3RGIA

Trans-acting transferase from disorazole synthase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
282
structure length
282
Chain Sequence
b'MKAYMFPGQGSQAKGMGRALFDAFPALTARADGVLGYSIRALCQDDPDQRLSQTQFTQPALYVVNALSYLKRREEEAPPDFLAGHSLGEFSALFAAGVFDFETGLALVKKRGELMGDARGGGMAAVIGLDEERVRELLDQNGATAVDIANLNSPSQVVISGAKDEIARLQVPFEAAGAKKYTVLRVSAAFHSRFMRPAMVEFGRFLEGYDFAPPKIPVISNVTARPCKADGIRAALSEQIASPVRWCESIRYLMGRGVEEFVECGHGIVLTGLYAQIRRDAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DisD protein
publication title Structure and Mechanism of the trans-Acting Acyltransferase from the Disorazole Synthase.
pubmed doi rcsb
source organism Sorangium cellulosum
molecule tags Transferase
total genus 99
structure length 282
sequence length 282
ec nomenclature ec 2.3.1.39: [Acyl-carrier-protein] S-malonyltransferase.
pdb deposition date 2011-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3rgiA02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 3rgiA01
3HJVA 2G2YA 5CZDA 5DZ6A 3TQEA 4QBUA 3G87A 2HG4A 3R8YA 3PTWA 2G2OA 3CJ8A 3BV8A 3TZXA 2QO3A 2G2ZA 2VZ9A 3IM9A 3HMJG 5DZ7A 3H0PA 3EZOA 3IM8A 4RL1A 2QJ3A 3TZYA 2C2NA 3SBMA 2CUYA 3K89A 3QATA 5CZCA 2QC3A 2PFFB 2H1YA 3RGIA 4RR5A 2JFKA 2UV8G 3TZZA 1MLAA 3TZWA 2G1HA 2VKZG 3HHDA 1NM2A 2VZ8A 2JFDA 3R97A
chains in the Genus database with same CATH superfamily
4WCEQ 1JNRB 2BQUA 1UWAA 4K4YA 3ZZRA 3W62A 1ZAXA 2DXDA 3I82A 4FYXB 3EVMA 3T1YF 2GJIA 3DRXA 2VFRA 2YKQA 1Y4ZB 1R8PA 1A6LA 3CCTA 2BE9B 3OR1A 5A6PA 4OJ3A 3W2WA 3DGPB 1OPIA 2E66A 3M8RA 1N34J 2F5GA 4ERDA 5KG2A 1B0VA 5KFCA 1R6YA 5B0CA 2GAHC 4GKJJ 5J2QA 1J5EF 3PNIA 2ZVSA 3V6KA 3QZ7A 1CPZA 2WBRA 3MMAA 1N5TA 1R6VA 1HLWA 2DY9A 1DJ0A 4LF5F 2Z30B 1SBRA 2XY6A 3NP5A 4LF2A 1RWOB 1F3VA 2GGPB 3FEXB 4PWUA 4TVAB 2KG0A 4KH0B 5KFTA 4TLQA 2PI4A 2J5AA 4DCPB 3DLLQ 2DNNA 4O3OA 2KB2A 1P6TA 4DQSA 4FXVA 4TU7A 1IR1A 4WKYA 3UR3C 2OI2A 4C3MA 2M5YA 4C8YA 1S1VB 2B5JA 1GFWB 3DRSA 1WHXA 1OYDA 5GAEI 2WTFA 1TFWA 3RB0A 2NXUA 4NLPA 3IBCB 1YBUA 1B0PA 4WP9A 4YHHJ 4YR2A 1R8CA 3J7AN 4M5DB 4KKOA 3MEEA 1O5JA 2KM8C 4ZP7A 1MROA 1S12A 2XS7A 2EFPA 2HMIB 4DV2F 1LXNA 5IQ6A 3MPYA 1ELOA 3ZO7A 1RTHA 1RTDA 4LSLA 3TA2A 4EZ6A 3IWNC 3Q8YA 4OZ0A 1YJVA 3SV3A 5B0FA 2R7VA 3MD1A 2ILZA 2WSFC 3BH7B 4DLEA 5DDOC 2Y1JA 4Q44A 5HJYA 1H6KX 5KT2A 4W90B 2HAIA 4OHZA 2ZM6F 1FK9A 2HPUA 3K89A 2CFXA 1QVFR 1WC3A 4L73A 5KFYA 2CJYB 2JEIA 2XY7A 2QLJB 2NXCA 2XHWA 2FZGB 3DOKB 3TAPA 4USHA 1GTEA 3VGVA 4P75A 3RB4A 3HMJG 4DWIA 2XYPB 3KK2B 1TL1A 5LJ5Y 5ETKA 1SL2A 2BKPA 1SQGA 3NGKA 3VGUA 3THVA 1SKSA 4L3KA 1WSRA 3K57A 3UI3A 3BQ0A 4M5HA 3J7YI 2NCKL 1FXRA 2H9ZA 1S6PB 1WTFA 4DUTA 5DDQC 2ZJRQ 4FF2A 2CQIA 5JJBA 2Q6CA 3IRWP 5KG5A 4CLUA 4DSKA 5I42A 2KFZA 1UAWA 2Y0BB 3G86A 3Q86A 3V5RA 5ETTA 5HATA 1FWKA 4B3SJ 1JLCB 3CJKA 5A8KB 2J7KA 3A8EA 4QYRA 2WAQD 2DR7A 3P5TL 2AU0A 1LWCB 3NWRA 2I38A 2VC1A 4DUYF 1F9HA 1TKZB 3CUNA 5HANA 1LFPA 4K4XA 4E2FB 2X51A 3R2CJ 3MAHA 4LFAF 5KG6A 2IMOA 5DZ7A 4F3OA 4KGMA 2V2VA 4O4GA 3Q8RB 3EE3A 3GSDA 4GKKJ 3M6WA 2GMLA 2VG6B 1EX8A 1FTCA 1LWFB 3V6DA 2CPJA 1L3UA 4D3GA 2C3UA 4EK2A 5CYMB 4XDDA 2PO4A 4DFJA 4ID5B 2VFUA 3QFWA 2LQBA 1OIAA 2P6TA 5LMUF 2FVSA 2QFJA 4X65J 2HHPA 2A1BA 1FD8A 3SV4A 2HVZA 4QOTA 2PMZD 2YNHA 4AT1B 3NOCA 2CPDA 1PJ6A 1R0AA 3BGOP 4O3NA 3DDKA 2VHGA 1QY7A 3HHLB 2XMJA 2XQCA 4N56A 1NHVA 4NLYA 2GHWA 4OIXA 2UV8G 1S7IA 1Z2LA 1S10A 1EARA 4LR7A 3IA0A 3DOMB 4EU0A 5ETLA 1RU2A 2OMOA 3I5BA 1M5HA 2CJKA 3THTA 2WBMA 4KO0B 4G1QA 5ETNA 4HH1A 5I4MA 1L3SA 1TV6B 3B4MA 1VC0A 4KE5A 2ATLA 4KTQA 3PYGA 4OZ1A 1N52B 4F4ZA 1Y9OA 2HGLA 1XJWB 3AB2B 4DX5A 2HAFA 4F4YA 4UTGA 3HI9A 1MW7A 3DLEB 3W9JA 2QA2A 2BQ3A 3OJSA 4ZVFA 1LV5A 4IO1A 1RWWB 4ZCIA 2XY5A 3PV8A 3R5BA 2YNGB 4U7UD 1F5CA 3DLBA 3ILIA 3RR8A 1QAJA 2B56A 3FUYA 2QEXS 3KMQA 1H3DA 3ADAC 1OY8A 1X60A 3HZEA 1DBDA 4DV4J 2EG2A 4J90A 2UUCF 1DTTB 4LR9A 5K8OA 8RUCA 5H1SV 1UL3A 3TRGA 2AW0A 2GGPA 3KFWX 4AMNA 2CNKB 2PA8D 2UVVA 4KIAA 2UUAJ 3RZAA 3LAMA 4HTJA 4C97A 3BH6B 4LF6J 2FVPA 3SXLA 1V5VA 1C0TB 3MXHP 2BYCA 1RT5B 3P3DA 1WELA 5KG7A 3RBEA 5JVGQ 4MK7A 1QTNB 2HHSA 3MCMA 2BQRA 1KSPA 1MWQA 2FB0A 3IGVA 1NH7A 5IQQA 3R5AA 4U67Q 1HPZB 3WDOA 1VR6A 1RTJB 3UCZP 2X1FA 3KLHA 1Z1ZA 4ZKAA 5KG0A 5KFOA 2XLIA 4I56A 3WC0A 4Y2KA 2AHOB 3AQOA 4W92B 4M5DA 2I1RA 2W2OP 1N32J 1URRA 2HHVA 2JLEA 4NMLA 1MSWD 3A1YG 3VAHA 2P5VA 5I3PA 2XULA 2XYGB 1FFGB 4Z37A 2HYIB 4ZLNA 2GIQA 3RBXA 1NHUA 3L9ZA 4KPCA 2E9RX 4QU7A 3ET6B 4ZDNA 2W4DA 5D4NA 3PG9A 2BKOA 3I32A 4AFFA 1F9FA 3VR1A 2E1MC 1N5QA 4ZIVA 3M8ZA 3DOKA 5HQLA 4A8OA 3CD6S 3H25A 5EN1A 4AL6A 3KK2A 2Y1LB 3PIOQ 3H8YA 1FT8A 1VQ9S 4WTOB 3MR5A 4ZA1A 3GJQB 3ZFVA 1T95A 4DX7A 3Q8VA 1JK9B 1XN9A 3O44A 3KK1B 1VMBA 2HW3A 3HSDA 4YQWA 1EP4B 4BWJA 3GFHA 3KDNA 1SKRA 5G4DA 2LQJA 1AUSL 3TA1A 3UCUP 2MPUA 3EGZA 3UVJB 2UVWA 4FP9A 4ID8A 2B7CB 3G6VA 3CJ0A 2XSJA 4WK1A 1JLCA 5A8KA 1I1GA 2IYGA 4NLQA 2EK6A 2DHXA 2GVZB 3GIIA 2V5HG 2Y9HA 2DD8S 3KWMA 1LWCA 3C46A 4K4ZA 2L08A 4K4VA 2BOAA 4DL2A 1TKZA 2MDAA 4Y2CA 4M8LA 5KFRA 2CQ2A 5KFUA 1U1NA 3KNAA 3P5BP 3P8BB 1DY3A 3PX0A 1YWXA 2VG6A 4DV3F 4P74A 2ZHAA 4NI2B 1LWFA 2XMAA 2V8GA 4L3NA 2J9CA 3R6LB 3BKUA 1WACA 4MTPA 4IH6A 3MMCA 2QE5A 1VYAA 5T14A 4MYTA 2QYCA 5L9XA 4ID5A 3SFUA 4Q43A 4PXDA 2E7VA 3HK2A 1Q81T 2QIFA 1FF2A 3OSPA 4B9VA 1TKXB 8ATCB 1NB2A 2OSRA 2YKNA 2UXBJ 1IWGA 1NJIT 2PSZA 4EYHB 4X4UA 3BJYA 1VS3A 3HFKA 5LMNF 2HBQB 4CIOA 3O1LA 3AD7C 4IOBA 3HHLA 5HAOA 2HS3A 1DAXA 1RGVA 4L74A 4A47A 1RAEB 4LFBJ 4ETZA 5KG1A 1X5OA 2IC3A 3PJXA 3WIUA 4ECQA 1TP7A 3UFCX 3IP0A 2AGQA 2R2UA 2CPEA 3CJRA 1UFLA 3IBWA 4W98A 3D6TB 4KO0A 4O23A 1LEOA 1ZOTA 5F8HA 1HHQA 4F67A 1TV6A 1Q8KA 4LF4F 2KZMA 1N56A 2FHOB 2XHCA 3D54A 1T3OA 2KH9A 2HK2A 2UVUA 1YJNS 4O4RA 3B4DA 2BUNA 3M1VB 4LIRA 2IM2A 3QGHA 1UW4A 3CJSA 3AJ1A 4U96A 1OSDA 2ZNZA 2DH9A 3RBDA 2ASLA 2KJWA 5AXNA 4E8UA 3CE8A 1U1PA 2CQDA 3DLEA 1D9FA 2G2ZA 2RSQA 5DQIA 4TU8A 3SCIE 4TY8B 2B6AB 5GAGU 3JTNA 1WC4A 2IJRA 1JLAB 4USWA 2JFDA 7FDRA 2K7KA 2AJ2A 2YNGA 1NDPA 2KXNB 3DXSX 2RRBA 3M4XA 1NZAA 1CVJA 4DPXA 3ENWA 2CRLA 4CLYA 3PHEA 4I2QB 3W5ZA 4F50A 4PRFA 3TQEA 1UMJA 3KHGA 4MH8A 4QR1A 5KT4A 2NZCA 1WORA 4H54A 2AIRB 5EHHA 4ES3A 3ILJA 1DTTA 1HNIB 3QGGA 3HVAA 3BSAA 3SDEB 2NR0A 1VQSA 4ZVRB 2M8HA 5KT3A 3DLHA 2VF3A 2QA4G 4DV5F 1OPZA 1F5AA 2KKHA 4CI0B 2FGOA 5LXYA 4EZ9A 3DLGB 4RW6B 1TKTA 1HBNB 4Q8FA 1C0TA 1XMQJ 3PYDA 1RUSA 1RZMA 1RT5A 1HI0P 1TMJA 4AXIA 5L1IA 3VZIA 2AEMA 3ZZTA 2M7SA 2XMVA 4DL5A 2PMHA 3UN2A 2PGCA 3PVXA 2QT7A 1HPZA 5GVQA 4WKRA 1Q4RA 5DZ6A 4KB7A 1SC4B 1LK5A 2U1AA 3R8YA 3UCGA 2ZZTA 3KG0A 1W25A 1LWEB 3D3CJ 3R1LA 4WZMA 3NCRA 3LWLA 4AL7A 1X9WA 3LPEA 2D9PA 2ZUAA 1AXQA 4YB1P 2CADA 4WYLA 2QLFB 4QIGA 3QWPA 4WF9Q 4QJVA 2KTQA 3NS5A 4OHYA 5KOXA 2ZEJA 1Q7LB 2WVBA 4B3OB 4XTTA 2RILA 4LSZB 5AXMA 4K2JA 3CCUS 3LH2S 3HKWA 4LFCJ 2DVIA 2ZDPA 3B82A 4WE1B 3GLJA 5B0GA 2ZJPQ 2RS2A 2HBYB 4NRTA 4WIIA 4FS1A 5L8RC 4WZQA 5CZVA 5AE3A 1WUUA 3HXMA 1ZTTA 2ZDOA 5FLXU 3L7OA 4C0HA 2FVCA 2F1FA 5DG8A 2HLUA 4ZVHA 5ETRA 5LSRA 4GVBB 3S7RA 5SZTA 5C2CA 3BSCA 2R2TA 1FI4A 3KK1A 2WSEC 2GMHA 4OYAA 1ZA2B 2M88A 2VJVA 1K1QA 3RUBL 1EZZB 4HTIA 1WKLA 1EP4A 3FBCA 4OX6A 3ZTPA 4ZLPA 4ZS6A 2NREA 4YY3F 1U4BA 2KG1A 1WOSA 4JI4J 1HW9A 2R7OA 3B54A 5F8LA 1UA0A 3MEKA 2LDYA 3RRKA 1V5IB 3JXOA 4PYAA 4N8OA 5J2NB 4JI8F 3FQKA 3UVJA 1U8WA 2EEYA 3BSOA 4LF9F 5CZDA 2R7XA 3A3PB 1U02A 2ZBPA 4NASA 3KLEA 4Y34A 4A8FA 4Q2LA 3N6MA 3VAFA 1OQ3A 2FY1A 3P4UB 1UVIA 2IDLA 1W2BR 2ZVIA 1GMUA 4CQ1A 4LF7J 2NXEA 4X2BA 4Q7AA 4KHRA 1JX4A 5HJXA 3NMAA 1HBOA 2MHEA 3GSIA 4DR2J 1FXDA 2V8VA 4NI2A 1S48A 5ETVA 3JQMA 1RAJA 2ASDA 2LA6A 2A0FB 2VJUA 1I94F 2KHCA 3MMJA 4RL1A 3RB6A 4N41A 3IR5B 2R2RA 4Y6IA 2H4YB 1L3TA 1JJCB 1TKXA 4MFBB 2QLWA 4RW9B 3B8HA 4IG0B 1AYEA 1OY6A 2M52A 4LIWA 1DFDA 2H5JB 5LL6d 4PWWA 2UUBJ 1Z2ZA 1CJVB 2J8AA 1SKUB 3MOJB 1WC5A 3ITHB 4JV1A 4PXEA 3F73A 5F3TA 1S7HA 5BYSA 4P2FA 4HHUA 4ZITA 2PC6A 3CCRS 2QA1A 2LQ5A 1WEYA 4JI1J 3CCZA 1YQHA 1KN6A 1J27A 2ZH8A 4PG6A 2AZ1A 5J2PA 5KT5A 4JI7J 3W7BA 4RBVA 3L7PA 1PJ7A 3GP9A 4RNOA 4MJKA 3R7NB 1UJ4A 2Q3PA 1SH2A 3OSNA 4C8NA 4UW2A 3T1HJ 4PCQA 3X1LB 2Y0SD 1R8BA 3MI7X 4PEOA 9ATCB 1LW2A 4IQXA 4K4WA 1F1BB 1XC9A 5I3QA 4TY8A 3BO4A 2B6AA 1D8YA 3PKMA 2EFNA 3QWUA 4DPTA 1JLAA 3HHKA 2RQKA 4ED1A 2A6OA 1TK8A 2DNKA 1P9YA 3GR1A 2ZKTA 3MEGB 1TL7B 4NX9A 3L7UA 2ZZNA 5L39A 1X4BA 4GO7X 4O0IA 1IBMF 2AF6A 3H5YA 2MZJA 5IWAF 4OZJA 2BX6A 2DGXA 5EUHA 3IR6B 3NL0A 1B64A 2VH7A 4EO6A 2LECA 2ZC3A 3HVRA 3BBCA 2DHSA 2XMKA 3MPDA 2DGVA 1YKWA 1QAXA 1HNIA 2CQ4A 2E9TA 3SDEA 1TAUA 4USMA 3EVWA 2FLOA 1U1KA 2SXLA 2CZ4A 2EFVA 4ED8A 4ILRA 2FGCA 4JV5J 4TQSA 5HO4A 2RIJA 2YNIB 1VBZA 3DLGA 4RW6A 1HBNA 2DR8A 3W9HA 5CYJA 3NGUA 3DXBA 4ZCKA 3V2UC 1UWBB 5KFEA 1IBCB 2W4CA 3MEDA 4USJC 2IJNA 4DR1J 3O2IA 1EQMA 1REVB 4QYZJ 2KT3A 1RADB 2HQGA 2KN4A 3BPDA 3KJVB 2N7YA 3ZZOA 3MD3A 3BEGB 1GX6A 1W7WA 2HZAA 1KC8T 4CLFA 4UUXA 1OSCA 1MWZA 2G2OA 2GS8A 2CNOB 1TL3A 1SQFA 4WP8A 4AUKA 2DNOA 4ED6A 3T1YJ 3DLKB 2ATCB 5HK4A 4KQZA 2XZDB 2YKOA 2AV5A 3OHBA 3FEYB 3HHEA 1FEHA 3F44A 3D5MA 4B3MJ 1SUQB 2AZ3A 4PR6A 2MKJA 2QYGA 1VI7A 3HSJA 4B3OA 5KFLA 7AT1B 2B3TB 1KFSA 3OTDA 3MM8B 4RW7B 4RWXA 1AUDA 3EWGA 2JH3A 1ULRA 4QIFA 4LRBA 2IRUA 1FCAA 4EBDA 2Y1IA 3A8IA 3CMES 4ZVOB 1FJEB 1RHQB 1J5EJ 4B08A 3IGNA 2R8IA 2BXJA 2MQLA 3QZ8A 1R8HA 1FRHA 2IYIA 5B0DA 2XI2A 3J80U 2J6SA 4RLEA 4LF5J 3NGDA 4PQUB 1ICEB 2CQ1A 2BW2A 3FJ2A 1HFEL 1M1GA 2LLZA 3B78A 1L3VA 1C0UB 2G0CA 4KGKA 1CC8A 3AOCA 4P10A 4GVBA 4O3PA 5KFGA 1FFWB 1LW0B 1ZTWA 2ZOGA 3VAMA 3HHNB 2JVRA 1PKUA 3C14B 2WOMA 3HJVA 3UO0A 4DV1F 3JYTA 1RAIB 2R8HA 1UPPA 4AXJA 1FNXH 1ZM9A 2AGPA 3BGLA 1TKDA 4PG8A 2C3PA 2DO0A 2CJAA 3PW0A 1YK9A 5J2NA 2L3MA 4LVOP 5HVHA 1TAQA 2AJFE 3OLBA 2OAUA 3TAMB 5BJRA 3EUNA 5CYQB 3FSYA 1HQUB 3FSXA 2D3O1 2IBOA 1B3TA 2Y1RI 1AT1B 3X3UA 1Z4UA 4DL0C 1WC6A 2H48B 4DV2J 2ZD1B 3MUVP 5H9EJ 2JVOA 1REGX 1I5OB 4CO1A 3T6JA 3RTVA 4NA2A 3QT7A 1SVDA 5BYQA 5DGBA 3LF0A 1BE4A 3QMQA 2VPWB 1OY9A 3PCOB 1G6BA 2B4OA 2DITA 4L72B 3D1OA 1YIJS 4B9SA 2WSCC 3FSIA 4HI1A 3T1AA 2ZM6J 3DKDA 1QDUB 1JLGB 3G96A 2HIQA 4P71A 1VQPS 1FJ7A 2MQNA 3IXQA 4YN3B 2A6MA 4DQQA 2ABYA 5EGYA 1AW0A 4MFBA 4LRDA 3GQCA 1VHFA 4RW9A 4IG0A 1RXOB 4QPXA 2HURA 1MLAA 1H2TZ 5DLFA 1CJVA 3RAXA 1NNDA 3M8QB 1RYSA 3ITHA 5C5JA 4DX6A 5CZXA 5A8WB 3RR7A 1RT6B 3R9LA 2K3KA 1FNMA 4DR3F 4D3HA 3M30B 2ZBQA 1BHNA 1MWYA 2P6SA 4P72A 4C8OA 1K47A 3CT9A 4TXSA 3E8OA 5JXSA 2V4RA 1Q7YT 5E3CA 5D4OA 3M2UB 4ZHRA 3QLHB 1S77D 1N0UA 4I4BA 4LMZA 3ZNJ1 4ZVQB 5IOLA 1S72S 1DARA 3HFZB 2B4UA 3K5PA 1EETB 3OFFA 4OHXA 2DCLA 1BWVA 1YGYA 4F3MA 4F02A 1D1UA 4DUYJ 4M5MA 2K7JA 4BBYA 3KK3B 4EI2A 5GADI 1M5VC 2E5IA 4LFAJ 1NDKA 1RT4B 3M9NB 2C22A 2F9DA 4DSFA 3HZGA 4N7TA 1JJ4A 1FKPB 2JEFA 3W8PA 3A3OB 1VISA 3MEGA 1FRLA 3T5HA 1K9MT 4C3LA 1TL7A 1X9MA 4FYDA 2YVSA 1TMMA 2RU3A 1S0NA 2OELA 3PR5B 5HP1B 1ZH5A 4J9UE 3JQJA 5LMUJ 3G8TA 3KDOA 4K0KF 1C1BB 4Q2MA 1RBOB 1S99A 2L41A 4PPDA 1OO0B 2H54B 3BR9A 2UZAA 4DI6A 2W2NP 2N4CA 2CWKA 3VVTA 5KFVA 3GG1A 5D15A 4QWAA 4FNHA 4QCLA 2ZFHA 3MR2A 2JL9A 2HHWA 5CD4H 2IVYA 2GFFA 3RAQA 3MPWA 4LJMA 2ADBA 2YNIA 2DGOA 1ZM2A 2K3IA 2BZ2A 4LF8F 2FLNA 3DM2B 3OLAA 4QU6A 1Q5VA 1UWBA 1J5OB 3M8SA 2M3DA 1PYSB 3D28A 3TX8A 2VD3A 1I3OB 2YKMB 1RAFB 3K58A 3SEOA 1APSA 3HVTB 5D4LA 3THPA 2HFVA 2JZ5A 3QIPB 3KJVA 3GIJA 4O3RA 3H2VE 1FTRA 2QZ8A 5EX3A 4OI1A 2E29A 2MKSA 4R0JA 1TUWA 3DLKA 1JWWA 3QJJA 2O3DA 1C4CA 4ZP6A 4JI2F 2DGTA 3CCVS 3QT6A 4JI3F 2MTLA 1SUQA 1NKBA 1HA1A 3DRRB 4ALZA 2ZJQQ 4UZBA 3BKTA 3CC7S 1VFJA 4RUHA 3D2WA 3H5XA 1JKHB 3MM8A 4RW7A 3NWGA 4TYAA 4MIBA 1IQTA 3GYGA 1RABB 4EO8A 4PG5A 2VU5A 3DYAA 3H0PA 3MAAB 3W66A 2KHDA 4GC7A 1RTZA 3KMSA 2IHR1 2VG5B 2UUCJ 1ZZFA 4XK8C 3DHXA 1U49A 1FDAA 4OYMA 4PQUA 2CA9A 1HNVA 5KFHA 4LSNB 2R7WA 1FJGF 4IFYB 1VQOS 3HJFA 3O6QA 1YI2S 2AD9A 1C0UA 1R43A 1ZAWA 4DV7F 2HQ3A 1NMEB 4NMXA 3W65A 1YBTA 5K8MA 3ENVA 4QYZK 2HFNA 4NCAA 1ZS6A 3EX7B 1CS4B 1LW0A 1EKRA 2HNDB 3NS6A 1S49A 3ONQA 1TQLA 1R0CB 3C14A 4ZMMA 5B7WA 4M5NA 3E01B 1Q8IA 4BHQA 6AT1B 4AYBD 3PJWA 3QFHA 2I2YA 1T9YA 1S1XB 1K8AT 2V69A 5B09A 5CYQA 4F0KA 1HQUA 1R31A 2GVDB 1XR5A 3N28A 4HEA9 1SJ3P 3C6UB 2BW7A 2Y8YA 3JSBA 4NLUA 2ZD1A 4ZLJA 3T3FA 2N3OA 4RU9A 4ED5A 1X8DA 3WBZA 4YDXA 2WB4A 5KG3A 3DMJB 3C8YA 4ZN1A 2IA6A 3R7BB 4CH0S 4URQU 3L4BC 4RBUA 1IXKA 2EI5A 3NNHA 2GJFA 5J1EB 3CGIA 2W25A 2ERRA 1JLGA 1RQ0A 2RUSA 1WSVA 3EXCX 3NEKA 1UVKA 2O67A 1X5TA 5DQGA 1HHTP 2ADCA 4CNYA 4EWTA 2NUUG 2RQCA 4C98A 2UP1A 1L3KA 2B9YA 4ICLB 4QIWD 1R7IA 1BLUA 3UE2A 4KHPF 1H38A 3E51A 2VODA 4JV2A 4MIWA 1S6OA 1HR0F 2C2MB 3M8QA 3GCWP 2GAGC 5A8WA 1RT6A 3HM9A 2GNKA 1R27B 1DLOB 3M30A 3ETOA 3I55S 3SMZA 2OJ3A 3C15B 4JI5F 1RACB 2QFIA 5F41A 4YB6A 3M2UA 3TZXA 1WKKA 4P9SA 5J2MB 3QLHA 3D7SB 4N5SA 4J9VA 5H9EK 1UKUA 4UQTA 4DR7F 3AOAA 3CD7A 1VQ7S 2NS1B 4I64A 2ZOMA 3W3SA 3DLJA 2GA7A 2VG7B 2IVMA 3FFIB 1U24A 4P2MA 4QWEA 2VZ9A 4ITSA 4RNHA 3U1LA 1CULB 1ZM4A 2X1AA 3AQPA 4H4MB 4DSIA 2VBXA 4FF4A 4OZ5A 3KK3A 2MZTA 2DRBA 1NBEB 5MLCV 3F0NA 4NA1A 2KM8B 4DS4A 3PX6A 1KP6A 1H2UX 1RT4A 3S01A 4CWBA 1RHMB 3WZ0A 3VALA 4DV3J 1FKPA 1NXIA 4LBIA 1EHWA 1WEXA 4USIA 3DCAA 2HHXA 3CB4A 4OI2A 3QQCD 3TUZC 2OPQB 1ZBTA 1MN9A 1OYEA 1WOOA 1KQFB 5G0RB 2B0GA 5GMDA 1IKYA 3SSSA 3N5FA 3R2DJ 5HP1A 4QW8A 4LQ3A 4J9OA 3IR7B 4CLSA 1Q8LA 4KR0B 1FDNA 4M94A 5F9NA 4TQRA 2EC2A 1C1BA 3C66A 4AMOA 2A2DA 2HQCA 1WI6A 2ZH3A 2RT3A 2BBEA 2AJQA 1SC6A 5IC4B 1TUVA 4U7CA 4EYIB 5LMNJ 5ITHA 1IBLF 4DR4F 4DFKA 3KHLA 2R42A 2WK4A 2OD6A 1RYRA 1JXLA 4C11B 2KT2A 4NXMF 3KLFB 2JFKA 3I5CA 2AP6A 1HNXF 3N9UC 4X4NA 3P6YC 2C3OA 2BOPA 5K14B 1KRPA 5C25B 1X4DA 1JLFB 2XLKA 3MHYA 5KOWA 3DM2A 2FJEB 2ASYA 1J5OA 4E98A 3ENAA 3KUGA 4X64F 4XO0A 1WC0A 3CIMA 2LFVA 4LF4J 1NM2A 2YKMA 3H59A 2Y3YA 3GJRB 4R25A 1RLDA 2DY1A 2JNJA 4NLXA 2HFOA 2YWHA 3ZZPA 2OGUA 3QIPA 3UW1A 5DGAA 1BQXA 1N6QA 2VKZG 2D41A 3HX9A 3NMRA 1CJKB 2NSCA 2XNQA 1VRUB 2YTCA 4WXWA 3J81j 3AB4B 1V3RA 2CPIA 2IA0A 2YBVA 2NYIA 3OPKA 4DDFA 3SSQA 3T9ZA 4RW4B 2J76E 1X31C 2EBGA 2EG1A 2R7TA 3DRRA 2IAJB 3SIPB 2EC0A 2XWXA 4RNNA 3EICA 3KJNB 4K4TA 1JKHA 2VPZB 2CNLB 3W60A 3W61A 3D66A 3QNWB 4HACB 4C8KA 1HL6A 3TW0A 1TTHB 3MAAA 1NSKL 3QAUA 1VIOA 5L1KA 1PSDA 2VG5A 1FE4A 1RWXB 2DRAA 1UP1A 4TN2A 1U2CA 4QR0A 5DM7Q 5F9LA 3H90A 4LSNA 1VJQA 4IFYA 2RNEA 4DV5J 4TU9A 2I0XA 3CNQP 5IT9U 4RKUC 2V2ZA 3N6LA 1NK0A 2DB1A 2EFQA 4QBUA 4Y28C 5F8GA 2R2SA 3VCDA 3IN5A 2HNDA 1U6BA 2AJ1A 2F3JA 1RHUB 3QT8A 2MSTA 1YRTA 1XMBA 2LEPA 1Q95G 3DOLB 3S8SA 4FYYB 1YJWS 3N79A 3WX8A 2BRLA 4OQJA 1S1XA 2OKQA 1Q16B 3OVBA 4N8NA 4KHMA 1S5ZA 1FESA 4OZ2A 3UR0A 4ZCMA 4FPIA 3VZHA 3CDAA 2V8DA 4XIUA 2GVDA 1LK7A 1X0FA 1GXLA 3Q89A 3EPIA 4XAKA 3C6UA 2J6UA 1VQ4S 3ULHA 2VFTA 3QRQA 4NLDA 1IKWB 2G1DA 4CO2A 2UV8A 4KFBB 3KYLA 1WD6A 3DMJA 2R8JA 4NPOA 2MKCA 2QC3A 3TA0A 1HNWF 4U7UK 5MAOA 2VOPA 3VVUA 1OWXA 5J1EA 4PKDB 3LW5C 3ISND 1UVNA 5C42B 2YWGA 1GX5A 2OEKA 3GV7B 1X0PA 4BWMA 2JDJA 1WTBA 2COLA 2FZKB 3D0GE 4NEZA 2FJVA 1EJ7L 3LP1B 3QGIA 4PG7A 1QUPA 4ICLA 1CEZA 1YJ9S 2J9DA 4IYQA 4ETXA 1N54B 4GVLA 1Q53A 4OX8A 3Q8UA 1NAQA 2BA9A 5DDPC 1OJ4A 2OEJA 4WYWA 2ZH7A 3CJ8A 4NYOA 2ROPA 1NK9A 2DEIA 1DLOA 2PI5A 3OL7A 4M5JA 3C15A 2LP4A 4J7CA 3RYLA 4YY3J 5H9FJ 4WPAA 1SL0A 4YB5A 3V4MA 3S6EA 3TZYA 1B7YB 4JI8J 2AGOA 2J9DE 2RS8A 4NWBA 1MU2B 3QYYA 4F8RA 4DZDA 4LF9J 1N48A 4Q5VA 2MZSA 1C2PA 3LAKA 3UNYA 4IOAQ 5IT9Y 1H7XA 1CULA 2ZH1A 4H4MA 4DS5A 2C2ZB 2CQCA 5KFFA 4ED4A 4A46A 2QV6A 3MMBB 3OL9A 3M9OB 4CT9A 1MMDA 3UNGC 2FUG9 2V4QA 1WF0A 3O5TB 2CZVC 2DISA 5JMNA 1RCOB 2FQQB 4NA3A 1CJUB 3KUEA 5L1JA 2EKNA 4OLPA 1YBAA 4PYDA 3MUTP 4OI6A 4ZJQA 2Z2LA 4ZPAA 2OPQA 1FRIA 2YY3A 2XMTA 1I94J 3TX0A 5G0RA 1BQNA 3I0RB 3R5CA 2PFFB 3J7A1 5KFSA 1FDDA 4LQ9A 1DQ8A 2B43A 2RAQA 2XSFA 2HHHF 4WFYA 1LFWA 3UD3P 3SFGA 1KHWA 2XMWA 4ZK7M 2ALYB 1KQKA 2MJNA 3FEZA 2Z58B 3LANA 4GMKA 4S0MA 2MYFA 4J91A 1ZAVA 1RISA 4LBPA 3KLGB 3TJ8A 3D68A 1U1MA 4IO9Q 4C11A 3KLFA 3MF5A 1VBYA 2XB2D 5K14A 4UT4A 2OPRB 2JRSA 1JLFA 1WG4A 3IRXB 1FWLA 2MLXA 3M8WA 4Q8EA 1H7WA 3SSRA 4OYZA 3K8VA 1SH0A 3FGVA 4NYPA 3AJDA 1TK0A 2ZKUA 2HZVA 3OD2A 3T5LA 4URSA 2HWIA 1K0TA 3DDNA 1JJHA 5GAHU 3MURP 1KBRA 2DNYA 1CJKA 1V3ZA 4DSLA 3C2PA 1VRUA 3CD5A 2EK1A 3Q2SC 3OTOF 1HWJA 4LF1A 5E7OB 4RW4A 3QRRA 1KVKA 1J2VA 2ZHOA 1PYOB 1N5YA 1OMSA 2IAJA 4JBCA 2JEGA 2D69A 3QBCA 2RRAA 5E2QA 3HPOA 4U8VA 2J0XA 3LO3A 2MZRA 5HVGA 1XMOF 3NAIA 1IBMJ 3FBBA 5IWAJ 4HACA 3TOQA 4QWBA 2V50A 1URNA 4C48A 2YQ1A 2HQFA 3SBMA 4DL7A 3FBFA 4WJBA 1M90T 4HR2A 4KC5A 2JWNA 1CJTB 2G1HA 2QRRA 1AZSB 2VV5A 1BUXA 1UJ5A 1D9AA 4K5SA 4ANDA 1F2GA 1NLKL 2FJBB 3PFOA 2DXEA 1G7CB 3EZOA 3ICLA 1HARA 3GILA 1AROP 4RW8B 5D0EA 1HNZF 3OUYB 1X5SA 3W1YC 1WHYA 3KKFA 4JB8B 3VF0B 4USTA 2PN6A 2IPOB 4IG3B 5A2QU 3BGUA 4CZCA 2W8KA 3IWXA 4WU3A 3N5BA 1PAUB 3CVKA 4B02A 3DOLA 1EIYB 4N76A 7FD1A 2BV3A 2G2YA 4CYUA 1M5SA 1K44A 4IFVB 3FKBA 2EKYA 4DF4A 4DV0F 1SJ4P 2E1PA 2YXLA 2DNHA 3JSMB 3GONA 1WOPA 2AWZA 2E5HA 2C42A 3K5MA 2GC8A 3TP2A 1NJWA 2KT5A 5ADZA 3MWBA 4BC7A 2WVDA 2W01A 1T11A 2H5EA 2Q6BA 2RU9A 3IC1A 1IKWA 4FF3A 2DHHA 2HG4A 3AHPA 4KFBA 4OI3A 3PRVA 4C3KA 1Q78A 5DDRC 4LVNP 3GIKA 3DGPA 3CDUA 2FZCB 1M5OC 4HT7A 2I9SA 3TO8A 3MR7A 1V9OA 3VHQA 1VK3A 3R97A 3VGSA 1VQ5S 2C3YA 3TEHB 5C42A 3UD4P 2VBYA 3OXFA 2HBZB 4DSJA 1XBWA 2VFSA 4K5RA 4OZLA 1S0VA 1XWLA 3GE9A 2UUWA 4C7QA 2MZ1A 2AYMA 3HF5A 2WW8A 2B51A 3LP1A 4FXDA 2F4VF 2W9BB 4KT0C 3W8GA 4J9PA 4QIEA 3M2VB 2KFYA 1WKJA 1RK8A 1S59A 1BD6A 3OVSA 3POTB 2GX8A 4B17A 2ZZMA 1SPBP 2RF2B 5A0YB 3P49B 3EDQB 1T9XA 2XS2A 5CA5A 1VQLS 1X4EA 1RBLA 4ECZA 1JLQB 4F3QA 3CCSS 5U47A 3T6BA 3CTRA 1NEEA 2WVCA 3H42A 4YUDA 1S1VA 3A4TA 4DV1J 3OTEA 4J5OA 1KLNA 4GO5X 1IJEB 3CJQA 3OR1B 4B9NA 1MU2A 5CQGA 2WW4A 4QW9A 3PKYA 5FDLB 1Y3JA 4DCJB 5KFMA 2DBBA 3KHRA 1YSJA 5L9NA 3D3BJ 4DUZF 3W5YA 5F8JA 2GIRA 1S6QB 3IWLA 2L9DA 4Z2XA 5FIIA 1RDRA 2HMIA 2XO7A 3MMBA 3V4IB 3A12A 4NYZA 2XCAA 2AYEA 1TL5A 4ILMA 1WHVA 4RO0A 3Q8QB 5A2QY 1FDBA 4ECVA 2PMWA 2V4JB 4F25A 4WP3A 1H2VZ 1RT3B 1AB8A 2YX1A 2GCFA 2G9OA 3GV5B 1RHKB 3QJLA 1RAHB 4USUA 2E5GA 2I6WA 5KTQA 3CCWA 2C2NA 1PBAA 3AFGA 3JSRA 3DU5A 1FJCA 3OTCA 5IZHA 2YWKA 1KDNA 4PPZA 5SUHA 3DRSB 2Z56B 3DI6B 3GTYX 3M6XA 4OYBA 3ZZ0A 2JX2A 5H9FK 2IJFA 3K5OA 4ZPBA 1OQ6A 3TNVA 1M5PC 3ENQA 4DCOB 3KLGA 1BC6A 4J9LA 3IMQJ 4DQRA 3KLIB 1NUEA 1GTHA 4DR3J 2ZUGA 1S6PA 4NZ0A 1VQKS 5CD4A 4F4KA 4ZPWR 4R8UB 3NY0A 2OPRA 4CLWA 5M2PA 3IRXA 3G8SA 1H98A 3MCSA 2NQPA 3AA9A 4BC9A 2CJXB 1RAGB 1S1TB 1S0MA 4Y00A 3VV2B 3SI8A 4G65A 3S1TA 4TNOA 5C2GA 5KT6A 4ILLA 2QLBB 1CLFA 4BDPA 1IBKF 2HS4A 4A4JA 1GMWD 1X4HA 1IR0A 1HHSA 4YOEA 4DEZA 2P9EA 4EUVA 3Q2TC 2D3OR 2ZH6A 1GK8A 4JYAF 2ZBCA 4RPFA 4M95A 3H5SA 1RWKB 1P1TA 2FLPA 3OFEA 4WFNQ 3CWJA 3IFEA 2OFGX 1N0VC 2ZH5A 1GQEA 2QSFA 5CYMA 3H4BA 3M8PB 1DHMA 4UY85 4Y3CA 2L9WA 4YFUA 4L6V3 2FLLA 3GU0A 2HWTA 4K0KJ 3JTPA 2FDNA 2XI3A 2YWWA 5CXTA 1D9DA 1RB0A 5I3UB 2YWFA 1U0SA 1KOHA 3AD9C 4UOCA 5AXKA 1GEHA 2FYXA 2CPYA 1PCAA 1RT2B 5DG7A 2FHJD 2W4PA 3VQSA 2WHOA 3U1NA 2OMLA 5DLGA 5GAGI 3F56A 4RW8A 1CQMA 5HVFA 3OUYA 3LGNA 3SYZA 2K2PA 3DOMA 5F8MA 5FD1A 2Y8WA 1YVFA 1ZA1B 2YKAA 2X7IA 5D0RA 1X9SA 4LF8J 4IG3A 3GIMA 3VTIA 2U2FA 6FD1A 1VC5A 4DFPA 1HBMB 3CXCR 4ENOA 4O4GB 4CNZA 2O66A 3CDWA 3HDSA 4ED3A 2PA3A 3DRYA 2ZE2B 3JSYA 1M0SA 3CF5Q 2LXUA 4ZN3A 4PXCA 4IFVA 5KFIA 3WC2A 1HYSB 2LYVA 3TEGA 2Z2YB 2WONB 3W64A 1FE0A 5K5MA 1N8RT 1KQSR 1MNEA 3CJ2A 4MKBA 1VQNS 1RLCL 2I8EA 1IKXB 4L76A 2CYYA 3VQTA 2DGQA 4JI2J 2IY5B 5ETOA 4F0HA 3C3LA 4F04B 4JI3J 1UJ6A 3EGWB 2AX1A 2HSEB 3UPFA 1S1UB 1T9WA 5E3QA 4OMFG 4FF1A 3H5UA 3OFHA 4OI0A 2KYZA 2RB7A 2ZH9A 3R3TA 2XBPA 2A3JA 3NKYA 2QGFB 2CG8A 2DK2A 1NZ8A 3O3LA 1BGXT 2QLXA 1VIXA 2DTJA 2DNQA 4DFMA 3RAMA 3V6JA 3K17A 4I69A 4B9MA 1TVRB 5F8IA 4KSEB 2DNLA 4O44B 2DT9A 5F0WA 1QD1A 4B3RF 1SJRA 4I6AA 2N82B 3MM7B 2W9BA 3ELHA 1FJGJ 2CNNB 2CVEA 3I31A 3LQVA 1FD2A 4EBEA 3M2VA 1VQYA 4DV7J 1FERA 2BM1A 3CCES 4TY9A 2VQEF 2Z57B 1OS5A 4K8RA 2RDIA 3POTA 3P45B 2BE2B 5A0YA 1IR2A 2POKA 4OX7A 1DURA 1UZHA 2PE8A 4P7TA 1IM4A 1JLQA 1RWVB 2MY8A 1Q1KA 2GQCA 1YTYA 3Q24A 1TK5A 2IM0A 3RRHA 2HQDA 2LXFA 4B3MF 3AD8C 4AQYF 3M2RB 2UUTA 3CIZA 1RTJA 4DG1B 3D4JA 5FDLA 2Z0GA 3V6HA 2B7BB 1Y00A 1IKVB 2CJQA 1M5KC 2V94A 5B0AA 3D9BA 1S6QA 4P7VA 4C8LA 4WU2A 1KOOA 2HKEA 2XCPA 3NNAA 3MFIA 3BYRA 1WF1A 2LEAA 3V4IA 1H72C 5T7LB 2ZH4A 5AT1B 5DQHA 4X62F 1NK7A 2M9KA 2IM3A 2JHEA 1XIQA 2EWHA 4PZVA 1D8ZA 1QSSA 2V4JA 2DCUB 1QE1B 3R5JB 1DZ5A 1RT3A 4KGVB 4N77A 3MM9B 3ET6A 4FZVA 2V9WA 4F4WA 2HFSA 1X4AA 2HEKA 2CQGA 3FVYA 2R4FA 2CPZA 1U6FA 5EWEA 1XNRF 1JLBB 1VJWA 2FJWA 1NK5A 2Q66A 5JUMA 2OEMA 4P6QA 4A48A 3DI6A 4KRWA 4QIVA 4NCBA 5B08A 4NEYA 4RU2A 5K9FA 4KHPJ 2CPHA 3R1HA 1HR0J 4DQIA 3GCXP 3KLHB 3G4SS 2B8PA 4K4UA 1SB6A 1Q86T 4WFZA 3UDCA 4DX8H 5KG4A 3KLIA 1NSQA 1KD1T 4JI5J 4PG4A 5ETPA 4R8UA 2W9AA 4DL4A 4PQAA 4UOHA 3G6XA 1VLYA 1RT1B 2RMLA 2FY8A 5EDWA 3PO4A 3A8JA 4DR7J 1HWLA 1QAIA 2BJDA 4HYKA 1S1TA 2HRTA 3JAMU 1IJFB 4LREA 1VRQC 2GVZA 3PJ9A 4MK9A 2VA2A 1NSPA 2UXCF 2MEWA 3GPAA 4ZP9A 4IRKA 2C3MA 2QG9B 3UDVA 3AODA 3OT9A 5GAEU 2CWXA 2KL8A 5AE2A 4HDGA 2LA4A 2C28A 2IBKA 2OIHA 4DOZA 3MFHA 4OZ3A 2PT0A 1AFIA 2YH0A 1HBUB 1ACMB 1C4AA 3IO1A 4HLBA 1IUJA 1N33F 3DFEA 5KT7A 4CLZA 3QO9B 3BSNA 1YZ7A 1WC1A 3VWSA 3QSIA 2JEJA 1W26A 3F41A 4MIAA 2D74B 3M8PA 4OYXA 5KAKA 1VQ8S 4B3TF 3NNCA 2DYAA 4YR0A 2VUGA 4PUOB 4FYWB 4U8YA 5IT0A 2ZBRA 5I3UA 4TKTA 2NUHA 2M0GB 2ACYA 1YZ6A 2BJ3A 1RT2A 1IBLJ 4DR4J 2XSJB 3NXZA 3FBEA 1Q82T 4WXOA 2QJ3A 5LSLA 4F0MA 2E1AA 3GYXB 4NXMJ 3TVZA 3DHWC 1U1QA 4IRCA 1HNXJ 1SC1B 2WVFA 4MK8A 3VAJA 2GZOA 3H2UB 3N0VA 1VLOA 1NDLA 1HBMA 4X64J 4ZPCA 3J7YU 2ZE2A 4FN5A 4LRCA 3VAGA 4ECSA 4M5IA 2JC1A 1IWAA 4Y2MA 1PAEX 1YDLA 1HYSA 2D7SA 1VRTB 1TFYA 3M1VA 3V81B 2CZ9A 3MMCB 4NLRA 1FHTA 2FJAB 2WONA 2ALZA 4K7QA 2CDRB 3ILOA 1F60B 1KVJA 2VASA 2W24A 2AMCB 2VFVA 3ZC4A 5KFWA 3W2VB 3TANA 4XDCA 2MLZA 1IKXA 5D4PA 4USKA 2VQFF 4CCHA 5LXRA 2YKNB 3HKZD 3PYEA 3D1HA 1LQ9A 4F36A 4I1TA 1S1UA 4ECXA 3DC2A 1RI7A 3WX4A 5D0GA 3MPVA 3KG4A 4FKXA 3HFVA 4I2QA 2IC3B 3BS9A 2C2EA 3JAMY 1MMLA 2EFGA 3BBFA 1HWIA 1M1KT 5KFAA 1RHRB 2N4DA 1TVRA 5KFXA 2CUYA 1F9EB 4I6WA 4M5KA 4O44A 2XTJP 4TLRA 1KQGB 2UXDF 3MM7A 2GIFA 2FJXA 4JI6F 4OLOA 4AMMA 3GG0A 4X4SA 1W2IA 3QATA 1SJQA 4ANCA 2P2CB 1CG2A 3D0HE 2JLGA 1IN0A 4ZPVR 4WBFA 3AY0A 2BE2A 3H20A 2HVHA 2MGZB 1ZM3A 2MJUA 1O51A 2BRKA 3ZNUA 2DPJA 1DTQB 2CQPA 1IVZA 3WIVA 3CPWR 3RG6A 1T3NA 2J9EA 1WDDA 4CTAB 2Q79A 2MY7A 3TVKA 4ZVSB 4IKAA 1RWUA 4NCGB 3LUYA 3NCPA 2VOOA 3M2RA 3QAEA 4DG1A 4R5PB 4DR6F 4CRJA 3PX4A 3TR5A 1IKVA 2CPXA 4X4QA 3ZZYA 3BR8A 3LGMA 2CPFA 1LWEA 3HSGA 3JTOA 2NPFA 3ISZA 2YQ0A 1X4FA 3U02A 2HVIA 4ELTA 5T7LA 1GXTA 2D1CA 1T02A 2EXUA 3Q22A 2BJ7A 3CSKA 4OV6A 3PYFA 4X84A 1QE1A 4U6PA 1S79A 4JI0F 4K50A 1XQIA 4K4SA 1V3SA 1HNWJ 4KV8B 5F3ZA 3MM9A 5IS2A 2BABA 3CO9A 4QPTA 3VAIA 3M7VA 4NXNF 1YJTA 4W4MA 3MPUB 3NBPB 2DGWA 1TKTB 1X5PA 2AJ4A 4WE1A 4QWDA 3JB9k 3LWMA 2KVQE 3ILLA 1JLBA 1RTIB 3GFYA 3EXYA 2XO6A 1YJ7A 3QT5A 2E7XA 4Q0BB 3R27A 4QWCA 3CCJS 2R7SA 2AEJA 3CJTA 1WNEA 3CULA 4ZCLA 1FRJA 5BR8F 5HBMB 1VOMA 3OW2R 1C1CB 2OLWA 4DV6F 2NZ4A 3TVYA 1T03B 5HMXA 1AA1B 5E3PA 4DMZA 3W9IA 5CABA 3BM7A 2J7WA 1GH8A 2W2PP 3PW2A 1U1LA 2Q43A 3O8WA 1RJJA 1RT1A 3MCNA 2DNGA 3CCQS 3OXLA 2NPIA 3MUMP 5KFJA 1D0EA 1S76D 3GV8B 3HD1A 1F6TA 4C6AA 3BGRB 2XNRA 1HWUA 4F7VA 3MM5B 2XS5A 1NHKL 1VBXA 2DIUA 3HT0A 2LCWA 2DXFA 1N36F 1XR6A 4LUBA 5KFNA 1HBUA 3ZZUA 4DLGA 3N4WA 4FYVB 4CLTA 4JOUA 3MM6B 4MKVA 1XNQF 3D0IE 3QO9A 5CHCB 3EMTA 1B70B 4HI2A 2AYBA 5CCMA 2RUGA 2QSWA 3IG1B 3G6ES 4YP3A 4NLTA 3EZUA 5HROB 3GYNA 4KGXB 2KRBA 2XEXA 2AT1B 4PUOA 4X66F 4B9TA 1PG5B 3OQ2A 2HHHJ 2PDAA 3I9V9 5JVHQ 2DNZA 2OO4A 4CLKA 2BMBA 5D0HA 4UOGA 2VBZA 2FJDB 2LU1A 3I4HX 2UU9F 2DNRA 5KFPA 4C2MA 2F40A 1SKWA 4WFXA 3GFXA 4MMOA 2DR6A 1HIYA 1JNZB 2ZWPA 5GMKa 2ZNYA 2E5LF 3KLEB 2NXNA 4RUCA 1S9GB 4UZCA 4WWSA 1IM6A 3HSZA 3MGJA 3LP0B 2BJEA 2VONA 3HHLD 1NB7A 5ETMA 3BBBA 1NKEA 1S1WB 4U9RA 2VDIA 2IFXA 1D3WA 3OR2B 1VBKA 4ER8A 2C2KB 1HBOB 1SCJB 4Y2IA 2EVZA 2DGUA 4F2SA 2CXEA 2GHVC 3SQOP 1FRMA 1VRTA 2B9WA 1ITPA 1YX2A 3G8QA 2HLTA 3DGVA 3V81A 5E5NA 1Q8BA 2OFHX 4DPOA 3M9MB 3TAQA 3EVOA 1UFWA 3CW2C 4M1KA 4ECTA 1S0OA 5IC6B 1JIHA 1U26A 2DPIA 3W2VA 2P9CA 1U25A 4LT6A 3OTOJ 5DJBA 1HMVB 2JC0A 3MOZA 1N5SA 3HHLC 3FMWA 3N01A 3J81U 1IQZA 2XLJA 4KYZA 2HQIA 2R3VA 4J9NA 1XMOJ 4LRFA 2E9ZA 2H1YA 3OBIA 4YR3A 4XPCA 3M8YA 5L38A 1U1OA 3ZTQA 2OP5A 4EBCA 3SCLE 4OYWA 1JQGA 4DU8A 1YRXA 4DR5F 1WF2A 5CAAA 4G3IA 3D6MB 1E6VB 1GT8A 1DQ9A 3A3NB 1TL4A 3BGFA 1FA0A 2M8DB 2MQ8A 5GMEA 3FDSA 4P2SA 3IM8A 4Y2AA 3UWTA 4DJBA 5LM7E 4MKAA 5J2PB 1L5UA 1TUGB 5DG9A 2MQQA 1HNZJ 5AJ3F 4ED2A 1EKSA 4WIQA 3D6FB 4DPWA 2MGZA 4C0BA 5K8PA 2ZOFA 1DTQA 2MQOA 3RW7A 3QSYB 1LW2B 5DETA 1WHWA 2DIVA 1A0OB 3NLCA 3J7Z5 2LDIA 3B6BA 2GHPA 4CTAA 4NL5A 1REVA 3KLVA 2H65B 3D1QA 4V1Ak 2XGPA 4DV0J 4NCGA 3DDIA 3OFGA 3MZIA 2HZCA 1B99A 4R5PA 4H4KC 1T9TA 4KPYA 5HN0A 2V6AA 2CKWA 1JB0C 1U0HB 2YNFB 4H4KA 3PY8A 1WG1A 1CC7A 3CCMS 1XEZA 1FKAF 2APOA 4TYBA 2QX0A 4FXWA 4HDHA 4ED7A 3E2EA 1R89A 3M6VA 3GFZA 4I7FB 2J8SA 2LVWA 1U2RA 1O0PA 1MG7A 4I67A 2DGSA 1Y7PA 4DN0A 3U1MA 5THWA 5IFMA 4KV8A 5C24B 5IV3A 5EX0A 2N3LA 4NOHA 2F65A 1CQNA 2XMMA 2OSQA 3DRPB 4OX9F 4X4TA 3NBPA 1VC6A 3D67A 1KLMB 4CO3A 2C2DA 3CJ5A 4ANEA 4KJIA 2G0JA 4RR5A 1RTIA 3MEDB 2NYHA 4DN9A 2Z4PA 4ZVGA 1F2HA 4ATNA 1RAOA 5L1LA 2F4VJ 4Q0BA 4KAIA 4PXBA 4J9SA 1T05B 1RAAB 3BDEA 4DU7A 3N6NA 1VQ6S 4YS2A 1T94A 3PW5A 4UUWA 3TZZA 3EYZA 3QJPA 3J81Y 5HBMA 1WEZA 2CQBA 1C1CA 2VPYB 3PEHA 4XPEA 1WJ9A 4IOCQ 1T03A 3CMAS 2DH8A 2F63A 2X3DA 1TL3B 2O5DA 1S9EB 3DNCA 1Q79A 3HHDA 1NPPA 4F2RA 2YX7A 3G82B 2RJZA 2E1CA 4HHJA 5HL7Q 4H4OB 3RBZA 3LP2B 3EGVA 2D9OA 3TAMA 1BMQB 4WFBQ 1N34F 4I2PB 1PC5A 4DUZJ 3BGRA 4UY8T 2QA4S 3MM5A 4GKJF 2M2BA 2NSBA 1SC3B 1FVSA 2N7CA 1Y5LB 5E33A 1QSYA 1FVQA 3UDLA 4QZVB 1NPRA 3BO3A 3MM6A 1TZ0A 1VCTA 2F9JA 1RT7B 2IIHA 1P1LA 3I0SB 5BXIA 5D78A 2CJ9A 1YLXA 3Q0AA 5HLFB 3H98A 3IG1A 4I0WA 2BR0A 1BQMB 2MLYA 5KFBA 2KDOA 5HROA 2QN6B 1HKAA 2R7RA 1S9FA 1UETA 4I68A 4DHVA 1UEKA 3TYTA 4ZVEA 5IV4A 1RA7A 2V68A 3VAKA 2WOMB 3LA0A 5CH7B 3JYTB 2F8HA 3CC2S 3FQLA 1TR0A 3KUHA 1U1RA 4OI4A 3HVWA 3K5LA 2J0QD 3I6PA 4YHHF 9RUBA 2MQPA 1O8BA 2H51B 4F26A 1S9GA 4ZVPB 1X7VA 2F8MA 5FJ4A 1KTQA 1SIZA 2GQ2A 3LP0A 1UEVA 4ZVTB 2ZC4A 4HHHA 3PW4A 2K8GA 5D8HB 1S1WA 1R3NA 5DO2A 2CVIA 2VC0A 3OR2A 1JXEA 4FDFA 3KNGA 1GXUA 2XM3A 2Z2MA 1Q0NA 2WVEA 3MCOA 5M2UA 1E6YB 1EETA 4DL3A 3BREA 4X4RA 2VKRA 4C4WA 4O3SA 3HLUA 4HKQA 1IBKJ 3I9ZA 5IM0B 3EDRB 1FRKA 2PIIA 2RVJA 3FMBA 3GWCA 1XR7A 2DNPA 1MN7A 3BQ1A 2VIHA 3QGPA 4JYAJ 2F8EX 1NO8A 2B4VA 1H0HB 1HMVA 2AJ0A 3PO5A 4IR9A 3NGTA 3PRDA 3SCKE 4C0OC 2ZBIA 2GJ2A 1FWPA 1SH3A 2VDHA 4RX6A 3HT3A 5D6GA 4ZJOA 2MKHA 2MMYA 1RWMB 2IRYA 2WB1D 2DH7A 3MR6A 2DKOB 1NU4A 4HH0A 4M5LA 1WWHA 5F0UA 1RKJA 3K7RA 3BF4A 4DPUA 2MB0B 2EFOA 1UVJA 1A9NB 1LOUA 4ZPTR 3R7SB 2HHTA 4ZHRB 1E6VA 1KTVA 2HNZB 3KHHA 4ZOSA 2DR5A 3ZZZA 1G2EA 1KWMA 4B3SF 2XMUA 1XK8A 3K2YA 4UQGA 2DJWA 4ELUA 4J9KA 3TI0A 1KEKA 4YDDB 3NAHA 5FLXY 1FX4A 2DEJA 2ASJA 2XG8A 4KH1B 1NKCA 1UZDA 1T7PA 3KXDA 1SL1A 4ZIWA 3NOGA 4AD6A 2W2MP 2GQQA 2OTLS 2DHGA 3H4DA 4GKKF 3K5NA 1GMVA 3HVTA 1UFKA 4KBIA 3BV8A 1LWXA 1U7LA 2CJBA 3SCJE 3I96A 3RB3A 4F4AA 3DN9A 5KFKA 4OV1A 1RP5A 2FC9A 2FC8A 1U0HA 2YNFA 3W63A 3L09A 4X65F 2CQ3A 3CCLS 3OJUA 2XZWA 3ZTRA 2V63A 4OYPA 3RGIA 2QL5B 4RBTA 4ECRA 1U2FA 4I7FA 1N4LA 4FS2A 2GW8A 4M63A 3A8KA 4NE9C 1CSJA 4C9DA 1V6HA 2HFUA 1MMNA 2VL1A 2HVDA 4L75A 3Q8SB 5C24A 5EWGA 3CEDA 3M05A 5HI7A 1FKOB 3DRPA 2RDDA 1LKZA 2B9XA 1KLMA 2FHKA 5E3RA 2JJ4D 1WG5A 4OJHA 3T19A 4B3RJ 3GB0A 3PM9A 4RNFA 2HNYB 1UW9A 1N88A 2KZZA 4LBHA 1T05A 2BJ1A 4GC6A 3RJMB 5BYRA 2VQEJ 1QJHA 1PILA 2RHQB 5HMYA 1UVMA 2HWHA 4BS2A 3CD0A 3Q23A 1ZPVA 1CS4A 4PABA 2DRDA 2R9LA 3AAWB 3IM9A 1UEUA 2LKZA 4I6YA 3LTOA 3CJ3A 2AQ4A 3OHAA 1S9EA 4CDIA 3IAM9 3E01A 2BANB 1LNQA 1N5VA 4X4PA 2RD5C 2KU7A 4DSEA 3AXMA 3PDNA 3G82A 3T9NA 4HT5A 4H4OA 1QM9A 3LP2A 4YB7A 3C16B 3H40A 1F0XA 4AQYJ 1NJZA 4I2PA 3R5DA 2K1RB 1Q5YA 2OPSB 2Z8QA 3MDFA 3WQPA 1BXNA 3LGHA 3DYAB 1U8SA 1S57A 4DV4F 4DL6A 4PWDB 2B8QA 4X62J 4DQPA 4G1PA 5IXUA 1SJ1A 4IR1A 2VA3A 4DXLA 4UOFA 3CJ4A 4A8YA 2RKIB 1PJ5A 1HNVB 1U48A 2WCXA 1RBAA 3PACA 1QSLA 2PFDA 3ETMA 1YRUA 1RT7A 2MQMA 2ROGA 3I0SA 4V19J 1S4FA 2OUGA 2VZ8A 4C8ZA 2UUAF 1SI9A 5D3GB 2PD1A 2W1BA 5HLFA 2P8IA 5DS7A 4DF8A 2KYXA 2XWYA 4LF6F 1BQMA 1HI1A 3TQ1A 2HHQA 5DRKA 1XNRJ 2W2QP 4GRSA 2YX4A 3TWZA 1SXLA 2RQMA 1VDHA 3TJ9A 4USVA 5F8NA 1XTZA 4FNIA 1XERA 2C2OB 1NK4A 2OHDA 3CDEA 3KG1A 4RUBA 3HCXA 3BN7A 3WHIA 1Y11A 5B0BA 2MZQA 1PC4A 1F5BA 2IMWP 5LJ3Y 5D77A 3AOBA 2O01C 5EWFA 4YEAA 4ZP8A 4Y65A 3C6TB 2FIUA 4FKYA 1N32F 3RRGA 4ECWA 4RUAA 4HVZA 4FBTA 4OFZA 3ISNC 2RHSB 2DO4A 2O1PA 1T0TV 4IUFA 1KKHA 1T8EA 5J2MA 3R6GB 3OL6A 2CG4A 4JP8A 3U27A 2WZ1A 2C2RA 1P9QC 4A8WA 2VG7A 3T5KA 3PIPQ 3FFIA 3E3XA 3CDBA 3I4PA 1E6YA 2W7PA 3G71S 2UXCJ 3LOUA 2FVQA 1Y0HA 2FHMA 1KFDA 5IM0A 4FVMA 4DBQA 3LPYA 4J37A 4AE5A 1U09A 2QO3A 1JJ2R 3AT1B 2E44A 3M32B 2HBRB 1QLNA 1TU0B 1N33J 4URGA 1RCXB 4U95A 3SQGB 2YPZA 3R5GA 4Q45A 3PHTA 2QL9B 5A8RB 2I5JB 2CQHA 3GJTB 3NS7B 3I87A 3PRBA 1G1XA 4B3TJ 5L46A 3NGSA 3MECB 4CLPA 4CP5A 2QMUB 2B9EA 2HGMA 1HQ2A 3Q83A 3MR3A 5J1PA 3QIDA 2X1BA 4IDKB 2E7WA 2HNZA 5GAHI 1ZPWX 3HULA 2HRUA 3J80Y 1CBKA 4NLSA 2OD4A 2PEHA 3CO0P 1DQAA 3PFEA 4IQMA 2V2QA 1SIWB 3HD2A 2HVEA 2JSXA 5C25A 4BLGA 4IH5A 1HD0A 3DU6A 3MTKA 1EQ0A 1VK8A 3FK4A 5E3AA 3ZTSA 5AXLA 4JV0A 4ZJLA 2V67A 4Y0FA 4V19X 3EGNA 2LMIA 1NH8A 1B0TA 3M6UA 2BDPA 3GJSB 2NLWA 1AFJA 1RWPB 1ZETA 4ECUA 1IKYB 5CZCA 2A18A 2BACA 4RWWA 3H7HB 1I51B 4OYIA 4CLLA 1P8GA 2HRYA 4NRUA 4QR2A 3EJMA 4RZRA 2DHAA 1HQEB 5HSPA 4FBUA 3OTBA 4OZNA 3KOAA 2V9KA 3AJ2A 2VQFJ 2GO8A 2UXBF 2YKPA 3AH6A 4G6VB 2HHUA 4J9MA 4RNMA 1X4GA 1NRKA 5GADU 2BVZA 2J0WA 4LFBF 1RHJB 3TUIC 3TZWA 1UCNA 2ZITA 4Z7CA 4OJ1A 1FKOA 1NJYA 3UD5A 2XGQA 5ETQA 1NSAA 3NCQA 4DPYA 2FVRA 2UXDJ 1RSCA 2XYHB 1QAYA 2HNYA 3CMQA 4MYUA 2OH2A 2YQ3A 4JI6J 2JOQA 2KO1A 3JS9A 2HGNA 2LEBA 3RU0A 2MKIA 2BM0A 1N6QB 2CIMA 3UQSA 2RRNA 1RE1B 1GNKA 4RJVA 5J1NA 3P96A 2BEFA 5B0EA 3LALA 1EAYC 2VICA 4A8SA 2W9CB 3QPIA 1P27B 1QTMA 2FTRA 2KXHA 1LXJA 5LSOA 4K59A 1VHIA 2BANA 4PAAA 2Z2ZA 5HQMA 2BE7D 4X4VA 5KFZA 5IT4A 3C16A 2A10A 4J9QA 1JLEB 1FXLA 5LOQA 1B7FA 4FVCA 4DR6J 3I56S 1NK8A 2R7QA 2YWEA 4JUZA 4E0DA 5RUBA 2K1RA 4QQBA 2OPSA 2LQ9A 2MKYA 1R8AA 3NG8A 1FFSB 4CO0A 1I6JA 1WDTA 3IS9B 3FC9A 1FX2A 4IH7A 3US5A 2XC9A 4PWDA 2GMJA 3OVAA 1S4EA 5K20B 5HMWA 4NLOA 2VPXB 2DR9A 1SV5B 2QMXA 2RKIA 2OTJS 2GV1A 2NXJA 4ZLLA 1HWKA 4JI0J 3FCWA 5M2RA 2E5JA 2ZH2A 4NLGA 3CC4S 5D3GA 2OPPB 1JXVA 3A13A 1NPKA 3GMGA 4NXNJ 1K1SA 4B9UA 1X4CA 2BJ8A 3G6YA 1XMQF 4IRDA 3PW7A 3KJQB 4MAKA 4KY3A 3UN5A 1K0VA 3K0JA 4EEYA 4DZ6A 3IBFB 3KTQA 2B4PA 2A2CA 2BJ9A 3MAQA 3BZQA 2AEFA 2PEBA 5BR8J 4MT1A 1VQMS 1G3OA 1U45A 4DV6J 1H73A 3ZXWA 3TARA 2ACMA 3C6TA 6FDRA 3W5XA 2R7UA 1NJXA 1RKIA 3Q8PB 3BPSP 2MXYA 1SJFA 1A7GE 4ZPDA 1H74A 2WRMA 3BB5A 1YJRA 4N47A 3W2WB 2KJVA 3BN4A 2RE1A 2G4BA 1HD1A 4OHVA 1DRZA 2P9GA 1VGYA 4LFCF 4OL8A 1Y3KA 3FZBA 1UVLA 4ZVUB 5J2QB 5HMZA 2CQ0A 2RQ4A 4CM0A 4BCAA 3BO2A 1N36J 3G2XA 5K8NA 5E41A 2X1GA 3MMAB 4X4OA 1HI8A 1QUVA 3M32A 3QRPA 2FPHX 2W7AA 1YG0A 1K73T 1XNQJ 2XZTB 1CJUA 3SQGA 2HIYA 2J6TA 2CAJA 5ETSA 5A8RA 2I5JA 2VBWA 1YJUA 4P2XA 1NDCA 3I0RA 1JMTA 3VGTA 3EPGA 3MECA 4X66J 4OHWA 4KGZB 2G13A 2M4MA 2B5JB 4MKYA 1ROFA 4JI4F 2KXFA 4IDKA 4A8MP 3OV7A 1ZYQA 2UU9J 2MKKA 4UF4A 1B4SA 3T41A 2J0SD 4CH1A 3J7ZT 2KFNA 4G1IA 1O6XA 4A8KA 4CT8A 4AL5A 2E5LJ 2HFZA 2H5IB 4CO5A 4KKOB 3MEEB 4HL9A 2KVIA 1MROB 3G9CA 4NLVA 2QL7B 1UTAA 2M70A 4NLWA 4LF7F 3G87A 5A76A 1RTHB 1RTDB 4EMDA 4LSLB 3TUPA 2CDQA 3BQ2A 5C7PA 1M1HA 4DR2F 2UVRA 4WK3A 2QMWA 3FCVA 4O0NA 3TJAA 5E0OA 3GZ7A 4J9RA 4EGLA 3D6HB 8AT1B 1BQNB 4WTYA 1FK9B 1KR4A 2YH1A 4Z7YA 2R8KA 1RA6A 4LR8A 2V0NA 1KNZA 2ZWOA 1S6UA 5AE1A 4ES1A 1NCLA 1HQEA 1RU1A 3I5AA 3PR4A 2MSSA 1TL1B 5T41A 1T9VA 2LU2A 3UDEA 2RH3A 4A8QA 4B9LA 3MTJA 3GIRA 3PXGa 4WFAQ 3L3CA 3AA8A 4CH7A 2UUBF 4NZ6A 2C1EB 1BWEA 3NRBA 3FCHA 3FRZA 1UPMB 3GR0A 1R0BG 2G0IA 2EW9A 2ZHBA 2YPYA 2W8LA 1HW8A 2ROEA 1RWNB 2VB6A 1FEEA 4LRAA 4DR5J 4C8MA 4FPRA 2IVFB 5I42B 2AKWB 1CJTA 4JI1F 1AZSA 4AMPA 1QVGR 4ECYA 1Y5NB 1G4CA 3H2LA 4ELVA 3EZ5A 1SQEA 3CJKB 1GMWA 3AXKA 4JI7F 2AX0A 4EFAC 5AJ3J 2KI2A 1KONA 2J7UA 2L9NA 3T5JA 3ZTOA 3FZ2A 1Y5IB 3T1HF 3HP6A 2BKNA 2W9CA 2W7OA 2FD2A 2IRXA 1TELA 3TUJC 1YITS 2R8GA 1PIEA 3PEJA 2Q1LA 1T9UA 2H3EB 2EPIA 2LXIA 3NGRA 2JLFA 2LQ8A 1PBUA 4CM2A 3V6DB 3IAS9 4ED0A 2EBEA 1N5YB 1FO1A 5HQ8A 2K06A 1JLEA 4CO4A 1U6ZA 2DNMA 2F4FA 3FNNA 3BKFA 2X3GA 4M5GA 3JSMA 3HO1A 3OXGA 1NK6A 1KS2A 4NZ7A 2F7VA 2D3UA 3BDPA 1ZZNA 2V8PA 3KJFB 4P52A 1WI8A 5A6WA 1PYTA 3IS9A 4R0EA 2FHJA 3K59A 2L48A 4F4XA 2YNHB 3U7JA 5LT5A 5KFDA 1Y10A 1R0AB 1KHVA 3BYPA 2ILYA 2GO9A 4O3QA 2IDEA 4K2XA 3EM1A 1SV5A 3SZ2A 3PTWA 1YHQS 4A8XA 1S97A 1FNOA 3OL8A 1UA1A 3RW6A 1PO6A 4ES2A 1PGZA 2OPPA 3C19A 4JV5F 2H4WB 3PZPA 1D09B 4YMEA 1U47A 1FRXA 4OX9J 2MHNA 2HK3A 3JQKA 2V2KA 2KRRA 2V8HA 4G1QB 4OJGA 5DM6Q 4DR1F 5CCLA 3UN3A 2AYGA 2QTWA 3K8WA 4CYUB 2RDJA 2E1RA 2D3ZA 4P73A 2V34A 1EB0A 2HS0A 3FRYA 1KVIA 2IM1A 1F3FA 4OYOA 3L95X 5KFQA 1BY9A 1GAOA 2RF2A
chains in the Genus database with same CATH topology
3HJVA 2G2YA 5CZDA 5DZ6A 3TQEA 4QBUA 3G87A 2HG4A 3R8YA 3PTWA 2G2OA 3CJ8A 3BV8A 3TZXA 2QO3A 2G2ZA 2VZ9A 3IM9A 3HMJG 5DZ7A 3H0PA 3EZOA 3IM8A 4RL1A 2QJ3A 3TZYA 2C2NA 3SBMA 2CUYA 3K89A 3QATA 5CZCA 2QC3A 2PFFB 2H1YA 3RGIA 4RR5A 2JFKA 2UV8G 3TZZA 1MLAA 3TZWA 2G1HA 2VKZG 3HHDA 1NM2A 2VZ8A 2JFDA 3R97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HJV A;  2G2Y A;  5CZD A;  5DZ6 A;  3TQE A;  4QBU A;  3G87 A;  2HG4 A;  3R8Y A;  3PTW A;  2G2O A;  3CJ8 A;  3BV8 A;  3TZX A;  2QO3 A;  2G2Z A;  2VZ9 A;  3IM9 A;  3HMJ G;  5DZ7 A;  3H0P A;  3EZO A;  3IM8 A;  4RL1 A;  2QJ3 A;  3TZY A;  2C2N A;  3SBM A;  2CUY A;  3K89 A;  3QAT A;  5CZC A;  2QC3 A;  2PFF B;  2H1Y A;  3RGI A;  4RR5 A;  2JFK A;  2UV8 G;  3TZZ A;  1MLA A;  3TZW A;  2G1H A;  2VKZ G;  3HHD A;  1NM2 A;  2VZ8 A;  2JFD A;  3R97 A; 
#chains in the Genus database with same CATH topology
 4WCE Q;  1JNR B;  2BQU A;  1UWA A;  4K4Y A;  3ZZR A;  3W62 A;  1ZAX A;  2DXD A;  3I82 A;  4FYX B;  3EVM A;  3T1Y F;  2GJI A;  3DRX A;  2VFR A;  2YKQ A;  1Y4Z B;  1R8P A;  1A6L A;  3CCT A;  2BE9 B;  3OR1 A;  5A6P A;  4OJ3 A;  3W2W A;  3DGP B;  1OPI A;  2E66 A;  3M8R A;  1N34 J;  2F5G A;  4ERD A;  5KG2 A;  1B0V A;  5KFC A;  1R6Y A;  5B0C A;  2GAH C;  4GKJ J;  5J2Q A;  1J5E F;  3PNI A;  2ZVS A;  3V6K A;  3QZ7 A;  1CPZ A;  2WBR A;  3MMA A;  1N5T A;  1R6V A;  1HLW A;  2DY9 A;  1DJ0 A;  4LF5 F;  2Z30 B;  1SBR A;  2XY6 A;  3NP5 A;  4LF2 A;  1RWO B;  1F3V A;  2GGP B;  3FEX B;  4PWU A;  4TVA B;  2KG0 A;  4KH0 B;  5KFT A;  4TLQ A;  2PI4 A;  2J5A A;  4DCP B;  3DLL Q;  2DNN A;  4O3O A;  2KB2 A;  1P6T A;  4DQS A;  4FXV A;  4TU7 A;  1IR1 A;  4WKY A;  3UR3 C;  2OI2 A;  4C3M A;  2M5Y A;  4C8Y A;  1S1V B;  2B5J A;  1GFW B;  3DRS A;  1WHX A;  1OYD A;  5GAE I;  2WTF A;  1TFW A;  3RB0 A;  2NXU A;  4NLP A;  3IBC B;  1YBU A;  1B0P A;  4WP9 A;  4YHH J;  4YR2 A;  1R8C A;  3J7A N;  4M5D B;  4KKO A;  3MEE A;  1O5J A;  2KM8 C;  4ZP7 A;  1MRO A;  1S12 A;  2XS7 A;  2EFP A;  2HMI B;  4DV2 F;  1LXN A;  5IQ6 A;  3MPY A;  1ELO A;  3ZO7 A;  1RTH A;  1RTD A;  4LSL A;  3TA2 A;  4EZ6 A;  3IWN C;  3Q8Y A;  4OZ0 A;  1YJV A;  3SV3 A;  5B0F A;  2R7V A;  3MD1 A;  2ILZ A;  2WSF C;  3BH7 B;  4DLE A;  5DDO C;  2Y1J A;  4Q44 A;  5HJY A;  1H6K X;  5KT2 A;  4W90 B;  2HAI A;  4OHZ A;  2ZM6 F;  1FK9 A;  2HPU A;  3K89 A;  2CFX A;  1QVF R;  1WC3 A;  4L73 A;  5KFY A;  2CJY B;  2JEI A;  2XY7 A;  2QLJ B;  2NXC A;  2XHW A;  2FZG B;  3DOK B;  3TAP A;  4USH A;  1GTE A;  3VGV A;  4P75 A;  3RB4 A;  3HMJ G;  4DWI A;  2XYP B;  3KK2 B;  1TL1 A;  5LJ5 Y;  5ETK A;  1SL2 A;  2BKP A;  1SQG A;  3NGK A;  3VGU A;  3THV A;  1SKS A;  4L3K A;  1WSR A;  3K57 A;  3UI3 A;  3BQ0 A;  4M5H A;  3J7Y I;  2NCK L;  1FXR A;  2H9Z A;  1S6P B;  1WTF A;  4DUT A;  5DDQ C;  2ZJR Q;  4FF2 A;  2CQI A;  5JJB A;  2Q6C A;  3IRW P;  5KG5 A;  4CLU A;  4DSK A;  5I42 A;  2KFZ A;  1UAW A;  2Y0B B;  3G86 A;  3Q86 A;  3V5R A;  5ETT A;  5HAT A;  1FWK A;  4B3S J;  1JLC B;  3CJK A;  5A8K B;  2J7K A;  3A8E A;  4QYR A;  2WAQ D;  2DR7 A;  3P5T L;  2AU0 A;  1LWC B;  3NWR A;  2I38 A;  2VC1 A;  4DUY F;  1F9H A;  1TKZ B;  3CUN A;  5HAN A;  1LFP A;  4K4X A;  4E2F B;  2X51 A;  3R2C J;  3MAH A;  4LFA F;  5KG6 A;  2IMO A;  5DZ7 A;  4F3O A;  4KGM A;  2V2V A;  4O4G A;  3Q8R B;  3EE3 A;  3GSD A;  4GKK J;  3M6W A;  2GML A;  2VG6 B;  1EX8 A;  1FTC A;  1LWF B;  3V6D A;  2CPJ A;  1L3U A;  4D3G A;  2C3U A;  4EK2 A;  5CYM B;  4XDD A;  2PO4 A;  4DFJ A;  4ID5 B;  2VFU A;  3QFW A;  2LQB A;  1OIA A;  2P6T A;  5LMU F;  2FVS A;  2QFJ A;  4X65 J;  2HHP A;  2A1B A;  1FD8 A;  3SV4 A;  2HVZ A;  4QOT A;  2PMZ D;  2YNH A;  4AT1 B;  3NOC A;  2CPD A;  1PJ6 A;  1R0A A;  3BGO P;  4O3N A;  3DDK A;  2VHG A;  1QY7 A;  3HHL B;  2XMJ A;  2XQC A;  4N56 A;  1NHV A;  4NLY A;  2GHW A;  4OIX A;  2UV8 G;  1S7I A;  1Z2L A;  1S10 A;  1EAR A;  4LR7 A;  3IA0 A;  3DOM B;  4EU0 A;  5ETL A;  1RU2 A;  2OMO A;  3I5B A;  1M5H A;  2CJK A;  3THT A;  2WBM A;  4KO0 B;  4G1Q A;  5ETN A;  4HH1 A;  5I4M A;  1L3S A;  1TV6 B;  3B4M A;  1VC0 A;  4KE5 A;  2ATL A;  4KTQ A;  3PYG A;  4OZ1 A;  1N52 B;  4F4Z A;  1Y9O A;  2HGL A;  1XJW B;  3AB2 B;  4DX5 A;  2HAF A;  4F4Y A;  4UTG A;  3HI9 A;  1MW7 A;  3DLE B;  3W9J A;  2QA2 A;  2BQ3 A;  3OJS A;  4ZVF A;  1LV5 A;  4IO1 A;  1RWW B;  4ZCI A;  2XY5 A;  3PV8 A;  3R5B A;  2YNG B;  4U7U D;  1F5C A;  3DLB A;  3ILI A;  3RR8 A;  1QAJ A;  2B56 A;  3FUY A;  2QEX S;  3KMQ A;  1H3D A;  3ADA C;  1OY8 A;  1X60 A;  3HZE A;  1DBD A;  4DV4 J;  2EG2 A;  4J90 A;  2UUC F;  1DTT B;  4LR9 A;  5K8O A;  8RUC A;  5H1S V;  1UL3 A;  3TRG A;  2AW0 A;  2GGP A;  3KFW X;  4AMN A;  2CNK B;  2PA8 D;  2UVV A;  4KIA A;  2UUA J;  3RZA A;  3LAM A;  4HTJ A;  4C97 A;  3BH6 B;  4LF6 J;  2FVP A;  3SXL A;  1V5V A;  1C0T B;  3MXH P;  2BYC A;  1RT5 B;  3P3D A;  1WEL A;  5KG7 A;  3RBE A;  5JVG Q;  4MK7 A;  1QTN B;  2HHS A;  3MCM A;  2BQR A;  1KSP A;  1MWQ A;  2FB0 A;  3IGV A;  1NH7 A;  5IQQ A;  3R5A A;  4U67 Q;  1HPZ B;  3WDO A;  1VR6 A;  1RTJ B;  3UCZ P;  2X1F A;  3KLH A;  1Z1Z A;  4ZKA A;  5KG0 A;  5KFO A;  2XLI A;  4I56 A;  3WC0 A;  4Y2K A;  2AHO B;  3AQO A;  4W92 B;  4M5D A;  2I1R A;  2W2O P;  1N32 J;  1URR A;  2HHV A;  2JLE A;  4NML A;  1MSW D;  3A1Y G;  3VAH A;  2P5V A;  5I3P A;  2XUL A;  2XYG B;  1FFG B;  4Z37 A;  2HYI B;  4ZLN A;  2GIQ A;  3RBX A;  1NHU A;  3L9Z A;  4KPC A;  2E9R X;  4QU7 A;  3ET6 B;  4ZDN A;  2W4D A;  5D4N A;  3PG9 A;  2BKO A;  3I32 A;  4AFF A;  1F9F A;  3VR1 A;  2E1M C;  1N5Q A;  4ZIV A;  3M8Z A;  3DOK A;  5HQL A;  4A8O A;  3CD6 S;  3H25 A;  5EN1 A;  4AL6 A;  3KK2 A;  2Y1L B;  3PIO Q;  3H8Y A;  1FT8 A;  1VQ9 S;  4WTO B;  3MR5 A;  4ZA1 A;  3GJQ B;  3ZFV A;  1T95 A;  4DX7 A;  3Q8V A;  1JK9 B;  1XN9 A;  3O44 A;  3KK1 B;  1VMB A;  2HW3 A;  3HSD A;  4YQW A;  1EP4 B;  4BWJ A;  3GFH A;  3KDN A;  1SKR A;  5G4D A;  2LQJ A;  1AUS L;  3TA1 A;  3UCU P;  2MPU A;  3EGZ A;  3UVJ B;  2UVW A;  4FP9 A;  4ID8 A;  2B7C B;  3G6V A;  3CJ0 A;  2XSJ A;  4WK1 A;  1JLC A;  5A8K A;  1I1G A;  2IYG A;  4NLQ A;  2EK6 A;  2DHX A;  2GVZ B;  3GII A;  2V5H G;  2Y9H A;  2DD8 S;  3KWM A;  1LWC A;  3C46 A;  4K4Z A;  2L08 A;  4K4V A;  2BOA A;  4DL2 A;  1TKZ A;  2MDA A;  4Y2C A;  4M8L A;  5KFR A;  2CQ2 A;  5KFU A;  1U1N A;  3KNA A;  3P5B P;  3P8B B;  1DY3 A;  3PX0 A;  1YWX A;  2VG6 A;  4DV3 F;  4P74 A;  2ZHA A;  4NI2 B;  1LWF A;  2XMA A;  2V8G A;  4L3N A;  2J9C A;  3R6L B;  3BKU A;  1WAC A;  4MTP A;  4IH6 A;  3MMC A;  2QE5 A;  1VYA A;  5T14 A;  4MYT A;  2QYC A;  5L9X A;  4ID5 A;  3SFU A;  4Q43 A;  4PXD A;  2E7V A;  3HK2 A;  1Q81 T;  2QIF A;  1FF2 A;  3OSP A;  4B9V A;  1TKX B;  8ATC B;  1NB2 A;  2OSR A;  2YKN A;  2UXB J;  1IWG A;  1NJI T;  2PSZ A;  4EYH B;  4X4U A;  3BJY A;  1VS3 A;  3HFK A;  5LMN F;  2HBQ B;  4CIO A;  3O1L A;  3AD7 C;  4IOB A;  3HHL A;  5HAO A;  2HS3 A;  1DAX A;  1RGV A;  4L74 A;  4A47 A;  1RAE B;  4LFB J;  4ETZ A;  5KG1 A;  1X5O A;  2IC3 A;  3PJX A;  3WIU A;  4ECQ A;  1TP7 A;  3UFC X;  3IP0 A;  2AGQ A;  2R2U A;  2CPE A;  3CJR A;  1UFL A;  3IBW A;  4W98 A;  3D6T B;  4KO0 A;  4O23 A;  1LEO A;  1ZOT A;  5F8H A;  1HHQ A;  4F67 A;  1TV6 A;  1Q8K A;  4LF4 F;  2KZM A;  1N56 A;  2FHO B;  2XHC A;  3D54 A;  1T3O A;  2KH9 A;  2HK2 A;  2UVU A;  1YJN S;  4O4R A;  3B4D A;  2BUN A;  3M1V B;  4LIR A;  2IM2 A;  3QGH A;  1UW4 A;  3CJS A;  3AJ1 A;  4U96 A;  1OSD A;  2ZNZ A;  2DH9 A;  3RBD A;  2ASL A;  2KJW A;  5AXN A;  4E8U A;  3CE8 A;  1U1P A;  2CQD A;  3DLE A;  1D9F A;  2G2Z A;  2RSQ A;  5DQI A;  4TU8 A;  3SCI E;  4TY8 B;  2B6A B;  5GAG U;  3JTN A;  1WC4 A;  2IJR A;  1JLA B;  4USW A;  2JFD A;  7FDR A;  2K7K A;  2AJ2 A;  2YNG A;  1NDP A;  2KXN B;  3DXS X;  2RRB A;  3M4X A;  1NZA A;  1CVJ A;  4DPX A;  3ENW A;  2CRL A;  4CLY A;  3PHE A;  4I2Q B;  3W5Z A;  4F50 A;  4PRF A;  3TQE A;  1UMJ A;  3KHG A;  4MH8 A;  4QR1 A;  5KT4 A;  2NZC A;  1WOR A;  4H54 A;  2AIR B;  5EHH A;  4ES3 A;  3ILJ A;  1DTT A;  1HNI B;  3QGG A;  3HVA A;  3BSA A;  3SDE B;  2NR0 A;  1VQS A;  4ZVR B;  2M8H A;  5KT3 A;  3DLH A;  2VF3 A;  2QA4 G;  4DV5 F;  1OPZ A;  1F5A A;  2KKH A;  4CI0 B;  2FGO A;  5LXY A;  4EZ9 A;  3DLG B;  4RW6 B;  1TKT A;  1HBN B;  4Q8F A;  1C0T A;  1XMQ J;  3PYD A;  1RUS A;  1RZM A;  1RT5 A;  1HI0 P;  1TMJ A;  4AXI A;  5L1I A;  3VZI A;  2AEM A;  3ZZT A;  2M7S A;  2XMV A;  4DL5 A;  2PMH A;  3UN2 A;  2PGC A;  3PVX A;  2QT7 A;  1HPZ A;  5GVQ A;  4WKR A;  1Q4R A;  5DZ6 A;  4KB7 A;  1SC4 B;  1LK5 A;  2U1A A;  3R8Y A;  3UCG A;  2ZZT A;  3KG0 A;  1W25 A;  1LWE B;  3D3C J;  3R1L A;  4WZM A;  3NCR A;  3LWL A;  4AL7 A;  1X9W A;  3LPE A;  2D9P A;  2ZUA A;  1AXQ A;  4YB1 P;  2CAD A;  4WYL A;  2QLF B;  4QIG A;  3QWP A;  4WF9 Q;  4QJV A;  2KTQ A;  3NS5 A;  4OHY A;  5KOX A;  2ZEJ A;  1Q7L B;  2WVB A;  4B3O B;  4XTT A;  2RIL A;  4LSZ B;  5AXM A;  4K2J A;  3CCU S;  3LH2 S;  3HKW A;  4LFC J;  2DVI A;  2ZDP A;  3B82 A;  4WE1 B;  3GLJ A;  5B0G A;  2ZJP Q;  2RS2 A;  2HBY B;  4NRT A;  4WII A;  4FS1 A;  5L8R C;  4WZQ A;  5CZV A;  5AE3 A;  1WUU A;  3HXM A;  1ZTT A;  2ZDO A;  5FLX U;  3L7O A;  4C0H A;  2FVC A;  2F1F A;  5DG8 A;  2HLU A;  4ZVH A;  5ETR A;  5LSR A;  4GVB B;  3S7R A;  5SZT A;  5C2C A;  3BSC A;  2R2T A;  1FI4 A;  3KK1 A;  2WSE C;  2GMH A;  4OYA A;  1ZA2 B;  2M88 A;  2VJV A;  1K1Q A;  3RUB L;  1EZZ B;  4HTI A;  1WKL A;  1EP4 A;  3FBC A;  4OX6 A;  3ZTP A;  4ZLP A;  4ZS6 A;  2NRE A;  4YY3 F;  1U4B A;  2KG1 A;  1WOS A;  4JI4 J;  1HW9 A;  2R7O A;  3B54 A;  5F8L A;  1UA0 A;  3MEK A;  2LDY A;  3RRK A;  1V5I B;  3JXO A;  4PYA A;  4N8O A;  5J2N B;  4JI8 F;  3FQK A;  3UVJ A;  1U8W A;  2EEY A;  3BSO A;  4LF9 F;  5CZD A;  2R7X A;  3A3P B;  1U02 A;  2ZBP A;  4NAS A;  3KLE A;  4Y34 A;  4A8F A;  4Q2L A;  3N6M A;  3VAF A;  1OQ3 A;  2FY1 A;  3P4U B;  1UVI A;  2IDL A;  1W2B R;  2ZVI A;  1GMU A;  4CQ1 A;  4LF7 J;  2NXE A;  4X2B A;  4Q7A A;  4KHR A;  1JX4 A;  5HJX A;  3NMA A;  1HBO A;  2MHE A;  3GSI A;  4DR2 J;  1FXD A;  2V8V A;  4NI2 A;  1S48 A;  5ETV A;  3JQM A;  1RAJ A;  2ASD A;  2LA6 A;  2A0F B;  2VJU A;  1I94 F;  2KHC A;  3MMJ A;  4RL1 A;  3RB6 A;  4N41 A;  3IR5 B;  2R2R A;  4Y6I A;  2H4Y B;  1L3T A;  1JJC B;  1TKX A;  4MFB B;  2QLW A;  4RW9 B;  3B8H A;  4IG0 B;  1AYE A;  1OY6 A;  2M52 A;  4LIW A;  1DFD A;  2H5J B;  5LL6 d;  4PWW A;  2UUB J;  1Z2Z A;  1CJV B;  2J8A A;  1SKU B;  3MOJ B;  1WC5 A;  3ITH B;  4JV1 A;  4PXE A;  3F73 A;  5F3T A;  1S7H A;  5BYS A;  4P2F A;  4HHU A;  4ZIT A;  2PC6 A;  3CCR S;  2QA1 A;  2LQ5 A;  1WEY A;  4JI1 J;  3CCZ A;  1YQH A;  1KN6 A;  1J27 A;  2ZH8 A;  4PG6 A;  2AZ1 A;  5J2P A;  5KT5 A;  4JI7 J;  3W7B A;  4RBV A;  3L7P A;  1PJ7 A;  3GP9 A;  4RNO A;  4MJK A;  3R7N B;  1UJ4 A;  2Q3P A;  1SH2 A;  3OSN A;  4C8N A;  4UW2 A;  3T1H J;  4PCQ A;  3X1L B;  2Y0S D;  1R8B A;  3MI7 X;  4PEO A;  9ATC B;  1LW2 A;  4IQX A;  4K4W A;  1F1B B;  1XC9 A;  5I3Q A;  4TY8 A;  3BO4 A;  2B6A A;  1D8Y A;  3PKM A;  2EFN A;  3QWU A;  4DPT A;  1JLA A;  3HHK A;  2RQK A;  4ED1 A;  2A6O A;  1TK8 A;  2DNK A;  1P9Y A;  3GR1 A;  2ZKT A;  3MEG B;  1TL7 B;  4NX9 A;  3L7U A;  2ZZN A;  5L39 A;  1X4B A;  4GO7 X;  4O0I A;  1IBM F;  2AF6 A;  3H5Y A;  2MZJ A;  5IWA F;  4OZJ A;  2BX6 A;  2DGX A;  5EUH A;  3IR6 B;  3NL0 A;  1B64 A;  2VH7 A;  4EO6 A;  2LEC A;  2ZC3 A;  3HVR A;  3BBC A;  2DHS A;  2XMK A;  3MPD A;  2DGV A;  1YKW A;  1QAX A;  1HNI A;  2CQ4 A;  2E9T A;  3SDE A;  1TAU A;  4USM A;  3EVW A;  2FLO A;  1U1K A;  2SXL A;  2CZ4 A;  2EFV A;  4ED8 A;  4ILR A;  2FGC A;  4JV5 J;  4TQS A;  5HO4 A;  2RIJ A;  2YNI B;  1VBZ A;  3DLG A;  4RW6 A;  1HBN A;  2DR8 A;  3W9H A;  5CYJ A;  3NGU A;  3DXB A;  4ZCK A;  3V2U C;  1UWB B;  5KFE A;  1IBC B;  2W4C A;  3MED A;  4USJ C;  2IJN A;  4DR1 J;  3O2I A;  1EQM A;  1REV B;  4QYZ J;  2KT3 A;  1RAD B;  2HQG A;  2KN4 A;  3BPD A;  3KJV B;  2N7Y A;  3ZZO A;  3MD3 A;  3BEG B;  1GX6 A;  1W7W A;  2HZA A;  1KC8 T;  4CLF A;  4UUX A;  1OSC A;  1MWZ A;  2G2O A;  2GS8 A;  2CNO B;  1TL3 A;  1SQF A;  4WP8 A;  4AUK A;  2DNO A;  4ED6 A;  3T1Y J;  3DLK B;  2ATC B;  5HK4 A;  4KQZ A;  2XZD B;  2YKO A;  2AV5 A;  3OHB A;  3FEY B;  3HHE A;  1FEH A;  3F44 A;  3D5M A;  4B3M J;  1SUQ B;  2AZ3 A;  4PR6 A;  2MKJ A;  2QYG A;  1VI7 A;  3HSJ A;  4B3O A;  5KFL A;  7AT1 B;  2B3T B;  1KFS A;  3OTD A;  3MM8 B;  4RW7 B;  4RWX A;  1AUD A;  3EWG A;  2JH3 A;  1ULR A;  4QIF A;  4LRB A;  2IRU A;  1FCA A;  4EBD A;  2Y1I A;  3A8I A;  3CME S;  4ZVO B;  1FJE B;  1RHQ B;  1J5E J;  4B08 A;  3IGN A;  2R8I A;  2BXJ A;  2MQL A;  3QZ8 A;  1R8H A;  1FRH A;  2IYI A;  5B0D A;  2XI2 A;  3J80 U;  2J6S A;  4RLE A;  4LF5 J;  3NGD A;  4PQU B;  1ICE B;  2CQ1 A;  2BW2 A;  3FJ2 A;  1HFE L;  1M1G A;  2LLZ A;  3B78 A;  1L3V A;  1C0U B;  2G0C A;  4KGK A;  1CC8 A;  3AOC A;  4P10 A;  4GVB A;  4O3P A;  5KFG A;  1FFW B;  1LW0 B;  1ZTW A;  2ZOG A;  3VAM A;  3HHN B;  2JVR A;  1PKU A;  3C14 B;  2WOM A;  3HJV A;  3UO0 A;  4DV1 F;  3JYT A;  1RAI B;  2R8H A;  1UPP A;  4AXJ A;  1FNX H;  1ZM9 A;  2AGP A;  3BGL A;  1TKD A;  4PG8 A;  2C3P A;  2DO0 A;  2CJA A;  3PW0 A;  1YK9 A;  5J2N A;  2L3M A;  4LVO P;  5HVH A;  1TAQ A;  2AJF E;  3OLB A;  2OAU A;  3TAM B;  5BJR A;  3EUN A;  5CYQ B;  3FSY A;  1HQU B;  3FSX A;  2D3O 1;  2IBO A;  1B3T A;  2Y1R I;  1AT1 B;  3X3U A;  1Z4U A;  4DL0 C;  1WC6 A;  2H48 B;  4DV2 J;  2ZD1 B;  3MUV P;  5H9E J;  2JVO A;  1REG X;  1I5O B;  4CO1 A;  3T6J A;  3RTV A;  4NA2 A;  3QT7 A;  1SVD A;  5BYQ A;  5DGB A;  3LF0 A;  1BE4 A;  3QMQ A;  2VPW B;  1OY9 A;  3PCO B;  1G6B A;  2B4O A;  2DIT A;  4L72 B;  3D1O A;  1YIJ S;  4B9S A;  2WSC C;  3FSI A;  4HI1 A;  3T1A A;  2ZM6 J;  3DKD A;  1QDU B;  1JLG B;  3G96 A;  2HIQ A;  4P71 A;  1VQP S;  1FJ7 A;  2MQN A;  3IXQ A;  4YN3 B;  2A6M A;  4DQQ A;  2ABY A;  5EGY A;  1AW0 A;  4MFB A;  4LRD A;  3GQC A;  1VHF A;  4RW9 A;  4IG0 A;  1RXO B;  4QPX A;  2HUR A;  1MLA A;  1H2T Z;  5DLF A;  1CJV A;  3RAX A;  1NND A;  3M8Q B;  1RYS A;  3ITH A;  5C5J A;  4DX6 A;  5CZX A;  5A8W B;  3RR7 A;  1RT6 B;  3R9L A;  2K3K A;  1FNM A;  4DR3 F;  4D3H A;  3M30 B;  2ZBQ A;  1BHN A;  1MWY A;  2P6S A;  4P72 A;  4C8O A;  1K47 A;  3CT9 A;  4TXS A;  3E8O A;  5JXS A;  2V4R A;  1Q7Y T;  5E3C A;  5D4O A;  3M2U B;  4ZHR A;  3QLH B;  1S77 D;  1N0U A;  4I4B A;  4LMZ A;  3ZNJ 1;  4ZVQ B;  5IOL A;  1S72 S;  1DAR A;  3HFZ B;  2B4U A;  3K5P A;  1EET B;  3OFF A;  4OHX A;  2DCL A;  1BWV A;  1YGY A;  4F3M A;  4F02 A;  1D1U A;  4DUY J;  4M5M A;  2K7J A;  4BBY A;  3KK3 B;  4EI2 A;  5GAD I;  1M5V C;  2E5I A;  4LFA J;  1NDK A;  1RT4 B;  3M9N B;  2C22 A;  2F9D A;  4DSF A;  3HZG A;  4N7T A;  1JJ4 A;  1FKP B;  2JEF A;  3W8P A;  3A3O B;  1VIS A;  3MEG A;  1FRL A;  3T5H A;  1K9M T;  4C3L A;  1TL7 A;  1X9M A;  4FYD A;  2YVS A;  1TMM A;  2RU3 A;  1S0N A;  2OEL A;  3PR5 B;  5HP1 B;  1ZH5 A;  4J9U E;  3JQJ A;  5LMU J;  3G8T A;  3KDO A;  4K0K F;  1C1B B;  4Q2M A;  1RBO B;  1S99 A;  2L41 A;  4PPD A;  1OO0 B;  2H54 B;  3BR9 A;  2UZA A;  4DI6 A;  2W2N P;  2N4C A;  2CWK A;  3VVT A;  5KFV A;  3GG1 A;  5D15 A;  4QWA A;  4FNH A;  4QCL A;  2ZFH A;  3MR2 A;  2JL9 A;  2HHW A;  5CD4 H;  2IVY A;  2GFF A;  3RAQ A;  3MPW A;  4LJM A;  2ADB A;  2YNI A;  2DGO A;  1ZM2 A;  2K3I A;  2BZ2 A;  4LF8 F;  2FLN A;  3DM2 B;  3OLA A;  4QU6 A;  1Q5V A;  1UWB A;  1J5O B;  3M8S A;  2M3D A;  1PYS B;  3D28 A;  3TX8 A;  2VD3 A;  1I3O B;  2YKM B;  1RAF B;  3K58 A;  3SEO A;  1APS A;  3HVT B;  5D4L A;  3THP A;  2HFV A;  2JZ5 A;  3QIP B;  3KJV A;  3GIJ A;  4O3R A;  3H2V E;  1FTR A;  2QZ8 A;  5EX3 A;  4OI1 A;  2E29 A;  2MKS A;  4R0J A;  1TUW A;  3DLK A;  1JWW A;  3QJJ A;  2O3D A;  1C4C A;  4ZP6 A;  4JI2 F;  2DGT A;  3CCV S;  3QT6 A;  4JI3 F;  2MTL A;  1SUQ A;  1NKB A;  1HA1 A;  3DRR B;  4ALZ A;  2ZJQ Q;  4UZB A;  3BKT A;  3CC7 S;  1VFJ A;  4RUH A;  3D2W A;  3H5X A;  1JKH B;  3MM8 A;  4RW7 A;  3NWG A;  4TYA A;  4MIB A;  1IQT A;  3GYG A;  1RAB B;  4EO8 A;  4PG5 A;  2VU5 A;  3DYA A;  3H0P A;  3MAA B;  3W66 A;  2KHD A;  4GC7 A;  1RTZ A;  3KMS A;  2IHR 1;  2VG5 B;  2UUC J;  1ZZF A;  4XK8 C;  3DHX A;  1U49 A;  1FDA A;  4OYM A;  4PQU A;  2CA9 A;  1HNV A;  5KFH A;  4LSN B;  2R7W A;  1FJG F;  4IFY B;  1VQO S;  3HJF A;  3O6Q A;  1YI2 S;  2AD9 A;  1C0U A;  1R43 A;  1ZAW A;  4DV7 F;  2HQ3 A;  1NME B;  4NMX A;  3W65 A;  1YBT A;  5K8M A;  3ENV A;  4QYZ K;  2HFN A;  4NCA A;  1ZS6 A;  3EX7 B;  1CS4 B;  1LW0 A;  1EKR A;  2HND B;  3NS6 A;  1S49 A;  3ONQ A;  1TQL A;  1R0C B;  3C14 A;  4ZMM A;  5B7W A;  4M5N A;  3E01 B;  1Q8I A;  4BHQ A;  6AT1 B;  4AYB D;  3PJW A;  3QFH A;  2I2Y A;  1T9Y A;  1S1X B;  1K8A T;  2V69 A;  5B09 A;  5CYQ A;  4F0K A;  1HQU A;  1R31 A;  2GVD B;  1XR5 A;  3N28 A;  4HEA 9;  1SJ3 P;  3C6U B;  2BW7 A;  2Y8Y A;  3JSB A;  4NLU A;  2ZD1 A;  4ZLJ A;  3T3F A;  2N3O A;  4RU9 A;  4ED5 A;  1X8D A;  3WBZ A;  4YDX A;  2WB4 A;  5KG3 A;  3DMJ B;  3C8Y A;  4ZN1 A;  2IA6 A;  3R7B B;  4CH0 S;  4URQ U;  3L4B C;  4RBU A;  1IXK A;  2EI5 A;  3NNH A;  2GJF A;  5J1E B;  3CGI A;  2W25 A;  2ERR A;  1JLG A;  1RQ0 A;  2RUS A;  1WSV A;  3EXC X;  3NEK A;  1UVK A;  2O67 A;  1X5T A;  5DQG A;  1HHT P;  2ADC A;  4CNY A;  4EWT A;  2NUU G;  2RQC A;  4C98 A;  2UP1 A;  1L3K A;  2B9Y A;  4ICL B;  4QIW D;  1R7I A;  1BLU A;  3UE2 A;  4KHP F;  1H38 A;  3E51 A;  2VOD A;  4JV2 A;  4MIW A;  1S6O A;  1HR0 F;  2C2M B;  3M8Q A;  3GCW P;  2GAG C;  5A8W A;  1RT6 A;  3HM9 A;  2GNK A;  1R27 B;  1DLO B;  3M30 A;  3ETO A;  3I55 S;  3SMZ A;  2OJ3 A;  3C15 B;  4JI5 F;  1RAC B;  2QFI A;  5F41 A;  4YB6 A;  3M2U A;  3TZX A;  1WKK A;  4P9S A;  5J2M B;  3QLH A;  3D7S B;  4N5S A;  4J9V A;  5H9E K;  1UKU A;  4UQT A;  4DR7 F;  3AOA A;  3CD7 A;  1VQ7 S;  2NS1 B;  4I64 A;  2ZOM A;  3W3S A;  3DLJ A;  2GA7 A;  2VG7 B;  2IVM A;  3FFI B;  1U24 A;  4P2M A;  4QWE A;  2VZ9 A;  4ITS A;  4RNH A;  3U1L A;  1CUL B;  1ZM4 A;  2X1A A;  3AQP A;  4H4M B;  4DSI A;  2VBX A;  4FF4 A;  4OZ5 A;  3KK3 A;  2MZT A;  2DRB A;  1NBE B;  5MLC V;  3F0N A;  4NA1 A;  2KM8 B;  4DS4 A;  3PX6 A;  1KP6 A;  1H2U X;  1RT4 A;  3S01 A;  4CWB A;  1RHM B;  3WZ0 A;  3VAL A;  4DV3 J;  1FKP A;  1NXI A;  4LBI A;  1EHW A;  1WEX A;  4USI A;  3DCA A;  2HHX A;  3CB4 A;  4OI2 A;  3QQC D;  3TUZ C;  2OPQ B;  1ZBT A;  1MN9 A;  1OYE A;  1WOO A;  1KQF B;  5G0R B;  2B0G A;  5GMD A;  1IKY A;  3SSS A;  3N5F A;  3R2D J;  5HP1 A;  4QW8 A;  4LQ3 A;  4J9O A;  3IR7 B;  4CLS A;  1Q8L A;  4KR0 B;  1FDN A;  4M94 A;  5F9N A;  4TQR A;  2EC2 A;  1C1B A;  3C66 A;  4AMO A;  2A2D A;  2HQC A;  1WI6 A;  2ZH3 A;  2RT3 A;  2BBE A;  2AJQ A;  1SC6 A;  5IC4 B;  1TUV A;  4U7C A;  4EYI B;  5LMN J;  5ITH A;  1IBL F;  4DR4 F;  4DFK A;  3KHL A;  2R42 A;  2WK4 A;  2OD6 A;  1RYR A;  1JXL A;  4C11 B;  2KT2 A;  4NXM F;  3KLF B;  2JFK A;  3I5C A;  2AP6 A;  1HNX F;  3N9U C;  4X4N A;  3P6Y C;  2C3O A;  2BOP A;  5K14 B;  1KRP A;  5C25 B;  1X4D A;  1JLF B;  2XLK A;  3MHY A;  5KOW A;  3DM2 A;  2FJE B;  2ASY A;  1J5O A;  4E98 A;  3ENA A;  3KUG A;  4X64 F;  4XO0 A;  1WC0 A;  3CIM A;  2LFV A;  4LF4 J;  1NM2 A;  2YKM A;  3H59 A;  2Y3Y A;  3GJR B;  4R25 A;  1RLD A;  2DY1 A;  2JNJ A;  4NLX A;  2HFO A;  2YWH A;  3ZZP A;  2OGU A;  3QIP A;  3UW1 A;  5DGA A;  1BQX A;  1N6Q A;  2VKZ G;  2D41 A;  3HX9 A;  3NMR A;  1CJK B;  2NSC A;  2XNQ A;  1VRU B;  2YTC A;  4WXW A;  3J81 j;  3AB4 B;  1V3R A;  2CPI A;  2IA0 A;  2YBV A;  2NYI A;  3OPK A;  4DDF A;  3SSQ A;  3T9Z A;  4RW4 B;  2J76 E;  1X31 C;  2EBG A;  2EG1 A;  2R7T A;  3DRR A;  2IAJ B;  3SIP B;  2EC0 A;  2XWX A;  4RNN A;  3EIC A;  3KJN B;  4K4T A;  1JKH A;  2VPZ B;  2CNL B;  3W60 A;  3W61 A;  3D66 A;  3QNW B;  4HAC B;  4C8K A;  1HL6 A;  3TW0 A;  1TTH B;  3MAA A;  1NSK L;  3QAU A;  1VIO A;  5L1K A;  1PSD A;  2VG5 A;  1FE4 A;  1RWX B;  2DRA A;  1UP1 A;  4TN2 A;  1U2C A;  4QR0 A;  5DM7 Q;  5F9L A;  3H90 A;  4LSN A;  1VJQ A;  4IFY A;  2RNE A;  4DV5 J;  4TU9 A;  2I0X A;  3CNQ P;  5IT9 U;  4RKU C;  2V2Z A;  3N6L A;  1NK0 A;  2DB1 A;  2EFQ A;  4QBU A;  4Y28 C;  5F8G A;  2R2S A;  3VCD A;  3IN5 A;  2HND A;  1U6B A;  2AJ1 A;  2F3J A;  1RHU B;  3QT8 A;  2MST A;  1YRT A;  1XMB A;  2LEP A;  1Q95 G;  3DOL B;  3S8S A;  4FYY B;  1YJW S;  3N79 A;  3WX8 A;  2BRL A;  4OQJ A;  1S1X A;  2OKQ A;  1Q16 B;  3OVB A;  4N8N A;  4KHM A;  1S5Z A;  1FES A;  4OZ2 A;  3UR0 A;  4ZCM A;  4FPI A;  3VZH A;  3CDA A;  2V8D A;  4XIU A;  2GVD A;  1LK7 A;  1X0F A;  1GXL A;  3Q89 A;  3EPI A;  4XAK A;  3C6U A;  2J6U A;  1VQ4 S;  3ULH A;  2VFT A;  3QRQ A;  4NLD A;  1IKW B;  2G1D A;  4CO2 A;  2UV8 A;  4KFB B;  3KYL A;  1WD6 A;  3DMJ A;  2R8J A;  4NPO A;  2MKC A;  2QC3 A;  3TA0 A;  1HNW F;  4U7U K;  5MAO A;  2VOP A;  3VVU A;  1OWX A;  5J1E A;  4PKD B;  3LW5 C;  3ISN D;  1UVN A;  5C42 B;  2YWG A;  1GX5 A;  2OEK A;  3GV7 B;  1X0P A;  4BWM A;  2JDJ A;  1WTB A;  2COL A;  2FZK B;  3D0G E;  4NEZ A;  2FJV A;  1EJ7 L;  3LP1 B;  3QGI A;  4PG7 A;  1QUP A;  4ICL A;  1CEZ A;  1YJ9 S;  2J9D A;  4IYQ A;  4ETX A;  1N54 B;  4GVL A;  1Q53 A;  4OX8 A;  3Q8U A;  1NAQ A;  2BA9 A;  5DDP C;  1OJ4 A;  2OEJ A;  4WYW A;  2ZH7 A;  3CJ8 A;  4NYO A;  2ROP A;  1NK9 A;  2DEI A;  1DLO A;  2PI5 A;  3OL7 A;  4M5J A;  3C15 A;  2LP4 A;  4J7C A;  3RYL A;  4YY3 J;  5H9F J;  4WPA A;  1SL0 A;  4YB5 A;  3V4M A;  3S6E A;  3TZY A;  1B7Y B;  4JI8 J;  2AGO A;  2J9D E;  2RS8 A;  4NWB A;  1MU2 B;  3QYY A;  4F8R A;  4DZD A;  4LF9 J;  1N48 A;  4Q5V A;  2MZS A;  1C2P A;  3LAK A;  3UNY A;  4IOA Q;  5IT9 Y;  1H7X A;  1CUL A;  2ZH1 A;  4H4M A;  4DS5 A;  2C2Z B;  2CQC A;  5KFF A;  4ED4 A;  4A46 A;  2QV6 A;  3MMB B;  3OL9 A;  3M9O B;  4CT9 A;  1MMD A;  3UNG C;  2FUG 9;  2V4Q A;  1WF0 A;  3O5T B;  2CZV C;  2DIS A;  5JMN A;  1RCO B;  2FQQ B;  4NA3 A;  1CJU B;  3KUE A;  5L1J A;  2EKN A;  4OLP A;  1YBA A;  4PYD A;  3MUT P;  4OI6 A;  4ZJQ A;  2Z2L A;  4ZPA A;  2OPQ A;  1FRI A;  2YY3 A;  2XMT A;  1I94 J;  3TX0 A;  5G0R A;  1BQN A;  3I0R B;  3R5C A;  2PFF B;  3J7A 1;  5KFS A;  1FDD A;  4LQ9 A;  1DQ8 A;  2B43 A;  2RAQ A;  2XSF A;  2HHH F;  4WFY A;  1LFW A;  3UD3 P;  3SFG A;  1KHW A;  2XMW A;  4ZK7 M;  2ALY B;  1KQK A;  2MJN A;  3FEZ A;  2Z58 B;  3LAN A;  4GMK A;  4S0M A;  2MYF A;  4J91 A;  1ZAV A;  1RIS A;  4LBP A;  3KLG B;  3TJ8 A;  3D68 A;  1U1M A;  4IO9 Q;  4C11 A;  3KLF A;  3MF5 A;  1VBY A;  2XB2 D;  5K14 A;  4UT4 A;  2OPR B;  2JRS A;  1JLF A;  1WG4 A;  3IRX B;  1FWL A;  2MLX A;  3M8W A;  4Q8E A;  1H7W A;  3SSR A;  4OYZ A;  3K8V A;  1SH0 A;  3FGV A;  4NYP A;  3AJD A;  1TK0 A;  2ZKU A;  2HZV A;  3OD2 A;  3T5L A;  4URS A;  2HWI A;  1K0T A;  3DDN A;  1JJH A;  5GAH U;  3MUR P;  1KBR A;  2DNY A;  1CJK A;  1V3Z A;  4DSL A;  3C2P A;  1VRU A;  3CD5 A;  2EK1 A;  3Q2S C;  3OTO F;  1HWJ A;  4LF1 A;  5E7O B;  4RW4 A;  3QRR A;  1KVK A;  1J2V A;  2ZHO A;  1PYO B;  1N5Y A;  1OMS A;  2IAJ A;  4JBC A;  2JEG A;  2D69 A;  3QBC A;  2RRA A;  5E2Q A;  3HPO A;  4U8V A;  2J0X A;  3LO3 A;  2MZR A;  5HVG A;  1XMO F;  3NAI A;  1IBM J;  3FBB A;  5IWA J;  4HAC A;  3TOQ A;  4QWB A;  2V50 A;  1URN A;  4C48 A;  2YQ1 A;  2HQF A;  3SBM A;  4DL7 A;  3FBF A;  4WJB A;  1M90 T;  4HR2 A;  4KC5 A;  2JWN A;  1CJT B;  2G1H A;  2QRR A;  1AZS B;  2VV5 A;  1BUX A;  1UJ5 A;  1D9A A;  4K5S A;  4AND A;  1F2G A;  1NLK L;  2FJB B;  3PFO A;  2DXE A;  1G7C B;  3EZO A;  3ICL A;  1HAR A;  3GIL A;  1ARO P;  4RW8 B;  5D0E A;  1HNZ F;  3OUY B;  1X5S A;  3W1Y C;  1WHY A;  3KKF A;  4JB8 B;  3VF0 B;  4UST A;  2PN6 A;  2IPO B;  4IG3 B;  5A2Q U;  3BGU A;  4CZC A;  2W8K A;  3IWX A;  4WU3 A;  3N5B A;  1PAU B;  3CVK A;  4B02 A;  3DOL A;  1EIY B;  4N76 A;  7FD1 A;  2BV3 A;  2G2Y A;  4CYU A;  1M5S A;  1K44 A;  4IFV B;  3FKB A;  2EKY A;  4DF4 A;  4DV0 F;  1SJ4 P;  2E1P A;  2YXL A;  2DNH A;  3JSM B;  3GON A;  1WOP A;  2AWZ A;  2E5H A;  2C42 A;  3K5M A;  2GC8 A;  3TP2 A;  1NJW A;  2KT5 A;  5ADZ A;  3MWB A;  4BC7 A;  2WVD A;  2W01 A;  1T11 A;  2H5E A;  2Q6B A;  2RU9 A;  3IC1 A;  1IKW A;  4FF3 A;  2DHH A;  2HG4 A;  3AHP A;  4KFB A;  4OI3 A;  3PRV A;  4C3K A;  1Q78 A;  5DDR C;  4LVN P;  3GIK A;  3DGP A;  3CDU A;  2FZC B;  1M5O C;  4HT7 A;  2I9S A;  3TO8 A;  3MR7 A;  1V9O A;  3VHQ A;  1VK3 A;  3R97 A;  3VGS A;  1VQ5 S;  2C3Y A;  3TEH B;  5C42 A;  3UD4 P;  2VBY A;  3OXF A;  2HBZ B;  4DSJ A;  1XBW A;  2VFS A;  4K5R A;  4OZL A;  1S0V A;  1XWL A;  3GE9 A;  2UUW A;  4C7Q A;  2MZ1 A;  2AYM A;  3HF5 A;  2WW8 A;  2B51 A;  3LP1 A;  4FXD A;  2F4V F;  2W9B B;  4KT0 C;  3W8G A;  4J9P A;  4QIE A;  3M2V B;  2KFY A;  1WKJ A;  1RK8 A;  1S59 A;  1BD6 A;  3OVS A;  3POT B;  2GX8 A;  4B17 A;  2ZZM A;  1SPB P;  2RF2 B;  5A0Y B;  3P49 B;  3EDQ B;  1T9X A;  2XS2 A;  5CA5 A;  1VQL S;  1X4E A;  1RBL A;  4ECZ A;  1JLQ B;  4F3Q A;  3CCS S;  5U47 A;  3T6B A;  3CTR A;  1NEE A;  2WVC A;  3H42 A;  4YUD A;  1S1V A;  3A4T A;  4DV1 J;  3OTE A;  4J5O A;  1KLN A;  4GO5 X;  1IJE B;  3CJQ A;  3OR1 B;  4B9N A;  1MU2 A;  5CQG A;  2WW4 A;  4QW9 A;  3PKY A;  5FDL B;  1Y3J A;  4DCJ B;  5KFM A;  2DBB A;  3KHR A;  1YSJ A;  5L9N A;  3D3B J;  4DUZ F;  3W5Y A;  5F8J A;  2GIR A;  1S6Q B;  3IWL A;  2L9D A;  4Z2X A;  5FII A;  1RDR A;  2HMI A;  2XO7 A;  3MMB A;  3V4I B;  3A12 A;  4NYZ A;  2XCA A;  2AYE A;  1TL5 A;  4ILM A;  1WHV A;  4RO0 A;  3Q8Q B;  5A2Q Y;  1FDB A;  4ECV A;  2PMW A;  2V4J B;  4F25 A;  4WP3 A;  1H2V Z;  1RT3 B;  1AB8 A;  2YX1 A;  2GCF A;  2G9O A;  3GV5 B;  1RHK B;  3QJL A;  1RAH B;  4USU A;  2E5G A;  2I6W A;  5KTQ A;  3CCW A;  2C2N A;  1PBA A;  3AFG A;  3JSR A;  3DU5 A;  1FJC A;  3OTC A;  5IZH A;  2YWK A;  1KDN A;  4PPZ A;  5SUH A;  3DRS B;  2Z56 B;  3DI6 B;  3GTY X;  3M6X A;  4OYB A;  3ZZ0 A;  2JX2 A;  5H9F K;  2IJF A;  3K5O A;  4ZPB A;  1OQ6 A;  3TNV A;  1M5P C;  3ENQ A;  4DCO B;  3KLG A;  1BC6 A;  4J9L A;  3IMQ J;  4DQR A;  3KLI B;  1NUE A;  1GTH A;  4DR3 J;  2ZUG A;  1S6P A;  4NZ0 A;  1VQK S;  5CD4 A;  4F4K A;  4ZPW R;  4R8U B;  3NY0 A;  2OPR A;  4CLW A;  5M2P A;  3IRX A;  3G8S A;  1H98 A;  3MCS A;  2NQP A;  3AA9 A;  4BC9 A;  2CJX B;  1RAG B;  1S1T B;  1S0M A;  4Y00 A;  3VV2 B;  3SI8 A;  4G65 A;  3S1T A;  4TNO A;  5C2G A;  5KT6 A;  4ILL A;  2QLB B;  1CLF A;  4BDP A;  1IBK F;  2HS4 A;  4A4J A;  1GMW D;  1X4H A;  1IR0 A;  1HHS A;  4YOE A;  4DEZ A;  2P9E A;  4EUV A;  3Q2T C;  2D3O R;  2ZH6 A;  1GK8 A;  4JYA F;  2ZBC A;  4RPF A;  4M95 A;  3H5S A;  1RWK B;  1P1T A;  2FLP A;  3OFE A;  4WFN Q;  3CWJ A;  3IFE A;  2OFG X;  1N0V C;  2ZH5 A;  1GQE A;  2QSF A;  5CYM A;  3H4B A;  3M8P B;  1DHM A;  4UY8 5;  4Y3C A;  2L9W A;  4YFU A;  4L6V 3;  2FLL A;  3GU0 A;  2HWT A;  4K0K J;  3JTP A;  2FDN A;  2XI3 A;  2YWW A;  5CXT A;  1D9D A;  1RB0 A;  5I3U B;  2YWF A;  1U0S A;  1KOH A;  3AD9 C;  4UOC A;  5AXK A;  1GEH A;  2FYX A;  2CPY A;  1PCA A;  1RT2 B;  5DG7 A;  2FHJ D;  2W4P A;  3VQS A;  2WHO A;  3U1N A;  2OML A;  5DLG A;  5GAG I;  3F56 A;  4RW8 A;  1CQM A;  5HVF A;  3OUY A;  3LGN A;  3SYZ A;  2K2P A;  3DOM A;  5F8M A;  5FD1 A;  2Y8W A;  1YVF A;  1ZA1 B;  2YKA A;  2X7I A;  5D0R A;  1X9S A;  4LF8 J;  4IG3 A;  3GIM A;  3VTI A;  2U2F A;  6FD1 A;  1VC5 A;  4DFP A;  1HBM B;  3CXC R;  4ENO A;  4O4G B;  4CNZ A;  2O66 A;  3CDW A;  3HDS A;  4ED3 A;  2PA3 A;  3DRY A;  2ZE2 B;  3JSY A;  1M0S A;  3CF5 Q;  2LXU A;  4ZN3 A;  4PXC A;  4IFV A;  5KFI A;  3WC2 A;  1HYS B;  2LYV A;  3TEG A;  2Z2Y B;  2WON B;  3W64 A;  1FE0 A;  5K5M A;  1N8R T;  1KQS R;  1MNE A;  3CJ2 A;  4MKB A;  1VQN S;  1RLC L;  2I8E A;  1IKX B;  4L76 A;  2CYY A;  3VQT A;  2DGQ A;  4JI2 J;  2IY5 B;  5ETO A;  4F0H A;  3C3L A;  4F04 B;  4JI3 J;  1UJ6 A;  3EGW B;  2AX1 A;  2HSE B;  3UPF A;  1S1U B;  1T9W A;  5E3Q A;  4OMF G;  4FF1 A;  3H5U A;  3OFH A;  4OI0 A;  2KYZ A;  2RB7 A;  2ZH9 A;  3R3T A;  2XBP A;  2A3J A;  3NKY A;  2QGF B;  2CG8 A;  2DK2 A;  1NZ8 A;  3O3L A;  1BGX T;  2QLX A;  1VIX A;  2DTJ A;  2DNQ A;  4DFM A;  3RAM A;  3V6J A;  3K17 A;  4I69 A;  4B9M A;  1TVR B;  5F8I A;  4KSE B;  2DNL A;  4O44 B;  2DT9 A;  5F0W A;  1QD1 A;  4B3R F;  1SJR A;  4I6A A;  2N82 B;  3MM7 B;  2W9B A;  3ELH A;  1FJG J;  2CNN B;  2CVE A;  3I31 A;  3LQV A;  1FD2 A;  4EBE A;  3M2V A;  1VQY A;  4DV7 J;  1FER A;  2BM1 A;  3CCE S;  4TY9 A;  2VQE F;  2Z57 B;  1OS5 A;  4K8R A;  2RDI A;  3POT A;  3P45 B;  2BE2 B;  5A0Y A;  1IR2 A;  2POK A;  4OX7 A;  1DUR A;  1UZH A;  2PE8 A;  4P7T A;  1IM4 A;  1JLQ A;  1RWV B;  2MY8 A;  1Q1K A;  2GQC A;  1YTY A;  3Q24 A;  1TK5 A;  2IM0 A;  3RRH A;  2HQD A;  2LXF A;  4B3M F;  3AD8 C;  4AQY F;  3M2R B;  2UUT A;  3CIZ A;  1RTJ A;  4DG1 B;  3D4J A;  5FDL A;  2Z0G A;  3V6H A;  2B7B B;  1Y00 A;  1IKV B;  2CJQ A;  1M5K C;  2V94 A;  5B0A A;  3D9B A;  1S6Q A;  4P7V A;  4C8L A;  4WU2 A;  1KOO A;  2HKE A;  2XCP A;  3NNA A;  3MFI A;  3BYR A;  1WF1 A;  2LEA A;  3V4I A;  1H72 C;  5T7L B;  2ZH4 A;  5AT1 B;  5DQH A;  4X62 F;  1NK7 A;  2M9K A;  2IM3 A;  2JHE A;  1XIQ A;  2EWH A;  4PZV A;  1D8Z A;  1QSS A;  2V4J A;  2DCU B;  1QE1 B;  3R5J B;  1DZ5 A;  1RT3 A;  4KGV B;  4N77 A;  3MM9 B;  3ET6 A;  4FZV A;  2V9W A;  4F4W A;  2HFS A;  1X4A A;  2HEK A;  2CQG A;  3FVY A;  2R4F A;  2CPZ A;  1U6F A;  5EWE A;  1XNR F;  1JLB B;  1VJW A;  2FJW A;  1NK5 A;  2Q66 A;  5JUM A;  2OEM A;  4P6Q A;  4A48 A;  3DI6 A;  4KRW A;  4QIV A;  4NCB A;  5B08 A;  4NEY A;  4RU2 A;  5K9F A;  4KHP J;  2CPH A;  3R1H A;  1HR0 J;  4DQI A;  3GCX P;  3KLH B;  3G4S S;  2B8P A;  4K4U A;  1SB6 A;  1Q86 T;  4WFZ A;  3UDC A;  4DX8 H;  5KG4 A;  3KLI A;  1NSQ A;  1KD1 T;  4JI5 J;  4PG4 A;  5ETP A;  4R8U A;  2W9A A;  4DL4 A;  4PQA A;  4UOH A;  3G6X A;  1VLY A;  1RT1 B;  2RML A;  2FY8 A;  5EDW A;  3PO4 A;  3A8J A;  4DR7 J;  1HWL A;  1QAI A;  2BJD A;  4HYK A;  1S1T A;  2HRT A;  3JAM U;  1IJF B;  4LRE A;  1VRQ C;  2GVZ A;  3PJ9 A;  4MK9 A;  2VA2 A;  1NSP A;  2UXC F;  2MEW A;  3GPA A;  4ZP9 A;  4IRK A;  2C3M A;  2QG9 B;  3UDV A;  3AOD A;  3OT9 A;  5GAE U;  2CWX A;  2KL8 A;  5AE2 A;  4HDG A;  2LA4 A;  2C28 A;  2IBK A;  2OIH A;  4DOZ A;  3MFH A;  4OZ3 A;  2PT0 A;  1AFI A;  2YH0 A;  1HBU B;  1ACM B;  1C4A A;  3IO1 A;  4HLB A;  1IUJ A;  1N33 F;  3DFE A;  5KT7 A;  4CLZ A;  3QO9 B;  3BSN A;  1YZ7 A;  1WC1 A;  3VWS A;  3QSI A;  2JEJ A;  1W26 A;  3F41 A;  4MIA A;  2D74 B;  3M8P A;  4OYX A;  5KAK A;  1VQ8 S;  4B3T F;  3NNC A;  2DYA A;  4YR0 A;  2VUG A;  4PUO B;  4FYW B;  4U8Y A;  5IT0 A;  2ZBR A;  5I3U A;  4TKT A;  2NUH A;  2M0G B;  2ACY A;  1YZ6 A;  2BJ3 A;  1RT2 A;  1IBL J;  4DR4 J;  2XSJ B;  3NXZ A;  3FBE A;  1Q82 T;  4WXO A;  2QJ3 A;  5LSL A;  4F0M A;  2E1A A;  3GYX B;  4NXM J;  3TVZ A;  3DHW C;  1U1Q A;  4IRC A;  1HNX J;  1SC1 B;  2WVF A;  4MK8 A;  3VAJ A;  2GZO A;  3H2U B;  3N0V A;  1VLO A;  1NDL A;  1HBM A;  4X64 J;  4ZPC A;  3J7Y U;  2ZE2 A;  4FN5 A;  4LRC A;  3VAG A;  4ECS A;  4M5I A;  2JC1 A;  1IWA A;  4Y2M A;  1PAE X;  1YDL A;  1HYS A;  2D7S A;  1VRT B;  1TFY A;  3M1V A;  3V81 B;  2CZ9 A;  3MMC B;  4NLR A;  1FHT A;  2FJA B;  2WON A;  2ALZ A;  4K7Q A;  2CDR B;  3ILO A;  1F60 B;  1KVJ A;  2VAS A;  2W24 A;  2AMC B;  2VFV A;  3ZC4 A;  5KFW A;  3W2V B;  3TAN A;  4XDC A;  2MLZ A;  1IKX A;  5D4P A;  4USK A;  2VQF F;  4CCH A;  5LXR A;  2YKN B;  3HKZ D;  3PYE A;  3D1H A;  1LQ9 A;  4F36 A;  4I1T A;  1S1U A;  4ECX A;  3DC2 A;  1RI7 A;  3WX4 A;  5D0G A;  3MPV A;  3KG4 A;  4FKX A;  3HFV A;  4I2Q A;  2IC3 B;  3BS9 A;  2C2E A;  3JAM Y;  1MML A;  2EFG A;  3BBF A;  1HWI A;  1M1K T;  5KFA A;  1RHR B;  2N4D A;  1TVR A;  5KFX A;  2CUY A;  1F9E B;  4I6W A;  4M5K A;  4O44 A;  2XTJ P;  4TLR A;  1KQG B;  2UXD F;  3MM7 A;  2GIF A;  2FJX A;  4JI6 F;  4OLO A;  4AMM A;  3GG0 A;  4X4S A;  1W2I A;  3QAT A;  1SJQ A;  4ANC A;  2P2C B;  1CG2 A;  3D0H E;  2JLG A;  1IN0 A;  4ZPV R;  4WBF A;  3AY0 A;  2BE2 A;  3H20 A;  2HVH A;  2MGZ B;  1ZM3 A;  2MJU A;  1O51 A;  2BRK A;  3ZNU A;  2DPJ A;  1DTQ B;  2CQP A;  1IVZ A;  3WIV A;  3CPW R;  3RG6 A;  1T3N A;  2J9E A;  1WDD A;  4CTA B;  2Q79 A;  2MY7 A;  3TVK A;  4ZVS B;  4IKA A;  1RWU A;  4NCG B;  3LUY A;  3NCP A;  2VOO A;  3M2R A;  3QAE A;  4DG1 A;  4R5P B;  4DR6 F;  4CRJ A;  3PX4 A;  3TR5 A;  1IKV A;  2CPX A;  4X4Q A;  3ZZY A;  3BR8 A;  3LGM A;  2CPF A;  1LWE A;  3HSG A;  3JTO A;  2NPF A;  3ISZ A;  2YQ0 A;  1X4F A;  3U02 A;  2HVI A;  4ELT A;  5T7L A;  1GXT A;  2D1C A;  1T02 A;  2EXU A;  3Q22 A;  2BJ7 A;  3CSK A;  4OV6 A;  3PYF A;  4X84 A;  1QE1 A;  4U6P A;  1S79 A;  4JI0 F;  4K50 A;  1XQI A;  4K4S A;  1V3S A;  1HNW J;  4KV8 B;  5F3Z A;  3MM9 A;  5IS2 A;  2BAB A;  3CO9 A;  4QPT A;  3VAI A;  3M7V A;  4NXN F;  1YJT A;  4W4M A;  3MPU B;  3NBP B;  2DGW A;  1TKT B;  1X5P A;  2AJ4 A;  4WE1 A;  4QWD A;  3JB9 k;  3LWM A;  2KVQ E;  3ILL A;  1JLB A;  1RTI B;  3GFY A;  3EXY A;  2XO6 A;  1YJ7 A;  3QT5 A;  2E7X A;  4Q0B B;  3R27 A;  4QWC A;  3CCJ S;  2R7S A;  2AEJ A;  3CJT A;  1WNE A;  3CUL A;  4ZCL A;  1FRJ A;  5BR8 F;  5HBM B;  1VOM A;  3OW2 R;  1C1C B;  2OLW A;  4DV6 F;  2NZ4 A;  3TVY A;  1T03 B;  5HMX A;  1AA1 B;  5E3P A;  4DMZ A;  3W9I A;  5CAB A;  3BM7 A;  2J7W A;  1GH8 A;  2W2P P;  3PW2 A;  1U1L A;  2Q43 A;  3O8W A;  1RJJ A;  1RT1 A;  3MCN A;  2DNG A;  3CCQ S;  3OXL A;  2NPI A;  3MUM P;  5KFJ A;  1D0E A;  1S76 D;  3GV8 B;  3HD1 A;  1F6T A;  4C6A A;  3BGR B;  2XNR A;  1HWU A;  4F7V A;  3MM5 B;  2XS5 A;  1NHK L;  1VBX A;  2DIU A;  3HT0 A;  2LCW A;  2DXF A;  1N36 F;  1XR6 A;  4LUB A;  5KFN A;  1HBU A;  3ZZU A;  4DLG A;  3N4W A;  4FYV B;  4CLT A;  4JOU A;  3MM6 B;  4MKV A;  1XNQ F;  3D0I E;  3QO9 A;  5CHC B;  3EMT A;  1B70 B;  4HI2 A;  2AYB A;  5CCM A;  2RUG A;  2QSW A;  3IG1 B;  3G6E S;  4YP3 A;  4NLT A;  3EZU A;  5HRO B;  3GYN A;  4KGX B;  2KRB A;  2XEX A;  2AT1 B;  4PUO A;  4X66 F;  4B9T A;  1PG5 B;  3OQ2 A;  2HHH J;  2PDA A;  3I9V 9;  5JVH Q;  2DNZ A;  2OO4 A;  4CLK A;  2BMB A;  5D0H A;  4UOG A;  2VBZ A;  2FJD B;  2LU1 A;  3I4H X;  2UU9 F;  2DNR A;  5KFP A;  4C2M A;  2F40 A;  1SKW A;  4WFX A;  3GFX A;  4MMO A;  2DR6 A;  1HIY A;  1JNZ B;  2ZWP A;  5GMK a;  2ZNY A;  2E5L F;  3KLE B;  2NXN A;  4RUC A;  1S9G B;  4UZC A;  4WWS A;  1IM6 A;  3HSZ A;  3MGJ A;  3LP0 B;  2BJE A;  2VON A;  3HHL D;  1NB7 A;  5ETM A;  3BBB A;  1NKE A;  1S1W B;  4U9R A;  2VDI A;  2IFX A;  1D3W A;  3OR2 B;  1VBK A;  4ER8 A;  2C2K B;  1HBO B;  1SCJ B;  4Y2I A;  2EVZ A;  2DGU A;  4F2S A;  2CXE A;  2GHV C;  3SQO P;  1FRM A;  1VRT A;  2B9W A;  1ITP A;  1YX2 A;  3G8Q A;  2HLT A;  3DGV A;  3V81 A;  5E5N A;  1Q8B A;  2OFH X;  4DPO A;  3M9M B;  3TAQ A;  3EVO A;  1UFW A;  3CW2 C;  4M1K A;  4ECT A;  1S0O A;  5IC6 B;  1JIH A;  1U26 A;  2DPI A;  3W2V A;  2P9C A;  1U25 A;  4LT6 A;  3OTO J;  5DJB A;  1HMV B;  2JC0 A;  3MOZ A;  1N5S A;  3HHL C;  3FMW A;  3N01 A;  3J81 U;  1IQZ A;  2XLJ A;  4KYZ A;  2HQI A;  2R3V A;  4J9N A;  1XMO J;  4LRF A;  2E9Z A;  2H1Y A;  3OBI A;  4YR3 A;  4XPC A;  3M8Y A;  5L38 A;  1U1O A;  3ZTQ A;  2OP5 A;  4EBC A;  3SCL E;  4OYW A;  1JQG A;  4DU8 A;  1YRX A;  4DR5 F;  1WF2 A;  5CAA A;  4G3I A;  3D6M B;  1E6V B;  1GT8 A;  1DQ9 A;  3A3N B;  1TL4 A;  3BGF A;  1FA0 A;  2M8D B;  2MQ8 A;  5GME A;  3FDS A;  4P2S A;  3IM8 A;  4Y2A A;  3UWT A;  4DJB A;  5LM7 E;  4MKA A;  5J2P B;  1L5U A;  1TUG B;  5DG9 A;  2MQQ A;  1HNZ J;  5AJ3 F;  4ED2 A;  1EKS A;  4WIQ A;  3D6F B;  4DPW A;  2MGZ A;  4C0B A;  5K8P A;  2ZOF A;  1DTQ A;  2MQO A;  3RW7 A;  3QSY B;  1LW2 B;  5DET A;  1WHW A;  2DIV A;  1A0O B;  3NLC A;  3J7Z 5;  2LDI A;  3B6B A;  2GHP A;  4CTA A;  4NL5 A;  1REV A;  3KLV A;  2H65 B;  3D1Q A;  4V1A k;  2XGP A;  4DV0 J;  4NCG A;  3DDI A;  3OFG A;  3MZI A;  2HZC A;  1B99 A;  4R5P A;  4H4K C;  1T9T A;  4KPY A;  5HN0 A;  2V6A A;  2CKW A;  1JB0 C;  1U0H B;  2YNF B;  4H4K A;  3PY8 A;  1WG1 A;  1CC7 A;  3CCM S;  1XEZ A;  1FKA F;  2APO A;  4TYB A;  2QX0 A;  4FXW A;  4HDH A;  4ED7 A;  3E2E A;  1R89 A;  3M6V A;  3GFZ A;  4I7F B;  2J8S A;  2LVW A;  1U2R A;  1O0P A;  1MG7 A;  4I67 A;  2DGS A;  1Y7P A;  4DN0 A;  3U1M A;  5THW A;  5IFM A;  4KV8 A;  5C24 B;  5IV3 A;  5EX0 A;  2N3L A;  4NOH A;  2F65 A;  1CQN A;  2XMM A;  2OSQ A;  3DRP B;  4OX9 F;  4X4T A;  3NBP A;  1VC6 A;  3D67 A;  1KLM B;  4CO3 A;  2C2D A;  3CJ5 A;  4ANE A;  4KJI A;  2G0J A;  4RR5 A;  1RTI A;  3MED B;  2NYH A;  4DN9 A;  2Z4P A;  4ZVG A;  1F2H A;  4ATN A;  1RAO A;  5L1L A;  2F4V J;  4Q0B A;  4KAI A;  4PXB A;  4J9S A;  1T05 B;  1RAA B;  3BDE A;  4DU7 A;  3N6N A;  1VQ6 S;  4YS2 A;  1T94 A;  3PW5 A;  4UUW A;  3TZZ A;  3EYZ A;  3QJP A;  3J81 Y;  5HBM A;  1WEZ A;  2CQB A;  1C1C A;  2VPY B;  3PEH A;  4XPE A;  1WJ9 A;  4IOC Q;  1T03 A;  3CMA S;  2DH8 A;  2F63 A;  2X3D A;  1TL3 B;  2O5D A;  1S9E B;  3DNC A;  1Q79 A;  3HHD A;  1NPP A;  4F2R A;  2YX7 A;  3G82 B;  2RJZ A;  2E1C A;  4HHJ A;  5HL7 Q;  4H4O B;  3RBZ A;  3LP2 B;  3EGV A;  2D9O A;  3TAM A;  1BMQ B;  4WFB Q;  1N34 F;  4I2P B;  1PC5 A;  4DUZ J;  3BGR A;  4UY8 T;  2QA4 S;  3MM5 A;  4GKJ F;  2M2B A;  2NSB A;  1SC3 B;  1FVS A;  2N7C A;  1Y5L B;  5E33 A;  1QSY A;  1FVQ A;  3UDL A;  4QZV B;  1NPR A;  3BO3 A;  3MM6 A;  1TZ0 A;  1VCT A;  2F9J A;  1RT7 B;  2IIH A;  1P1L A;  3I0S B;  5BXI A;  5D78 A;  2CJ9 A;  1YLX A;  3Q0A A;  5HLF B;  3H98 A;  3IG1 A;  4I0W A;  2BR0 A;  1BQM B;  2MLY A;  5KFB A;  2KDO A;  5HRO A;  2QN6 B;  1HKA A;  2R7R A;  1S9F A;  1UET A;  4I68 A;  4DHV A;  1UEK A;  3TYT A;  4ZVE A;  5IV4 A;  1RA7 A;  2V68 A;  3VAK A;  2WOM B;  3LA0 A;  5CH7 B;  3JYT B;  2F8H A;  3CC2 S;  3FQL A;  1TR0 A;  3KUH A;  1U1R A;  4OI4 A;  3HVW A;  3K5L A;  2J0Q D;  3I6P A;  4YHH F;  9RUB A;  2MQP A;  1O8B A;  2H51 B;  4F26 A;  1S9G A;  4ZVP B;  1X7V A;  2F8M A;  5FJ4 A;  1KTQ A;  1SIZ A;  2GQ2 A;  3LP0 A;  1UEV A;  4ZVT B;  2ZC4 A;  4HHH A;  3PW4 A;  2K8G A;  5D8H B;  1S1W A;  1R3N A;  5DO2 A;  2CVI A;  2VC0 A;  3OR2 A;  1JXE A;  4FDF A;  3KNG A;  1GXU A;  2XM3 A;  2Z2M A;  1Q0N A;  2WVE A;  3MCO A;  5M2U A;  1E6Y B;  1EET A;  4DL3 A;  3BRE A;  4X4R A;  2VKR A;  4C4W A;  4O3S A;  3HLU A;  4HKQ A;  1IBK J;  3I9Z A;  5IM0 B;  3EDR B;  1FRK A;  2PII A;  2RVJ A;  3FMB A;  3GWC A;  1XR7 A;  2DNP A;  1MN7 A;  3BQ1 A;  2VIH A;  3QGP A;  4JYA J;  2F8E X;  1NO8 A;  2B4V A;  1H0H B;  1HMV A;  2AJ0 A;  3PO5 A;  4IR9 A;  3NGT A;  3PRD A;  3SCK E;  4C0O C;  2ZBI A;  2GJ2 A;  1FWP A;  1SH3 A;  2VDH A;  4RX6 A;  3HT3 A;  5D6G A;  4ZJO A;  2MKH A;  2MMY A;  1RWM B;  2IRY A;  2WB1 D;  2DH7 A;  3MR6 A;  2DKO B;  1NU4 A;  4HH0 A;  4M5L A;  1WWH A;  5F0U A;  1RKJ A;  3K7R A;  3BF4 A;  4DPU A;  2MB0 B;  2EFO A;  1UVJ A;  1A9N B;  1LOU A;  4ZPT R;  3R7S B;  2HHT A;  4ZHR B;  1E6V A;  1KTV A;  2HNZ B;  3KHH A;  4ZOS A;  2DR5 A;  3ZZZ A;  1G2E A;  1KWM A;  4B3S F;  2XMU A;  1XK8 A;  3K2Y A;  4UQG A;  2DJW A;  4ELU A;  4J9K A;  3TI0 A;  1KEK A;  4YDD B;  3NAH A;  5FLX Y;  1FX4 A;  2DEJ A;  2ASJ A;  2XG8 A;  4KH1 B;  1NKC A;  1UZD A;  1T7P A;  3KXD A;  1SL1 A;  4ZIW A;  3NOG A;  4AD6 A;  2W2M P;  2GQQ A;  2OTL S;  2DHG A;  3H4D A;  4GKK F;  3K5N A;  1GMV A;  3HVT A;  1UFK A;  4KBI A;  3BV8 A;  1LWX A;  1U7L A;  2CJB A;  3SCJ E;  3I96 A;  3RB3 A;  4F4A A;  3DN9 A;  5KFK A;  4OV1 A;  1RP5 A;  2FC9 A;  2FC8 A;  1U0H A;  2YNF A;  3W63 A;  3L09 A;  4X65 F;  2CQ3 A;  3CCL S;  3OJU A;  2XZW A;  3ZTR A;  2V63 A;  4OYP A;  3RGI A;  2QL5 B;  4RBT A;  4ECR A;  1U2F A;  4I7F A;  1N4L A;  4FS2 A;  2GW8 A;  4M63 A;  3A8K A;  4NE9 C;  1CSJ A;  4C9D A;  1V6H A;  2HFU A;  1MMN A;  2VL1 A;  2HVD A;  4L75 A;  3Q8S B;  5C24 A;  5EWG A;  3CED A;  3M05 A;  5HI7 A;  1FKO B;  3DRP A;  2RDD A;  1LKZ A;  2B9X A;  1KLM A;  2FHK A;  5E3R A;  2JJ4 D;  1WG5 A;  4OJH A;  3T19 A;  4B3R J;  3GB0 A;  3PM9 A;  4RNF A;  2HNY B;  1UW9 A;  1N88 A;  2KZZ A;  4LBH A;  1T05 A;  2BJ1 A;  4GC6 A;  3RJM B;  5BYR A;  2VQE J;  1QJH A;  1PIL A;  2RHQ B;  5HMY A;  1UVM A;  2HWH A;  4BS2 A;  3CD0 A;  3Q23 A;  1ZPV A;  1CS4 A;  4PAB A;  2DRD A;  2R9L A;  3AAW B;  3IM9 A;  1UEU A;  2LKZ A;  4I6Y A;  3LTO A;  3CJ3 A;  2AQ4 A;  3OHA A;  1S9E A;  4CDI A;  3IAM 9;  3E01 A;  2BAN B;  1LNQ A;  1N5V A;  4X4P A;  2RD5 C;  2KU7 A;  4DSE A;  3AXM A;  3PDN A;  3G82 A;  3T9N A;  4HT5 A;  4H4O A;  1QM9 A;  3LP2 A;  4YB7 A;  3C16 B;  3H40 A;  1F0X A;  4AQY J;  1NJZ A;  4I2P A;  3R5D A;  2K1R B;  1Q5Y A;  2OPS B;  2Z8Q A;  3MDF A;  3WQP A;  1BXN A;  3LGH A;  3DYA B;  1U8S A;  1S57 A;  4DV4 F;  4DL6 A;  4PWD B;  2B8Q A;  4X62 J;  4DQP A;  4G1P A;  5IXU A;  1SJ1 A;  4IR1 A;  2VA3 A;  4DXL A;  4UOF A;  3CJ4 A;  4A8Y A;  2RKI B;  1PJ5 A;  1HNV B;  1U48 A;  2WCX A;  1RBA A;  3PAC A;  1QSL A;  2PFD A;  3ETM A;  1YRU A;  1RT7 A;  2MQM A;  2ROG A;  3I0S A;  4V19 J;  1S4F A;  2OUG A;  2VZ8 A;  4C8Z A;  2UUA F;  1SI9 A;  5D3G B;  2PD1 A;  2W1B A;  5HLF A;  2P8I A;  5DS7 A;  4DF8 A;  2KYX A;  2XWY A;  4LF6 F;  1BQM A;  1HI1 A;  3TQ1 A;  2HHQ A;  5DRK A;  1XNR J;  2W2Q P;  4GRS A;  2YX4 A;  3TWZ A;  1SXL A;  2RQM A;  1VDH A;  3TJ9 A;  4USV A;  5F8N A;  1XTZ A;  4FNI A;  1XER A;  2C2O B;  1NK4 A;  2OHD A;  3CDE A;  3KG1 A;  4RUB A;  3HCX A;  3BN7 A;  3WHI A;  1Y11 A;  5B0B A;  2MZQ A;  1PC4 A;  1F5B A;  2IMW P;  5LJ3 Y;  5D77 A;  3AOB A;  2O01 C;  5EWF A;  4YEA A;  4ZP8 A;  4Y65 A;  3C6T B;  2FIU A;  4FKY A;  1N32 F;  3RRG A;  4ECW A;  4RUA A;  4HVZ A;  4FBT A;  4OFZ A;  3ISN C;  2RHS B;  2DO4 A;  2O1P A;  1T0T V;  4IUF A;  1KKH A;  1T8E A;  5J2M A;  3R6G B;  3OL6 A;  2CG4 A;  4JP8 A;  3U27 A;  2WZ1 A;  2C2R A;  1P9Q C;  4A8W A;  2VG7 A;  3T5K A;  3PIP Q;  3FFI A;  3E3X A;  3CDB A;  3I4P A;  1E6Y A;  2W7P A;  3G71 S;  2UXC J;  3LOU A;  2FVQ A;  1Y0H A;  2FHM A;  1KFD A;  5IM0 A;  4FVM A;  4DBQ A;  3LPY A;  4J37 A;  4AE5 A;  1U09 A;  2QO3 A;  1JJ2 R;  3AT1 B;  2E44 A;  3M32 B;  2HBR B;  1QLN A;  1TU0 B;  1N33 J;  4URG A;  1RCX B;  4U95 A;  3SQG B;  2YPZ A;  3R5G A;  4Q45 A;  3PHT A;  2QL9 B;  5A8R B;  2I5J B;  2CQH A;  3GJT B;  3NS7 B;  3I87 A;  3PRB A;  1G1X A;  4B3T J;  5L46 A;  3NGS A;  3MEC B;  4CLP A;  4CP5 A;  2QMU B;  2B9E A;  2HGM A;  1HQ2 A;  3Q83 A;  3MR3 A;  5J1P A;  3QID A;  2X1B A;  4IDK B;  2E7W A;  2HNZ A;  5GAH I;  1ZPW X;  3HUL A;  2HRU A;  3J80 Y;  1CBK A;  4NLS A;  2OD4 A;  2PEH A;  3CO0 P;  1DQA A;  3PFE A;  4IQM A;  2V2Q A;  1SIW B;  3HD2 A;  2HVE A;  2JSX A;  5C25 A;  4BLG A;  4IH5 A;  1HD0 A;  3DU6 A;  3MTK A;  1EQ0 A;  1VK8 A;  3FK4 A;  5E3A A;  3ZTS A;  5AXL A;  4JV0 A;  4ZJL A;  2V67 A;  4Y0F A;  4V19 X;  3EGN A;  2LMI A;  1NH8 A;  1B0T A;  3M6U A;  2BDP A;  3GJS B;  2NLW A;  1AFJ A;  1RWP B;  1ZET A;  4ECU A;  1IKY B;  5CZC A;  2A18 A;  2BAC A;  4RWW A;  3H7H B;  1I51 B;  4OYI A;  4CLL A;  1P8G A;  2HRY A;  4NRU A;  4QR2 A;  3EJM A;  4RZR A;  2DHA A;  1HQE B;  5HSP A;  4FBU A;  3OTB A;  4OZN A;  3KOA A;  2V9K A;  3AJ2 A;  2VQF J;  2GO8 A;  2UXB F;  2YKP A;  3AH6 A;  4G6V B;  2HHU A;  4J9M A;  4RNM A;  1X4G A;  1NRK A;  5GAD U;  2BVZ A;  2J0W A;  4LFB F;  1RHJ B;  3TUI C;  3TZW A;  1UCN A;  2ZIT A;  4Z7C A;  4OJ1 A;  1FKO A;  1NJY A;  3UD5 A;  2XGQ A;  5ETQ A;  1NSA A;  3NCQ A;  4DPY A;  2FVR A;  2UXD J;  1RSC A;  2XYH B;  1QAY A;  2HNY A;  3CMQ A;  4MYU A;  2OH2 A;  2YQ3 A;  4JI6 J;  2JOQ A;  2KO1 A;  3JS9 A;  2HGN A;  2LEB A;  3RU0 A;  2MKI A;  2BM0 A;  1N6Q B;  2CIM A;  3UQS A;  2RRN A;  1RE1 B;  1GNK A;  4RJV A;  5J1N A;  3P96 A;  2BEF A;  5B0E A;  3LAL A;  1EAY C;  2VIC A;  4A8S A;  2W9C B;  3QPI A;  1P27 B;  1QTM A;  2FTR A;  2KXH A;  1LXJ A;  5LSO A;  4K59 A;  1VHI A;  2BAN A;  4PAA A;  2Z2Z A;  5HQM A;  2BE7 D;  4X4V A;  5KFZ A;  5IT4 A;  3C16 A;  2A10 A;  4J9Q A;  1JLE B;  1FXL A;  5LOQ A;  1B7F A;  4FVC A;  4DR6 J;  3I56 S;  1NK8 A;  2R7Q A;  2YWE A;  4JUZ A;  4E0D A;  5RUB A;  2K1R A;  4QQB A;  2OPS A;  2LQ9 A;  2MKY A;  1R8A A;  3NG8 A;  1FFS B;  4CO0 A;  1I6J A;  1WDT A;  3IS9 B;  3FC9 A;  1FX2 A;  4IH7 A;  3US5 A;  2XC9 A;  4PWD A;  2GMJ A;  3OVA A;  1S4E A;  5K20 B;  5HMW A;  4NLO A;  2VPX B;  2DR9 A;  1SV5 B;  2QMX A;  2RKI A;  2OTJ S;  2GV1 A;  2NXJ A;  4ZLL A;  1HWK A;  4JI0 J;  3FCW A;  5M2R A;  2E5J A;  2ZH2 A;  4NLG A;  3CC4 S;  5D3G A;  2OPP B;  1JXV A;  3A13 A;  1NPK A;  3GMG A;  4NXN J;  1K1S A;  4B9U A;  1X4C A;  2BJ8 A;  3G6Y A;  1XMQ F;  4IRD A;  3PW7 A;  3KJQ B;  4MAK A;  4KY3 A;  3UN5 A;  1K0V A;  3K0J A;  4EEY A;  4DZ6 A;  3IBF B;  3KTQ A;  2B4P A;  2A2C A;  2BJ9 A;  3MAQ A;  3BZQ A;  2AEF A;  2PEB A;  5BR8 J;  4MT1 A;  1VQM S;  1G3O A;  1U45 A;  4DV6 J;  1H73 A;  3ZXW A;  3TAR A;  2ACM A;  3C6T A;  6FDR A;  3W5X A;  2R7U A;  1NJX A;  1RKI A;  3Q8P B;  3BPS P;  2MXY A;  1SJF A;  1A7G E;  4ZPD A;  1H74 A;  2WRM A;  3BB5 A;  1YJR A;  4N47 A;  3W2W B;  2KJV A;  3BN4 A;  2RE1 A;  2G4B A;  1HD1 A;  4OHV A;  1DRZ A;  2P9G A;  1VGY A;  4LFC F;  4OL8 A;  1Y3K A;  3FZB A;  1UVL A;  4ZVU B;  5J2Q B;  5HMZ A;  2CQ0 A;  2RQ4 A;  4CM0 A;  4BCA A;  3BO2 A;  1N36 J;  3G2X A;  5K8N A;  5E41 A;  2X1G A;  3MMA B;  4X4O A;  1HI8 A;  1QUV A;  3M32 A;  3QRP A;  2FPH X;  2W7A A;  1YG0 A;  1K73 T;  1XNQ J;  2XZT B;  1CJU A;  3SQG A;  2HIY A;  2J6T A;  2CAJ A;  5ETS A;  5A8R A;  2I5J A;  2VBW A;  1YJU A;  4P2X A;  1NDC A;  3I0R A;  1JMT A;  3VGT A;  3EPG A;  3MEC A;  4X66 J;  4OHW A;  4KGZ B;  2G13 A;  2M4M A;  2B5J B;  4MKY A;  1ROF A;  4JI4 F;  2KXF A;  4IDK A;  4A8M P;  3OV7 A;  1ZYQ A;  2UU9 J;  2MKK A;  4UF4 A;  1B4S A;  3T41 A;  2J0S D;  4CH1 A;  3J7Z T;  2KFN A;  4G1I A;  1O6X A;  4A8K A;  4CT8 A;  4AL5 A;  2E5L J;  2HFZ A;  2H5I B;  4CO5 A;  4KKO B;  3MEE B;  4HL9 A;  2KVI A;  1MRO B;  3G9C A;  4NLV A;  2QL7 B;  1UTA A;  2M70 A;  4NLW A;  4LF7 F;  3G87 A;  5A76 A;  1RTH B;  1RTD B;  4EMD A;  4LSL B;  3TUP A;  2CDQ A;  3BQ2 A;  5C7P A;  1M1H A;  4DR2 F;  2UVR A;  4WK3 A;  2QMW A;  3FCV A;  4O0N A;  3TJA A;  5E0O A;  3GZ7 A;  4J9R A;  4EGL A;  3D6H B;  8AT1 B;  1BQN B;  4WTY A;  1FK9 B;  1KR4 A;  2YH1 A;  4Z7Y A;  2R8K A;  1RA6 A;  4LR8 A;  2V0N A;  1KNZ A;  2ZWO A;  1S6U A;  5AE1 A;  4ES1 A;  1NCL A;  1HQE A;  1RU1 A;  3I5A A;  3PR4 A;  2MSS A;  1TL1 B;  5T41 A;  1T9V A;  2LU2 A;  3UDE A;  2RH3 A;  4A8Q A;  4B9L A;  3MTJ A;  3GIR A;  3PXG a;  4WFA Q;  3L3C A;  3AA8 A;  4CH7 A;  2UUB F;  4NZ6 A;  2C1E B;  1BWE A;  3NRB A;  3FCH A;  3FRZ A;  1UPM B;  3GR0 A;  1R0B G;  2G0I A;  2EW9 A;  2ZHB A;  2YPY A;  2W8L A;  1HW8 A;  2ROE A;  1RWN B;  2VB6 A;  1FEE A;  4LRA A;  4DR5 J;  4C8M A;  4FPR A;  2IVF B;  5I42 B;  2AKW B;  1CJT A;  4JI1 F;  1AZS A;  4AMP A;  1QVG R;  4ECY A;  1Y5N B;  1G4C A;  3H2L A;  4ELV A;  3EZ5 A;  1SQE A;  3CJK B;  1GMW A;  3AXK A;  4JI7 F;  2AX0 A;  4EFA C;  5AJ3 J;  2KI2 A;  1KON A;  2J7U A;  2L9N A;  3T5J A;  3ZTO A;  3FZ2 A;  1Y5I B;  3T1H F;  3HP6 A;  2BKN A;  2W9C A;  2W7O A;  2FD2 A;  2IRX A;  1TEL A;  3TUJ C;  1YIT S;  2R8G A;  1PIE A;  3PEJ A;  2Q1L A;  1T9U A;  2H3E B;  2EPI A;  2LXI A;  3NGR A;  2JLF A;  2LQ8 A;  1PBU A;  4CM2 A;  3V6D B;  3IAS 9;  4ED0 A;  2EBE A;  1N5Y B;  1FO1 A;  5HQ8 A;  2K06 A;  1JLE A;  4CO4 A;  1U6Z A;  2DNM A;  2F4F A;  3FNN A;  3BKF A;  2X3G A;  4M5G A;  3JSM A;  3HO1 A;  3OXG A;  1NK6 A;  1KS2 A;  4NZ7 A;  2F7V A;  2D3U A;  3BDP A;  1ZZN A;  2V8P A;  3KJF B;  4P52 A;  1WI8 A;  5A6W A;  1PYT A;  3IS9 A;  4R0E A;  2FHJ A;  3K59 A;  2L48 A;  4F4X A;  2YNH B;  3U7J A;  5LT5 A;  5KFD A;  1Y10 A;  1R0A B;  1KHV A;  3BYP A;  2ILY A;  2GO9 A;  4O3Q A;  2IDE A;  4K2X A;  3EM1 A;  1SV5 A;  3SZ2 A;  3PTW A;  1YHQ S;  4A8X A;  1S97 A;  1FNO A;  3OL8 A;  1UA1 A;  3RW6 A;  1PO6 A;  4ES2 A;  1PGZ A;  2OPP A;  3C19 A;  4JV5 F;  2H4W B;  3PZP A;  1D09 B;  4YME A;  1U47 A;  1FRX A;  4OX9 J;  2MHN A;  2HK3 A;  3JQK A;  2V2K A;  2KRR A;  2V8H A;  4G1Q B;  4OJG A;  5DM6 Q;  4DR1 F;  5CCL A;  3UN3 A;  2AYG A;  2QTW A;  3K8W A;  4CYU B;  2RDJ A;  2E1R A;  2D3Z A;  4P73 A;  2V34 A;  1EB0 A;  2HS0 A;  3FRY A;  1KVI A;  2IM1 A;  1F3F A;  4OYO A;  3L95 X;  5KFQ A;  1BY9 A;  1GAO A;  2RF2 A; 
#chains in the Genus database with same CATH homology
 3HJV A;  2G2Y A;  5CZD A;  5DZ6 A;  3TQE A;  4QBU A;  3G87 A;  2HG4 A;  3R8Y A;  3PTW A;  2G2O A;  3CJ8 A;  3BV8 A;  3TZX A;  2QO3 A;  2G2Z A;  2VZ9 A;  3IM9 A;  3HMJ G;  5DZ7 A;  3H0P A;  3EZO A;  3IM8 A;  4RL1 A;  2QJ3 A;  3TZY A;  2C2N A;  3SBM A;  2CUY A;  3K89 A;  3QAT A;  5CZC A;  2QC3 A;  2PFF B;  2H1Y A;  3RGI A;  4RR5 A;  2JFK A;  2UV8 G;  3TZZ A;  1MLA A;  3TZW A;  2G1H A;  2VKZ G;  3HHD A;  1NM2 A;  2VZ8 A;  2JFD A;  3R97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...