3RGUA

Structure of fap-nra at ph 5.0
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
b'DSVRENLDKMISEAEVLNDMAARKLITLDAEQQLELMKSLVATQSQLEATKNLIGDPNATVADLQIAYTTLGNNTQALGNELIKLNPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fimbriae-associated protein Fap1
publication title Structural insight into the role of Streptococcus parasanguinis Fap1 within oral biofilm formation.
pubmed doi rcsb
source organism Streptococcus parasanguinis
molecule tags Structural protein
total genus 34
structure length 88
sequence length 88
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 3rguA00
1SS1A 2QRXA 2KZJA 2M0BA 1EC5A 4IOIH 2ZAEB 5CBNA 2OTKE 4GOFA 2B87A 1DEEG 2P58A 1OVVA 1MFTA 2M5AA 1EDJA 4NPFX 4GODA 2Q1KA 2KS1B 2R44A 4ZNCA 1OVRA 1FC2C 1S3JA 1Y47A 2LXCB 2I8DA 1BDDA 4GOEA 4KJMA 4WWIA 3RGUA 2KUBA 2LXBA 3MHVA 4K3AA 2UWJE 1ZW0A 1U7MA 2B89A 2B87B 1ZXGA 5EFWB 4HJGH 4NPDA 5C39A 4ZMDA 4JBZA 2M5AB 4ASWA 1LT1A 2LR2A 2RKLA 4BXLA 2JWDA 2QVAA 1BDCA 3QWOC 2KIKA 4NPEA 3ZDMA 5CBOA 1X0TA 5K5GB 1H0TA 1U7JA 4HKZH 1EDLA 2B88A 1H0TB 2HR3A 2K3RA 4HB1A 1OVUA 4K35A 1NVOA 1Q2NA 5DJTB 1EDIA 5DJUB 1JM0A 3MZWB 3FXEA 3FXDA 3PH0A 3S1KA 1LP1A 2KI7B 4CPGA 1LP1B 2WMMA 4ASVA 4MN4C 2SPZA 4EYYQ 2KZIA 1EDKA 1JMBA
chains in the Genus database with same CATH superfamily
3A2AA 3WUTA 4OGQD 2GUSA 2QJYB 4D6TD 5BU5A 1FZCB 2E75B 3H1KE 3H1HE 1ZRTD 3H1IG 1AV1A 1M1KQ 3RGUA 4DZOA 1NOHA 4JYCA 2LXBA 1PPJG 3GW6A 3F89A 3AE9C 3PRJA 3FGAD 1X9VA 4ASWA 1FDOA 3AECC 1NKNA 3M91A 1IC2A 3RK2C 2BCCG 3HD7C 2KIKA 2O01J 1K9MQ 2QIWA 1NU1E 3HE5A 2WPSA 3HUSC 4H0LC 1S5LE 2H8PD 1EDIA 1CI6B 1SQQJ 5AW0B 3MTUE 1MZ9A 1W2EA 1NO4A 3E1IA 2Z5IA 3L70D 1SQXD 2R5DA 3VMXA 1H8AA 1KC8Q 3AEEC 2M3BA 1ZR2A 2ZT9C 2AXTH 1BE3E 1YTZI 3L74D 1K73Q 2AXCA 2OTKE 5AVZB 2Q5UA 3H1IJ 2B87A 1LWUB 1M1JA 3KZIH 4I7ZC 1KB9I 2IX7C 1P84H 1T2KD 4GT1A 1SQPG 2WSFJ 5AVWB 3P32A 3AEBC 1KB9D 4RO0A 2W8ZA 2ZVNB 1OVRA 1BCCD 3KPEA 1K8AQ 1K05A 4PJ0E 2V7QH 2YMKA 2BCCJ 2Z4EA 4HJGH 3V5BA 1ZR4A 5E79E 1M56D 2E5TA 1LT1A 4OH8B 3IF4A 1L0LJ 3E1RA 5AW4B 3V2RA 2RN0A 2E43A 5K5GB 5CJ0A 3JCUH 1EDLA 4XE5B 4HB1A 1HJBA 1ZMEC 3M0DC 1S5LH 1KD1Q 3V2PA 3AE5C 1LP1A 1SQBE 1D7MA 1S1CX 3S9OA 4ZKUA 3H1KD 1N7LA 3KHUA 1NTMG 2D2CD 1U57A 1L2PA 3H1HD 4EYYQ 1SFCC 3MIWA 4HYTB 3L71G 3S4RA 1DEBA 2BASA 1FJPA 2ZXEB 3Q5PA 3TF5A 3B5NB 1R5SA 5AW8B 1OW7A 2ZYDA 2H43A 2RH0A 3EFFK 4BRYB 2ZYAA 2E75D 1Y8AA 2MKVA 3FWLA 1IJDB 2JEEA 3AE7C 5B66E 2Q6QA 3V2NA 1N73C 2E74C 4GDOA 3CC2P 1BDDA 3F5HA 1IZNB 2E76B 2YO3A 1JTHA 5CMZA 2JO1A 2HG5D 2E5YA 2YKPA 3H6PA 4JBZA 3I5CA 2JWDA 1RQUA 2PP6A 1SQVJ 1Q82Q 4IFDK 1ZP0C 1NTZG 1RE3A 2WPQA 3MUDC 5B5EH 1BE3D 4K35A 1CZQA 3G71P 1NTMJ 1SQPK 1L4AA 3RL0C 1OFCX 3SWYA 3FXEA 1Z56A 5GTHE 1QEXA 3PH0A 2W6AA 2Q3EA 3H32A 2KB7P 1KYOI 1N7SB 2R3SA 3GF3A 3O8ZA 1OW6A 2SPZA 1WMKA 2IBZG 2OQQA 3MD0A 2C9LY 3HE5B 1KILC 1SS1A 2G3AA 1JY3O 1SQXK 2GUVA 1EZVI 1RF0C 2YNYA 4Y28J 1L0NK 3PHLA 5AW6B 4YXWH 1IK7A 3L75J 1HUCA 2PAJA 5APQA 3B8EB 3CCUP 1YHQP 3CMEP 3CPWO 1RF1C 3V4WA 2J58A 2XNXA 2N9YB 1KZUB 2Q9IA 2QJPB 2B89A 3IR9A 2B87B 4IL6E 3G6EP 1M1JB 1VQLP 3CWBE 1JCCA 1SQBD 5KTBA 5KAIE 2V7QJ 1Q81Q 1RH5B 1URQA 2O1JA 1CI6A 4D6TE 1QL2A 4L75A 3SWFA 4DJGA 5KJ7A 1PZQA 1T2KC 1RHZB 3S1KA 2KOGA 3A3YB 3G3ZA 1YJNP 3A0HE 2N9BA 1ZN5A 4MN4C 3NMDA 4W7ZA 2YIUB 3V2QA 2E42A 2OYHB 5CCGA 1UIXA 3NFQA 2WPRA 3B5ND 5CBNA 4C7RA 4Y99C 2WT7A 2Q7CA 3CXHI 3VP8A 1KFMA 1LT9C 3CXHD 4UB8E 3TGUE 1VF5B 2KXPB 3RL0g 3H1JG 5AVQB 3LIDA 1SQPE 5BVZA 1MV8A 1RE4A 1FAVA 2RMZA 1A02F 2E76D 1KQLA 4WWIA 1Q86Q 2IPPA 3ABVC 3MHVA 3L36A 4YXDC 2YO2A 3L72G 2ZJSE 3B71A 1MKMA 4IL6H 3TYYA 3L70E 2W27A 4BXLA 1JEKA 2QVAA 3SFEC 5KAIH 3L73J 1JY2P 2YKQA 4O9BA 3SWKA 1LTBC 1L0NE 2QJYC 1SQQD 5AVTB 1T6AA 2FYUG 5AW2B 4U3FE 1FZAA 1BGYG 1FZCC 4EI2A 2E75C 5AW7B 1VQ5P 1AVYA 1KB9E 1DD3A 1N7SD 3V6IA 2A45G 2KI7B 1BCCE 2XV5A 1LTAC 4OVNF 3A0HH 2BEZF 1T3UA 1EC5A 1JMBA 3PLNA 5AVXB 1GW4A 1EXIA 1IFNA 1JY3N 3H1ID 2PFXA 2AEFA 3CCMP 1J2JB 1MUUA 3L71E 1VDFA 3H1JJ 2J59M 3N4XA 1W5CE 4PD4I 1AA0A 4H44B 3VMAA 3L35A 3H32B 3CWBD 2MJZA 2M5AA 1M57D 1N86A 3KQGA 4GODA 1S5LX 2H88C 3H1LG 2K88A 3L72J 1NTKJ 2BCCD 1VQ6P 2KUBA 3LW5H 5KLVG 1JB0J 3IAOA 1PP9G 2OTJP 1Q7YQ 4NPDA 2A06G 1E79H 3HTKA 2FYUJ 3GHGA 2KLUA 1BGYJ 1SQBK 3VOPA 5CBOA 4HKZH 1LWUC 3IN6A 1J1EB 1Q2NA 2CPBA 1NTZE 1VQKP 1JM0A 3AE2C 3MZWB 2QEXP 4R4LA 2W6JH 4I6MC 1N7SA 3TGUD 1KB9H 1LTSC 2WITA 2H7HA 1YJ9P 3CX5I 1SQPD 2K1AA 2R3CA 2YKOA 1L0LG 2N1TB 1URQB 4UB6H 2KZJA 4H13B 2IBZE 3T97A 1GW3A 2XDJA 1GL2A 2FYNB 3H1LJ 3AE4C 3Q3DA 2QM7A 3WU2H 3WUVA 2P58A 1AQ5A 1VF5D 2L5GB 3OA7A 3MGNA 1LTTC 5KLVJ 2R44A 1GTWA 1PP9J 5CCHD 2XKMA 1L0ND 4DOJA 4U3FD 2JDIH 2WT7B 2W83C 1ZLLA 5APTA 1PGJA 1GK6A 1PFIA 2KK7A 1GMJA 3HRNA 1GZLA 1GU4A 1KYOE 4RJTA 1QL1A 2POHA 3D70A 2Q3IA 3CMAP 3Q5RA 5APVA 4N6JA 3B5NC 3ZDMA 3CCQP 1KORA 1NTMD 3N7NA 1J1DB 2ZFCA 3L71D 3HD7B 1SQQK 1EZVE 1SVFA 4KT0J 1JUNA 3EWKA 5M1BA 2KSJA 2P7JA 1JY2N 3AE6C 3BCCG 3HUSB 4WY4B 3BASA 1W2BO 2E76C 2OYHA 2AEJA 4N78E 4D6TJ 2KZIA 1OW8A 3C9IA 4L76A 1PGQA 1KQFB 2IYPA 1L4AD 1SQVG 3L74G 4H44D 3E7KA 5H2FE 2OARA 2IDBA 2VRSA 2FFDA 1PV3A 1NGMB 1M90Q 2OYIB 1LTJA 1P84I 3JSVC 2YMYA 5APYA 1FOSE 2H89C 5CHXA 3P7KA 3VP9A 4C7NB 5CCHA 4I7ZB 4GOEA 2HLOA 3HE4B 3BATA 1E5WA 1NTZD 1Q90D 3KDPB 1YITP 4W80A 4ZMDA 3H25A 2M5AB 2LKMA 3SFDC 3OJAB 2JR8A 1R8EA 2XNDH 3CCLP 3L75G 4U7JA 1LNQA 2IBZI 4PJ0H 1T8ZA 2IBZD 2OTLP 2R32A 1CW5A 3BCCJ 1SQXJ 1NH4A 3CXHE 5E79H 3HTKB 3H1KG 1PGPA 3GHGB 1X8YA 3H1HG 3L74J 4IL6X 2N1TD 1G1IA 1URQD 5GTIE 4OGQC 1DH3A 1XTCC 2QJPC 4H13D 2HFED 1M1JC 3VTPC 5KJ7D 2M0BA 2HPCA 3C1LA 4IOIH 5BU8B 1BCCJ 1KFNA 1YYCA 3MP7B 1KYOD 2C0XA 5CCGD 1VQMP 1SQQE 2FXOA 1NU1G 3D6ZA 1PGOA 4A7PA 1XTGB 3T97B 1FZBA 4EDFA 3Q1MA 1GL2B 1KQGB 3U1AA 1EZVD 4EIJA 1ZXGA 5EFWB 4EOTA 2NPSA 1N73B 3CC7P 2YIUC 1PIXA 5B66H 1N2DC 3CCEP 3AEGC 3RK3B 4NPEA 3H1IE 4N78D 1FZFA 2GM4A 2B88A 3AE1C 3H1KJ 2M3EA 2ITAA 1PPJE 1NTMK 3H1HJ 4W7YA 2ZVOB 1YQ4C 4PD4E 5TISE 2HODB 2QSIA 3VYIA 3CXHH 2IZ1A 3V4QA 4WY4D 3RK3E 1HBWA 4L74A 2BCCE 2N1TA 1GK4A 5CCHC 2M8RA 3RL0B 1BSNA 3OAKA 3OW2O 3L73G 4IFFA 2O1KA 3CD6P 1OMIA 5KKZC 1HF9A 5GTHH 5AW9B 2Y0EA 1NU1J 2Y9ZA 1KILB 2FKWB 3II6A 1FZEA 1FC2C 1S3JA 1PL5A 1Y47A 3M9QA 2QJKB 1OX3A 3A7OA 1KV4A 2FFDB 2GA1A 2XU6A 3PJSK 1LTJB 1NTZK 2RKLA 5AW3B 1SLQA 2R5BA 2A45I 1RE3C 3CCJP 1BE3J 3G9RA 1IFPA 3CX5E 3M0AA 3FX0A 4KHXA 2ZXXA 1L4AC 1VQ9P 1Y9BA 3TDKA 3IFMA 4H44C 1VQ8P 3AEDC 3HD7A 2K3RA 1NTKG 1NVOA 2WSFH 2D2CC 3CCVP 3FXDA 4JQ0D 2BEQD 1QVFO 3HUSA 4WY4A 1M7LA 1FOSF 1VQOP 2WMMA 5KAFE 1HTLC 2DW3A 5AVVB 5APUA 1SQVE 1LTIC 1JY2O 2OYIA 1A02J 1PP9D 4XFJA 1IFJA 1HVVA 2Q1KA 2NZ2A 4I1LA 1NTME 3WUUA 1KQSO 4C7NA 2NRGA 3PP5A 3HE4A 1IFDA 1LJ2A 5L8RJ 1SQBJ 1GL2D 1FZGA 2HPCB 2YXRB 1PPJD 2IFNA 4WVZA 2WVRA 2K37A 4PD4D 3VN0A 3SSUA 1NAFA 4UB8H 1LTGC 2N1TC 1URQC 3RK3D 2WSSH 3CC4P 3PTZA 4H13C 5KJ7C 4LLHA 2FYNC 1U7JA 2HR3A 2AXTE 1L0LD 3L75E 1JOCA 2NPSB 4QMAA 5KLIB 4N3YB 3O6QA 3KZIE 1IO4A 1P84E 1USDA 5CCGC 2C9NY 3ITKA 3M0DA 3EQ2A 3RL0D 1DX7A 2QM8A 3NXSA 1CSBA 1S9KD 1ZV8A 5KAFH 5AW5B 1K04A 4L73A 3TNUA 3W67A 1SFCA 1KILD 3CWBG 4LC1A 1MFTA 1UIIA 1RE4C 3Q5SA 2P67A 2WQYC 4I2LC 2IZ0A 4PV1B 3CX5D 5AVUB 1J1DC 1NTKK 1ZOYC 2LXCB 3I56P 3G4SP 3FWNA 2AEMA 2KYVA 3JCUE 4D6TG 1KMIZ 3GF7A 1N73A 1WRGA 4WY4C 5C39A 1LGHB 2K9JB 2FYUK 4AQRD 3C8VA 4JF7A 2WWWA 3BCCD 1GDTA 1RQVA 1H0TB 2PGDA 4XA4A 5DJTB 2OYIC 2JKVA 2HODA 2KLVA 5DJUB 2KSEA 3CCSP 3D6YA 1SQVD 2OGUA 2G8YA 1HWTC 3GG2A 3TGUG 3MUDA 1VQ7P 1IFMA 5AVSB 5AVYB 4JPZB 4GKGA 4HH2A 3CWBJ 3RK2B 1BSHA 2QRXA 1YI2P 4TT3H 4B86A 2CK3H 2KNCA 3M9HA 3UIAA 4RKUJ 5TJHA 2FYZA 3L73E 1DEEG 1KILA 1KN7A 3L70G 4H0LB 1SQXG 2WSEH 4NPFX 4IFMA 5AVRB 5KLVK 1RF0A 1H88A 1L0NG 1QLED 4U3FG 3CLQA 4R4MA 5APXA 1VQNP 2QA4P 1FDIA 4K3AA 4BWNA 3L75D 2UWJE 5B5EE 1R5LA 1U7MA 4RESB 3GHGC 1YJWP 2ZT9B 2WZ7A 3KXDA 1RF1A 2I1JA 1NAYA 1NWQA 1OIPA 1BCCG 1P84D 3M06A 1OZHA 3H1JE 3KYQA 3QH9A 3D71A 4AYCA 3A0BE 1X0TA 1VQ4P 1YBKA 3TGUJ 2K9YA 1N7SC 2NPSD 1VQPP 2V4HA 1SQPJ 3L72E 1L0LK 1NTKE 3LW5J 3R4YA 3RBZA 2FXMA 3VMZA 1KYOH 3B4SA 1GU5A 5APSA 4ASVA 2KS1A 4ZKPA 1GL2C 1NKZB 3CI9A 3L70J 1NU1D 3WMM0 2FYUE 3NTNA 2ZAEB 4DCKA 1BGYE 1G2CA 2IYOA 3USSA 3O6QB 3RK3C 1DIPA 1L0NJ 1EDJA 1N8RQ 3AE8C 3BVHA 4PV1D 4AUWA 4U3FJ 2P10A 1NJIQ 4ZNCA 1LT9A 2HYNA 2I8DA 3K5BA 3LIEA 1S4XA 1AQTA 1VL2A 2WSCH 3TNUB 3RBXA 1SFCB 1ZW0A 5H2FH 3A5TA 4M3LA 1JY3P 4OWFA 1IK9A 3VMYA 3QWOC 3L71J 3W68A 3H1LE 1HGZA 3Q2YA 2JP3A 4LGDE 1YIJP 1QGKB 3U1CA 2WPVB 3A0BH 3CCRP 2IFMA 1OVUA 2E74B 3L37A 4YTPC 5KLVE 3P8CE 1PP9E 3L73D 2OYHC 2OYOA 2A06E 1FU1A 1FZCA 1SQVK 2QJKC 5CJ4A 3RK2D 2J5UA 1BE3G 1EDKA 3HD7D 4JYBA 3CL3D 1AVOA 2QG4A 2W6BA 1VF5C 2FFDC 1QVGO 1S72P 1LTJC 1EXJA 2ZYGA 4GOFA 3M9BA 4TLFA 4H0LD 4OGQB 1FE6A 1USEA 1G1JA 2B9BA 3R2PA 4C46A 1T3JA 5AW1B 5GTIH 4GIFA 1NTZJ 2A45H 3H1JD 2JWAA 1JNMA 2FY8A 2W90A 1L0LE 4KJMA 2WSEJ 2KNCB 4WB4A 1FS0E 3L4FA 2ZT9D 1EZVG 2JJLA 1YQ3C 2Y9YA 2O01H 3L72D 1NTKD 2K9JA 2P2UA 3P8MC 1FDMA 1IFIA 2FXPA 1S9KE 2XZRA 1BDCA 1ZRTE 1JMMA 1DD4A 1JCDA 1HJ0A 1OWAA 2FBWC 1HGVA 3BRTB 1H0TA 3TK1A 1OXZA 1KILE 2FYUD 2PRRA 1KTMA 1SQBG 1BGYD 2I1KA 1JO5A 2Y0DA 1RF1B 3I55P 2P1JA 1LWUA 2Y0CA 1FBMA 1LP1B 3TSIA 2Z5HA 1RY3A 4WBAA 3AE3C 1SP4A 2C0WA 4Z1MH 3AEFC 1GD2E 4PD4H 5TISH 1NU1K 2O3JA 1H89A 1OVVA 2KP8A 1NYHA 1YTZT 2QE7H 2CPSA 2YXQB 2KS1B 3BCCE 1SQXE 1FJKA 3H1LD 1HH0A 5KKZB 2O01N 1QX8A 2NPSC 1SFCD 5KLIC 1G2CB 5KLVD 3L74E 1JTHB 3P8CD 1MFZA 1TU3F 1M8OB 2WTYA 2A06D 2LR2A 3EFGA 4Y99B 1WT6A 3GLMA 1EQ7A 1NHLA 1J1EC 1X79B 2WSCJ 3U59A 3GMAA 3JC22 1LT9B 4UB6E 2E74D 1X22A 3AEAC 3B5NA 1S2EA 1VPCA 4PV1C 3WU2E 1L4AB 3BRVB 4BRYA 4DT0A 4YPCA 4CPGA 5APWA 3CX5H 1SQQG 1AFOA 2D2CB 2L91A 1AJYA
chains in the Genus database with same CATH topology
1SS1A 2QRXA 2KZJA 2M0BA 1EC5A 4IOIH 2ZAEB 5CBNA 2OTKE 4GOFA 2B87A 1DEEG 2P58A 1OVVA 1MFTA 2M5AA 1EDJA 4NPFX 4GODA 2Q1KA 2KS1B 2R44A 4ZNCA 1OVRA 1FC2C 1S3JA 1Y47A 2LXCB 2I8DA 1BDDA 4GOEA 4KJMA 4WWIA 3RGUA 2KUBA 2LXBA 3MHVA 4K3AA 2UWJE 1ZW0A 1U7MA 2B89A 2B87B 1ZXGA 5EFWB 4HJGH 4NPDA 5C39A 4ZMDA 4JBZA 2M5AB 4ASWA 1LT1A 2LR2A 2RKLA 4BXLA 2JWDA 2QVAA 1BDCA 3QWOC 2KIKA 4NPEA 3ZDMA 5CBOA 1X0TA 5K5GB 1H0TA 1U7JA 4HKZH 1EDLA 2B88A 1H0TB 2HR3A 2K3RA 4HB1A 1OVUA 4K35A 1NVOA 1Q2NA 5DJTB 1EDIA 5DJUB 1JM0A 3MZWB 3FXEA 3FXDA 3PH0A 3S1KA 1LP1A 2KI7B 4CPGA 1LP1B 2WMMA 4ASVA 4MN4C 2SPZA 4EYYQ 2KZIA 1EDKA 1JMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SS1 A;  2QRX A;  2KZJ A;  2M0B A;  1EC5 A;  4IOI H;  2ZAE B;  5CBN A;  2OTK E;  4GOF A;  2B87 A;  1DEE G;  2P58 A;  1OVV A;  1MFT A;  2M5A A;  1EDJ A;  4NPF X;  4GOD A;  2Q1K A;  2KS1 B;  2R44 A;  4ZNC A;  1OVR A;  1FC2 C;  1S3J A;  1Y47 A;  2LXC B;  2I8D A;  1BDD A;  4GOE A;  4KJM A;  4WWI A;  3RGU A;  2KUB A;  2LXB A;  3MHV A;  4K3A A;  2UWJ E;  1ZW0 A;  1U7M A;  2B89 A;  2B87 B;  1ZXG A;  5EFW B;  4HJG H;  4NPD A;  5C39 A;  4ZMD A;  4JBZ A;  2M5A B;  4ASW A;  1LT1 A;  2LR2 A;  2RKL A;  4BXL A;  2JWD A;  2QVA A;  1BDC A;  3QWO C;  2KIK A;  4NPE A;  3ZDM A;  5CBO A;  1X0T A;  5K5G B;  1H0T A;  1U7J A;  4HKZ H;  1EDL A;  2B88 A;  1H0T B;  2HR3 A;  2K3R A;  4HB1 A;  1OVU A;  4K35 A;  1NVO A;  1Q2N A;  5DJT B;  1EDI A;  5DJU B;  1JM0 A;  3MZW B;  3FXE A;  3FXD A;  3PH0 A;  3S1K A;  1LP1 A;  2KI7 B;  4CPG A;  1LP1 B;  2WMM A;  4ASV A;  4MN4 C;  2SPZ A;  4EYY Q;  2KZI A;  1EDK A;  1JMB A; 
#chains in the Genus database with same CATH topology
 3A2A A;  3WUT A;  4OGQ D;  2GUS A;  2QJY B;  4D6T D;  5BU5 A;  1FZC B;  2E75 B;  3H1K E;  3H1H E;  1ZRT D;  3H1I G;  1AV1 A;  1M1K Q;  3RGU A;  4DZO A;  1NOH A;  4JYC A;  2LXB A;  1PPJ G;  3GW6 A;  3F89 A;  3AE9 C;  3PRJ A;  3FGA D;  1X9V A;  4ASW A;  1FDO A;  3AEC C;  1NKN A;  3M91 A;  1IC2 A;  3RK2 C;  2BCC G;  3HD7 C;  2KIK A;  2O01 J;  1K9M Q;  2QIW A;  1NU1 E;  3HE5 A;  2WPS A;  3HUS C;  4H0L C;  1S5L E;  2H8P D;  1EDI A;  1CI6 B;  1SQQ J;  5AW0 B;  3MTU E;  1MZ9 A;  1W2E A;  1NO4 A;  3E1I A;  2Z5I A;  3L70 D;  1SQX D;  2R5D A;  3VMX A;  1H8A A;  1KC8 Q;  3AEE C;  2M3B A;  1ZR2 A;  2ZT9 C;  2AXT H;  1BE3 E;  1YTZ I;  3L74 D;  1K73 Q;  2AXC A;  2OTK E;  5AVZ B;  2Q5U A;  3H1I J;  2B87 A;  1LWU B;  1M1J A;  3KZI H;  4I7Z C;  1KB9 I;  2IX7 C;  1P84 H;  1T2K D;  4GT1 A;  1SQP G;  2WSF J;  5AVW B;  3P32 A;  3AEB C;  1KB9 D;  4RO0 A;  2W8Z A;  2ZVN B;  1OVR A;  1BCC D;  3KPE A;  1K8A Q;  1K05 A;  4PJ0 E;  2V7Q H;  2YMK A;  2BCC J;  2Z4E A;  4HJG H;  3V5B A;  1ZR4 A;  5E79 E;  1M56 D;  2E5T A;  1LT1 A;  4OH8 B;  3IF4 A;  1L0L J;  3E1R A;  5AW4 B;  3V2R A;  2RN0 A;  2E43 A;  5K5G B;  5CJ0 A;  3JCU H;  1EDL A;  4XE5 B;  4HB1 A;  1HJB A;  1ZME C;  3M0D C;  1S5L H;  1KD1 Q;  3V2P A;  3AE5 C;  1LP1 A;  1SQB E;  1D7M A;  1S1C X;  3S9O A;  4ZKU A;  3H1K D;  1N7L A;  3KHU A;  1NTM G;  2D2C D;  1U57 A;  1L2P A;  3H1H D;  4EYY Q;  1SFC C;  3MIW A;  4HYT B;  3L71 G;  3S4R A;  1DEB A;  2BAS A;  1FJP A;  2ZXE B;  3Q5P A;  3TF5 A;  3B5N B;  1R5S A;  5AW8 B;  1OW7 A;  2ZYD A;  2H43 A;  2RH0 A;  3EFF K;  4BRY B;  2ZYA A;  2E75 D;  1Y8A A;  2MKV A;  3FWL A;  1IJD B;  2JEE A;  3AE7 C;  5B66 E;  2Q6Q A;  3V2N A;  1N73 C;  2E74 C;  4GDO A;  3CC2 P;  1BDD A;  3F5H A;  1IZN B;  2E76 B;  2YO3 A;  1JTH A;  5CMZ A;  2JO1 A;  2HG5 D;  2E5Y A;  2YKP A;  3H6P A;  4JBZ A;  3I5C A;  2JWD A;  1RQU A;  2PP6 A;  1SQV J;  1Q82 Q;  4IFD K;  1ZP0 C;  1NTZ G;  1RE3 A;  2WPQ A;  3MUD C;  5B5E H;  1BE3 D;  4K35 A;  1CZQ A;  3G71 P;  1NTM J;  1SQP K;  1L4A A;  3RL0 C;  1OFC X;  3SWY A;  3FXE A;  1Z56 A;  5GTH E;  1QEX A;  3PH0 A;  2W6A A;  2Q3E A;  3H32 A;  2KB7 P;  1KYO I;  1N7S B;  2R3S A;  3GF3 A;  3O8Z A;  1OW6 A;  2SPZ A;  1WMK A;  2IBZ G;  2OQQ A;  3MD0 A;  2C9L Y;  3HE5 B;  1KIL C;  1SS1 A;  2G3A A;  1JY3 O;  1SQX K;  2GUV A;  1EZV I;  1RF0 C;  2YNY A;  4Y28 J;  1L0N K;  3PHL A;  5AW6 B;  4YXW H;  1IK7 A;  3L75 J;  1HUC A;  2PAJ A;  5APQ A;  3B8E B;  3CCU P;  1YHQ P;  3CME P;  3CPW O;  1RF1 C;  3V4W A;  2J58 A;  2XNX A;  2N9Y B;  1KZU B;  2Q9I A;  2QJP B;  2B89 A;  3IR9 A;  2B87 B;  4IL6 E;  3G6E P;  1M1J B;  1VQL P;  3CWB E;  1JCC A;  1SQB D;  5KTB A;  5KAI E;  2V7Q J;  1Q81 Q;  1RH5 B;  1URQ A;  2O1J A;  1CI6 A;  4D6T E;  1QL2 A;  4L75 A;  3SWF A;  4DJG A;  5KJ7 A;  1PZQ A;  1T2K C;  1RHZ B;  3S1K A;  2KOG A;  3A3Y B;  3G3Z A;  1YJN P;  3A0H E;  2N9B A;  1ZN5 A;  4MN4 C;  3NMD A;  4W7Z A;  2YIU B;  3V2Q A;  2E42 A;  2OYH B;  5CCG A;  1UIX A;  3NFQ A;  2WPR A;  3B5N D;  5CBN A;  4C7R A;  4Y99 C;  2WT7 A;  2Q7C A;  3CXH I;  3VP8 A;  1KFM A;  1LT9 C;  3CXH D;  4UB8 E;  3TGU E;  1VF5 B;  2KXP B;  3RL0 g;  3H1J G;  5AVQ B;  3LID A;  1SQP E;  5BVZ A;  1MV8 A;  1RE4 A;  1FAV A;  2RMZ A;  1A02 F;  2E76 D;  1KQL A;  4WWI A;  1Q86 Q;  2IPP A;  3ABV C;  3MHV A;  3L36 A;  4YXD C;  2YO2 A;  3L72 G;  2ZJS E;  3B71 A;  1MKM A;  4IL6 H;  3TYY A;  3L70 E;  2W27 A;  4BXL A;  1JEK A;  2QVA A;  3SFE C;  5KAI H;  3L73 J;  1JY2 P;  2YKQ A;  4O9B A;  3SWK A;  1LTB C;  1L0N E;  2QJY C;  1SQQ D;  5AVT B;  1T6A A;  2FYU G;  5AW2 B;  4U3F E;  1FZA A;  1BGY G;  1FZC C;  4EI2 A;  2E75 C;  5AW7 B;  1VQ5 P;  1AVY A;  1KB9 E;  1DD3 A;  1N7S D;  3V6I A;  2A45 G;  2KI7 B;  1BCC E;  2XV5 A;  1LTA C;  4OVN F;  3A0H H;  2BEZ F;  1T3U A;  1EC5 A;  1JMB A;  3PLN A;  5AVX B;  1GW4 A;  1EXI A;  1IFN A;  1JY3 N;  3H1I D;  2PFX A;  2AEF A;  3CCM P;  1J2J B;  1MUU A;  3L71 E;  1VDF A;  3H1J J;  2J59 M;  3N4X A;  1W5C E;  4PD4 I;  1AA0 A;  4H44 B;  3VMA A;  3L35 A;  3H32 B;  3CWB D;  2MJZ A;  2M5A A;  1M57 D;  1N86 A;  3KQG A;  4GOD A;  1S5L X;  2H88 C;  3H1L G;  2K88 A;  3L72 J;  1NTK J;  2BCC D;  1VQ6 P;  2KUB A;  3LW5 H;  5KLV G;  1JB0 J;  3IAO A;  1PP9 G;  2OTJ P;  1Q7Y Q;  4NPD A;  2A06 G;  1E79 H;  3HTK A;  2FYU J;  3GHG A;  2KLU A;  1BGY J;  1SQB K;  3VOP A;  5CBO A;  4HKZ H;  1LWU C;  3IN6 A;  1J1E B;  1Q2N A;  2CPB A;  1NTZ E;  1VQK P;  1JM0 A;  3AE2 C;  3MZW B;  2QEX P;  4R4L A;  2W6J H;  4I6M C;  1N7S A;  3TGU D;  1KB9 H;  1LTS C;  2WIT A;  2H7H A;  1YJ9 P;  3CX5 I;  1SQP D;  2K1A A;  2R3C A;  2YKO A;  1L0L G;  2N1T B;  1URQ B;  4UB6 H;  2KZJ A;  4H13 B;  2IBZ E;  3T97 A;  1GW3 A;  2XDJ A;  1GL2 A;  2FYN B;  3H1L J;  3AE4 C;  3Q3D A;  2QM7 A;  3WU2 H;  3WUV A;  2P58 A;  1AQ5 A;  1VF5 D;  2L5G B;  3OA7 A;  3MGN A;  1LTT C;  5KLV J;  2R44 A;  1GTW A;  1PP9 J;  5CCH D;  2XKM A;  1L0N D;  4DOJ A;  4U3F D;  2JDI H;  2WT7 B;  2W83 C;  1ZLL A;  5APT A;  1PGJ A;  1GK6 A;  1PFI A;  2KK7 A;  1GMJ A;  3HRN A;  1GZL A;  1GU4 A;  1KYO E;  4RJT A;  1QL1 A;  2POH A;  3D70 A;  2Q3I A;  3CMA P;  3Q5R A;  5APV A;  4N6J A;  3B5N C;  3ZDM A;  3CCQ P;  1KOR A;  1NTM D;  3N7N A;  1J1D B;  2ZFC A;  3L71 D;  3HD7 B;  1SQQ K;  1EZV E;  1SVF A;  4KT0 J;  1JUN A;  3EWK A;  5M1B A;  2KSJ A;  2P7J A;  1JY2 N;  3AE6 C;  3BCC G;  3HUS B;  4WY4 B;  3BAS A;  1W2B O;  2E76 C;  2OYH A;  2AEJ A;  4N78 E;  4D6T J;  2KZI A;  1OW8 A;  3C9I A;  4L76 A;  1PGQ A;  1KQF B;  2IYP A;  1L4A D;  1SQV G;  3L74 G;  4H44 D;  3E7K A;  5H2F E;  2OAR A;  2IDB A;  2VRS A;  2FFD A;  1PV3 A;  1NGM B;  1M90 Q;  2OYI B;  1LTJ A;  1P84 I;  3JSV C;  2YMY A;  5APY A;  1FOS E;  2H89 C;  5CHX A;  3P7K A;  3VP9 A;  4C7N B;  5CCH A;  4I7Z B;  4GOE A;  2HLO A;  3HE4 B;  3BAT A;  1E5W A;  1NTZ D;  1Q90 D;  3KDP B;  1YIT P;  4W80 A;  4ZMD A;  3H25 A;  2M5A B;  2LKM A;  3SFD C;  3OJA B;  2JR8 A;  1R8E A;  2XND H;  3CCL P;  3L75 G;  4U7J A;  1LNQ A;  2IBZ I;  4PJ0 H;  1T8Z A;  2IBZ D;  2OTL P;  2R32 A;  1CW5 A;  3BCC J;  1SQX J;  1NH4 A;  3CXH E;  5E79 H;  3HTK B;  3H1K G;  1PGP A;  3GHG B;  1X8Y A;  3H1H G;  3L74 J;  4IL6 X;  2N1T D;  1G1I A;  1URQ D;  5GTI E;  4OGQ C;  1DH3 A;  1XTC C;  2QJP C;  4H13 D;  2HFE D;  1M1J C;  3VTP C;  5KJ7 D;  2M0B A;  2HPC A;  3C1L A;  4IOI H;  5BU8 B;  1BCC J;  1KFN A;  1YYC A;  3MP7 B;  1KYO D;  2C0X A;  5CCG D;  1VQM P;  1SQQ E;  2FXO A;  1NU1 G;  3D6Z A;  1PGO A;  4A7P A;  1XTG B;  3T97 B;  1FZB A;  4EDF A;  3Q1M A;  1GL2 B;  1KQG B;  3U1A A;  1EZV D;  4EIJ A;  1ZXG A;  5EFW B;  4EOT A;  2NPS A;  1N73 B;  3CC7 P;  2YIU C;  1PIX A;  5B66 H;  1N2D C;  3CCE P;  3AEG C;  3RK3 B;  4NPE A;  3H1I E;  4N78 D;  1FZF A;  2GM4 A;  2B88 A;  3AE1 C;  3H1K J;  2M3E A;  2ITA A;  1PPJ E;  1NTM K;  3H1H J;  4W7Y A;  2ZVO B;  1YQ4 C;  4PD4 E;  5TIS E;  2HOD B;  2QSI A;  3VYI A;  3CXH H;  2IZ1 A;  3V4Q A;  4WY4 D;  3RK3 E;  1HBW A;  4L74 A;  2BCC E;  2N1T A;  1GK4 A;  5CCH C;  2M8R A;  3RL0 B;  1BSN A;  3OAK A;  3OW2 O;  3L73 G;  4IFF A;  2O1K A;  3CD6 P;  1OMI A;  5KKZ C;  1HF9 A;  5GTH H;  5AW9 B;  2Y0E A;  1NU1 J;  2Y9Z A;  1KIL B;  2FKW B;  3II6 A;  1FZE A;  1FC2 C;  1S3J A;  1PL5 A;  1Y47 A;  3M9Q A;  2QJK B;  1OX3 A;  3A7O A;  1KV4 A;  2FFD B;  2GA1 A;  2XU6 A;  3PJS K;  1LTJ B;  1NTZ K;  2RKL A;  5AW3 B;  1SLQ A;  2R5B A;  2A45 I;  1RE3 C;  3CCJ P;  1BE3 J;  3G9R A;  1IFP A;  3CX5 E;  3M0A A;  3FX0 A;  4KHX A;  2ZXX A;  1L4A C;  1VQ9 P;  1Y9B A;  3TDK A;  3IFM A;  4H44 C;  1VQ8 P;  3AED C;  3HD7 A;  2K3R A;  1NTK G;  1NVO A;  2WSF H;  2D2C C;  3CCV P;  3FXD A;  4JQ0 D;  2BEQ D;  1QVF O;  3HUS A;  4WY4 A;  1M7L A;  1FOS F;  1VQO P;  2WMM A;  5KAF E;  1HTL C;  2DW3 A;  5AVV B;  5APU A;  1SQV E;  1LTI C;  1JY2 O;  2OYI A;  1A02 J;  1PP9 D;  4XFJ A;  1IFJ A;  1HVV A;  2Q1K A;  2NZ2 A;  4I1L A;  1NTM E;  3WUU A;  1KQS O;  4C7N A;  2NRG A;  3PP5 A;  3HE4 A;  1IFD A;  1LJ2 A;  5L8R J;  1SQB J;  1GL2 D;  1FZG A;  2HPC B;  2YXR B;  1PPJ D;  2IFN A;  4WVZ A;  2WVR A;  2K37 A;  4PD4 D;  3VN0 A;  3SSU A;  1NAF A;  4UB8 H;  1LTG C;  2N1T C;  1URQ C;  3RK3 D;  2WSS H;  3CC4 P;  3PTZ A;  4H13 C;  5KJ7 C;  4LLH A;  2FYN C;  1U7J A;  2HR3 A;  2AXT E;  1L0L D;  3L75 E;  1JOC A;  2NPS B;  4QMA A;  5KLI B;  4N3Y B;  3O6Q A;  3KZI E;  1IO4 A;  1P84 E;  1USD A;  5CCG C;  2C9N Y;  3ITK A;  3M0D A;  3EQ2 A;  3RL0 D;  1DX7 A;  2QM8 A;  3NXS A;  1CSB A;  1S9K D;  1ZV8 A;  5KAF H;  5AW5 B;  1K04 A;  4L73 A;  3TNU A;  3W67 A;  1SFC A;  1KIL D;  3CWB G;  4LC1 A;  1MFT A;  1UII A;  1RE4 C;  3Q5S A;  2P67 A;  2WQY C;  4I2L C;  2IZ0 A;  4PV1 B;  3CX5 D;  5AVU B;  1J1D C;  1NTK K;  1ZOY C;  2LXC B;  3I56 P;  3G4S P;  3FWN A;  2AEM A;  2KYV A;  3JCU E;  4D6T G;  1KMI Z;  3GF7 A;  1N73 A;  1WRG A;  4WY4 C;  5C39 A;  1LGH B;  2K9J B;  2FYU K;  4AQR D;  3C8V A;  4JF7 A;  2WWW A;  3BCC D;  1GDT A;  1RQV A;  1H0T B;  2PGD A;  4XA4 A;  5DJT B;  2OYI C;  2JKV A;  2HOD A;  2KLV A;  5DJU B;  2KSE A;  3CCS P;  3D6Y A;  1SQV D;  2OGU A;  2G8Y A;  1HWT C;  3GG2 A;  3TGU G;  3MUD A;  1VQ7 P;  1IFM A;  5AVS B;  5AVY B;  4JPZ B;  4GKG A;  4HH2 A;  3CWB J;  3RK2 B;  1BSH A;  2QRX A;  1YI2 P;  4TT3 H;  4B86 A;  2CK3 H;  2KNC A;  3M9H A;  3UIA A;  4RKU J;  5TJH A;  2FYZ A;  3L73 E;  1DEE G;  1KIL A;  1KN7 A;  3L70 G;  4H0L B;  1SQX G;  2WSE H;  4NPF X;  4IFM A;  5AVR B;  5KLV K;  1RF0 A;  1H88 A;  1L0N G;  1QLE D;  4U3F G;  3CLQ A;  4R4M A;  5APX A;  1VQN P;  2QA4 P;  1FDI A;  4K3A A;  4BWN A;  3L75 D;  2UWJ E;  5B5E E;  1R5L A;  1U7M A;  4RES B;  3GHG C;  1YJW P;  2ZT9 B;  2WZ7 A;  3KXD A;  1RF1 A;  2I1J A;  1NAY A;  1NWQ A;  1OIP A;  1BCC G;  1P84 D;  3M06 A;  1OZH A;  3H1J E;  3KYQ A;  3QH9 A;  3D71 A;  4AYC A;  3A0B E;  1X0T A;  1VQ4 P;  1YBK A;  3TGU J;  2K9Y A;  1N7S C;  2NPS D;  1VQP P;  2V4H A;  1SQP J;  3L72 E;  1L0L K;  1NTK E;  3LW5 J;  3R4Y A;  3RBZ A;  2FXM A;  3VMZ A;  1KYO H;  3B4S A;  1GU5 A;  5APS A;  4ASV A;  2KS1 A;  4ZKP A;  1GL2 C;  1NKZ B;  3CI9 A;  3L70 J;  1NU1 D;  3WMM 0;  2FYU E;  3NTN A;  2ZAE B;  4DCK A;  1BGY E;  1G2C A;  2IYO A;  3USS A;  3O6Q B;  3RK3 C;  1DIP A;  1L0N J;  1EDJ A;  1N8R Q;  3AE8 C;  3BVH A;  4PV1 D;  4AUW A;  4U3F J;  2P10 A;  1NJI Q;  4ZNC A;  1LT9 A;  2HYN A;  2I8D A;  3K5B A;  3LIE A;  1S4X A;  1AQT A;  1VL2 A;  2WSC H;  3TNU B;  3RBX A;  1SFC B;  1ZW0 A;  5H2F H;  3A5T A;  4M3L A;  1JY3 P;  4OWF A;  1IK9 A;  3VMY A;  3QWO C;  3L71 J;  3W68 A;  3H1L E;  1HGZ A;  3Q2Y A;  2JP3 A;  4LGD E;  1YIJ P;  1QGK B;  3U1C A;  2WPV B;  3A0B H;  3CCR P;  2IFM A;  1OVU A;  2E74 B;  3L37 A;  4YTP C;  5KLV E;  3P8C E;  1PP9 E;  3L73 D;  2OYH C;  2OYO A;  2A06 E;  1FU1 A;  1FZC A;  1SQV K;  2QJK C;  5CJ4 A;  3RK2 D;  2J5U A;  1BE3 G;  1EDK A;  3HD7 D;  4JYB A;  3CL3 D;  1AVO A;  2QG4 A;  2W6B A;  1VF5 C;  2FFD C;  1QVG O;  1S72 P;  1LTJ C;  1EXJ A;  2ZYG A;  4GOF A;  3M9B A;  4TLF A;  4H0L D;  4OGQ B;  1FE6 A;  1USE A;  1G1J A;  2B9B A;  3R2P A;  4C46 A;  1T3J A;  5AW1 B;  5GTI H;  4GIF A;  1NTZ J;  2A45 H;  3H1J D;  2JWA A;  1JNM A;  2FY8 A;  2W90 A;  1L0L E;  4KJM A;  2WSE J;  2KNC B;  4WB4 A;  1FS0 E;  3L4F A;  2ZT9 D;  1EZV G;  2JJL A;  1YQ3 C;  2Y9Y A;  2O01 H;  3L72 D;  1NTK D;  2K9J A;  2P2U A;  3P8M C;  1FDM A;  1IFI A;  2FXP A;  1S9K E;  2XZR A;  1BDC A;  1ZRT E;  1JMM A;  1DD4 A;  1JCD A;  1HJ0 A;  1OWA A;  2FBW C;  1HGV A;  3BRT B;  1H0T A;  3TK1 A;  1OXZ A;  1KIL E;  2FYU D;  2PRR A;  1KTM A;  1SQB G;  1BGY D;  2I1K A;  1JO5 A;  2Y0D A;  1RF1 B;  3I55 P;  2P1J A;  1LWU A;  2Y0C A;  1FBM A;  1LP1 B;  3TSI A;  2Z5H A;  1RY3 A;  4WBA A;  3AE3 C;  1SP4 A;  2C0W A;  4Z1M H;  3AEF C;  1GD2 E;  4PD4 H;  5TIS H;  1NU1 K;  2O3J A;  1H89 A;  1OVV A;  2KP8 A;  1NYH A;  1YTZ T;  2QE7 H;  2CPS A;  2YXQ B;  2KS1 B;  3BCC E;  1SQX E;  1FJK A;  3H1L D;  1HH0 A;  5KKZ B;  2O01 N;  1QX8 A;  2NPS C;  1SFC D;  5KLI C;  1G2C B;  5KLV D;  3L74 E;  1JTH B;  3P8C D;  1MFZ A;  1TU3 F;  1M8O B;  2WTY A;  2A06 D;  2LR2 A;  3EFG A;  4Y99 B;  1WT6 A;  3GLM A;  1EQ7 A;  1NHL A;  1J1E C;  1X79 B;  2WSC J;  3U59 A;  3GMA A;  3JC2 2;  1LT9 B;  4UB6 E;  2E74 D;  1X22 A;  3AEA C;  3B5N A;  1S2E A;  1VPC A;  4PV1 C;  3WU2 E;  1L4A B;  3BRV B;  4BRY A;  4DT0 A;  4YPC A;  4CPG A;  5APW A;  3CX5 H;  1SQQ G;  1AFO A;  2D2C B;  2L91 A;  1AJY A; 
#chains in the Genus database with same CATH homology
 1SS1 A;  2QRX A;  2KZJ A;  2M0B A;  1EC5 A;  4IOI H;  2ZAE B;  5CBN A;  2OTK E;  4GOF A;  2B87 A;  1DEE G;  2P58 A;  1OVV A;  1MFT A;  2M5A A;  1EDJ A;  4NPF X;  4GOD A;  2Q1K A;  2KS1 B;  2R44 A;  4ZNC A;  1OVR A;  1FC2 C;  1S3J A;  1Y47 A;  2LXC B;  2I8D A;  1BDD A;  4GOE A;  4KJM A;  4WWI A;  3RGU A;  2KUB A;  2LXB A;  3MHV A;  4K3A A;  2UWJ E;  1ZW0 A;  1U7M A;  2B89 A;  2B87 B;  1ZXG A;  5EFW B;  4HJG H;  4NPD A;  5C39 A;  4ZMD A;  4JBZ A;  2M5A B;  4ASW A;  1LT1 A;  2LR2 A;  2RKL A;  4BXL A;  2JWD A;  2QVA A;  1BDC A;  3QWO C;  2KIK A;  4NPE A;  3ZDM A;  5CBO A;  1X0T A;  5K5G B;  1H0T A;  1U7J A;  4HKZ H;  1EDL A;  2B88 A;  1H0T B;  2HR3 A;  2K3R A;  4HB1 A;  1OVU A;  4K35 A;  1NVO A;  1Q2N A;  5DJT B;  1EDI A;  5DJU B;  1JM0 A;  3MZW B;  3FXE A;  3FXD A;  3PH0 A;  3S1K A;  1LP1 A;  2KI7 B;  4CPG A;  1LP1 B;  2WMM A;  4ASV A;  4MN4 C;  2SPZ A;  4EYY Q;  2KZI A;  1EDK A;  1JMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...