3RGUA

Structure of fap-nra at ph 5.0
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
DSVRENLDKMISEAEVLNDMAARKLITLDAEQQLELMKSLVATQSQLEATKNLIGDPNATVADLQIAYTTLGNNTQALGNELIKLNPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insight into the role of Streptococcus parasanguinis Fap1 within oral biofilm formation.
pubmed doi rcsb
molecule keywords Fimbriae-associated protein Fap1
molecule tags Structural protein
source organism Streptococcus parasanguinis
total genus 34
structure length 88
sequence length 88
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 3rguA00
5C39A 2WMMA 2QVAA 1FC2C 2KI7B 1H0TB 1OVUA 4ASWA 1U7JA 1SS1A 4IOIH 2SPZA 1S3JA 2B89A 2M0BA 1Y47A 1ZXGA 1EDKA 4ASVA 3PH0A 2KS1B 4NPFX 1EDIA 1U7MA 2KZIA 2B87A 1LP1B 1EDLA 2RKLA 3S1KA 1JMBA 4CPGA 4MN4C 2HR3A 4HB1A 5CBOA 4ZMDA 5CBNA 5EFWB 4NPDA 1OVRA 4JBZA 3RGUA 4BXLA 2LXBA 5DJUB 4GOFA 2P58A 1Q2NA 2R44A 3QWOC 4WWIA 1NVOA 2M5AA 2KUBA 1DEEG 3ZDMA 2B87B 3MZWB 2KIKA 2KZJA 3FXDA 4KJMA 5DJTB 4K3AA 2Q1KA 4EYYQ 1EC5A 1BDCA 2LR2A 4NPEA 4GODA 3FXEA 4GOEA 4HJGH 1JM0A 1OVVA 5K5GB 2I8DA 1MFTA 1X0TA 2B88A 1ZW0A 4K35A 3MHVA 2OTKE 2LXCB 2M5AB 2JWDA 2UWJE 4HKZH 1BDDA 1LT1A 1LP1A 2QRXA 4ZNCA 1EDJA 2K3RA 2ZAEB 1H0TA
chains in the Genus database with same CATH superfamily
4DT0A 2QVAA 5AW9B 3CWBG 1SQPD 1S3JA 1W5CE 3L35A 2KYVA 3V6IA 2JJLA 3JCUH 3GHGA 5AW7B 4AYCA 3KDPB 1LT9C 1SQXG 2A06G 1SQBE 1KYOD 2YMYA 1QL2A 2FBWC 3G71P 3QWOC 2KB7P 2ZT9C 1RE3A 3HD7B 3B4SA 3L73D 4N6JA 5AVUB 2POHA 4JQ0D 1N7SD 2KZJA 1K73Q 4KJMA 2WSEH 1YYCA 2HODA 2LR2A 3KXDA 2OTJP 4LGDE 2P1JA 4IFMA 3FXEA 3CCLP 1M56D 2N1TD 3VMXA 2I8DA 4C7RA 1KQGB 4B86A 3A0BE 1LTBC 4Y28J 1GDTA 2QE7H 2OYHC 2W6AA 2KP8A 2HODB 2HPCA 1YTZT 4L73A 3KHUA 3FX0A 3A0BH 3H1ID 1S9KD 2FYZA 2K1AA 1LT9A 3BCCJ 1VQMP 5AVRB 3PH0A 2Q7CA 1JEKA 3VOPA 5CHXA 4N78D 1IK9A 4UB8E 4R4MA 1N86A 1H89A 3BRVB 2Q6QA 2QJKB 2Z5HA 1NTZJ 2IFNA 1KB9I 1N73C 1LTJA 2ZYAA 3P7KA 4H13C 5KAIE 1FU1A 2P58A 4WWIA 5AW0B 1RHZB 3EFGA 3RL0C 2HFED 3VMAA 2KUBA 1LWUB 4R4LA 4UB8H 3L74E 1T8ZA 1KQLA 2Y9YA 2Q3IA 3SWKA 1DH3A 2QJYB 5BU5A 4IFFA 1J1EB 1MZ9A 3SSUA 5KAIH 1LTJB 2OYHA 2E75B 5K5GB 5AW3B 1KYOI 3U1CA 2OYIC 1KILA 1ZN5A 3CCVP 1IFMA 3RK3C 3TSIA 2WSFH 4AQRD 2Z4EA 1T3UA 3FWLA 3EQ2A 2KI7B 3V4QA 3WUTA 3KPEA 3WUUA 2SPZA 1KFNA 1FZFA 1PPJE 1ZXGA 3BRTB 1AA0A 1PZQA 1KQFB 2WSFJ 1KILB 1OWAA 5AVYB 2XDJA 1W2EA 3C1LA 3PP5A 1L0NJ 3CCRP 5EFWB 2C0WA 3PRJA 2JO1A 3L71D 2PGDA 4GOFA 1PP9G 2V4HA 1JCDA 3BCCG 3IAOA 1HH0A 3H1IG 1T3JA 2GM4A 4HH2A 2WPRA 1EXJA 1J2JB 2DW3A 3V2NA 1EXIA 3M0AA 5KLVG 3CX5D 1AFOA 2W6JH 1NTZG 3KQGA 1NGMB 2C9LY 2FXOA 4IL6E 3R2PA 4WB4A 1QLED 1Y8AA 1JB0J 3OJAB 2OYOA 1BCCE 1NTMG 4DOJA 4EIJA 1LTGC 5CCHC 4JF7A 1DD3A 1GMJA 3M06A 2RN0A 3L36A 3L75D 3S9OA 5AVSB 4U3FE 1JY3P 1FC2C 4IL6H 4D6TG 4I1LA 1QVGO 1SS1A 4IOIH 1Q82Q 1RF1C 1SQVD 1E5WA 1NO4A 2B87A 4PD4E 3CD6P 4LC1A 2WT7A 1EZVE 1BE3E 1AVOA 1KILD 3M9HA 5APYA 1M8OB 4ZMDA 2OQQA 3RGUA 4RJTA 1GTWA 3G3ZA 3CXHD 1OW8A 1X79B 3AE3C 3P32A 4PJ0H 1DX7A 2W6BA 2AXCA 1SQXK 1W2BO 4PD4H 1FOSF 2YXRB 1NHLA 2B87B 1E79H 4U3FJ 1VL2A 2KIKA 2BEQD 2WT7B 1N7SC 2J58A 1FZBA 3P8CD 2W8ZA 3H1JJ 3JSVC 2HYNA 3GG2A 4GODA 5CCHA 4YXWH 5KLIC 4DCKA 1GZLA 2N1TC 4PV1B 1J1DC 2OTKE 3L71G 2WPQA 1BGYD 2Q5UA 3W67A 1ZRTE 1BDDA 1AQTA 2FYUK 3RK3E 2IFMA 2KOGA 2M8RA 2IYPA 2QRXA 3CWBD 4XA4A 2O3JA 1RF1A 3OA7A 3CC2P 3HE4B 3GW6A 2WVRA 4ZKUA 3ITKA 4RO0A 3PHLA 4XE5B 1SQXD 2HG5D 1Y47A 2A06D 1N7LA 1VQKP 2J59M 1P84D 2KZIA 1QL1A 4GIFA 1NTKK 2FYNB 2RKLA 1NJIQ 4JYCA 2FYUE 1RF1B 1GK6A 3TGUJ 3Q2YA 4EDFA 2A45G 1IK7A 2YIUB 3M0DC 1KQSO 4GDOA 5CJ4A 3D6YA 4WVZA 3H1LE 1BSNA 2M3BA 1NVOA 2QG4A 2R5DA 3HRNA 2QSIA 3L72D 3PJSK 3RBZA 2N9BA 3HD7C 4M3LA 1DD4A 1SQVG 4I2LC 1RF0A 3E1RA 1GL2A 1NTKE 4KT0J 3H1HD 2NPSA 1FAVA 5AW6B 2QA4P 4EI2A 2G3AA 1OW7A 2O1KA 1H8AA 3GF7A 1S5LE 2I1JA 1NAYA 1GK4A 4EOTA 3C9IA 1PGQA 1IZNB 4PV1D 1NU1E 3CXHI 2ZVNB 3VMYA 1FZCB 1HJ0A 2JP3A 1RE3C 1KB9E 3AE4C 1GL2B 1M7LA 2NPSB 3B71A 2BCCE 1S5LH 3MUDA 3F89A 1SQPE 3NXSA 2QJPB 1FDIA 4L75A 2OARA 1PV3A 3JC22 2ITAA 3VP8A 5APQA 4C7NA 2E42A 3AE6C 1KB9H 3M0DA 2ZFCA 3V2QA 5KTBA 1OVRA 4JBZA 4BXLA 3CMEP 1NU1J 3UIAA 3HD7A 1KYOE 1YITP 2QJKC 1K9MQ 1LTTC 3H25A 3AE2C 4C7NB 3L73E 2BCCJ 3N4XA 1ZOYC 2WZ7A 3A2AA 1LWUC 4IFDK 5B5EE 1SQPJ 3L70G 1X22A 2JR8A 3TGUG 1KYOH 2QJYC 1JM0A 3AEDC 1J1EC 2R3SA 2E5TA 3AECC 5KLVK 1LTJC 2E75C 1DEBA 1JY3N 3MIWA 1VQPP 1IFDA 5B5EH 1S5LX 1VQ6P 1N2DC 4GT1A 1OZHA 3L72G 2IYOA 5AVTB 1ZV8A 4YXDC 3FGAD 2P7JA 1GL2D 1NTMK 2NPSD 1KORA 2WTYA 1HJBA 1D7MA 1CI6B 2IX7C 3H1HG 2Y0CA 3H1IE 1T6AA 1S9KE 1TU3F 3H1KE 3D6ZA 2WSEJ 1A02F 1EDKA 2XNXA 1SQBJ 1SQQG 1LJ2A 4N78E 4KHXA 1ZMEC 2E76B 3G9RA 1L0LG 1FOSE 4TT3H 1QX8A 1LTSC 3CCSP 1PP9D 3BCCD 1KILC 1IFPA 2LXBA 1YJWP 1OMIA 1QEXA 1LWUA 2AEFA 5KLVD 1NTZD 1JMMA 3MTUE 5APUA 3VMZA 3H1KJ 2K88A 2B9BA 2ZXEB 1NTMD 1RE4A 1OX3A 3R4YA 1WRGA 1M1KQ 3OW2O 2B88A 3HD7D 3CI9A 3HUSC 2UWJE 4HKZH 3GMAA 4D6TD 4JYBA 4L74A 3GF3A 3I55P 3IN6A 5C39A 2WPSA 1H0TB 4ASWA 1U7JA 5KJ7D 2H7HA 2Q9IA 4YPCA 3EWKA 5GTIE 2PRRA 3PTZA 2CK3H 1YBKA 2IBZD 1JO5A 3LW5H 2E76D 2HR3A 2KNCA 3S4RA 1XTCC 5AVZB 1G2CB 3L74J 4OVNF 3L71E 2GUVA 5GTIH 1JOCA 3BASA 1KN7A 2IZ1A 3AEFC 1USDA 1L0ND 1YJ9P 3II6A 1SQBG 5B66E 3AE8C 3LIEA 3AEEC 3AE5C 5DJTB 1S72P 2E74B 5APWA 1JCCA 3CX5E 4WY4A 1IO4A 4BRYA 2YKQA 1AQ5A 3HUSA 2KNCB 3IFMA 2RMZA 1OVVA 1SQVK 3SFEC 1EQ7A 1JY3O 5B66H 4C46A 2J5UA 4PV1C 3L75E 4ZKPA 3CX5H 2L5GB 2ZYDA 1HWTC 2ZAEB 3B8EB 3TNUA 4WY4B 4BRYB 5AW1B 1CW5A 3HUSB 5E79E 2PP6A 3LIDA 2E75D 1ZLLA 2YKOA 2O01N 3D70A 1OFCX 1LTAC 5KKZB 3SWYA 3I56P 1KILE 1YTZI 5E79H 1AV1A 1WMKA 3TNUB 1BSHA 2FYNC 1RQVA 5DJUB 2ZVOB 3CXHE 3L4FA 4PJ0E 1LTIC 2R44A 3I5CA 1M90Q 3O6QB 2KXPB 3L75J 2YIUC 3CL3D 3ZDMA 3RBXA 1T2KD 3P8CE 1EC5A 3U59A 1BCCJ 1M1JB 1R8EA 2IBZG 4XFJA 2E74D 3CXHH 2FXMA 4U3FD 1X0TA 3M9BA 2BASA 3H1JD 1USEA 1BGYE 4W7YA 1MUUA 3HE4A 3CWBE 2D2CB 1S4XA 1L0NG 1Q81Q 1UIXA 1EZVD 1FZCC 1SFCA 2YO3A 4WY4D 2KSEA 1OVUA 2XNDH 1RF0C 1GL2C 5KAFE 1BE3J 2NPSC 5CMZA 4H44B 1IFIA 1Q90D 2G8YA 1SQXE 3H32A 2A06E 2H43A 2QJPC 4YTPC 2Z5IA 3D71A 1P84E 1U7MA 3M91A 2AXTE 2OGUA 2IDBA 1PPJG 4QMAA 3AE7C 4RESB 4HB1A 3CX5I 4I7ZB 5KAFH 1SFCB 1SQQK 1R5SA 1L0LK 3NTNA 3MUDC 1LGHB 2W27A 3L70D 1P84H 3H32B 2M5AA 3TGUD 2AXTH 2KLUA 3M9QA 1YJNP 1Y9BA 3H1HE 1BDCA 2A45I 5AVQB 1SP4A 1SVFA 2R5BA 1K04A 1SQXJ 3A7OA 2WITA 4HJGH 1NH4A 2K9YA 4Z1MH 2O1JA 2IPPA 3MHVA 1FZCA 2M5AB 1VQ9P 1AVYA 3RK2B 1MV8A 1LP1A 4DJGA 2KLVA 1EDJA 5APTA 2D2CD 1NKZB 1SLQA 1BCCG 1FDOA 2Y0DA 1S1CX 1SQQD 3Q5SA 2FYUJ 1L0LD 3IR9A 3AE9C 5KJ7C 3CLQA 4H44D 4ASVA 4U3FG 2HLOA 2V7QH 1LP1B 3VTPC 3H1JG 4WBAA 2P2UA 3A0HE 3H1LJ 2XZRA 3B5NA 3L37A 2E76C 1M57D 1VQ7P 1SFCD 1EZVG 1BE3G 1RQUA 1Q2NA 1NTKJ 2JWAA 2PFXA 3AEAC 2MKVA 2R3CA 3A0HH 4Y99B 1VQNP 1URQA 2NZ2A 5APVA 4EYYQ 1VQ5P 3B5NB 1YIJP 1HUCA 1GW3A 1KD1Q 2WPVB 3BVHA 3FWNA 1ZW0A 5CCGA 1JY2N 4W80A 1NOHA 1VQLP 1L4AC 1P84I 1VF5B 1URQB 2YKPA 3RK2D 5KJ7A 1L2PA 1PL5A 1CI6A 2FFDA 4LLHA 3NMDA 2FY8A 4RKUJ 1RE4C 5AW5B 1NTZK 1PGPA 2M0BA 2M3EA 2P67A 4H0LB 3CCUP 5AW2B 1PP9E 3GHGB 3BCCE 2FFDB 3L73J 5CBOA 3CCJP 1SQBD 2H8PD 3VN0A 2FYUG 1ZP0C 2YMKA 5KLVE 2C0XA 4U7JA 3MGNA 2YNYA 1NTZE 2NRGA 1FZEA 1FJKA 2Y9ZA 3H1LG 2IZ0A 1IJDB 2Y0EA 1T2KC 1NYHA 4NPEA 1NTME 4O9BA 1L4AA 3B5ND 1KC8Q 2ZYGA 2E74C 3H6PA 4K35A 1NTKG 1Q7YQ 2LXCB 4HYTB 2KS1A 1PP9J 3H1KD 1JTHA 1H88A 1JNMA 4D6TE 3A3YB 3H1IJ 4ZNCA 5AW8B 2CPBA 1VF5D 1NAFA 1URQD 1H0TA 1NU1G 5KLVJ 2OTLP 1L4AB 2QM8A 4TLFA 2HPCB 4WY4C 2B89A 2AEMA 1L0NK 1FE6A 3G6EP 1MFZA 2BCCG 1OXZA 3AEGC 2KS1B 4NPFX 5CCGD 3Q5RA 1JTHB 2L91A 1LT9B 3Q5PA 1NTMJ 1SQPG 1HGZA 1EDLA 2IBZE 4H0LD 1G2CA 2W90A 3WUVA 5KKZC 2ZT9B 3N7NA 4D6TJ 3USSA 5BVZA 3O8ZA 5AW4B 1L0NE 1DEEG 3L74D 3OAKA 3E1IA 3GLMA 4K3AA 1HVVA 2H89C 2YXQB 3F5HA 2Q1KA 3CC7P 1PGJA 2ZXXA 1KZUB 4N3YB 3L73G 4JPZB 3V4WA 1ZR2A 1XTGB 4OGQC 4I6MC 1M1JC 3MP7B 1JY2O 3V2PA 3TK1A 3LW5J 2OYHB 2JEEA 1HF9A 1GU4A 2PAJA 5AVXB 2O01H 1GU5A 1PIXA 1N73A 1K05A 3KYQA 2D2CC 2WMMA 1FJPA 1L4AD 3K5BA 3Q1MA 1HBWA 1PPJD 3TF5A 1NWQA 1KMIZ 1FZAA 3A5TA 2O01J 3L71J 4H44C 1QVFO 1JY2P 1AJYA 2H88C 3H1KG 1N73B 2GUSA 3SFDC 4DZOA 4H13B 4MN4C 1N8RQ 1OIPA 2WWWA 5CBNA 3RL0B 1RY3A 3O6QA 3TYYA 5AVVB 5APSA 2ZT9D 2OYIA 1SQVE 4I7ZC 3WMM0 1SFCC 2JDIH 1X9VA 2A45H 1S2EA 1RH5B 3P8MC 2FKWB 1Z56A 3MZWB 1PGOA 1M1JA 1HGVA 3CCQP 4UB6E 2WSCH 1WT6A 1IFJA 2OYIB 2N9YB 3H1JE 3RK3B 1BCCD 1LT1A 4OGQB 1YQ4C 5TJHA 4W7ZA 3AEBC 4UB6H 2IBZI 3RK2C 2WSCJ 3L74G 1SQVJ 2K9JA 5TISE 3QH9A 1VQOP 2KSJA 3MD0A 1OW6A 4OWFA 2LKMA 3TDKA 3NFQA 3E7KA 1CSBA 4PD4D 1VQ8P 2Q3EA 4L76A 1BE3D 5TISH 3S1KA 3SWFA 3V5BA 1X8YA 2K9JB 1QGKB 1FBMA 4H13D 4NPDA 3W68A 2QEXP 3RL0D 2I1KA 3PLNA 5BU8B 3L70E 3HTKA 1VQ4P 3TGUE 2XKMA 5AVWB 3T97A 1VPCA 2JKVA 3FXDA 4GKGA 2AEJA 2YO2A 3AE1C 2C9NY 3RL0g 2R32A 4Y99C 1BGYJ 1YHQP 4IL6X 1KFMA 1A02J 2FXPA 2P10A 3CWBJ 4GOEA 3B5NC 3WU2E 5H2FE 1MFTA 3L72E 3HTKB 2E43A 1ZRTD 2WQYC 3T97B 2RH0A 3RK3D 4OGQD 3CMAP 5GTHE 2K3RA 1NKNA 2WSSH 1VF5C 1URQC 3L70J 4A7PA 3WU2H 2MJZA 2E5YA 1SQQE 5H2FH 3CPWO 3Q3DA 3L75G 1IC2A 2BEZF 1L0LE 1CZQA 1YQ3C 2VRSA 1YI2P 1ZR4A 4BWNA 1K8AQ 1N7SA 1NU1K 2KK7A 2W83C 1EDIA 2CPSA 2ZJSE 1VDFA 5GTHH 5CCGC 3U1AA 3C8VA 2FYUD 3ABVC 3BATA 1JMBA 1GD2E 1U57A 4H0LC 4CPGA 3L72J 1LNQA 2N1TA 1FZGA 3GHGC 3HE5A 1SQPK 2FFDC 2QIWA 3IF4A 3H1HJ 3H1LD 1G1IA 1FDMA 1N7SB 1JUNA 1DIPA 1KTMA 3CCEP 5APXA 1SQQJ 1MKMA 1R5LA 5L8RJ 5KLIB 1NTKD 3VP9A 1L0LJ 4PD4I 5M1BA 3CC4P 2QM7A 1GW4A 1FS0E 1HTLC 2K37A 1G1JA 1EZVI 2N1TB 1J1DB 3VYIA 3G4SP 2V7QJ 3KZIE 3HE5B 2XV5A 5CJ0A 3CCMP 1Q86Q 1UIIA 4OH8B 2XU6A 5CCHD 2JWDA 1NU1D 4AUWA 1PFIA 3EFFK 1KV4A 1KB9D 3JCUE 2GA1A 1IFNA 1SQBK 3V2RA 1BGYG 2BCCD 3KZIH
chains in the Genus database with same CATH topology
5C39A 2WMMA 2QVAA 1FC2C 2KI7B 1H0TB 1OVUA 4ASWA 1U7JA 1SS1A 4IOIH 2SPZA 1S3JA 2B89A 2M0BA 1Y47A 1ZXGA 1EDKA 4ASVA 3PH0A 2KS1B 4NPFX 1EDIA 1U7MA 2KZIA 2B87A 1LP1B 1EDLA 2RKLA 3S1KA 1JMBA 4CPGA 4MN4C 2HR3A 4HB1A 5CBOA 4ZMDA 5CBNA 5EFWB 4NPDA 1OVRA 4JBZA 3RGUA 4BXLA 2LXBA 5DJUB 4GOFA 2P58A 1Q2NA 2R44A 3QWOC 4WWIA 1NVOA 2M5AA 2KUBA 1DEEG 3ZDMA 2B87B 3MZWB 2KIKA 2KZJA 3FXDA 4KJMA 5DJTB 4K3AA 2Q1KA 4EYYQ 1EC5A 1BDCA 2LR2A 4NPEA 4GODA 3FXEA 4GOEA 4HJGH 1JM0A 1OVVA 5K5GB 2I8DA 1MFTA 1X0TA 2B88A 1ZW0A 4K35A 3MHVA 2OTKE 2LXCB 2M5AB 2JWDA 2UWJE 4HKZH 1BDDA 1LT1A 1LP1A 2QRXA 4ZNCA 1EDJA 2K3RA 2ZAEB 1H0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C39 A;  2WMM A;  2QVA A;  1FC2 C;  2KI7 B;  1H0T B;  1OVU A;  4ASW A;  1U7J A;  1SS1 A;  4IOI H;  2SPZ A;  1S3J A;  2B89 A;  2M0B A;  1Y47 A;  1ZXG A;  1EDK A;  4ASV A;  3PH0 A;  2KS1 B;  4NPF X;  1EDI A;  1U7M A;  2KZI A;  2B87 A;  1LP1 B;  1EDL A;  2RKL A;  3S1K A;  1JMB A;  4CPG A;  4MN4 C;  2HR3 A;  4HB1 A;  5CBO A;  4ZMD A;  5CBN A;  5EFW B;  4NPD A;  1OVR A;  4JBZ A;  3RGU A;  4BXL A;  2LXB A;  5DJU B;  4GOF A;  2P58 A;  1Q2N A;  2R44 A;  3QWO C;  4WWI A;  1NVO A;  2M5A A;  2KUB A;  1DEE G;  3ZDM A;  2B87 B;  3MZW B;  2KIK A;  2KZJ A;  3FXD A;  4KJM A;  5DJT B;  4K3A A;  2Q1K A;  4EYY Q;  1EC5 A;  1BDC A;  2LR2 A;  4NPE A;  4GOD A;  3FXE A;  4GOE A;  4HJG H;  1JM0 A;  1OVV A;  5K5G B;  2I8D A;  1MFT A;  1X0T A;  2B88 A;  1ZW0 A;  4K35 A;  3MHV A;  2OTK E;  2LXC B;  2M5A B;  2JWD A;  2UWJ E;  4HKZ H;  1BDD A;  1LT1 A;  1LP1 A;  2QRX A;  4ZNC A;  1EDJ A;  2K3R A;  2ZAE B;  1H0T A; 
#chains in the Genus database with same CATH topology
 4DT0 A;  2QVA A;  5AW9 B;  3CWB G;  1SQP D;  1S3J A;  1W5C E;  3L35 A;  2KYV A;  3V6I A;  2JJL A;  3JCU H;  3GHG A;  5AW7 B;  4AYC A;  3KDP B;  1LT9 C;  1SQX G;  2A06 G;  1SQB E;  1KYO D;  2YMY A;  1QL2 A;  2FBW C;  3G71 P;  3QWO C;  2KB7 P;  2ZT9 C;  1RE3 A;  3HD7 B;  3B4S A;  3L73 D;  4N6J A;  5AVU B;  2POH A;  4JQ0 D;  1N7S D;  2KZJ A;  1K73 Q;  4KJM A;  2WSE H;  1YYC A;  2HOD A;  2LR2 A;  3KXD A;  2OTJ P;  4LGD E;  2P1J A;  4IFM A;  3FXE A;  3CCL P;  1M56 D;  2N1T D;  3VMX A;  2I8D A;  4C7R A;  1KQG B;  4B86 A;  3A0B E;  1LTB C;  4Y28 J;  1GDT A;  2QE7 H;  2OYH C;  2W6A A;  2KP8 A;  2HOD B;  2HPC A;  1YTZ T;  4L73 A;  3KHU A;  3FX0 A;  3A0B H;  3H1I D;  1S9K D;  2FYZ A;  2K1A A;  1LT9 A;  3BCC J;  1VQM P;  5AVR B;  3PH0 A;  2Q7C A;  1JEK A;  3VOP A;  5CHX A;  4N78 D;  1IK9 A;  4UB8 E;  4R4M A;  1N86 A;  1H89 A;  3BRV B;  2Q6Q A;  2QJK B;  2Z5H A;  1NTZ J;  2IFN A;  1KB9 I;  1N73 C;  1LTJ A;  2ZYA A;  3P7K A;  4H13 C;  5KAI E;  1FU1 A;  2P58 A;  4WWI A;  5AW0 B;  1RHZ B;  3EFG A;  3RL0 C;  2HFE D;  3VMA A;  2KUB A;  1LWU B;  4R4L A;  4UB8 H;  3L74 E;  1T8Z A;  1KQL A;  2Y9Y A;  2Q3I A;  3SWK A;  1DH3 A;  2QJY B;  5BU5 A;  4IFF A;  1J1E B;  1MZ9 A;  3SSU A;  5KAI H;  1LTJ B;  2OYH A;  2E75 B;  5K5G B;  5AW3 B;  1KYO I;  3U1C A;  2OYI C;  1KIL A;  1ZN5 A;  3CCV P;  1IFM A;  3RK3 C;  3TSI A;  2WSF H;  4AQR D;  2Z4E A;  1T3U A;  3FWL A;  3EQ2 A;  2KI7 B;  3V4Q A;  3WUT A;  3KPE A;  3WUU A;  2SPZ A;  1KFN A;  1FZF A;  1PPJ E;  1ZXG A;  3BRT B;  1AA0 A;  1PZQ A;  1KQF B;  2WSF J;  1KIL B;  1OWA A;  5AVY B;  2XDJ A;  1W2E A;  3C1L A;  3PP5 A;  1L0N J;  3CCR P;  5EFW B;  2C0W A;  3PRJ A;  2JO1 A;  3L71 D;  2PGD A;  4GOF A;  1PP9 G;  2V4H A;  1JCD A;  3BCC G;  3IAO A;  1HH0 A;  3H1I G;  1T3J A;  2GM4 A;  4HH2 A;  2WPR A;  1EXJ A;  1J2J B;  2DW3 A;  3V2N A;  1EXI A;  3M0A A;  5KLV G;  3CX5 D;  1AFO A;  2W6J H;  1NTZ G;  3KQG A;  1NGM B;  2C9L Y;  2FXO A;  4IL6 E;  3R2P A;  4WB4 A;  1QLE D;  1Y8A A;  1JB0 J;  3OJA B;  2OYO A;  1BCC E;  1NTM G;  4DOJ A;  4EIJ A;  1LTG C;  5CCH C;  4JF7 A;  1DD3 A;  1GMJ A;  3M06 A;  2RN0 A;  3L36 A;  3L75 D;  3S9O A;  5AVS B;  4U3F E;  1JY3 P;  1FC2 C;  4IL6 H;  4D6T G;  4I1L A;  1QVG O;  1SS1 A;  4IOI H;  1Q82 Q;  1RF1 C;  1SQV D;  1E5W A;  1NO4 A;  2B87 A;  4PD4 E;  3CD6 P;  4LC1 A;  2WT7 A;  1EZV E;  1BE3 E;  1AVO A;  1KIL D;  3M9H A;  5APY A;  1M8O B;  4ZMD A;  2OQQ A;  3RGU A;  4RJT A;  1GTW A;  3G3Z A;  3CXH D;  1OW8 A;  1X79 B;  3AE3 C;  3P32 A;  4PJ0 H;  1DX7 A;  2W6B A;  2AXC A;  1SQX K;  1W2B O;  4PD4 H;  1FOS F;  2YXR B;  1NHL A;  2B87 B;  1E79 H;  4U3F J;  1VL2 A;  2KIK A;  2BEQ D;  2WT7 B;  1N7S C;  2J58 A;  1FZB A;  3P8C D;  2W8Z A;  3H1J J;  3JSV C;  2HYN A;  3GG2 A;  4GOD A;  5CCH A;  4YXW H;  5KLI C;  4DCK A;  1GZL A;  2N1T C;  4PV1 B;  1J1D C;  2OTK E;  3L71 G;  2WPQ A;  1BGY D;  2Q5U A;  3W67 A;  1ZRT E;  1BDD A;  1AQT A;  2FYU K;  3RK3 E;  2IFM A;  2KOG A;  2M8R A;  2IYP A;  2QRX A;  3CWB D;  4XA4 A;  2O3J A;  1RF1 A;  3OA7 A;  3CC2 P;  3HE4 B;  3GW6 A;  2WVR A;  4ZKU A;  3ITK A;  4RO0 A;  3PHL A;  4XE5 B;  1SQX D;  2HG5 D;  1Y47 A;  2A06 D;  1N7L A;  1VQK P;  2J59 M;  1P84 D;  2KZI A;  1QL1 A;  4GIF A;  1NTK K;  2FYN B;  2RKL A;  1NJI Q;  4JYC A;  2FYU E;  1RF1 B;  1GK6 A;  3TGU J;  3Q2Y A;  4EDF A;  2A45 G;  1IK7 A;  2YIU B;  3M0D C;  1KQS O;  4GDO A;  5CJ4 A;  3D6Y A;  4WVZ A;  3H1L E;  1BSN A;  2M3B A;  1NVO A;  2QG4 A;  2R5D A;  3HRN A;  2QSI A;  3L72 D;  3PJS K;  3RBZ A;  2N9B A;  3HD7 C;  4M3L A;  1DD4 A;  1SQV G;  4I2L C;  1RF0 A;  3E1R A;  1GL2 A;  1NTK E;  4KT0 J;  3H1H D;  2NPS A;  1FAV A;  5AW6 B;  2QA4 P;  4EI2 A;  2G3A A;  1OW7 A;  2O1K A;  1H8A A;  3GF7 A;  1S5L E;  2I1J A;  1NAY A;  1GK4 A;  4EOT A;  3C9I A;  1PGQ A;  1IZN B;  4PV1 D;  1NU1 E;  3CXH I;  2ZVN B;  3VMY A;  1FZC B;  1HJ0 A;  2JP3 A;  1RE3 C;  1KB9 E;  3AE4 C;  1GL2 B;  1M7L A;  2NPS B;  3B71 A;  2BCC E;  1S5L H;  3MUD A;  3F89 A;  1SQP E;  3NXS A;  2QJP B;  1FDI A;  4L75 A;  2OAR A;  1PV3 A;  3JC2 2;  2ITA A;  3VP8 A;  5APQ A;  4C7N A;  2E42 A;  3AE6 C;  1KB9 H;  3M0D A;  2ZFC A;  3V2Q A;  5KTB A;  1OVR A;  4JBZ A;  4BXL A;  3CME P;  1NU1 J;  3UIA A;  3HD7 A;  1KYO E;  1YIT P;  2QJK C;  1K9M Q;  1LTT C;  3H25 A;  3AE2 C;  4C7N B;  3L73 E;  2BCC J;  3N4X A;  1ZOY C;  2WZ7 A;  3A2A A;  1LWU C;  4IFD K;  5B5E E;  1SQP J;  3L70 G;  1X22 A;  2JR8 A;  3TGU G;  1KYO H;  2QJY C;  1JM0 A;  3AED C;  1J1E C;  2R3S A;  2E5T A;  3AEC C;  5KLV K;  1LTJ C;  2E75 C;  1DEB A;  1JY3 N;  3MIW A;  1VQP P;  1IFD A;  5B5E H;  1S5L X;  1VQ6 P;  1N2D C;  4GT1 A;  1OZH A;  3L72 G;  2IYO A;  5AVT B;  1ZV8 A;  4YXD C;  3FGA D;  2P7J A;  1GL2 D;  1NTM K;  2NPS D;  1KOR A;  2WTY A;  1HJB A;  1D7M A;  1CI6 B;  2IX7 C;  3H1H G;  2Y0C A;  3H1I E;  1T6A A;  1S9K E;  1TU3 F;  3H1K E;  3D6Z A;  2WSE J;  1A02 F;  1EDK A;  2XNX A;  1SQB J;  1SQQ G;  1LJ2 A;  4N78 E;  4KHX A;  1ZME C;  2E76 B;  3G9R A;  1L0L G;  1FOS E;  4TT3 H;  1QX8 A;  1LTS C;  3CCS P;  1PP9 D;  3BCC D;  1KIL C;  1IFP A;  2LXB A;  1YJW P;  1OMI A;  1QEX A;  1LWU A;  2AEF A;  5KLV D;  1NTZ D;  1JMM A;  3MTU E;  5APU A;  3VMZ A;  3H1K J;  2K88 A;  2B9B A;  2ZXE B;  1NTM D;  1RE4 A;  1OX3 A;  3R4Y A;  1WRG A;  1M1K Q;  3OW2 O;  2B88 A;  3HD7 D;  3CI9 A;  3HUS C;  2UWJ E;  4HKZ H;  3GMA A;  4D6T D;  4JYB A;  4L74 A;  3GF3 A;  3I55 P;  3IN6 A;  5C39 A;  2WPS A;  1H0T B;  4ASW A;  1U7J A;  5KJ7 D;  2H7H A;  2Q9I A;  4YPC A;  3EWK A;  5GTI E;  2PRR A;  3PTZ A;  2CK3 H;  1YBK A;  2IBZ D;  1JO5 A;  3LW5 H;  2E76 D;  2HR3 A;  2KNC A;  3S4R A;  1XTC C;  5AVZ B;  1G2C B;  3L74 J;  4OVN F;  3L71 E;  2GUV A;  5GTI H;  1JOC A;  3BAS A;  1KN7 A;  2IZ1 A;  3AEF C;  1USD A;  1L0N D;  1YJ9 P;  3II6 A;  1SQB G;  5B66 E;  3AE8 C;  3LIE A;  3AEE C;  3AE5 C;  5DJT B;  1S72 P;  2E74 B;  5APW A;  1JCC A;  3CX5 E;  4WY4 A;  1IO4 A;  4BRY A;  2YKQ A;  1AQ5 A;  3HUS A;  2KNC B;  3IFM A;  2RMZ A;  1OVV A;  1SQV K;  3SFE C;  1EQ7 A;  1JY3 O;  5B66 H;  4C46 A;  2J5U A;  4PV1 C;  3L75 E;  4ZKP A;  3CX5 H;  2L5G B;  2ZYD A;  1HWT C;  2ZAE B;  3B8E B;  3TNU A;  4WY4 B;  4BRY B;  5AW1 B;  1CW5 A;  3HUS B;  5E79 E;  2PP6 A;  3LID A;  2E75 D;  1ZLL A;  2YKO A;  2O01 N;  3D70 A;  1OFC X;  1LTA C;  5KKZ B;  3SWY A;  3I56 P;  1KIL E;  1YTZ I;  5E79 H;  1AV1 A;  1WMK A;  3TNU B;  1BSH A;  2FYN C;  1RQV A;  5DJU B;  2ZVO B;  3CXH E;  3L4F A;  4PJ0 E;  1LTI C;  2R44 A;  3I5C A;  1M90 Q;  3O6Q B;  2KXP B;  3L75 J;  2YIU C;  3CL3 D;  3ZDM A;  3RBX A;  1T2K D;  3P8C E;  1EC5 A;  3U59 A;  1BCC J;  1M1J B;  1R8E A;  2IBZ G;  4XFJ A;  2E74 D;  3CXH H;  2FXM A;  4U3F D;  1X0T A;  3M9B A;  2BAS A;  3H1J D;  1USE A;  1BGY E;  4W7Y A;  1MUU A;  3HE4 A;  3CWB E;  2D2C B;  1S4X A;  1L0N G;  1Q81 Q;  1UIX A;  1EZV D;  1FZC C;  1SFC A;  2YO3 A;  4WY4 D;  2KSE A;  1OVU A;  2XND H;  1RF0 C;  1GL2 C;  5KAF E;  1BE3 J;  2NPS C;  5CMZ A;  4H44 B;  1IFI A;  1Q90 D;  2G8Y A;  1SQX E;  3H32 A;  2A06 E;  2H43 A;  2QJP C;  4YTP C;  2Z5I A;  3D71 A;  1P84 E;  1U7M A;  3M91 A;  2AXT E;  2OGU A;  2IDB A;  1PPJ G;  4QMA A;  3AE7 C;  4RES B;  4HB1 A;  3CX5 I;  4I7Z B;  5KAF H;  1SFC B;  1SQQ K;  1R5S A;  1L0L K;  3NTN A;  3MUD C;  1LGH B;  2W27 A;  3L70 D;  1P84 H;  3H32 B;  2M5A A;  3TGU D;  2AXT H;  2KLU A;  3M9Q A;  1YJN P;  1Y9B A;  3H1H E;  1BDC A;  2A45 I;  5AVQ B;  1SP4 A;  1SVF A;  2R5B A;  1K04 A;  1SQX J;  3A7O A;  2WIT A;  4HJG H;  1NH4 A;  2K9Y A;  4Z1M H;  2O1J A;  2IPP A;  3MHV A;  1FZC A;  2M5A B;  1VQ9 P;  1AVY A;  3RK2 B;  1MV8 A;  1LP1 A;  4DJG A;  2KLV A;  1EDJ A;  5APT A;  2D2C D;  1NKZ B;  1SLQ A;  1BCC G;  1FDO A;  2Y0D A;  1S1C X;  1SQQ D;  3Q5S A;  2FYU J;  1L0L D;  3IR9 A;  3AE9 C;  5KJ7 C;  3CLQ A;  4H44 D;  4ASV A;  4U3F G;  2HLO A;  2V7Q H;  1LP1 B;  3VTP C;  3H1J G;  4WBA A;  2P2U A;  3A0H E;  3H1L J;  2XZR A;  3B5N A;  3L37 A;  2E76 C;  1M57 D;  1VQ7 P;  1SFC D;  1EZV G;  1BE3 G;  1RQU A;  1Q2N A;  1NTK J;  2JWA A;  2PFX A;  3AEA C;  2MKV A;  2R3C A;  3A0H H;  4Y99 B;  1VQN P;  1URQ A;  2NZ2 A;  5APV A;  4EYY Q;  1VQ5 P;  3B5N B;  1YIJ P;  1HUC A;  1GW3 A;  1KD1 Q;  2WPV B;  3BVH A;  3FWN A;  1ZW0 A;  5CCG A;  1JY2 N;  4W80 A;  1NOH A;  1VQL P;  1L4A C;  1P84 I;  1VF5 B;  1URQ B;  2YKP A;  3RK2 D;  5KJ7 A;  1L2P A;  1PL5 A;  1CI6 A;  2FFD A;  4LLH A;  3NMD A;  2FY8 A;  4RKU J;  1RE4 C;  5AW5 B;  1NTZ K;  1PGP A;  2M0B A;  2M3E A;  2P67 A;  4H0L B;  3CCU P;  5AW2 B;  1PP9 E;  3GHG B;  3BCC E;  2FFD B;  3L73 J;  5CBO A;  3CCJ P;  1SQB D;  2H8P D;  3VN0 A;  2FYU G;  1ZP0 C;  2YMK A;  5KLV E;  2C0X A;  4U7J A;  3MGN A;  2YNY A;  1NTZ E;  2NRG A;  1FZE A;  1FJK A;  2Y9Z A;  3H1L G;  2IZ0 A;  1IJD B;  2Y0E A;  1T2K C;  1NYH A;  4NPE A;  1NTM E;  4O9B A;  1L4A A;  3B5N D;  1KC8 Q;  2ZYG A;  2E74 C;  3H6P A;  4K35 A;  1NTK G;  1Q7Y Q;  2LXC B;  4HYT B;  2KS1 A;  1PP9 J;  3H1K D;  1JTH A;  1H88 A;  1JNM A;  4D6T E;  3A3Y B;  3H1I J;  4ZNC A;  5AW8 B;  2CPB A;  1VF5 D;  1NAF A;  1URQ D;  1H0T A;  1NU1 G;  5KLV J;  2OTL P;  1L4A B;  2QM8 A;  4TLF A;  2HPC B;  4WY4 C;  2B89 A;  2AEM A;  1L0N K;  1FE6 A;  3G6E P;  1MFZ A;  2BCC G;  1OXZ A;  3AEG C;  2KS1 B;  4NPF X;  5CCG D;  3Q5R A;  1JTH B;  2L91 A;  1LT9 B;  3Q5P A;  1NTM J;  1SQP G;  1HGZ A;  1EDL A;  2IBZ E;  4H0L D;  1G2C A;  2W90 A;  3WUV A;  5KKZ C;  2ZT9 B;  3N7N A;  4D6T J;  3USS A;  5BVZ A;  3O8Z A;  5AW4 B;  1L0N E;  1DEE G;  3L74 D;  3OAK A;  3E1I A;  3GLM A;  4K3A A;  1HVV A;  2H89 C;  2YXQ B;  3F5H A;  2Q1K A;  3CC7 P;  1PGJ A;  2ZXX A;  1KZU B;  4N3Y B;  3L73 G;  4JPZ B;  3V4W A;  1ZR2 A;  1XTG B;  4OGQ C;  4I6M C;  1M1J C;  3MP7 B;  1JY2 O;  3V2P A;  3TK1 A;  3LW5 J;  2OYH B;  2JEE A;  1HF9 A;  1GU4 A;  2PAJ A;  5AVX B;  2O01 H;  1GU5 A;  1PIX A;  1N73 A;  1K05 A;  3KYQ A;  2D2C C;  2WMM A;  1FJP A;  1L4A D;  3K5B A;  3Q1M A;  1HBW A;  1PPJ D;  3TF5 A;  1NWQ A;  1KMI Z;  1FZA A;  3A5T A;  2O01 J;  3L71 J;  4H44 C;  1QVF O;  1JY2 P;  1AJY A;  2H88 C;  3H1K G;  1N73 B;  2GUS A;  3SFD C;  4DZO A;  4H13 B;  4MN4 C;  1N8R Q;  1OIP A;  2WWW A;  5CBN A;  3RL0 B;  1RY3 A;  3O6Q A;  3TYY A;  5AVV B;  5APS A;  2ZT9 D;  2OYI A;  1SQV E;  4I7Z C;  3WMM 0;  1SFC C;  2JDI H;  1X9V A;  2A45 H;  1S2E A;  1RH5 B;  3P8M C;  2FKW B;  1Z56 A;  3MZW B;  1PGO A;  1M1J A;  1HGV A;  3CCQ P;  4UB6 E;  2WSC H;  1WT6 A;  1IFJ A;  2OYI B;  2N9Y B;  3H1J E;  3RK3 B;  1BCC D;  1LT1 A;  4OGQ B;  1YQ4 C;  5TJH A;  4W7Z A;  3AEB C;  4UB6 H;  2IBZ I;  3RK2 C;  2WSC J;  3L74 G;  1SQV J;  2K9J A;  5TIS E;  3QH9 A;  1VQO P;  2KSJ A;  3MD0 A;  1OW6 A;  4OWF A;  2LKM A;  3TDK A;  3NFQ A;  3E7K A;  1CSB A;  4PD4 D;  1VQ8 P;  2Q3E A;  4L76 A;  1BE3 D;  5TIS H;  3S1K A;  3SWF A;  3V5B A;  1X8Y A;  2K9J B;  1QGK B;  1FBM A;  4H13 D;  4NPD A;  3W68 A;  2QEX P;  3RL0 D;  2I1K A;  3PLN A;  5BU8 B;  3L70 E;  3HTK A;  1VQ4 P;  3TGU E;  2XKM A;  5AVW B;  3T97 A;  1VPC A;  2JKV A;  3FXD A;  4GKG A;  2AEJ A;  2YO2 A;  3AE1 C;  2C9N Y;  3RL0 g;  2R32 A;  4Y99 C;  1BGY J;  1YHQ P;  4IL6 X;  1KFM A;  1A02 J;  2FXP A;  2P10 A;  3CWB J;  4GOE A;  3B5N C;  3WU2 E;  5H2F E;  1MFT A;  3L72 E;  3HTK B;  2E43 A;  1ZRT D;  2WQY C;  3T97 B;  2RH0 A;  3RK3 D;  4OGQ D;  3CMA P;  5GTH E;  2K3R A;  1NKN A;  2WSS H;  1VF5 C;  1URQ C;  3L70 J;  4A7P A;  3WU2 H;  2MJZ A;  2E5Y A;  1SQQ E;  5H2F H;  3CPW O;  3Q3D A;  3L75 G;  1IC2 A;  2BEZ F;  1L0L E;  1CZQ A;  1YQ3 C;  2VRS A;  1YI2 P;  1ZR4 A;  4BWN A;  1K8A Q;  1N7S A;  1NU1 K;  2KK7 A;  2W83 C;  1EDI A;  2CPS A;  2ZJS E;  1VDF A;  5GTH H;  5CCG C;  3U1A A;  3C8V A;  2FYU D;  3ABV C;  3BAT A;  1JMB A;  1GD2 E;  1U57 A;  4H0L C;  4CPG A;  3L72 J;  1LNQ A;  2N1T A;  1FZG A;  3GHG C;  3HE5 A;  1SQP K;  2FFD C;  2QIW A;  3IF4 A;  3H1H J;  3H1L D;  1G1I A;  1FDM A;  1N7S B;  1JUN A;  1DIP A;  1KTM A;  3CCE P;  5APX A;  1SQQ J;  1MKM A;  1R5L A;  5L8R J;  5KLI B;  1NTK D;  3VP9 A;  1L0L J;  4PD4 I;  5M1B A;  3CC4 P;  2QM7 A;  1GW4 A;  1FS0 E;  1HTL C;  2K37 A;  1G1J A;  1EZV I;  2N1T B;  1J1D B;  3VYI A;  3G4S P;  2V7Q J;  3KZI E;  3HE5 B;  2XV5 A;  5CJ0 A;  3CCM P;  1Q86 Q;  1UII A;  4OH8 B;  2XU6 A;  5CCH D;  2JWD A;  1NU1 D;  4AUW A;  1PFI A;  3EFF K;  1KV4 A;  1KB9 D;  3JCU E;  2GA1 A;  1IFN A;  1SQB K;  3V2R A;  1BGY G;  2BCC D;  3KZI H; 
#chains in the Genus database with same CATH homology
 5C39 A;  2WMM A;  2QVA A;  1FC2 C;  2KI7 B;  1H0T B;  1OVU A;  4ASW A;  1U7J A;  1SS1 A;  4IOI H;  2SPZ A;  1S3J A;  2B89 A;  2M0B A;  1Y47 A;  1ZXG A;  1EDK A;  4ASV A;  3PH0 A;  2KS1 B;  4NPF X;  1EDI A;  1U7M A;  2KZI A;  2B87 A;  1LP1 B;  1EDL A;  2RKL A;  3S1K A;  1JMB A;  4CPG A;  4MN4 C;  2HR3 A;  4HB1 A;  5CBO A;  4ZMD A;  5CBN A;  5EFW B;  4NPD A;  1OVR A;  4JBZ A;  3RGU A;  4BXL A;  2LXB A;  5DJU B;  4GOF A;  2P58 A;  1Q2N A;  2R44 A;  3QWO C;  4WWI A;  1NVO A;  2M5A A;  2KUB A;  1DEE G;  3ZDM A;  2B87 B;  3MZW B;  2KIK A;  2KZJ A;  3FXD A;  4KJM A;  5DJT B;  4K3A A;  2Q1K A;  4EYY Q;  1EC5 A;  1BDC A;  2LR2 A;  4NPE A;  4GOD A;  3FXE A;  4GOE A;  4HJG H;  1JM0 A;  1OVV A;  5K5G B;  2I8D A;  1MFT A;  1X0T A;  2B88 A;  1ZW0 A;  4K35 A;  3MHV A;  2OTK E;  2LXC B;  2M5A B;  2JWD A;  2UWJ E;  4HKZ H;  1BDD A;  1LT1 A;  1LP1 A;  2QRX A;  4ZNC A;  1EDJ A;  2K3R A;  2ZAE B;  1H0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...