA 1NDKA 1SQFA 2HRTA 2VONA 4ED6A 5J2QB 1YBUA 2P6SA 2DYAA 5KFGA 1ZAWA 2Z2LA 4NLOA 1TMMA 2F40A 3LP0B 1GT8A 3T5LA 5DM7Q 4J9VA 2FB0A 3I82A 4F0MA 3J7YU 4QIFA 1N4LA 2BKNA 3M2RA 2CQ1A 4DG1B 4HDGA 1SH3A 5KG6A 3NNAA 1RWNB 2NLWA 1HR0F 4A8FA 2XHWA 3DM2A 3U7JA 3IBFB 4WFXA 4EYHB 2ZZTA 3FMBA 4I69A 4DG1A 1HI0P 1LKZA 3ULHA 1R8HA 2HHPA 3GCWP 1RISA 4HL9A 4OHZA 4OI4A 2GVDB 3GG0A 4LF4F 2DKOB 3PYGA
chains in the Genus database with same CATH topology
2G2ZA 3SBMA 5DZ6A 1MLAA 2C2NA 3TZZA 2G2YA 2QO3A 2UV8G 2VKZG 3HJVA 2VZ8A 2H1YA 3CJ8A 3TZXA 2HG4A 3TQEA 3IM9A 2CUYA 4RL1A 2G2OA 5DZ7A 5CZCA 3R97A 4RR5A 3TZYA 3G87A 3HHDA 1NM2A 2JFKA 3TZWA 3PTWA 2JFDA 2G1HA 3QATA 5CZDA 4QBUA 3IM8A 3HMJG 3BV8A 3H0PA 3RGIA 2VZ9A 3K89A 3R8YA 2QJ3A 2QC3A 2PFFB 3EZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G2Z A;  3SBM A;  5DZ6 A;  1MLA A;  2C2N A;  3TZZ A;  2G2Y A;  2QO3 A;  2UV8 G;  2VKZ G;  3HJV A;  2VZ8 A;  2H1Y A;  3CJ8 A;  3TZX A;  2HG4 A;  3TQE A;  3IM9 A;  2CUY A;  4RL1 A;  2G2O A;  5DZ7 A;  5CZC A;  3R97 A;  4RR5 A;  3TZY A;  3G87 A;  3HHD A;  1NM2 A;  2JFK A;  3TZW A;  3PTW A;  2JFD A;  2G1H A;  3QAT A;  5CZD A;  4QBU A;  3IM8 A;  3HMJ G;  3BV8 A;  3H0P A;  3RGI A;  2VZ9 A;  3K89 A;  3R8Y A;  2QJ3 A;  2QC3 A;  2PFF B;  3EZO A; 
#chains in the Genus database with same CATH topology
 2F5G A;  2HNZ B;  1TV6 B;  5KFV A;  4DL3 A;  3FVY A;  2QZ8 A;  1Q4R A;  2C2N A;  2E5J A;  4ZHR B;  2RE1 A;  2VG6 B;  4NMX A;  1NK5 A;  2BAN B;  2ZBQ A;  4CO2 A;  4DV6 J;  2B4O A;  3HP6 A;  2Y8W A;  4Q0B A;  1TAU A;  5HO4 A;  3KJV A;  1S5Z A;  2V94 A;  4ZVT B;  1H0H B;  5EX3 A;  4H4K A;  4DMZ A;  4DF8 A;  3BGR B;  1SL2 A;  1M1K T;  1HNW J;  4OYA A;  4LFA F;  1BMQ B;  1WDT A;  4V19 J;  2NUH A;  3QBC A;  1CS4 A;  3D5M A;  4UST A;  2GIR A;  2HBR B;  1Y0H A;  3W9J A;  4C0H A;  2ZH8 A;  2YKP A;  2HW3 A;  3KJQ B;  5A2Q Y;  1IBC B;  1KOO A;  1YKW A;  3CIM A;  3LP2 B;  5CD4 A;  2MGZ A;  4PWD A;  3TAM A;  5KFE A;  2ZH7 A;  1U1Q A;  4U8Y A;  4PR6 A;  2EFO A;  1LWF A;  1S1X A;  3MEK A;  5KG0 A;  2XS2 A;  5KFC A;  4X65 J;  1NH8 A;  3HI9 A;  1F5C A;  3S6E A;  2BZ2 A;  4CLF A;  1EET A;  2ZH6 A;  1AUD A;  3J80 U;  1HNZ J;  1HW9 A;  1RT5 A;  4Z2X A;  1BQM A;  3OBI A;  3GFH A;  4DV4 F;  2B8Q A;  2E9R X;  3MM9 A;  1RT3 A;  1UEV A;  2QO3 A;  4NYO A;  1LOU A;  1FER A;  1U0H A;  3LGN A;  3M30 A;  1FX2 A;  3OSN A;  4PKD B;  1X0F A;  3QYY A;  1Y10 A;  1UEK A;  1X8D A;  3K8W A;  3NGT A;  3HHL B;  2B4U A;  1VQN S;  1FD8 A;  3IS9 A;  3R5D A;  1ZM4 A;  3NRB A;  5DG7 A;  3CD0 A;  4DHV A;  2W9B A;  3Q23 A;  3PRB A;  3ZTQ A;  3G71 S;  2YVS A;  1NDL A;  2CQ3 A;  3K5P A;  3QPI A;  2HVE A;  4M8L A;  4I56 A;  2W2M P;  5KFA A;  1U47 A;  2FHM A;  2Z2M A;  3W3S A;  1M5S A;  2ZD1 B;  2AF6 A;  4NLS A;  1RTH B;  4IDK A;  4U7U K;  3ZC4 A;  5ETT A;  4K0K F;  2W2Q P;  1F1B B;  4IO1 A;  2CDQ A;  5B0G A;  2RVJ A;  3CCV S;  4B3R F;  1T9T A;  2KKH A;  4OZ5 A;  3C6T A;  1OWX A;  4LFA J;  3W9I A;  2AQ4 A;  4M5D A;  1SPB P;  3CCT A;  2CZ4 A;  4R8U B;  4CLS A;  4JI2 J;  4IQM A;  2RDD A;  5GVQ A;  1R0A A;  2HNY B;  1YSJ A;  3MCN A;  2H1Y A;  2BE9 B;  3UR3 C;  1FKO A;  3I5B A;  4LBH A;  4AT1 B;  5A8K A;  5E3A A;  4RL1 A;  3TRG A;  5BYQ A;  1VIS A;  2COL A;  2MKS A;  2D41 A;  5HAN A;  4UOH A;  5F8L A;  4EEY A;  1RHU B;  4LJM A;  2HFU A;  4RZR A;  4J9N A;  3RTV A;  2CQ2 A;  1FJE B;  3AFG A;  2CPZ A;  2MKI A;  2UXD J;  3B6B A;  1UL3 A;  1NM2 A;  4ID5 A;  4PG6 A;  4DV4 J;  3E01 B;  5HJX A;  1XC9 A;  2HMI B;  3OVB A;  4OV1 A;  1IM4 A;  4HH0 A;  5E3P A;  4LRD A;  1S0O A;  4QQB A;  3F0N A;  3N01 A;  3M8P A;  2UV8 A;  4I7F B;  1M90 T;  1IBM F;  1AUS L;  1FRK A;  1OJ4 A;  4UTG A;  4ZVF A;  2QL9 B;  4FN5 A;  2GGP B;  5AE2 A;  2LA6 A;  3M8S A;  4WFZ A;  3KUG A;  5LXR A;  1FWK A;  3NCP A;  4FPI A;  4IFY A;  1J5O A;  2BE2 B;  5DDR C;  3DRS B;  1FJC A;  3SCK E;  4WCE Q;  3TZX A;  2VG5 A;  1MWZ A;  2DNQ A;  3I0S B;  2CQD A;  4Y65 A;  1HNX F;  1GH8 A;  1ZZN A;  1MNE A;  3HLU A;  3T1Y J;  1QSY A;  1U09 A;  2UVV A;  2C2Z B;  3B4D A;  3MEC A;  1T9V A;  3OTD A;  3VZI A;  4D3H A;  2DGS A;  3CCE S;  3MAA B;  2EFP A;  2LP4 A;  5AXN A;  2HS4 A;  3R5C A;  4PCQ A;  1RQ0 A;  1CSJ A;  3IRW P;  2XWY A;  2V69 A;  3FCV A;  4Y2I A;  5SZT A;  4ED1 A;  5C7P A;  4C8M A;  2XZW A;  3FRY A;  4C11 B;  1S1T B;  2LXU A;  2V63 A;  2BA9 A;  3UDC A;  1D9F A;  1IR2 A;  4W4M A;  2C3O A;  2OP5 A;  1UVJ A;  3GJT B;  5A8R B;  2R8J A;  1REG X;  1S1V A;  3A12 A;  3TR5 A;  4V19 X;  3IR5 B;  5FLX Y;  2LCW A;  4NZ7 A;  4WE1 A;  5AE3 A;  3BF4 A;  2HPU A;  3IRX B;  2A18 A;  3KJN B;  3A13 A;  2ZNY A;  2FHK A;  2R9L A;  3DGP B;  4DX7 A;  3MPD A;  3ILL A;  1X9M A;  4AL6 A;  5D77 A;  3U1M A;  3E2E A;  3DNC A;  3BSC A;  3GE9 A;  1LK7 A;  2GJ2 A;  3OJU A;  1G3O A;  2V68 A;  4NX9 A;  4ZP8 A;  2KT5 A;  1V5I B;  4QIG A;  4EK2 A;  4XPC A;  3OL6 A;  1KQK A;  2JFK A;  3DU6 A;  1XTZ A;  4MYT A;  4XDC A;  1Q82 T;  3PIO Q;  1R3N A;  4DFP A;  4Y2C A;  3BV8 A;  1I51 B;  5IM0 A;  1YHQ S;  3OPK A;  1PC4 A;  4JV0 A;  4X4Q A;  1PGZ A;  4TLR A;  2IBK A;  4A8X A;  1LW0 B;  4HAC A;  3C19 A;  1O5J A;  3AD8 C;  5FD1 A;  5HQL A;  3V6D B;  3D54 A;  3SBM A;  1U45 A;  2QL7 B;  2ACM A;  1Q7L B;  1S57 A;  1VJQ A;  2F8H A;  5KFM A;  2KHD A;  1TFW A;  3RRG A;  3C15 B;  2AJ2 A;  1QD1 A;  1T9X A;  1U1K A;  2DD8 S;  3M32 A;  1B99 A;  3DXB A;  1W25 A;  2QT7 A;  4RNF A;  4DV6 F;  1OIA A;  3N6L A;  3NP5 A;  4OYW A;  4OYM A;  3U27 A;  3RUB L;  1MWY A;  1UVK A;  2YNI A;  3P5B P;  3CJR A;  4IO9 Q;  1KVJ A;  1I5O B;  2L08 A;  1PYT A;  4I6A A;  5A2Q U;  4HTJ A;  1RU1 A;  4RO0 A;  2ZBC A;  5KFB A;  4EBE A;  3I6P A;  3T5K A;  4FF4 A;  4HKQ A;  3ZTO A;  2JWN A;  1K44 A;  2A6O A;  1HWU A;  1TR0 A;  4FKY A;  4ED0 A;  2CQB A;  1RKI A;  1SXL A;  2BJ3 A;  3IBW A;  3NGU A;  4E2F B;  2XMT A;  2YKM A;  4IG3 A;  5C42 B;  4USH A;  3J80 Y;  2V50 A;  1SC3 B;  4P6Q A;  2CNN B;  2LEC A;  1GMV A;  3WZ0 A;  4ECZ A;  1S4F A;  1S6O A;  4LSZ B;  2BQR A;  2FVQ A;  1AFI A;  3EMT A;  2HWH A;  1FXD A;  1YJT A;  1QSS A;  3HT0 A;  2KT2 A;  4B17 A;  4DV7 F;  1YIT S;  3CO0 P;  4DUZ F;  2FVP A;  4O3Q A;  2AGO A;  4MMO A;  2VUG A;  2YQ0 A;  5I3P A;  5BR8 J;  3KLF B;  1VQM S;  2FJX A;  2W24 A;  2ZJP Q;  2LDI A;  1G2E A;  4UQT A;  2MTL A;  5IT0 A;  2C28 A;  3NXZ A;  1ZA2 B;  4MFB B;  3H4D A;  2B9W A;  2FHJ A;  1J5E F;  1SL1 A;  1S9E B;  1CJU A;  1RWM B;  1SIW B;  4CLZ A;  1WEL A;  1UP1 A;  2KVQ E;  4KIA A;  2N7Y A;  3EIC A;  1KVI A;  4IRC A;  4AQY J;  2PD1 A;  1S9E A;  3FEZ A;  2E44 A;  4CH0 S;  1FKP A;  1TL1 A;  3JSM A;  4I0W A;  2WON B;  1N6Q A;  2UUB F;  1RTD A;  2ABY A;  4FNH A;  4I2Q B;  2B6A A;  4F4X A;  1NJW A;  4DR3 J;  2FIU A;  4EFA C;  3DLH A;  4NA1 A;  3MDF A;  3TQ1 A;  1VQ5 S;  2JZ5 A;  2QL5 B;  3UNY A;  1HHT P;  1WEY A;  2RSQ A;  3I56 S;  2W2O P;  3VQT A;  3TAQ A;  1U49 A;  4J9S A;  2PMZ D;  2VZ8 A;  1XBW A;  1VQP S;  2IM0 A;  2WSE C;  3NKY A;  4TXS A;  2C2E A;  3OTO F;  5HMY A;  5JVG Q;  2QA1 A;  4LRE A;  1M1G A;  2O5D A;  1GX5 A;  3T1Y F;  3Q2S C;  3PNI A;  4E98 A;  3CXC R;  3BGR A;  4RBU A;  2VBZ A;  2WW8 A;  3KMQ A;  1VLY A;  3OLA A;  4PG8 A;  5J2P A;  3KHH A;  4FBU A;  2AT1 B;  3ISN C;  1GMU A;  5KAK A;  3GLJ A;  2MKY A;  2L3M A;  2NXJ A;  3SFG A;  3T9Z A;  4O44 A;  2GJF A;  5GAG I;  4YHH F;  5KFF A;  2MZS A;  2DBB A;  1R27 B;  3CWJ A;  3MMB B;  4LF9 J;  4ZKA A;  4ANC A;  1REV B;  5K8P A;  2V4Q A;  2EK6 A;  3P96 A;  1XNQ F;  2IBO A;  1TV6 A;  2DH9 A;  4L75 A;  3R3T A;  3SXL A;  5IFM A;  1ZAX A;  4C8Y A;  1EKS A;  3V6D A;  1NEE A;  1IKX A;  1KQS R;  3UN3 A;  3QNW B;  4H4O A;  2XYP B;  5KFW A;  4WU2 A;  4OI2 A;  2VB6 A;  4F4K A;  4BBY A;  2SXL A;  5KG7 A;  1LXJ A;  4FVM A;  2LEA A;  1VCT A;  4H4O B;  2N4D A;  2RRB A;  2VG7 B;  1M5O C;  4P52 A;  1N56 A;  3N79 A;  2OAU A;  3LP1 A;  1KTQ A;  4NI2 A;  2XI2 A;  1NZ8 A;  4ZS6 A;  3V6K A;  2CJX B;  1EJ7 L;  3MFH A;  3KK1 B;  3GP9 A;  5EN1 A;  3KTQ A;  2VFV A;  3M6V A;  3CCQ S;  2BJ7 A;  5J2M A;  3DN9 A;  4P73 A;  1SL0 A;  4CLP A;  4F4Z A;  4JI1 F;  1U1R A;  3JTP A;  5FLX U;  3Q86 A;  4NLU A;  5KFZ A;  4NXN F;  4WKR A;  3VAG A;  2CQI A;  2V4J B;  1S4E A;  2NYI A;  4YY3 J;  2V4R A;  4X4U A;  2GZO A;  4G1Q A;  1UVI A;  2W9C A;  4ECS A;  2ROG A;  1G4C A;  4DN0 A;  1XQI A;  4GKJ J;  2RH3 A;  2HFN A;  1GXT A;  3KUE A;  4IUF A;  3KLV A;  2PMH A;  3MUV P;  4YP3 A;  4PUO A;  1U4B A;  1WC5 A;  2H5I B;  4LUB A;  4ZP6 A;  2MZT A;  1IN0 A;  2AEF A;  2NYH A;  3V4M A;  2CQP A;  2I2Y A;  1ICE B;  2BRK A;  3H98 A;  1EAY C;  2DY1 A;  4RW6 A;  3LA0 A;  4ZVO B;  4DV2 F;  2I8E A;  2DIS A;  3OFE A;  2UXC F;  3D67 A;  2CPJ A;  4G6V B;  1DY3 A;  4CP5 A;  2E9T A;  4KTQ A;  4QIV A;  3IO1 A;  4AXJ A;  4OHX A;  5I42 B;  2FVC A;  2QJ3 A;  3ENV A;  1RT6 A;  5IV4 A;  1T9W A;  4O4G A;  3OUY A;  1TU0 B;  5KFL A;  4MIB A;  4OX6 A;  2O3D A;  1RTD B;  2V2V A;  4XAK A;  4K4T A;  2K1R B;  1C1C B;  3BEG B;  1M5K C;  5D0R A;  1RTI A;  1U8W A;  3ZO7 A;  5F3T A;  3PX6 A;  1MN7 A;  4NCA A;  2DNN A;  1SKU B;  7FD1 A;  2BE7 D;  3T19 A;  2AKW B;  3Q22 A;  2Y1J A;  4NPO A;  3PW2 A;  4ZCL A;  2F9D A;  3M6W A;  3OFH A;  4EWT A;  1U2C A;  4J9L A;  4WU3 A;  4DEZ A;  2DR7 A;  1WOP A;  2P9C A;  4UQG A;  2AZ3 A;  2JFD A;  5CZD A;  4J9R A;  4TLQ A;  2BJD A;  1X4F A;  5C5J A;  3V81 B;  2XCA A;  2UVU A;  2M4M A;  4ZPD A;  5KFX A;  4BLG A;  1U1N A;  2E29 A;  3AD9 C;  4CH1 A;  2GAH C;  4PQU A;  1HQ2 A;  5L9X A;  1OSD A;  1H98 A;  1ZA1 B;  1RDR A;  2AJQ A;  3H42 A;  3BO4 A;  2A2C A;  2BDP A;  5HQ8 A;  2J9C A;  3G82 B;  4FF2 A;  1VRT B;  1NU4 A;  1IQT A;  1J5E J;  2A6M A;  3MM6 B;  4LVN P;  3TA1 A;  3MMB A;  4J91 A;  2WRM A;  3W65 A;  4MTP A;  1PCA A;  1FEE A;  4QU7 A;  4O0I A;  1IKW A;  1RT1 B;  1NHV A;  3FBF A;  3P45 B;  3GFZ A;  4UW2 A;  3DI6 B;  4HT7 A;  3OTO J;  2XNQ A;  5L1I A;  4MH8 A;  3CMA S;  2BAB A;  3OFF A;  3QLH B;  5CA5 A;  1SQG A;  5L46 A;  1C1B A;  4PRF A;  1RT6 B;  4YDX A;  3NGS A;  4CO1 A;  5HVH A;  2AX0 A;  1BE4 A;  4CO5 A;  1RAF B;  2HQG A;  2ZEJ A;  3UDL A;  2XSJ A;  1A0O B;  4ILR A;  1TK0 A;  4B3O A;  1WF2 A;  2XLJ A;  2F4F A;  4JI6 F;  4C98 A;  1QTM A;  3D68 A;  3KOA A;  3V6J A;  1TKX A;  2J9D A;  2EBE A;  2KO1 A;  2X7I A;  4LMZ A;  5LL6 d;  4AMN A;  3TX0 A;  3DRX A;  2QX0 A;  3T1A A;  2R8H A;  2V9K A;  5C42 A;  3KG1 A;  1R8B A;  3I5C A;  4LSL B;  2F4V J;  4B3S J;  4I4B A;  3FQK A;  1BQM B;  2EWH A;  2Z0G A;  1N5T A;  3CJT A;  2EKN A;  3DYA B;  4FZV A;  2R8G A;  3C2P A;  4N5S A;  3VGS A;  4Q2L A;  2XMK A;  2KYX A;  4ZVQ B;  4B08 A;  4KJI A;  5GAH I;  1FCA A;  1HPZ A;  2M9K A;  3FDS A;  4L74 A;  4OYI A;  5KG2 A;  5KT3 A;  2KJV A;  2AW0 A;  3AQP A;  1X0P A;  3D7S B;  3PTW A;  3UQS A;  3W2W A;  2XO7 A;  3NNC A;  1CS4 B;  3HFZ B;  3GJQ B;  1TMJ A;  3POT A;  4NLW A;  3GB0 A;  5FDL B;  1JMT A;  4LF5 F;  3G82 A;  2YX7 A;  4UOF A;  1U6B A;  1N52 B;  4DXL A;  2PFF B;  2LXF A;  1ZH5 A;  1PSD A;  1YJU A;  2JLE A;  1T7P A;  4XTT A;  3CC4 S;  4URS A;  5I42 A;  1HHS A;  1TAQ A;  4QWB A;  1S10 A;  4DR6 F;  2V8G A;  1O0P A;  4WTY A;  4M95 A;  2DXD A;  3MOZ A;  3RB6 A;  3JYT B;  4DQQ A;  1BGX T;  1U25 A;  4NLQ A;  4PEO A;  5HK4 A;  4TU7 A;  1VFJ A;  1JLQ B;  4BWM A;  4B3R J;  3W60 A;  3ZTR A;  2DNP A;  1U7L A;  4ZCK A;  4ELU A;  1RHK B;  2PII A;  4ZN1 A;  1P27 B;  1UWB A;  2DHA A;  2CQC A;  2X1B A;  2XC9 A;  2MKJ A;  3TOQ A;  1KNZ A;  1B70 B;  5B0C A;  4DL4 A;  1HBU B;  1MU2 B;  4L6V 3;  5CAA A;  5D0E A;  3BRE A;  1SKR A;  3BGL A;  4K2J A;  3VQS A;  2C2R A;  2YKA A;  1JLG B;  3UCG A;  1Y7P A;  2EXU A;  4B9U A;  2CZ9 A;  1HIY A;  1WAC A;  2XZT B;  1F5A A;  4CLL A;  4CTA B;  1JWW A;  4DR4 J;  5T14 A;  2QFJ A;  4YN3 B;  2CPH A;  4EYI B;  1OYE A;  2VFR A;  4CQ1 A;  4ED3 A;  4Q0B B;  1Q8B A;  3A4T A;  4OFZ A;  4DR7 J;  2WVE A;  2NSB A;  3VGT A;  4DQP A;  1TUW A;  3SCL E;  3DLB A;  2DH7 A;  1TEL A;  4FBT A;  1EP4 B;  3HFV A;  1T94 A;  3MUM P;  1FRL A;  1S7H A;  1KP6 A;  1IJE B;  2QG9 B;  1VBX A;  1HWL A;  3CTR A;  3HO1 A;  1S49 A;  2VG5 B;  5DQH A;  3CDE A;  4IYQ A;  3MPW A;  2GCF A;  3E3X A;  2B9Y A;  4U7C A;  3R9L A;  4BS2 A;  1IKX B;  3BGO P;  2YWF A;  4WFY A;  2XCP A;  1KLM B;  4FF1 A;  2BXJ A;  2HQ3 A;  2E66 A;  4OYO A;  4OYP A;  3WC0 A;  3CJ5 A;  3GR0 A;  3WX8 A;  2R7S A;  4OJH A;  2OPQ A;  4FYY B;  4RW4 B;  1VC6 A;  4KO0 A;  2M8D B;  1K0V A;  2DIU A;  2I1R A;  5CH7 B;  2XMV A;  2CXE A;  3CD6 S;  3EGW B;  4IOA Q;  2G2Z A;  2HQC A;  1S1W B;  1T05 B;  5ETS A;  3I32 A;  4OLO A;  2UVR A;  3QRP A;  3PHT A;  2CG8 A;  4DJB A;  2M0G B;  5AE1 A;  5E41 A;  3VF0 B;  4O3O A;  3M8R A;  1FRM A;  2DNL A;  3BN7 A;  1YWX A;  3I31 A;  1BWE A;  5F0W A;  3GSI A;  1RGV A;  2E1C A;  1R8P A;  2HFO A;  3RB4 A;  1H2T Z;  1WDD A;  1K9M T;  5DJB A;  3D6H B;  2E9Z A;  2EC0 A;  4RWX A;  3LPE A;  1C4C A;  3KWM A;  3QSI A;  4KBI A;  1DHM A;  2CQG A;  2PFD A;  3KK3 B;  3DDK A;  3HVA A;  4QPT A;  4FP9 A;  1PAU B;  1RBL A;  2YNG B;  4RW8 A;  2VJU A;  1RSC A;  2B9E A;  2QC3 A;  3MM7 B;  4JI2 F;  2RQM A;  1XJW B;  4MK8 A;  3CJ2 A;  1FFS B;  4EBC A;  2JEF A;  4B3M J;  2RD5 C;  4Y34 A;  1NUE A;  1OQ6 A;  1HMV B;  2OML A;  3KUH A;  4FYV B;  1UFL A;  1UJ4 A;  1VDH A;  3QQC D;  4F67 A;  2VBW A;  4DV3 F;  3S01 A;  3V6H A;  3R1L A;  3PRD A;  1H2U X;  2F65 A;  3KLH B;  2XY5 A;  3QLH A;  1VQS A;  1AZS B;  2LXI A;  4ZLN A;  1F2H A;  5IV3 A;  1ARO P;  3GYG A;  4PG5 A;  2VQF F;  4RUH A;  1NJZ A;  4J90 A;  2XQC A;  2UXD F;  2XS5 A;  4X62 F;  3A3O B;  3I4P A;  1AZS A;  4U7U D;  1VRQ C;  3M30 B;  3QT5 A;  3MUT P;  1WSV A;  3HHL A;  1XEZ A;  3QGP A;  3KLF A;  4X4P A;  2J0X A;  4DSJ A;  3TZW A;  1RHR B;  3OXL A;  2ASL A;  1JLF A;  1Y5I B;  2DCU B;  4WK1 A;  3FBB A;  4DPT A;  5ITH A;  3PHE A;  2F4V F;  5U47 A;  2PMW A;  4MKA A;  3T1H F;  1HD0 A;  1HQU B;  2O1P A;  4MK7 A;  3PW7 A;  2POK A;  2CJQ A;  4JYA J;  5JVH Q;  5F9N A;  2UUA J;  1BQN B;  3DLK B;  1PBA A;  4MKY A;  3R7N B;  4I2Q A;  4FXD A;  1AB8 A;  2V8H A;  3CED A;  2CAD A;  1TUV A;  4QOT A;  4RU9 A;  3TI0 A;  4K4Z A;  1SBR A;  2DRB A;  4RLE A;  1JNZ B;  2CVI A;  3BR9 A;  1F0X A;  1FRJ A;  1U8S A;  2GQ2 A;  3PW0 A;  3V4I A;  2K1R A;  3KHR A;  4LF5 J;  5AJ3 J;  4RR5 A;  3HCX A;  2WVF A;  4DV7 J;  3JS9 A;  3PEJ A;  1FX4 A;  2B5J B;  2A10 A;  4NA3 A;  1Y5N B;  1FES A;  4GMK A;  2OH2 A;  3VAJ A;  2G13 A;  2BW2 A;  2E1P A;  1DLO B;  1MRO A;  3TNV A;  4PQA A;  1VI7 A;  1FK9 B;  2VZ9 A;  2E5I A;  1GQE A;  1CUL A;  5MLC V;  5J2N A;  4DQR A;  1FJG F;  4C3M A;  1F3F A;  2XO6 A;  2CIM A;  1QE1 A;  2DT9 A;  2H51 B;  5EGY A;  1YJR A;  2HVI A;  2G0C A;  4CLU A;  3KLE B;  1SC4 B;  4EMD A;  1B3T A;  4QW9 A;  4TYB A;  1G7C B;  4JUZ A;  3TUZ C;  1GFW B;  1VHF A;  3AAW B;  2IJF A;  1IR0 A;  1H72 C;  2LQ5 A;  3AOD A;  3DHW C;  3O8W A;  3HKW A;  2YWE A;  4LRA A;  4IFY B;  4NL5 A;  4PYA A;  5B0E A;  5B7W A;  1VGY A;  3CDU A;  3GV7 B;  1NJY A;  5CZC A;  5DQG A;  4JI7 F;  2XNR A;  5DRK A;  2ZOG A;  2GVZ B;  3F41 A;  2DEI A;  1HQE A;  3NWR A;  3K5N A;  3BBB A;  3VWS A;  1X7V A;  2QTW A;  3EM1 A;  5JJB A;  1NAQ A;  2HHW A;  3RBZ A;  5KT2 A;  3B54 A;  3NNH A;  4B9M A;  4G1I A;  1QUV A;  4AL5 A;  4EO8 A;  5K5M A;  2BRL A;  3K0J A;  2C3M A;  1E6V A;  2FY1 A;  3LP1 B;  4RWW A;  3CCM S;  2FJA B;  1NSQ A;  3T41 A;  4C11 A;  5GAG U;  2ZM6 J;  2OGU A;  5J2M B;  3PJX A;  3T5H A;  2VA3 A;  3QWU A;  3W61 A;  2G4B A;  2VOD A;  2JOQ A;  3THV A;  4ED4 A;  3B82 A;  5KFH A;  1IUJ A;  2B9X A;  3DOM A;  1KHV A;  4NOH A;  1RP5 A;  5J1P A;  2F1F A;  3MPV A;  2XGQ A;  1JLQ A;  3UD5 A;  3M9M B;  3GV8 B;  2DGT A;  5CZV A;  5SUH A;  4TQR A;  4MYU A;  2WOM A;  1WOO A;  4GVL A;  4UF4 A;  4R5P B;  1QVF R;  2C42 A;  3MM5 A;  1XMB A;  4KC5 A;  3KYL A;  1OS5 A;  1X9W A;  2F7V A;  1TVR B;  1EAR A;  3BYR A;  2GGP A;  3FGV A;  3I4H X;  3LO3 A;  3R8Y A;  2GMH A;  5J2P B;  2ZH3 A;  3QJP A;  2DHS A;  3AT1 B;  1NPP A;  2RML A;  3MD1 A;  2FTR A;  1F60 B;  2UV8 G;  3W7B A;  4C8O A;  2FZK B;  3NAH A;  2DH8 A;  3QAE A;  4JBC A;  4TY8 B;  5KFP A;  3MM8 A;  1E6Y B;  5KFQ A;  4QWD A;  1PC5 A;  2AHO B;  4KR0 B;  3HSG A;  4PAA A;  1KLN A;  1T0T V;  1W7W A;  5H9F K;  4EO6 A;  1UET A;  2H65 B;  3M2V A;  1K0T A;  3RAM A;  1R8A A;  3ILO A;  4X4T A;  3RJM B;  5DO2 A;  3HKZ D;  4TNO A;  2L48 A;  4GC7 A;  1PJ7 A;  1V3R A;  2HZC A;  2IDE A;  3ZTS A;  3GIK A;  2P8I A;  5GME A;  2HND B;  3DOK B;  5C25 A;  4KRW A;  3AHP A;  1KFS A;  2JEI A;  4X65 F;  1ZBT A;  3UCZ P;  3DLJ A;  4USK A;  2MGZ B;  1NK8 A;  3Q0A A;  1K8A T;  3NY0 A;  2LEB A;  5CAB A;  3EYZ A;  1M5H A;  2LLZ A;  3D0H E;  1CUL B;  1WC4 A;  3FEY B;  5A0Y A;  1BC6 A;  3C16 A;  4Y6I A;  1UAW A;  4HHU A;  4LF8 F;  3EZU A;  3GON A;  4M1K A;  5F9L A;  2V2Q A;  2ZC3 A;  1PO6 A;  4ERD A;  1YBT A;  3DRR B;  2JVR A;  5D8H B;  1YJ9 S;  1I94 F;  2UU9 F;  3PG9 A;  2FC9 A;  1LV5 A;  3CGI A;  1DTQ A;  4J9U E;  2FLN A;  1XER A;  4WIQ A;  1W26 A;  1RWX B;  1ULR A;  1XR6 A;  4ID8 A;  4Y2M A;  2EEY A;  4OV6 A;  1X31 C;  3PYD A;  4O4R A;  2EKY A;  1H6K X;  4CLY A;  4AND A;  3GSD A;  2VC1 A;  3ETO A;  1QM9 A;  4ZJQ A;  4DZ6 A;  4OI0 A;  3O5T B;  3OUY B;  1PYS B;  2OIH A;  2CDR B;  3EGV A;  2BAN A;  1X4A A;  1YZ6 A;  1KLM A;  1FXR A;  1J27 A;  2Q6C A;  2HLT A;  3CIZ A;  3VGV A;  3CJS A;  3PVX A;  2W8L A;  2KI2 A;  2RU3 A;  7FDR A;  2DB1 A;  3HVT B;  4Z7C A;  1U48 A;  1F2G A;  3MI7 X;  3JTN A;  4IH5 A;  5AXM A;  3LW5 C;  1VHI A;  1HL6 A;  3PDN A;  2JH3 A;  2OEL A;  1UW9 A;  1VBY A;  4AMO A;  5E3C A;  3SDE B;  1QY7 A;  3BDP A;  2FJD B;  2DRD A;  2NZC A;  2FD2 A;  3EUN A;  3JAM Y;  2M2B A;  1IBL J;  1IKV A;  2E7W A;  1OY6 A;  2FLP A;  1GEH A;  4M5L A;  1FE0 A;  4FYW B;  4LF7 J;  2ZNZ A;  4B3T F;  1NO8 A;  1D8Z A;  3TWZ A;  4MKV A;  5HLF A;  2W1B A;  2ZVI A;  4YFU A;  1CC8 A;  2OSQ A;  4AUK A;  5L38 A;  4F4W A;  3EVW A;  2H54 B;  2P9E A;  2BW7 A;  5E7O B;  3RGI A;  3IAM 9;  4ZP7 A;  3W5Z A;  1MWQ A;  3DKD A;  2C3U A;  4DWI A;  4YHH J;  2HIY A;  3V81 A;  3G2X A;  2FGC A;  2OPQ B;  4EGL A;  5HP1 B;  3IR7 B;  1JLE A;  2F8E X;  2AJF E;  2KG0 A;  4WXO A;  5M2P A;  4TYA A;  3RR7 A;  2HHX A;  1RE1 B;  2MYF A;  3K8V A;  4H54 A;  3K7R A;  3R6L B;  4R25 A;  1XMQ J;  3AOA A;  1U1L A;  1ZPV A;  4TU8 A;  4LF6 J;  3AOB A;  4DV2 J;  2V8V A;  3UPF A;  2OKQ A;  3HHL D;  1QAY A;  4DCJ B;  1DRZ A;  2G1D A;  5H9F J;  3TJ8 A;  2NS1 B;  1KFD A;  4I7F A;  1L3U A;  2IJR A;  3QGI A;  2ZHO A;  4ZPT R;  5CYQ B;  5DGA A;  1T05 A;  5CCM A;  1S6U A;  2QLB B;  5IWA J;  4LF4 J;  1RLC L;  4RUC A;  1HNW F;  3LAM A;  3S7R A;  1JJ4 A;  3ZTP A;  4PAB A;  1JLG A;  1SIZ A;  2KFZ A;  5L1J A;  2VD3 A;  3G6X A;  2G2Y A;  2JC0 A;  2V67 A;  4WPA A;  1UW4 A;  1Y5L B;  2OUG A;  3THT A;  3I0S A;  3ZZT A;  4NE9 C;  2M3D A;  2OEK A;  3LUY A;  4ZVS B;  3MUR P;  2D9P A;  4CO0 A;  4CZC A;  2VOO A;  5HMW A;  2L9N A;  1FNX H;  2HHH J;  1U6F A;  3MAA A;  5DDP C;  1LXN A;  3JQK A;  4FKX A;  3NGK A;  4DU7 A;  3EVO A;  4A8S A;  4PG7 A;  5FDL A;  5IZH A;  2DRA A;  3L7P A;  4M5H A;  2GV1 A;  4KHR A;  2AIR B;  3TEG A;  5LXY A;  2B7C B;  1UEU A;  3AJD A;  5HAO A;  4NLV A;  2UXC J;  4RW9 A;  1H7W A;  1REV A;  4QR2 A;  4TN2 A;  3SSS A;  3F56 A;  4DCP B;  5IS2 A;  2K3K A;  4FYX B;  2DXE A;  5M2U A;  3OTC A;  5KT6 A;  4C8Z A;  1QSL A;  4WE1 B;  2RHS B;  2FLO A;  4QIW D;  5L9N A;  2CPI A;  2RNE A;  1FVQ A;  3OVS A;  4CTA A;  2ZHA A;  5GMD A;  1UWA A;  1WI6 A;  3CD5 A;  5MAO A;  4OI3 A;  4DS5 A;  2QMU B;  1KD1 T;  3QT8 A;  4XPE A;  2DTJ A;  4K2X A;  3AH6 A;  3H4B A;  3TAP A;  1UA0 A;  2NCK L;  2CAJ A;  2G9O A;  3KNG A;  3OD2 A;  1HNV A;  4O23 A;  2MQL A;  4OZ2 A;  3DLL Q;  1HBM B;  3GYX B;  1GXU A;  5T7L B;  5GAE U;  1WKJ A;  3FRZ A;  1FRX A;  1UCN A;  4LQ9 A;  2PI4 A;  1CPZ A;  1RWO B;  2XSJ B;  1S12 A;  3QFW A;  4XK8 C;  1NCL A;  1HQU A;  3JSY A;  3W2V A;  1S6Q A;  3M7V A;  4UOC A;  2CJB A;  4YB5 A;  8AT1 B;  5F0U A;  2L41 A;  3BZQ A;  2RDI A;  5CQG A;  4DV1 J;  3GIR A;  4OX9 F;  1JXV A;  1VK3 A;  3D6T B;  3ZZY A;  1TL5 A;  5RUB A;  2I5J A;  3HHK A;  4E0D A;  5E2Q A;  3OTB A;  5I3Q A;  1PJ6 A;  3CJ4 A;  3NGD A;  3VAM A;  3CC7 S;  4F8R A;  4DSK A;  3IS9 B;  2KXH A;  3EPI A;  3V4I B;  2UUA F;  3FZ2 A;  1LFW A;  4GKK J;  2GQC A;  1CQN A;  3HF5 A;  3HHL C;  1EQ0 A;  3TEH B;  2Q79 A;  2OTJ S;  3RG6 A;  2Y1R I;  4ZA1 A;  2UUW A;  4RUB A;  2FJE B;  1FKA F;  3R5B A;  2P9G A;  4ID5 B;  5IC4 B;  5F8I A;  1IKW B;  2DGX A;  2RRA A;  4QPX A;  3SI8 A;  5LJ5 Y;  3DI6 A;  2OPR A;  4B3S F;  1NPR A;  4X66 F;  3CCW A;  2MKK A;  2PT0 A;  3KG4 A;  5ETP A;  1JLC A;  5ETN A;  3OL7 A;  2M5Y A;  4F50 A;  2IVF B;  1FDN A;  1VK8 A;  2OPR B;  4WP8 A;  1G1X A;  2OO4 A;  2IYG A;  1DAR A;  2WBR A;  3MED A;  4JI6 J;  2HNY A;  4CLT A;  3OR1 B;  7AT1 B;  3P8B B;  1M0S A;  4WYL A;  2R7W A;  5DZ6 A;  3WX4 A;  1FNM A;  2HS0 A;  1RA6 A;  2HND A;  2XZD B;  3DOK A;  4OX7 A;  1NSK L;  5E3Q A;  1QJH A;  3BKT A;  2QLX A;  1Q8I A;  4D3G A;  2YNI B;  2CQH A;  3RU0 A;  3W63 A;  2DJW A;  4CWB A;  2KFY A;  1C0U A;  3C6U A;  3JAM U;  4MFB A;  2BAC A;  2FVR A;  2E1A A;  5I4M A;  4RNO A;  4ED7 A;  1FO1 A;  1XMQ F;  4DPX A;  3CME S;  3FKB A;  3U02 A;  2Z8Q A;  4LF6 F;  1DQA A;  1SV5 A;  2JDJ A;  1SI9 A;  1B64 A;  1FEH A;  4P72 A;  4CM0 A;  1AYE A;  3VZH A;  3GII A;  1NK7 A;  2CNL B;  2HGM A;  2B43 A;  2VQF J;  1BLU A;  3I0R A;  1R31 A;  2ZKU A;  4UZC A;  4LQ3 A;  4P2M A;  3GIL A;  1SJ3 P;  1FDB A;  1AW0 A;  3BM7 A;  5AT1 B;  2E7V A;  5HN0 A;  1A9N B;  2XMA A;  2R8K A;  2MY8 A;  4F3M A;  2W2P P;  4WYW A;  1N34 J;  2LKZ A;  3R27 A;  4I64 A;  4IQX A;  2YWH A;  3CDB A;  4DR6 J;  2EFN A;  2AYE A;  2YNF A;  4DV5 F;  3LP0 A;  1NBE B;  3DOM B;  3ELH A;  4OIX A;  4DSL A;  1YRU A;  2W9A A;  4USI A;  4QR0 A;  2DNG A;  1FA0 A;  1LEO A;  3V5R A;  1YRT A;  1VS3 A;  3DM2 B;  1HNI B;  2ZOF A;  3U1N A;  2AMC B;  2KJW A;  3HM9 A;  4M94 A;  1P9Y A;  3E51 A;  2ADC A;  3OQ2 A;  2CFX A;  2GW8 A;  3RB0 A;  2OPP B;  2Z2Z A;  3TUI C;  2HGL A;  5DM6 Q;  2VQE F;  2Z58 B;  1GTE A;  5IOL A;  4DCO B;  4YUD A;  1SJ1 A;  1EHW A;  4M5G A;  1UMJ A;  2OPP A;  3I5A A;  3DRP A;  1NHU A;  2J6U A;  1UJ6 A;  1EX8 A;  1R89 A;  2V4J A;  5B0D A;  2DR5 A;  4ATN A;  1WJ9 A;  3KK1 A;  4XO0 A;  3J7Z T;  3O3L A;  2RQ4 A;  9ATC B;  1KQG B;  1FNO A;  1X60 A;  3SMZ A;  4KHP J;  2JLG A;  4I2P B;  1HPZ B;  3TUP A;  3EDR B;  1PIE A;  3VAK A;  4IFV B;  4C8K A;  5KFD A;  2X3D A;  2H9Z A;  3A3P B;  4NLY A;  5HP1 A;  1TK8 A;  4R8U A;  4N56 A;  1QVG R;  3PW4 A;  2OEM A;  4ELV A;  4IH7 A;  4FDF A;  1HLW A;  2DHH A;  4ZPA A;  4Q43 A;  5CZX A;  5C24 A;  2EPI A;  4J9P A;  1NK4 A;  3EE3 A;  5HSP A;  1RZM A;  3DXS X;  2BQ3 A;  4HHJ A;  4O44 B;  1RAA B;  1YX2 A;  4ZVR B;  3ZZR A;  5KFN A;  4J7C A;  5A8R A;  2DNK A;  3UN2 A;  3CE8 A;  4LRC A;  2R7Q A;  1QE1 B;  3DU5 A;  1H7X A;  4Q45 A;  1VQL S;  3GZ7 A;  3EDQ B;  4YDD B;  4K4Y A;  1PAE X;  1X4E A;  3FSY A;  4UZB A;  3AXK A;  3R5G A;  5E3R A;  3PX0 A;  2BMB A;  4F02 A;  2AJ1 A;  4USU A;  1HWI A;  2RF2 A;  1YVF A;  2MQO A;  1HR0 J;  2MHN A;  1GTH A;  4Y3C A;  4OL8 A;  2A3J A;  2VPY B;  4C0O C;  5K8M A;  1DBD A;  1TL7 B;  2EFV A;  5LMU J;  3PIP Q;  3RRH A;  2XWX A;  4J5O A;  2VG7 A;  1JLE B;  3TQE A;  1YG0 A;  4CI0 B;  1HBU A;  1MU2 A;  3THP A;  3CCR S;  2ALZ A;  1VQ6 S;  2CWK A;  3X1L B;  3GQC A;  2RAQ A;  4C7Q A;  2J7U A;  1ZOT A;  4MKB A;  2WON A;  2W4C A;  2YKM B;  3MMA A;  3B4M A;  4IG3 B;  2GJI A;  5BR8 F;  1N6Q B;  4CH7 A;  2E5H A;  3OHB A;  3CDW A;  3C6T B;  1RHQ B;  2ZJQ Q;  1BQN A;  2ASY A;  3DLK A;  3KK3 A;  2W4P A;  3K89 A;  3MR7 A;  5HLF B;  2AX1 A;  2J9E A;  1MG7 A;  2JEJ A;  2Y3Y A;  1Q53 A;  2U2F A;  4RJV A;  1X4H A;  5K8N A;  2QMX A;  1X4D A;  2LU2 A;  2UUC F;  5BYS A;  1JLA B;  1MLA A;  3TVK A;  4P2F A;  4W92 B;  3IWN C;  3JSM B;  3E8O A;  1RT1 A;  1YJN S;  1T03 A;  4OHW A;  2LA4 A;  5KTQ A;  1CJU B;  2PGC A;  2MLY A;  3QAU A;  1S6P A;  3H5Y A;  1MSW D;  5B0F A;  3OL8 A;  2H5E A;  3T6B A;  4DV0 J;  1WHY A;  1YJV A;  2KU7 A;  3N0V A;  4PWW A;  1C0T A;  4JI3 F;  4JYA F;  1XWL A;  4WFN Q;  3AB2 B;  4CO3 A;  2GO8 A;  2PN6 A;  1IKY A;  2RB7 A;  3P5T L;  1FTC A;  4KPY A;  1C0T B;  2DNO A;  1TL3 A;  1URR A;  3MGJ A;  4WP3 A;  4RPF A;  5D78 A;  3S8S A;  4J9Q A;  2MQM A;  3CCS S;  3DHX A;  5KFS A;  3MR3 A;  4X2B A;  1X5S A;  4LBP A;  1TL7 A;  2VDI A;  2LQB A;  2YKO A;  3FMW A;  3GTY X;  2IM1 A;  4KSE B;  4QW8 A;  3W2V B;  2VC0 A;  3NEK A;  3FSI A;  4K4W A;  3OR2 B;  3H25 A;  2IM3 A;  3GJS B;  3R5A A;  2CNO B;  1GXL A;  1Q79 A;  2ZHB A;  2HBZ B;  2FY8 A;  2HHU A;  1HA1 A;  4UUX A;  5F8H A;  5ETV A;  2Z57 B;  4LR7 A;  2MZJ A;  1BHN A;  5E33 A;  3PX4 A;  1GMW D;  4B9T A;  2DNZ A;  2Q66 A;  3TUJ C;  3DMJ B;  5D4P A;  1YTY A;  1Y3J A;  4EI2 A;  4WP9 A;  4N76 A;  4ICL A;  3K59 A;  1UA1 A;  4JI1 J;  2IJN A;  5C25 B;  4C2M A;  1AXQ A;  3PM9 A;  4PXE A;  2QV6 A;  4CYU B;  2FDN A;  2MJU A;  2XMU A;  2HWT A;  1RUS A;  3FBC A;  4KH1 B;  4DV5 J;  1SJQ A;  2CVE A;  3DCA A;  2CKW A;  2MZ1 A;  3KLG A;  1PYO B;  1SQE A;  1FJG J;  5D3G A;  2M52 A;  4F25 A;  4DDF A;  1LWF B;  2JNJ A;  2R42 A;  1FWP A;  4ECU A;  1WC6 A;  2FZC B;  1WTB A;  3VTI A;  3DC2 A;  2KZZ A;  2J9D E;  3KLI B;  2LU1 A;  2CRL A;  4DX5 A;  2D3Z A;  4U95 A;  2VU5 A;  3M2R B;  2KH9 A;  4DSF A;  1S72 S;  1R43 A;  1UZD A;  2WB1 D;  1JQG A;  3L95 X;  3QGG A;  3VAF A;  3CCL S;  3SIP B;  4M5N A;  1C1C A;  1FDD A;  1LWE B;  1NND A;  4NYZ A;  4BC7 A;  3HVR A;  2PSZ A;  4O0N A;  1JJC B;  1RT7 B;  5GAD I;  3NL0 A;  4K4V A;  4DPY A;  3HSD A;  3TJ9 A;  1TVR A;  4CRJ A;  4NEY A;  3R5J B;  4ECY A;  1DZ5 A;  1M1H A;  1UPP A;  5EDW A;  1FF2 A;  2ZWP A;  2I9S A;  2XYH B;  4GO7 X;  4ECQ A;  4M63 A;  2R4F A;  3IP0 A;  2MMY A;  2OTL S;  1YI2 S;  2R7R A;  2MKH A;  1UZH A;  1XR7 A;  2A1B A;  2AWZ A;  1HQE B;  2DGO A;  4GRS A;  2KN4 A;  1Q5Y A;  4IFV A;  2NQP A;  1PJ5 A;  3NBP A;  5D4O A;  3JYT A;  1Q8L A;  5H9E K;  1JKH B;  1Y11 A;  2ZM6 F;  3BO2 A;  5K9F A;  5DLF A;  1Q78 A;  2PC6 A;  4HI1 A;  4O3P A;  5A8K B;  4ECR A;  4PUO B;  4LF7 F;  4C0B A;  2GC8 A;  1OY9 A;  1LW2 B;  4RW6 B;  3BBF A;  4A8Q A;  2I0X A;  1HBN A;  2ILY A;  1EP4 A;  2PO4 A;  1VJW A;  2KB2 A;  3MFI A;  2IAJ A;  4USM A;  1NJX A;  2AP6 A;  1VIO A;  3CT9 A;  4HR2 A;  2G0J A;  3KLG B;  1FD2 A;  4CLK A;  1MN9 A;  2DIV A;  5J2N B;  1XMO F;  1VQ8 S;  3IGV A;  2VF3 A;  1FFG B;  1U1P A;  3L09 A;  4IOC Q;  2D69 A;  3BH7 B;  5IXU A;  1SV5 B;  4QWA A;  2V6A A;  1CJV B;  1WG4 A;  3D2W A;  4F7V A;  3AXM A;  4IG0 B;  2YQ1 A;  1HI1 A;  2GAG C;  3MR5 A;  4M5I A;  1I6J A;  2C1E B;  1PIL A;  1U2F A;  3CUL A;  2WVD A;  1CJT B;  3L9Z A;  2DHX A;  2J0Q D;  3QZ7 A;  5EUH A;  1IBK J;  4O3S A;  2VKZ G;  1OMS A;  4A47 A;  2JEG A;  1FJ7 A;  3QID A;  1D8Y A;  1AT1 B;  2DO4 A;  3HD1 A;  5KOW A;  4NAS A;  3MEC B;  4RX6 A;  3Q8R B;  1V3Z A;  2KT3 A;  1B0T A;  4ETX A;  4DL0 C;  1A6L A;  2AYM A;  2B8P A;  2M70 A;  1C2P A;  4NLG A;  1KTV A;  4FXV A;  3GPA A;  4PPZ A;  3MCO A;  1APS A;  3I96 A;  5KT4 A;  3C8Y A;  2RIL A;  3QRR A;  1RK8 A;  1N5Q A;  2B6A B;  2AGP A;  1CEZ A;  2CPX A;  4KGX B;  2NXN A;  9RUB A;  6FDR A;  4TU9 A;  3M8Z A;  2BBE A;  1U26 A;  3O1L A;  3BKF A;  4ICL B;  4YQW A;  3PFO A;  1R0A B;  4USW A;  4F36 A;  2J6T A;  3I0R B;  4QIE A;  2LQ9 A;  1UFK A;  3POT B;  4ZPV R;  3EXC X;  5HMX A;  4NRU A;  4X64 J;  4LFB J;  4KT0 C;  1D9D A;  1MRO B;  4ZVG A;  1RLD A;  2CYY A;  1S6P B;  5BJR A;  3ZXW A;  5L1L A;  1IKV B;  2NR0 A;  3HK2 A;  3Q8Q B;  3G8Q A;  3NS5 A;  4DR5 J;  2AJ0 A;  1W2I A;  2I6W A;  4LBI A;  5L8R C;  2VIC A;  2AGQ A;  3SCI E;  1TQL A;  1RAO A;  3L7U A;  3A8E A;  3OV7 A;  1VC5 A;  3C16 B;  1JK9 B;  3RBX A;  3GU0 A;  3DRR A;  2VIH A;  2X1A A;  4R5P A;  4EUV A;  2YKQ A;  1N54 B;  2BJ1 A;  4F26 A;  5IQ6 A;  1SKW A;  3BKU A;  4B9V A;  1YQH A;  3G87 A;  2HZV A;  4RW8 B;  4U96 A;  1N0U A;  3CJ0 A;  2AEJ A;  4NLX A;  1TFY A;  4Z37 A;  4M5K A;  3A3N B;  3KHG A;  2CPF A;  3NG8 A;  4HAC B;  4NLR A;  2WSC C;  4I68 A;  4DUZ J;  2C22 A;  2LQJ A;  5T41 A;  3H0P A;  2L9W A;  2W7P A;  3UNG C;  1IBL F;  3T1H J;  1D9A A;  1V3S A;  1WG1 A;  4QJV A;  1VMB A;  4MK9 A;  2KRB A;  4IH6 A;  1JLC B;  1FWL A;  4GO5 X;  3K5L A;  2XSF A;  3AJ2 A;  3Q89 A;  3GV5 B;  2BOP A;  3MCM A;  1WNE A;  1PBU A;  4W90 B;  3CF5 Q;  3M2V B;  1U6Z A;  2I5J B;  3VAL A;  1GX6 A;  5THW A;  1JXE A;  2YKN A;  3CJ8 A;  1JLA A;  2XI3 A;  1QUP A;  3H5U A;  4EZ9 A;  3C15 A;  1Z1Z A;  4J9O A;  4RW7 A;  3ENW A;  1U02 A;  3GMG A;  4OYZ A;  5AJ3 F;  3KXD A;  4MT1 A;  1EQM A;  1FFW B;  3UE2 A;  3LPY A;  3LWL A;  1JLB A;  4X64 F;  3PJ9 A;  1KR4 A;  1RAI B;  4NI2 B;  4Q44 A;  2E5L F;  1NXI A;  1HI8 A;  4JV2 A;  2IAJ B;  3SV3 A;  2DY9 A;  4HTI A;  4FS1 A;  3VAI A;  3IFE A;  2D3O R;  1HMV A;  1VQ7 S;  4K5S A;  4ZDN A;  3HJF A;  4OI1 A;  3NMA A;  2R7T A;  2LDY A;  1S6Q B;  2HEK A;  2OFG X;  2QLF B;  4ZN3 A;  2W9C B;  3PY8 A;  4B9S A;  1VLO A;  1NZA A;  4KFB A;  1XK8 A;  2HBY B;  3NWG A;  4Q2M A;  1KSP A;  2J0S D;  3OFG A;  1P9Q C;  5CCL A;  5EWG A;  2UXB F;  1ZET A;  3M8Y A;  2B51 A;  3CD7 A;  1NSA A;  3ILI A;  2F3J A;  3FZB A;  3M8Q A;  1Q95 G;  3Q8P B;  1S9F A;  1L3S A;  1XN9 A;  5KFR A;  1UJ5 A;  5GAD U;  1Z4U A;  3QSY B;  5IT9 Y;  3DRS A;  3AA9 A;  1NPK A;  1TKZ B;  3AB4 B;  3OTE A;  3KHL A;  5LMN J;  3C66 A;  3Q83 A;  3TVY A;  4L72 B;  5J2Q A;  4DR2 J;  2DGV A;  3D3C J;  2GFF A;  2WW4 A;  2O67 A;  3NOC A;  4G65 A;  3DDI A;  1PG5 B;  1WUU A;  2ZUG A;  4WXW A;  1OYD A;  2OD4 A;  3MR2 A;  4NXM F;  5ETK A;  2NUU G;  1S1W A;  3KDO A;  3BSO A;  3OSP A;  3RRK A;  3B8H A;  2V5H G;  3PKY A;  3QZ8 A;  2R7X A;  2ZBP A;  1ELO A;  1HYS A;  1XIQ A;  4N77 A;  2HRY A;  3US5 A;  2KG1 A;  3KLE A;  5DGB A;  2GHW A;  3VCD A;  1LW2 A;  4KE5 A;  4OZL A;  3DFE A;  3J7Y I;  1UVL A;  4KV8 B;  4JB8 B;  5DLG A;  1NJI T;  3IR6 B;  3MMC A;  3Q8U A;  4ZK7 M;  4LIR A;  1RT2 B;  3MAQ A;  1Q7Y T;  3PO4 A;  3Q24 A;  3J7A 1;  2VFT A;  3QO9 B;  2WVB A;  2PEH A;  4DFM A;  3QRQ A;  2XUL A;  4ZOS A;  1WWH A;  4ZVU B;  4OZ3 A;  4DUY J;  2FHJ D;  1FTR A;  1WOR A;  2I38 A;  3GWC A;  3SV4 A;  3W62 A;  1RA7 A;  4ER8 A;  1IBK F;  1KRP A;  3D1Q A;  4F04 B;  2NZ4 A;  4YOE A;  2H4Y B;  3G6Y A;  1DTT B;  2HBQ B;  4K50 A;  1WSR A;  3TVZ A;  2R8I A;  1HFE L;  1U24 A;  5LT5 A;  3HHE A;  2ATC B;  3K57 A;  2UZA A;  5CYM B;  4GKK F;  5L39 A;  5CHC B;  2CPE A;  4YME A;  2DHG A;  4LFC F;  1H2V Z;  3PCO B;  5KG1 A;  1RB0 A;  1S7I A;  3CPW R;  2D7S A;  3IMQ J;  4U9R A;  4WFA Q;  4C3K A;  4OX9 J;  5DZ7 A;  4XIU A;  4AMM A;  1RTJ B;  3SQO P;  4OI6 A;  3A8J A;  2IM2 A;  4LIW A;  1HBO A;  8ATC B;  4B3O B;  1VC0 A;  4ZLJ A;  1IJF B;  1BWV A;  4QBU A;  1KKH A;  2XY6 A;  2A2D A;  3JSB A;  3T5J A;  4DQI A;  3KMS A;  4KY3 A;  1X5P A;  3JB9 k;  1RWV B;  1GMW A;  2E1R A;  2CJ9 A;  2HFZ A;  3CSK A;  3E01 A;  4L73 A;  4WF9 Q;  2VJV A;  2WTF A;  2EFG A;  4GVB A;  3MM8 B;  5K14 A;  3SCJ E;  4GC6 A;  2HHV A;  2AU0 A;  4LF8 J;  3WBZ A;  1P8G A;  5ETQ A;  4DX8 H;  3QT7 A;  3MD3 A;  4K59 A;  2ADB A;  1HNZ F;  4ZVE A;  1VQ4 S;  1ROF A;  5D4N A;  2PEB A;  4ZVH A;  3Q8S B;  5EWE A;  2HK3 A;  2YNG A;  3AQO A;  4DSI A;  4LF9 F;  2FC8 A;  4N7T A;  5BYR A;  4OZN A;  3PAC A;  4A48 A;  4I6W A;  3EX7 B;  4I67 A;  4ZPB A;  1S79 A;  1NK9 A;  2FYX A;  1NSP A;  4Y2K A;  1N5Y A;  4BDP A;  3ZZ0 A;  8RUC A;  4EZ6 A;  3SFU A;  1M5P C;  1KHW A;  2MDA A;  3PEH A;  1FE4 A;  2IYI A;  1KQF B;  2QLW A;  4TY8 A;  1SJF A;  1T9U A;  3R1H A;  1OY8 A;  2BYC A;  3PW5 A;  5CD4 H;  3WHI A;  2EFQ A;  2K7J A;  4L3K A;  4F4A A;  2IRY A;  1BD6 A;  2W01 A;  1RTI B;  4JI4 F;  1S76 D;  3CCU S;  5CYQ A;  5KFO A;  2A0F B;  3AA8 A;  2XM3 A;  3CUN A;  4K4X A;  5CXT A;  4IG0 A;  2DO0 A;  4ZP9 A;  1MML A;  2FVS A;  2ZZM A;  1IVZ A;  1RHM B;  3DGV A;  2YNH B;  2QA2 A;  5LSL A;  1S1U B;  2GO9 A;  2WHO A;  2K06 A;  3JTO A;  1N32 F;  3CDA A;  4WBF A;  2EG2 A;  3CVK A;  1UVN A;  1LQ9 A;  3EVM A;  3MMC B;  1R7I A;  1VIX A;  4CO4 A;  5DDO C;  5ETL A;  1T95 A;  1KEK A;  2VQE J;  4B9L A;  1TTH B;  2JX2 A;  4CM2 A;  1N33 F;  2VPZ B;  6FD1 A;  3UN5 A;  3ADA C;  1U2R A;  1WHW A;  3LGH A;  1TUG B;  2V8D A;  3ITH B;  4WJB A;  1NKB A;  2OSR A;  3Q8Y A;  4GKJ F;  3H5S A;  2H4W B;  5J1E B;  3M1V B;  1YIJ S;  2YWW A;  2DPI A;  2QMW A;  3FUY A;  3ITH A;  1VRU B;  3QJJ A;  1FHT A;  2XLK A;  2MJN A;  4P7T A;  4B02 A;  3OW2 R;  4A8M P;  1N48 A;  5JXS A;  4DR3 F;  4OX8 A;  5IM0 B;  4OMF G;  2RKI B;  1ZTT A;  1VRU A;  3MR6 A;  2MZR A;  5LMN F;  1YBA A;  3R7B B;  5F8M A;  1RWP B;  4S0M A;  3FCH A;  1N8R T;  2ZJR Q;  1S1V B;  3ZZZ A;  3TAN A;  3J7Z 5;  1E6Y A;  3FQL A;  1P6T A;  1CQM A;  4USV A;  1S97 A;  2Q1L A;  3P3D A;  1DLO A;  2WOM B;  3WQP A;  1XR5 A;  3FK4 A;  1V9O A;  4N8O A;  3C46 A;  2C3P A;  4JI4 J;  4A8Y A;  3AD7 C;  3IAS 9;  1QLN A;  4RW4 A;  3N28 A;  3BSN A;  1NDC A;  4FS2 A;  2J6S A;  3C14 A;  3W5Y A;  1N5S A;  3X3U A;  2YBV A;  4DOZ A;  3K5O A;  1D1U A;  1HNX J;  3P49 B;  4P9S A;  2YY3 A;  3IBC B;  2B7B B;  4WK3 A;  1X5T A;  4PXC A;  4U67 Q;  2AV5 A;  3ETM A;  5KFT A;  1S1T A;  2BE2 A;  2DXF A;  1L3K A;  3MMJ A;  1ZM9 A;  2PA3 A;  2MST A;  4R0J A;  1NRK A;  5B0A A;  4M5D B;  3F73 A;  5IQQ A;  1SJ4 P;  4FYD A;  2QGF B;  3PRV A;  2NXC A;  4ZIV A;  3CJK B;  3MAH A;  4FNI A;  2Y0B B;  3BGF A;  4F2S A;  1DJ0 A;  3PO5 A;  3I9Z A;  4CYU A;  3HHD A;  1DTQ B;  1IWG A;  2RUS A;  5B08 A;  3DMJ A;  3OXG A;  1U0S A;  4DU8 A;  5EHH A;  3HXM A;  5LMU F;  4ILM A;  3HMJ G;  2R2T A;  2O66 A;  5EWF A;  5F8J A;  4DR1 J;  1B7Y B;  3UWT A;  3RW6 A;  3BGU A;  3JQJ A;  2CQ4 A;  2HRU A;  2KYZ A;  2N4C A;  2W4D A;  2ZDO A;  3LAL A;  5AXL A;  2BJ8 A;  1L3V A;  1NH7 A;  2HMI A;  3KLI A;  2EI5 A;  4ECV A;  4F2R A;  5HQM A;  1U0H B;  3H2L A;  4ED5 A;  2VPW B;  3A8K A;  1JNR B;  1N34 F;  4WZQ A;  3BR8 A;  3OR1 A;  4NCG A;  2YX1 A;  3N5B A;  3D28 A;  2LEP A;  4O3N A;  1KS2 A;  3PXG a;  3HD2 A;  1UVM A;  1TKT B;  4NRT A;  3H2U B;  2HUR A;  1F9F A;  2WAQ D;  1NDP A;  3R6G B;  5KT7 A;  2R7V A;  2LQ8 A;  4WZM A;  4OZ0 A;  3RR8 A;  3Q8V A;  2YPY A;  1RWK B;  4OYB A;  3HFK A;  4M5M A;  1K1S A;  2HK2 A;  2OD6 A;  2BX6 A;  1B4S A;  2C2O B;  4EU0 A;  3BDE A;  1M5V C;  4C8N A;  4X4R A;  2W9B B;  2VKR A;  1JB0 C;  2DNH A;  3GJR B;  4Z7Y A;  3ET6 A;  2HHS A;  2KDO A;  2XYG B;  5DET A;  1Q1K A;  4YR0 A;  4UUW A;  3VV2 B;  1N36 F;  1B0V A;  3HSZ A;  1Q16 B;  3MZI A;  1T11 A;  1RTH A;  4IDK B;  1KVK A;  4LF1 A;  1FI4 A;  2CA9 A;  5KFU A;  3BQ2 A;  4O3R A;  3SDE A;  4KKO A;  4I1T A;  2ZBI A;  2CJK A;  4IR9 A;  2MLX A;  3MEG B;  2HFV A;  3Q2T C;  5KG3 A;  3LGM A;  4OZ1 A;  1S77 D;  4Q5V A;  5LOQ A;  4ES1 A;  4CIO A;  1DQ8 A;  1ZAV A;  2HYI B;  1VRT A;  2ZH5 A;  4Q7A A;  4IRD A;  4MIA A;  5GAE I;  2YPZ A;  1N32 J;  2LMI A;  1KC8 T;  2UUB J;  4K4S A;  3RZA A;  3MM6 A;  3R97 A;  3TAM B;  3UW1 A;  3DLE A;  3DRY A;  5D0G A;  3TZY A;  4YB1 P;  1K47 A;  4YS2 A;  1SH0 A;  5H1S V;  3CW2 C;  2ATL A;  4B3M F;  2LVW A;  4JI0 J;  3M8W A;  2HKE A;  5KOX A;  4NCB A;  4DLE A;  1EET B;  2OLW A;  2CJA A;  3PR4 A;  1NME B;  3OHA A;  2MY7 A;  4G1P A;  4HHH A;  4G3I A;  3FEX B;  3MCS A;  3M6U A;  5G0R A;  4E8U A;  1KDN A;  2IMW P;  2R2U A;  5H9E J;  2R2R A;  3C14 B;  4P75 A;  4MIW A;  2Z30 B;  4LR9 A;  2W7A A;  2VBX A;  3PYE A;  4LF2 A;  3JQM A;  1RAC B;  3UVJ B;  4QWE A;  4DS4 A;  3VVT A;  2MHE A;  2XMM A;  1HYS B;  1R6V A;  2XGP A;  3J7A N;  1VYA A;  4Y00 A;  4ECT A;  1L3T A;  2HNZ A;  5DS7 A;  2VG6 A;  4CLW A;  4ZHR A;  4DI6 A;  1U1M A;  4OHY A;  2GVZ A;  4OYX A;  2Z2Y B;  4BHQ A;  1NKE A;  4W98 A;  3ENQ A;  4H4M A;  5G4D A;  4DL5 A;  2AJ4 A;  2VPX B;  1SJR A;  5F41 A;  2ZH1 A;  4Y28 C;  4OQJ A;  3CJK A;  2W25 A;  4PQU B;  2CZV C;  3N4W A;  4BWJ A;  2Y0S D;  1S9G A;  1WOS A;  3EJM A;  3O2I A;  5HRO A;  1YLX A;  4QU6 A;  3SSQ A;  4C8L A;  5C24 B;  2IIH A;  4WKY A;  3PV8 A;  2VDH A;  1PKU A;  2K8G A;  3ILJ A;  2F9J A;  3R2D J;  2CNK B;  3LAK A;  3TA0 A;  1F5B A;  2IRX A;  1Y00 A;  2RHQ B;  2AZ1 A;  4C6A A;  3TZZ A;  2N82 B;  3CNQ P;  3HX9 A;  1Y9O A;  1YDL A;  4CNZ A;  4ES3 A;  4LFC J;  4NYP A;  5KT5 A;  3UD3 P;  3CCJ S;  2BEF A;  1H73 A;  1RAH B;  1SCJ B;  1VQY A;  4DQS A;  4AXI A;  5CYJ A;  3FFI B;  3OT9 A;  2KTQ A;  2QEX S;  1IXK A;  2W7O A;  5ETO A;  3G8S A;  4YB6 A;  3TW0 A;  2XY7 A;  2GMJ A;  3ENA A;  3W5X A;  1TP7 A;  1UFW A;  2HSE B;  4QZV B;  3P6Y C;  4H4K C;  1NB2 A;  3RAX A;  1SUQ A;  3SQG A;  1LWE A;  2QFI A;  1WC3 A;  4X4S A;  4P71 A;  2ZC4 A;  4DPO A;  2BM0 A;  3S1T A;  3AY0 A;  4IR1 A;  5HBM A;  2MQP A;  3G96 A;  5HJY A;  1T8E A;  1NB7 A;  4ZJL A;  5JUM A;  1UWB B;  2DK2 A;  3OR2 A;  5D0H A;  3TX8 A;  1YJ7 A;  1ITP A;  2RIJ A;  2JVO A;  4HEA 9;  5GMK a;  2RS8 A;  4I2P A;  1N5Y B;  4QWC A;  2RS2 A;  1WI8 A;  2ZE2 B;  2KHC A;  1I1G A;  2U1A A;  2WBM A;  2C2D A;  2EC2 A;  2VA2 A;  2GHV C;  4DL7 A;  4TKT A;  3CB4 A;  2N3O A;  4G1Q B;  1JLB B;  3BH6 B;  3EGN A;  3BQ1 A;  2ZH9 A;  4XDD A;  4DR1 F;  3D6F B;  2J7W A;  4QYR A;  3VVU A;  4NZ0 A;  3GIM A;  5L1K A;  2DPJ A;  4DR7 F;  3VGU A;  4OLP A;  1FK9 A;  1WC1 A;  2YWK A;  2X1G A;  3T3F A;  3GIJ A;  3M2U B;  3B78 A;  2CJY B;  4B9N A;  2JL9 A;  4CCH A;  4KGM A;  3CJ3 A;  3LQV A;  3SYZ A;  2J0W A;  1LNQ A;  3ZNU A;  2N7C A;  3BJY A;  4JI5 J;  1JX4 A;  2HLU A;  2B56 A;  2ZZN A;  2HHQ A;  2FPH X;  5AXK A;  1BUX A;  2GHP A;  3EWG A;  2HVD A;  3IG1 A;  1RI7 A;  3G8T A;  1TKT A;  2GQQ A;  3HZE A;  5G0R B;  3BS9 A;  1T3O A;  2BKP A;  1FXL A;  1TL4 A;  1UKU A;  2RRN A;  4QR1 A;  2EBG A;  1V5V A;  4YR2 A;  4X84 A;  1N0V C;  1Z2Z A;  3MOJ B;  2NPF A;  2FHO B;  5LSO A;  4L76 A;  1LWX A;  3K17 A;  4RKU C;  3HPO A;  3K58 A;  2ZH4 A;  3VAH A;  1VQO S;  1VBK A;  1QAI A;  3OL9 A;  2JC1 A;  3TO8 A;  1VQ9 S;  3DLG B;  1P1L A;  1K1Q A;  4F3Q A;  3KK2 B;  1OO0 B;  1QTN B;  3IXQ A;  4DR5 F;  1RXO B;  3MEE A;  4TVA B;  1XNR J;  1ZM3 A;  4P74 A;  4KKO B;  4ZLP A;  4WWS A;  1YGY A;  2PDA A;  3ZZP A;  2IDL A;  4TY9 A;  4YR3 A;  5J1N A;  1QDU B;  4JI8 F;  3CMQ A;  4MJK A;  2Y1L B;  3KK2 A;  3W2W B;  1RKJ A;  2OI2 A;  2WCX A;  4U6P A;  4URG A;  2UUC J;  1KWM A;  2D74 B;  3N5F A;  4EBD A;  1KOH A;  2B4P A;  2MQ8 A;  1JJH A;  5HI7 A;  2HVH A;  3ONQ A;  2B4V A;  1HBN B;  3L3C A;  4LSN B;  3D9B A;  4DFJ A;  3DLE B;  3I87 A;  5KFJ A;  4K0K J;  2QRR A;  2MXY A;  3MM9 B;  1V6H A;  1Y3K A;  2V0N A;  2E7X A;  4HDH A;  1O8B A;  4J37 A;  5ETM A;  5KFI A;  4DV0 F;  3RBD A;  4NCG B;  4JI7 J;  4F0K A;  4ED2 A;  1TL3 B;  2V8P A;  3D4J A;  1CC7 A;  1WHX A;  2VBY A;  1K73 T;  2IFX A;  3BO3 A;  3IM8 A;  1JJ2 R;  2QLJ B;  4ES2 A;  4YEA A;  3UI3 A;  1CJT A;  2VAS A;  2DNY A;  3W8P A;  1O6X A;  5B09 A;  5HBM B;  4J9M A;  2KFN A;  1F3V A;  4OJG A;  1BXN A;  3T9N A;  1CG2 A;  2IVY A;  3BSA A;  3ET6 B;  3G4S S;  5F3Z A;  2GIF A;  1OPI A;  2L9D A;  2ZD1 A;  3QJL A;  5E5N A;  1HD1 A;  1DTT A;  3NOG A;  1WKK A;  4A8O A;  2BOA A;  4CDI A;  2B3T B;  3QWP A;  1TKZ A;  3TYT A;  1FVS A;  3RW7 A;  2MQQ A;  1I94 J;  1WF0 A;  1MMN A;  2ZE2 A;  1CBK A;  3O44 A;  2ZH2 A;  2O01 C;  3FSX A;  3I9V 9;  4KHM A;  4UT4 A;  4ECW A;  2VOP A;  2QSF A;  2J8A A;  1HBO B;  2BJE A;  1HWK A;  4C97 A;  2FQQ B;  3U1L A;  2E5L J;  5KG4 A;  2NXE A;  3P4U B;  2MB0 B;  4ZIW A;  4YB7 A;  4KGK A;  4ZJO A;  2V2K A;  1GNK A;  1I3O B;  4RNH A;  1ZS6 A;  4KQZ A;  2AD9 A;  4NLT A;  2ZIT A;  5T7L A;  1RT4 A;  4ZPC A;  2ZVS A;  2DGU A;  2MLZ A;  4DBQ A;  3HVW A;  3HSJ A;  4P2X A;  2OEJ A;  4JOU A;  4F3O A;  2HZA A;  2ZUA A;  1TK5 A;  1RT4 B;  5A6P A;  1DUR A;  2APO A;  2HQI A;  3MF5 A;  4P10 A;  2W8K A;  3K5M A;  1L5U A;  3R7S B;  4ENO A;  3HT3 A;  3GG1 A;  4LT6 A;  2BJ9 A;  2K3I A;  4HI2 A;  4USJ C;  2DNM A;  5J1E A;  5D3G B;  4KYZ A;  1RYR A;  3CCZ A;  6AT1 B;  1IBM J;  1HHQ A;  5LJ3 Y;  2QSW A;  4QYZ K;  3M8P B;  3DOL B;  3BPD A;  1SUQ B;  3SQG B;  2HVZ A;  4L3N A;  4WTO B;  3QIP B;  3QT6 A;  1YRX A;  3FC9 A;  2MZQ A;  2NRE A;  1CLF A;  4DUY F;  1FDA A;  3BB5 A;  2GVD A;  2KVI A;  2RQK A;  4OZJ A;  5I3U A;  1LW0 A;  1RT7 A;  4RNN A;  3MPU B;  2KXN B;  1UTA A;  1LK5 A;  3TAR A;  4ILL A;  2BM1 A;  2EG1 A;  2XG8 A;  1RU2 A;  2J7K A;  3N6M A;  4NXM J;  2YQ3 A;  3W8G A;  2YNF B;  3UR0 A;  1JKH A;  1WEX A;  2ZOM A;  3UDE A;  4BCA A;  5KFK A;  2R7U A;  1WEZ A;  2IC3 A;  3PYF A;  2UP1 A;  2Q3P A;  2RUG A;  3AJ1 A;  2KRR A;  2OPS A;  1CVJ A;  5F8N A;  5KFY A;  3H5X A;  4TQS A;  1LWC B;  2Q6B A;  4P7V A;  5ADZ A;  2X51 A;  3FBE A;  3HJV A;  2V2Z A;  2WSF C;  3SEO A;  4Y0F A;  4BC9 A;  4UY8 5;  2B5J A;  5D4L A;  1EKR A;  2DGW A;  4CNY A;  4DLG A;  3GFY A;  5HL7 Q;  4PXD A;  2ZDP A;  4LSN A;  4NEZ A;  3G6V A;  3CC2 S;  4UY8 T;  4C9D A;  2J76 E;  3LWM A;  1R0B G;  1DAX A;  3FFI A;  3PKM A;  3M05 A;  2DR6 A;  2CPD A;  2CQ0 A;  2GA7 A;  1RJJ A;  2J5A A;  1OPZ A;  3AOC A;  2MSS A;  3PFE A;  3KDN A;  5A0Y B;  2UU9 J;  4OJ1 A;  3ZNJ 1;  1XNR F;  2ROE A;  2CPY A;  5C2G A;  1P1T A;  5M2R A;  1EIY B;  2NSC A;  4P2S A;  3M1V A;  1FRI A;  3T6J A;  2DNR A;  1B0P A;  4NLP A;  2MEW A;  2FGO A;  1RAG B;  4N41 A;  1FKO B;  3FCW A;  2QA4 S;  3MM7 A;  2VHG A;  2HFS A;  2GIQ A;  4HYK A;  4KH0 B;  4LR8 A;  1SKS A;  4LSL A;  3G9C A;  1J5O B;  3EZ5 A;  5K8O A;  1ZYQ A;  5LSR A;  4PZV A;  1TKD A;  2FJW A;  1IKY B;  2HWI A;  2XBP A;  3ISZ A;  5HVG A;  2FJV A;  4F4Y A;  4B3T J;  4JI8 J;  4X4V A;  5B0B A;  4ZPW R;  1FKP B;  1TL1 B;  1J2V A;  4DV1 F;  1AFJ A;  2HGN A;  1C4A A;  2H3E B;  3D0G E;  1WC0 A;  2Z4P A;  3V2U C;  4X4N A;  1VQK S;  2YX4 A;  1BQX A;  1C1B B;  5A8W A;  5BXI A;  4DL2 A;  1BY9 A;  3UVJ A;  4DFK A;  3H20 A;  2R2S A;  1T03 B;  1RWU A;  4Q8E A;  2ASJ A;  4AMP A;  3G86 A;  1Q81 T;  1C0U B;  2MKC A;  3C6U B;  1Y4Z B;  5A8W B;  4OHV A;  4PYD A;  3I55 S;  1RT2 A;  3DYA A;  3PR5 B;  2WK4 A;  3H59 A;  4ZLL A;  4AQY F;  3PJW A;  3FNN A;  3OLB A;  1RT5 B;  3H7H B;  4HT5 A;  2KM8 C;  3MXH P;  3H40 A;  2PE8 A;  2G0I A;  2HG4 A;  4NZ6 A;  4DUT A;  1RT3 B;  3QO9 A;  4HLB A;  1RAD B;  3D0I E;  2HQF A;  1RAB B;  4K5R A;  2Y8Y A;  4FVC A;  1F6T A;  4ZMM A;  1RBA A;  2LFV A;  1S99 A;  2LYV A;  3M6X A;  2NPI A;  2K7K A;  4IRK A;  1HAR A;  5E0O A;  2E5G A;  3KJF B;  2AYB A;  2EK1 A;  1YJW S;  2FLL A;  3M4X A;  2X3G A;  1IR1 A;  3JXO A;  3D6M B;  2XLI A;  4ZVP B;  5I3U B;  4X62 J;  2UUT A;  2XB2 D;  1D09 B;  3GFX A;  3TA2 A;  3O6Q A;  2Y9H A;  2KZM A;  2R3V A;  2C2K B;  4ZCM A;  4KGZ B;  3DLG A;  2IY5 B;  1S0M A;  2GS8 A;  2BUN A;  4LVO P;  4RW9 B;  3M2U A;  1WG5 A;  1HKA A;  3LH2 S;  1Q5V A;  5D15 A;  1WTF A;  3M32 B;  1VR6 A;  4K8R A;  1XNQ J;  4DZD A;  1N33 J;  4Y2A A;  2MPU A;  1HNI A;  2GML A;  1R8C A;  3W64 A;  2D9O A;  1EB0 A;  1X4G A;  1SH2 A;  2P6T A;  3NLC A;  4FXW A;  2J8S A;  4O4G B;  4AD6 A;  1W2B R;  3LAN A;  4ELT A;  2OPS B;  3IM9 A;  2VV5 A;  2HHH F;  5HAT A;  3SZ2 A;  2AEM A;  1LWC A;  4ALZ A;  2EVZ A;  1RYS A;  1JXL A;  2AYG A;  2DR9 A;  2RDJ A;  4PXB A;  3G6E S;  2QE5 A;  4KPC A;  3BBC A;  3H2V E;  4AFF A;  4CT8 A;  1RAE B;  1RWW B;  2RJZ A;  2V34 A;  2ZFH A;  3D3B J;  3LF0 A;  3BYP A;  4U8V A;  5DQI A;  4I6Y A;  4X4O A;  3NCQ A;  2M8H A;  5DG9 A;  3NS6 A;  4C3L A;  3KNA A;  1KN6 A;  1R6Y A;  3HZG A;  2GNK A;  3IC1 A;  3ZZU A;  3KG0 A;  3K2Y A;  5IC6 B;  2BVZ A;  3IN5 A;  3IRX A;  4RBV A;  1Q86 T;  5HRO B;  3DOL A;  2V9W A;  3J81 U;  1FRH A;  4PWU A;  3D1H A;  3DGP A;  1D3W A;  2H5J B;  2QN6 B;  3QIP A;  3IWX A;  3VR1 A;  2VFS A;  2ROP A;  1NKC A;  2YKN B;  2HIQ A;  3CJQ A;  4PPD A;  5IWA F;  4JV1 A;  1MMD A;  1NK0 A;  4AYB D;  2ILZ A;  2ACY A;  1E6V B;  1XMO J;  1AA1 B;  4MAK A;  2FUG 9;  2P5V A;  2N3L A;  3KKF A;  2Y1I A;  3RBE A;  3NMR A;  3GR1 A;  2OJ3 A;  3ISN D;  3M8Q B;  3D66 A;  5DG8 A;  4NXN J;  4NA2 A;  2ALY B;  1QAX A;  5LM7 E;  4YY3 F;  4DR2 F;  3EPG A;  1GAO A;  3H8Y A;  4A4J A;  2M7S A;  3MED B;  2KM8 B;  2IC3 B;  1T3N A;  1ACM B;  2DGQ A;  4ETZ A;  2BQU A;  1EZZ B;  2JSX A;  3HVT A;  5FII A;  1Q8K A;  1LFP A;  4KFB B;  5HVF A;  4DV3 J;  1S0V A;  2CWX A;  4ZCI A;  4KHP F;  5FJ4 A;  2QYC A;  2DEJ A;  5EX0 A;  2BR0 A;  5F8G A;  2RT3 A;  2ZBR A;  1N5V A;  1S1U A;  2BV3 A;  3NAI A;  2QA4 G;  2D1C A;  5IT4 A;  3DRP B;  4Q8F A;  1TKX B;  3TP2 A;  1H74 A;  5IT9 U;  2GX8 A;  3LOU A;  1S48 A;  3TJA A;  3A1Y G;  2RQC A;  1A7G E;  5JMN A;  1D0E A;  3L4B C;  1X4B A;  2Z56 B;  3QFH A;  3IA0 A;  1WKL A;  3HUL A;  4H4M B;  4DX6 A;  3ZZO A;  4ZIT A;  1N88 A;  5K20 B;  4RNM A;  2OHD A;  2JHE A;  1ZZF A;  1SC1 B;  4IKA A;  5HMZ A;  3M9N B;  2IPO B;  5A76 A;  3UD4 P;  3MTK A;  2ASD A;  4LFB F;  4JV5 F;  3BPS P;  4X66 J;  4DF4 A;  4N8N A;  3VHQ A;  2IVM A;  1O51 A;  2C2M B;  1JIH A;  2C3Y A;  4NWB A;  1U1O A;  1DFD A;  1H3D A;  3N6N A;  2NXU A;  3NCR A;  2RKI A;  3JSR A;  4KAI A;  2Q43 A;  2XMW A;  3GYN A;  4JP8 A;  5ETR A;  1S9G B;  2ZWO A;  5GAH U;  2IRU A;  3A8I A;  4ED8 A;  4AL7 A;  1CJK B;  1GK8 A;  4ITS A;  5DDQ C;  4K4U A;  1ZPW X;  1DQ9 A;  2B0G A;  2IMO A;  1S59 A;  3UFC X;  1F9H A;  2OMO A;  2PI5 A;  3KFW X;  2UVW A;  4C4W A;  1NHK L;  1G6B A;  2MQN A;  3QGH A;  3WC2 A;  4DPU A;  1OQ3 A;  3CO9 A;  4A8W A;  1VBZ A;  1Q0N A;  2JRS A;  2HQD A;  2RU9 A;  1RHJ B;  2F63 A;  1KON A;  1KBR A;  4RUA A;  1H38 A;  2HAF A;  1UPM B;  2FZG B;  1RCX B;  1RAJ A;  2ERR A;  4WII A;  1T02 A;  1JLF B;  2DIT A;  1CJV A;  3DDN A;  3SSR A;  2YNH A;  4AE5 A;  1HBM A;  3UCU P;  1QAJ A;  2JLF A;  2YH0 A;  4J9K A;  1HNV B;  1HWJ A;  5D6G A;  4NML A;  2H48 B;  3C3L A;  3QAT A;  3HDS A;  2XMJ A;  4IOB A;  2JJ4 D;  2YH1 A;  3OVA A;  3L7O A;  2K2P A;  4KGV B;  4ECX A;  1N36 J;  3EZO A;  3D1O A;  4R0E A;  1X5O A;  1RCO B;  3HHN B;  1OSC A;  3UO0 A;  4A8K A;  1VOM A;  3KJV B;  4OJ3 A;  1T9Y A;  1YZ7 A;  2D3O 1;  2QIF A;  4RU2 A;  2ZKT A;  3H90 A;  4JI0 F;  4M5J A;  3W66 A;  4JV5 J;  3MPY A;  3IG1 B;  1FT8 A;  2WZ1 A;  3BN4 A;  3IWL A;  4DSE A;  4ANE A;  2IHR 1;  3RB3 A;  4JI5 F;  1F9E B;  3EGZ A;  1RTJ A;  2PA8 D;  3GCX P;  3OJS A;  2R7O A;  1NLK L;  1ZM2 A;  4FF3 A;  3W1Y C;  2F8M A;  2VFU A;  3MEG A;  1IM6 A;  3QMQ A;  1IWA A;  4QCL A;  2BKO A;  2IA0 A;  3RYL A;  1S1X B;  2X1F A;  1YK9 A;  2EW9 A;  3EXY A;  3N9U C;  3R2C J;  3MHY A;  1NK6 A;  3WDO A;  2HS3 A;  4DN9 A;  1CJK A;  2XEX A;  2YWG A;  5KG5 A;  2E1M C;  2P2C B;  4FPR A;  2DCL A;  3NS7 B;  5CYM A;  1URN A;  4A46 A;  1MW7 A;  2M88 A;  4GVB B;  4HVZ A;  5K14 B;  4V1A k;  2RF2 B;  1ZTW A;  4N47 A;  3F44 A;  3MEE B;  3FJ2 A;  3MTJ A;  3KLH A;  3MM5 B;  2DVI A;  4JI3 J;  3J81 j;  4RBT A;  4K7Q A;  4CT9 A;  1B7F A;  2VL1 A;  5A6W A;  2HAI A;  4PG4 A;  2WVC A;  4KO0 B;  4C48 A;  4QYZ J;  4DPW A;  3M9O B;  5C2C A;  2IA6 A;  2CUY A;  4KV8 A;  1S0N A;  1IQZ A;  3NGR A;  2CG4 A;  2G2O A;  2YTC A;  4NLD A;  3IGN A;  2KXF A;  3MMA B;  2OFH X;  1TZ0 A;  2UXB J;  3WIU A;  1RBO B;  3PZP A;  4KB7 A;  4URQ U;  1HW8 A;  1R0C B;  1WHV A;  2WB4 A;  2G1H A;  3NBP B;  2KL8 A;  3OXF A;  3MWB A;  4HH1 A;  3BQ0 A;  1X9S A;  1X4C A;  1RTZ A;  1WF1 A;  4WFB Q;  2HHT A;  2QYG A;  4F0H A;  4DR4 F;  2XHC A;  1SC6 A;  3J81 Y;  1WD6 A;  3W9H A;  3LP2 A;  2XTJ P;  2XS7 A;  4PWD B;  1SB6 A;  2D3U A;  2YXL A;  4UOG A;  4DL6 A;  3ZFV A;  1SVD A;  3ICL A;  2DR8 A;  1Z2L A;  4LRB A;  4LRF A;  3WIV A;  4RW7 B;  3LTO A;  2FJB B;  2VH7 A;  3UDV A;  2W2N P;  3RAQ A;  1NDK A;  1SQF A;  2HRT A;  2VON A;  4ED6 A;  5J2Q B;  1YBU A;  2P6S A;  2DYA A;  5KFG A;  1ZAW A;  2Z2L A;  4NLO A;  1TMM A;  2F40 A;  3LP0 B;  1GT8 A;  3T5L A;  5DM7 Q;  4J9V A;  2FB0 A;  3I82 A;  4F0M A;  3J7Y U;  4QIF A;  1N4L A;  2BKN A;  3M2R A;  2CQ1 A;  4DG1 B;  4HDG A;  1SH3 A;  5KG6 A;  3NNA A;  1RWN B;  2NLW A;  1HR0 F;  4A8F A;  2XHW A;  3DM2 A;  3U7J A;  3IBF B;  4WFX A;  4EYH B;  2ZZT A;  3FMB A;  4I69 A;  4DG1 A;  1HI0 P;  1LKZ A;  3ULH A;  1R8H A;  2HHP A;  3GCW P;  1RIS A;  4HL9 A;  4OHZ A;  4OI4 A;  2GVD B;  3GG0 A;  4LF4 F;  2DKO B;  3PYG A; 
#chains in the Genus database with same CATH homology
 2G2Z A;  3SBM A;  5DZ6 A;  1MLA A;  2C2N A;  3TZZ A;  2G2Y A;  2QO3 A;  2UV8 G;  2VKZ G;  3HJV A;  2VZ8 A;  2H1Y A;  3CJ8 A;  3TZX A;  2HG4 A;  3TQE A;  3IM9 A;  2CUY A;  4RL1 A;  2G2O A;  5DZ7 A;  5CZC A;  3R97 A;  4RR5 A;  3TZY A;  3G87 A;  3HHD A;  1NM2 A;  2JFK A;  3TZW A;  3PTW A;  2JFD A;  2G1H A;  3QAT A;  5CZD A;  4QBU A;  3IM8 A;  3HMJ G;  3BV8 A;  3H0P A;  3RGI A;  2VZ9 A;  3K89 A;  3R8Y A;  2QJ3 A;  2QC3 A;  2PFF B;  3EZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...