3RGUA

Structure of fap-nra at ph 5.0
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
DSVRENLDKMISEAEVLNDMAARKLITLDAEQQLELMKSLVATQSQLEATKNLIGDPNATVADLQIAYTTLGNNTQALGNELIKLNPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fimbriae-associated protein Fap1
publication title Structural insight into the role of Streptococcus parasanguinis Fap1 within oral biofilm formation.
pubmed doi rcsb
source organism Streptococcus parasanguinis
molecule tags Structural protein
total genus 34
structure length 88
sequence length 88
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 3rguA00
3PH0A 2Q1KA 1H0TA 5DJUB 1EDKA 1FC2C 3MZWB 1MFTA 4ASVA 1EDIA 3S1KA 1EC5A 4HB1A 1U7JA 2LXBA 4HJGH 4NPFX 2B87A 2UWJE 4WWIA 2SPZA 1U7MA 4HKZH 1EDLA 2M0BA 1NVOA 3FXDA 2RKLA 2KIKA 4BXLA 2M5AB 3ZDMA 1OVRA 2R44A 1LP1B 4GOFA 1OVVA 1S3JA 4KJMA 4ASWA 1H0TB 1JM0A 4K3AA 2HR3A 1SS1A 1JMBA 4GODA 1ZXGA 2QRXA 3RGUA 4GOEA 2K3RA 3MHVA 2B88A 4IOIH 2B89A 1Y47A 4ZMDA 2B87B 4K35A 2KZJA 4EYYQ 5CBNA 4CPGA 2P58A 1Q2NA 4NPDA 5EFWB 1EDJA 1X0TA 1LT1A 5CBOA 1ZW0A 2OTKE 2QVAA 1DEEG 2KS1B 5DJTB 1BDDA 4NPEA 2KUBA 3QWOC 2KZIA 2I8DA 5K5GB 4JBZA 2WMMA 2LXCB 2M5AA 4MN4C 2JWDA 1OVUA 1LP1A 2LR2A 4ZNCA 2ZAEB 5C39A 2KI7B 3FXEA 1BDCA
chains in the Genus database with same CATH superfamily
3RL0C 3V2PA 2QA4P 3H1ID 1YITP 1K9MQ 2H88C 3MZWB 3WUTA 1Y9BA 1LWUB 1URQD 2AXTH 2CPSA 3B5ND 4JPZB 2E74B 2Q9IA 2OTJP 3LIDA 2LXBA 1M1KQ 2UWJE 3CMAP 5TJHA 1LTJA 1ZMEC 1BE3D 2WPQA 1HWTC 3W67A 2E75D 5AVQB 1OVRA 1VQNP 4QMAA 2IZ0A 2ZVNB 2JKVA 2ZYAA 3RK3D 1N7SB 3KZIH 2FFDB 2QJKB 3CX5H 4WBAA 1L0LK 1VQ7P 4KHXA 1NTZD 2WSEJ 1QGKB 1JMBA 4PV1D 3RGUA 5M1BA 5CCGC 2P7JA 4H13D 2B88A 4Z1MH 3H1JJ 2B87B 4CPGA 1OFCX 3TSIA 3WUUA 2HLOA 3L70D 3IN6A 5KKZC 4GIFA 5BVZA 4Y99B 1EDJA 2GUVA 2W8ZA 2ZT9D 2HODB 5CCHA 5APWA 1IZNB 5AVXB 1NU1J 4BWNA 1L0LG 3V6IA 3R2PA 4UB6H 1YBKA 3KYQA 1SFCA 1URQB 3CD6P 3CLQA 1RF1C 3LW5H 1RE4A 2AXCA 1AVYA 1W5CE 2O1JA 2K9YA 1BGYJ 3H1JE 1OW6A 1YI2P 4ASVA 1YTZI 1ZP0C 2QJYC 3OW2O 2OYHA 2KNCA 4LGDE 1LT9C 1Q82Q 2KLUA 1NVOA 1PP9G 1NU1E 1NTMD 2KLVA 1KB9E 3M0AA 1USDA 2O01N 4YXWH 3M9BA 3KDPB 2E5TA 2Z5IA 1JM0A 3CWBJ 4UB8H 2OYOA 2YKQA 1HUCA 1JNMA 1BGYE 1M1JA 3HD7B 3G71P 1HBWA 3F89A 4OWFA 2GUSA 1JY3O 4NPDA 3H6PA 3AE8C 5CBOA 5KJ7A 3D70A 1NTKD 1ZRTE 2B9BA 3BCCD 4N78D 1KILC 4DT0A 1AA0A 1NKZB 1KQSO 3FX0A 1J1EC 1LP1A 3CWBE 4TLFA 2R3SA 3B4SA 4DCKA 1FZGA 1QEXA 2AEFA 2K1AA 1PPJD 5DJUB 1BE3J 1JY2N 3KXDA 4C7NB 1PGOA 2A06G 5CHXA 2BCCG 2XKMA 1N2DC 1N86A 4JF7A 4GT1A 1FZCB 1OMIA 1L0NJ 2FYUD 4GOFA 1YJ9P 4UB6E 3Q3DA 1FDIA 5AW8B 2YO3A 1LTIC 3L70J 4PD4D 5CCHC 1PL5A 3SFEC 1S4XA 3BRVB 3A0HE 2B89A 3HUSA 3OA7A 5KJ7D 3TF5A 1VQPP 2NPSB 5KLVJ 3GW6A 3QH9A 2XNXA 3VMZA 1BCCD 1IFDA 1SFCC 2FXMA 1GL2B 1RE4C 2QIWA 1KN7A 3VMAA 1L0NE 3WUVA 2WT7A 1KYOI 2N1TA 3GG2A 2E76D 1H89A 2KSEA 4AQRD 3L70E 1IFPA 5C39A 2PFXA 4IL6H 1SQBD 1GK4A 1VQ4P 5E79E 2C9NY 3HTKA 3SWYA 5KLVE 1NTMJ 1Q90D 2FYNB 1IK9A 2YIUC 1VF5D 1JCDA 2YMKA 2IZ1A 2VRSA 5CJ4A 1YIJP 3L75G 5GTIH 1FU1A 1KQGB 1S5LH 3PTZA 1GZLA 4L75A 5AVYB 2YMYA 2JWAA 1R8EA 4IFMA 1Y47A 2A45G 3FGAD 1FZFA 1NTME 2O01H 3BCCJ 5APTA 4YXDC 2Q7CA 1FDOA 3RL0g 1EZVD 1LWUA 5BU5A 2OYIA 2IFNA 1PGQA 1FZEA 1FOSE 3AEEC 2KS1B 5DJTB 1PGJA 5B66H 1QL2A 2C9LY 4H0LD 3F5HA 5AVWB 1VL2A 1G2CB 5APUA 3CCSP 5APYA 4U3FD 1N7SA 2FFDA 4L76A 2A45H 2KXPB 3H1KE 1SQXD 1MFTA 4N78E 3S1KA 1EC5A 5AW7B 5AVTB 4WY4B 2IYPA 2FYUJ 2B87A 4JYBA 1U7MA 1NU1K 2QG4A 3G6EP 3C9IA 1VPCA 5BU8B 1JB0J 2KIKA 2M5AB 2R44A 3KHUA 2HODA 3VOPA 3E1RA 3AE2C 3L72J 2OGUA 4KJMA 3RK2B 1AFOA 2Z4EA 3EWKA 2P1JA 4H44B 4IL6E 1BCCJ 2W6AA 1URQA 3B5NA 4IOIH 1FBMA 1NGMB 4D6TJ 2L5GB 1T3JA 2O01J 1MFZA 2N1TC 3MP7B 2FYUE 1NU1G 3Q5PA 4H0LB 2JJLA 5KAFH 2WSEH 1NWQA 1L4AB 2NRGA 3TGUJ 2IYOA 3CCRP 3M0DA 2O3JA 4I7ZC 2KUBA 3G9RA 4EI2A 1T2KC 1N7SD 3L72E 1SQBJ 1BGYG 2HG5D 4EIJA 1DIPA 3Q1MA 1QVGO 5GTIE 2ZYGA 1H88A 1S5LE 1BCCE 1KORA 2OTLP 4R4LA 1FC2C 1S9KD 4D6TE 2OARA 4A7PA 1SQVJ 3HD7A 3ITKA 3L74J 3PRJA 4XE5B 1Y8AA 4DOJA 3CCQP 3CXHH 3TGUE 3R4YA 1IFJA 3CWBG 1P84I 1DEBA 5B66E 2HPCB 1S3JA 3RL0B 1VQKP 5CMZA 2OYIC 3CC7P 2Y0DA 3MHVA 3U1AA 2WITA 3CCJP 4OGQC 3CCVP 2QJPC 1M7LA 1CW5A 3P8CD 1SQVE 5TISE 1K73Q 3L74E 2GM4A 1R5LA 4C7NA 5AW9B 3CI9A 3VYIA 1L0NK 2D2CC 1SVFA 2Q3IA 3AEDC 1QL1A 1CZQA 1Z56A 1KB9I 1L0LD 4HH2A 3KQGA 1L2PA 3HD7D 3V2QA 5KKZB 5KLVK 3T97B 4JQ0D 4RJTA 5AW2B 2J59M 2YXQB 1NAYA 1L0NG 3MD0A 5KAFE 4WVZA 1RE3A 2WPRA 1T6AA 1D7MA 1AQ5A 4LLHA 3TYYA 3OAKA 3TK1A 2H89C 3B5NC 3MUDA 3GHGC 2KOGA 3L70G 1PP9D 1RF1B 3A0HH 1KILD 2W6BA 3AE3C 1JTHB 2E75C 3CX5I 1KZUB 5KLVG 2Z5HA 3L35A 2QJYB 2J58A 2K3RA 1NH4A 3RK3C 1LT9B 1NTMK 3N4XA 1W2EA 3NMDA 4PV1C 4H13C 3CXHE 3IF4A 1KYOD 3M9HA 1DD3A 2W90A 3A2AA 1FAVA 1YTZT 4U7JA 3AEFC 1PV3A 3B71A 5E79H 1HJBA 3L71J 1RH5B 3E7KA 1IK7A 2ZT9C 4RO0A 2KSJA 1CI6A 1OIPA 3CCLP 1NTMG 2IBZE 1KFNA 3FXEA 2W6JH 3H1HJ 1VQMP 1YQ4C 1OWAA 4N3YB 3M06A 2NPSD 2YXRB 1ZR2A 3AE5C 4IL6X 2KYVA 3K5BA 1KILB 3H1IJ 1GL2D 2A06D 2BCCD 1J1EB 5H2FH 1K04A 1LTJC 3KPEA 3PP5A 2RKLA 3AEAC 2XU6A 2P10A 1NO4A 3AECC 2GA1A 3L71E 1OVVA 4Y28J 4L73A 3L4FA 3Q2YA 2XV5A 3H1KG 1H0TB 3L73G 4TT3H 4ZKPA 1SS1A 2KK7A 3H1HE 5KTBA 3L37A 1Q86Q 1G2CA 1NTZJ 2Q3EA 4EYYQ 1ZN5A 1S5LX 5L8RJ 2FYUK 2WQYC 1X8YA 3V2NA 1PZQA 1IJDB 3H1IE 1LT1A 2K9JB 2YKOA 1YQ3C 1L0LJ 4WY4A 4W80A 1KFMA 1OXZA 1BE3E 1SQQD 3JC22 4JBZA 5KAIH 2M5AA 1HH0A 3HRNA 3AE9C 4IFFA 2ZAEB 3RK3E 2LKMA 3CC4P 2FYUG 1NTZE 1SFCB 1EDKA 2WPSA 1EDIA 2Y9ZA 1HVVA 3HE4B 1LTSC 2RMZA 2OYHC 3A5TA 1X79B 3L72G 3NTNA 4DZOA 1FOSF 3CMEP 1VQ5P 4BXLA 2WSFJ 3ZDMA 1T3UA 4M3LA 1BCCG 3P7KA 1IC2A 1L4AA 2FKWB 1QX8A 3G3ZA 4D6TG 4GODA 2QRXA 3L75D 1S1CX 1NHLA 2H7HA 1RF0A 5APQA 2N9BA 1M1JC 2YIUB 3C8VA 1BSHA 2M3EA 5CBNA 3U1CA 1SQVK 1RHZB 4PD4H 3TGUG 4WY4D 3CPWO 1EQ7A 1LGHB 1LTBC 5APSA 3AE1C 5H2FE 3L36A 3AEBC 1DD4A 5KJ7C 1N73A 1AJYA 2CK3H 3II6A 5APXA 3WU2E 2ZXEB 2Y0EA 1KD1Q 3VMXA 3RK2D 1NTKJ 1OX3A 4H44D 1UIXA 2YNYA 3E1IA 1YYCA 1XTGB 3EQ2A 3TDKA 4ZNCA 2HPCA 2ZXXA 1OW8A 1J1DC 1SQVG 3L74G 1GDTA 1KYOE 2E76C 3PHLA 1P84D 2WTYA 1RQUA 1HF9A 1L4AD 1EDLA 3B8EB 1U57A 3FXDA 5AW0B 1ZR4A 1A02J 1HTLC 3CCEP 4BRYB 3PJSK 1NTKE 1JO5A 3BCCE 5KAIE 1VF5C 2XNDH 1VQLP 5TISH 2H8PD 1LTTC 1LTGC 5CCGA 2K37A 3V2RA 2H43A 2R5BA 5AW4B 2A06E 3AEGC 4I2LC 1JY2O 3HUSC 2P58A 1J2JB 1YHQP 3GF3A 1PPJE 1H8AA 1VQ6P 1SQQJ 3H1JG 3T97A 1NU1D 1X0TA 1SP4A 1KB9D 2FBWC 1RQVA 3H1LD 1ZLLA 2ZYDA 1M8OB 3CCUP 1X9VA 2V4HA 3RL0D 4AYCA 2BASA 2WVRA 1ZOYC 2O1KA 1BGYD 2KB7P 1USEA 2V7QJ 1OW7A 3I5CA 1PIXA 2N1TB 3PH0A 2Q1KA 1MKMA 1TU3F 1WT6A 2A45I 1JTHA 4C7RA 4PD4E 3I56P 2POHA 2L91A 1JY3N 1SQQE 1KTMA 3JCUE 1LT9A 4I7ZB 1SQPD 4OVNF 4XFJA 3M9QA 1K8AQ 3A3YB 2P67A 3MIWA 3CX5D 3D71A 5KLIC 2IBZG 5CCGD 3L75J 3USSA 3CWBD 2R32A 1FZAA 1ZXGA 4RKUJ 1N73C 2ZVOB 3V5BA 1RY3A 3VMYA 1SQBE 2JDIH 1MV8A 3VP8A 4W7YA 1ZV8A 1YJWP 3L71G 3BVHA 2Y0CA 1LWUC 1KILA 2E74C 2RN0A 4RESB 3L75E 2G3AA 5B5EE 2OYIB 3H1HG 2LXCB 2BEQD 4MN4C 2QE7H 4OGQB 2QJPB 2KP8A 1CSBA 3PLNA 2FYZA 1NTZK 5GTHE 3H1IG 1BDCA 1N7SC 3M91A 2YO2A 2FFDC 1H0TA 2QJKC 2WPVB 1FS0E 4U3FJ 2D2CB 1FZCA 3A0BE 1BE3G 1SQXJ 1L0ND 1VDFA 3V4WA 2JEEA 3CXHI 2WSCJ 1EZVE 1NKNA 2K9JA 4Y99C 3NFQA 3UIAA 3H25A 4PJ0H 1NTZG 2QEXP 2QSIA 4YPCA 3OJAB 1FDMA 1WRGA 4K3AA 2NPSA 1P84E 3GLMA 5KLVD 3S4RA 1JOCA 2IBZI 3SSUA 1URQC 4K35A 2NZ2A 4U3FE 3H1LJ 1GL2A 1GU4A 3FWLA 3BATA 1K05A 3B5NB 3GHGB 1IFIA 5EFWB 1SQXE 2OTKE 4EDFA 1KV4A 1GMJA 3HE5B 1GK6A 3HE4A 1KMIZ 2ZJSE 1FZBA 2N9YB 2JR8A 2E75B 3M0DC 3CC2P 2ITAA 3S9OA 4N6JA 2FXPA 2K88A 1AV1A 4DJGA 3RK3B 2IPPA 4I6MC 3IAOA 3H32B 4PV1B 1SQPJ 4H13B 3TNUB 3H1LE 1DH3A 4HB1A 5AVVB 1U7JA 1LTAC 4I1LA 1Q81Q 1QLED 3HD7C 3MTUE 3WMM0 1XTCC 2ZT9B 5AW5B 2M0BA 2WWWA 1JMMA 2W27A 5AW1B 1NTKK 5CCHD 1JUNA 2AXTE 1VQ9P 3O6QB 1EXIA 5CJ0A 3D6ZA 1N8RQ 2Q5UA 4IFDK 1UIIA 2BEZF 2JP3A 3H1KD 2I1JA 1SFCD 1SQPE 3L73D 2I1KA 3WU2H 1GU5A 2WSFH 1MZ9A 2WZ7A 1FJPA 2FY8A 3KZIE 1LJ2A 1LTJB 1X22A 2WSSH 2XDJA 3CX5E 1G1IA 1S9KE 2KS1A 2W83C 3LW5J 1NTKG 1ZW0A 2M3BA 3BCCG 2Y9YA 3BASA 1KYOH 2PRRA 2KZIA 2I8DA 1Q7YQ 2P2UA 4PJ0E 1FZCC 3GMAA 3SFDC 1JY3P 3Q5RA 4BRYA 4C46A 1PPJG 2C0XA 2E43A 5APVA 1NOHA 4XA4A 2E5YA 4GDOA 2JO1A 3RBZA 2C0WA 3CCMP 1IO4A 1SQQK 4AUWA 3Q5SA 3P8CE 1S2EA 2QM7A 2G8YA 1M90Q 2NPSC 1RE3C 3L72D 3FWNA 2DW3A 3D6YA 3MUDC 2XZRA 1GL2C 4OH8B 3W68A 1VQ8P 1M56D 1HGVA 4ASWA 1PP9J 3CL3D 5AVZB 5AVSB 2YKPA 2HR3A 2J5UA 1L0LE 4D6TD 1SQQG 2OYHB 1SQBK 2KNCB 4B86A 3P32A 3TGUD 1JCCA 1G1JA 4UB8E 3LIEA 2FYNC 1T8ZA 1BDDA 1NYHA 1S72P 1E79H 2WMMA 1IFMA 3VTPC 1PP9E 4LC1A 1M1JB 3JCUH 1VQOP 1KILE 1HGZA 3V4QA 2LR2A 1SQBG 3RBXA 1NAFA 1MUUA 2PGDA 1M57D 1CI6B 1SQVD 1DX7A 3L74D 1KC8Q 2AEMA 1AQTA 4HJGH 4NPFX 4YTPC 4GKGA 2MJZA 2V7QH 2SPZA 5AW6B 3NXSA 1A02F 3SWKA 3O8ZA 3AE4C 2BCCJ 5AVRB 3H1KJ 1LP1B 5AW3B 1J1DB 3L73J 4JYCA 3VN0A 1PGPA 3IFMA 2E76B 3BRTB 1GTWA 2N1TD 4GOEA 1HJ0A 2KZJA 4O9BA 2FXOA 3AE7C 1E5WA 5B5EH 1SQXK 2ZFCA 4PD4I 1EZVG 1QVFO 1T2KD 2OQQA 3H1JD 2IFMA 1VF5B 1IFNA 4EOTA 3I55P 1W2BO 2QVAA 1AVOA 5GTHH 2BCCE 4WY4C 4NPEA 2PP6A 3L73E 5K5GB 1N7LA 1R5SA 3VP9A 3P8MC 3GF7A 3A0BH 3C1LA 4U3FG 1FJKA 1OVUA 2JWDA 4L74A 3HUSB 3U59A 2KI7B 1SQXG 3RK2C 4H44C 3CXHD 3JSVC 1RF1A 4W7ZA 4WWIA 2IDBA 2WT7B 4HKZH 1KQLA 2CPBA 2QM8A 1P84H 3GHGA 3EFFK 1FE6A 4H0LC 2R5DA 2E74D 3HE5A 1KQFB 2IBZD 1L4AC 4OGQD 1GW3A 2Q6QA 1PFIA 3H1LG 1ZRTD 1SLQA 3HTKB 1EXJA 1SQPK 2IX7C 3MGNA 2WSCH 3AE6C 2AEJA 4ZMDA 1RF0C 2HYNA 2D2CD 1JY2P 4HYTB 1Q2NA 3A7OA 3H32A 3N7NA 4KT0J 2MKVA 4WB4A 3TNUA 5KLIB 1JEKA 4R4MA 1GW4A 1GD2E 3L71D 2R3CA 3SWFA 3ABVC 1BSNA 1WMKA 1DEEG 2E42A 3QWOC 1KB9H 1EZVI 4ZKUA 2M8RA 1SQPG 1N73B 1LNQA 1NJIQ 3H1HD 3EFGA 1OZHA 1YJNP 2RH0A 3IR9A 2PAJA 3O6QA 3G4SP 5AVUB 2HFED
chains in the Genus database with same CATH topology
3PH0A 2Q1KA 1H0TA 5DJUB 1EDKA 1FC2C 3MZWB 1MFTA 4ASVA 1EDIA 3S1KA 1EC5A 4HB1A 1U7JA 2LXBA 4HJGH 4NPFX 2B87A 2UWJE 4WWIA 2SPZA 1U7MA 4HKZH 1EDLA 2M0BA 1NVOA 3FXDA 2RKLA 2KIKA 4BXLA 2M5AB 3ZDMA 1OVRA 2R44A 1LP1B 4GOFA 1OVVA 1S3JA 4KJMA 4ASWA 1H0TB 1JM0A 4K3AA 2HR3A 1SS1A 1JMBA 4GODA 1ZXGA 2QRXA 3RGUA 4GOEA 2K3RA 3MHVA 2B88A 4IOIH 2B89A 1Y47A 4ZMDA 2B87B 4K35A 2KZJA 4EYYQ 5CBNA 4CPGA 2P58A 1Q2NA 4NPDA 5EFWB 1EDJA 1X0TA 1LT1A 5CBOA 1ZW0A 2OTKE 2QVAA 1DEEG 2KS1B 5DJTB 1BDDA 4NPEA 2KUBA 3QWOC 2KZIA 2I8DA 5K5GB 4JBZA 2WMMA 2LXCB 2M5AA 4MN4C 2JWDA 1OVUA 1LP1A 2LR2A 4ZNCA 2ZAEB 5C39A 2KI7B 3FXEA 1BDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PH0 A;  2Q1K A;  1H0T A;  5DJU B;  1EDK A;  1FC2 C;  3MZW B;  1MFT A;  4ASV A;  1EDI A;  3S1K A;  1EC5 A;  4HB1 A;  1U7J A;  2LXB A;  4HJG H;  4NPF X;  2B87 A;  2UWJ E;  4WWI A;  2SPZ A;  1U7M A;  4HKZ H;  1EDL A;  2M0B A;  1NVO A;  3FXD A;  2RKL A;  2KIK A;  4BXL A;  2M5A B;  3ZDM A;  1OVR A;  2R44 A;  1LP1 B;  4GOF A;  1OVV A;  1S3J A;  4KJM A;  4ASW A;  1H0T B;  1JM0 A;  4K3A A;  2HR3 A;  1SS1 A;  1JMB A;  4GOD A;  1ZXG A;  2QRX A;  3RGU A;  4GOE A;  2K3R A;  3MHV A;  2B88 A;  4IOI H;  2B89 A;  1Y47 A;  4ZMD A;  2B87 B;  4K35 A;  2KZJ A;  4EYY Q;  5CBN A;  4CPG A;  2P58 A;  1Q2N A;  4NPD A;  5EFW B;  1EDJ A;  1X0T A;  1LT1 A;  5CBO A;  1ZW0 A;  2OTK E;  2QVA A;  1DEE G;  2KS1 B;  5DJT B;  1BDD A;  4NPE A;  2KUB A;  3QWO C;  2KZI A;  2I8D A;  5K5G B;  4JBZ A;  2WMM A;  2LXC B;  2M5A A;  4MN4 C;  2JWD A;  1OVU A;  1LP1 A;  2LR2 A;  4ZNC A;  2ZAE B;  5C39 A;  2KI7 B;  3FXE A;  1BDC A; 
#chains in the Genus database with same CATH topology
 3RL0 C;  3V2P A;  2QA4 P;  3H1I D;  1YIT P;  1K9M Q;  2H88 C;  3MZW B;  3WUT A;  1Y9B A;  1LWU B;  1URQ D;  2AXT H;  2CPS A;  3B5N D;  4JPZ B;  2E74 B;  2Q9I A;  2OTJ P;  3LID A;  2LXB A;  1M1K Q;  2UWJ E;  3CMA P;  5TJH A;  1LTJ A;  1ZME C;  1BE3 D;  2WPQ A;  1HWT C;  3W67 A;  2E75 D;  5AVQ B;  1OVR A;  1VQN P;  4QMA A;  2IZ0 A;  2ZVN B;  2JKV A;  2ZYA A;  3RK3 D;  1N7S B;  3KZI H;  2FFD B;  2QJK B;  3CX5 H;  4WBA A;  1L0L K;  1VQ7 P;  4KHX A;  1NTZ D;  2WSE J;  1QGK B;  1JMB A;  4PV1 D;  3RGU A;  5M1B A;  5CCG C;  2P7J A;  4H13 D;  2B88 A;  4Z1M H;  3H1J J;  2B87 B;  4CPG A;  1OFC X;  3TSI A;  3WUU A;  2HLO A;  3L70 D;  3IN6 A;  5KKZ C;  4GIF A;  5BVZ A;  4Y99 B;  1EDJ A;  2GUV A;  2W8Z A;  2ZT9 D;  2HOD B;  5CCH A;  5APW A;  1IZN B;  5AVX B;  1NU1 J;  4BWN A;  1L0L G;  3V6I A;  3R2P A;  4UB6 H;  1YBK A;  3KYQ A;  1SFC A;  1URQ B;  3CD6 P;  3CLQ A;  1RF1 C;  3LW5 H;  1RE4 A;  2AXC A;  1AVY A;  1W5C E;  2O1J A;  2K9Y A;  1BGY J;  3H1J E;  1OW6 A;  1YI2 P;  4ASV A;  1YTZ I;  1ZP0 C;  2QJY C;  3OW2 O;  2OYH A;  2KNC A;  4LGD E;  1LT9 C;  1Q82 Q;  2KLU A;  1NVO A;  1PP9 G;  1NU1 E;  1NTM D;  2KLV A;  1KB9 E;  3M0A A;  1USD A;  2O01 N;  4YXW H;  3M9B A;  3KDP B;  2E5T A;  2Z5I A;  1JM0 A;  3CWB J;  4UB8 H;  2OYO A;  2YKQ A;  1HUC A;  1JNM A;  1BGY E;  1M1J A;  3HD7 B;  3G71 P;  1HBW A;  3F89 A;  4OWF A;  2GUS A;  1JY3 O;  4NPD A;  3H6P A;  3AE8 C;  5CBO A;  5KJ7 A;  3D70 A;  1NTK D;  1ZRT E;  2B9B A;  3BCC D;  4N78 D;  1KIL C;  4DT0 A;  1AA0 A;  1NKZ B;  1KQS O;  3FX0 A;  1J1E C;  1LP1 A;  3CWB E;  4TLF A;  2R3S A;  3B4S A;  4DCK A;  1FZG A;  1QEX A;  2AEF A;  2K1A A;  1PPJ D;  5DJU B;  1BE3 J;  1JY2 N;  3KXD A;  4C7N B;  1PGO A;  2A06 G;  5CHX A;  2BCC G;  2XKM A;  1N2D C;  1N86 A;  4JF7 A;  4GT1 A;  1FZC B;  1OMI A;  1L0N J;  2FYU D;  4GOF A;  1YJ9 P;  4UB6 E;  3Q3D A;  1FDI A;  5AW8 B;  2YO3 A;  1LTI C;  3L70 J;  4PD4 D;  5CCH C;  1PL5 A;  3SFE C;  1S4X A;  3BRV B;  3A0H E;  2B89 A;  3HUS A;  3OA7 A;  5KJ7 D;  3TF5 A;  1VQP P;  2NPS B;  5KLV J;  3GW6 A;  3QH9 A;  2XNX A;  3VMZ A;  1BCC D;  1IFD A;  1SFC C;  2FXM A;  1GL2 B;  1RE4 C;  2QIW A;  1KN7 A;  3VMA A;  1L0N E;  3WUV A;  2WT7 A;  1KYO I;  2N1T A;  3GG2 A;  2E76 D;  1H89 A;  2KSE A;  4AQR D;  3L70 E;  1IFP A;  5C39 A;  2PFX A;  4IL6 H;  1SQB D;  1GK4 A;  1VQ4 P;  5E79 E;  2C9N Y;  3HTK A;  3SWY A;  5KLV E;  1NTM J;  1Q90 D;  2FYN B;  1IK9 A;  2YIU C;  1VF5 D;  1JCD A;  2YMK A;  2IZ1 A;  2VRS A;  5CJ4 A;  1YIJ P;  3L75 G;  5GTI H;  1FU1 A;  1KQG B;  1S5L H;  3PTZ A;  1GZL A;  4L75 A;  5AVY B;  2YMY A;  2JWA A;  1R8E A;  4IFM A;  1Y47 A;  2A45 G;  3FGA D;  1FZF A;  1NTM E;  2O01 H;  3BCC J;  5APT A;  4YXD C;  2Q7C A;  1FDO A;  3RL0 g;  1EZV D;  1LWU A;  5BU5 A;  2OYI A;  2IFN A;  1PGQ A;  1FZE A;  1FOS E;  3AEE C;  2KS1 B;  5DJT B;  1PGJ A;  5B66 H;  1QL2 A;  2C9L Y;  4H0L D;  3F5H A;  5AVW B;  1VL2 A;  1G2C B;  5APU A;  3CCS P;  5APY A;  4U3F D;  1N7S A;  2FFD A;  4L76 A;  2A45 H;  2KXP B;  3H1K E;  1SQX D;  1MFT A;  4N78 E;  3S1K A;  1EC5 A;  5AW7 B;  5AVT B;  4WY4 B;  2IYP A;  2FYU J;  2B87 A;  4JYB A;  1U7M A;  1NU1 K;  2QG4 A;  3G6E P;  3C9I A;  1VPC A;  5BU8 B;  1JB0 J;  2KIK A;  2M5A B;  2R44 A;  3KHU A;  2HOD A;  3VOP A;  3E1R A;  3AE2 C;  3L72 J;  2OGU A;  4KJM A;  3RK2 B;  1AFO A;  2Z4E A;  3EWK A;  2P1J A;  4H44 B;  4IL6 E;  1BCC J;  2W6A A;  1URQ A;  3B5N A;  4IOI H;  1FBM A;  1NGM B;  4D6T J;  2L5G B;  1T3J A;  2O01 J;  1MFZ A;  2N1T C;  3MP7 B;  2FYU E;  1NU1 G;  3Q5P A;  4H0L B;  2JJL A;  5KAF H;  2WSE H;  1NWQ A;  1L4A B;  2NRG A;  3TGU J;  2IYO A;  3CCR P;  3M0D A;  2O3J A;  4I7Z C;  2KUB A;  3G9R A;  4EI2 A;  1T2K C;  1N7S D;  3L72 E;  1SQB J;  1BGY G;  2HG5 D;  4EIJ A;  1DIP A;  3Q1M A;  1QVG O;  5GTI E;  2ZYG A;  1H88 A;  1S5L E;  1BCC E;  1KOR A;  2OTL P;  4R4L A;  1FC2 C;  1S9K D;  4D6T E;  2OAR A;  4A7P A;  1SQV J;  3HD7 A;  3ITK A;  3L74 J;  3PRJ A;  4XE5 B;  1Y8A A;  4DOJ A;  3CCQ P;  3CXH H;  3TGU E;  3R4Y A;  1IFJ A;  3CWB G;  1P84 I;  1DEB A;  5B66 E;  2HPC B;  1S3J A;  3RL0 B;  1VQK P;  5CMZ A;  2OYI C;  3CC7 P;  2Y0D A;  3MHV A;  3U1A A;  2WIT A;  3CCJ P;  4OGQ C;  3CCV P;  2QJP C;  1M7L A;  1CW5 A;  3P8C D;  1SQV E;  5TIS E;  1K73 Q;  3L74 E;  2GM4 A;  1R5L A;  4C7N A;  5AW9 B;  3CI9 A;  3VYI A;  1L0N K;  2D2C C;  1SVF A;  2Q3I A;  3AED C;  1QL1 A;  1CZQ A;  1Z56 A;  1KB9 I;  1L0L D;  4HH2 A;  3KQG A;  1L2P A;  3HD7 D;  3V2Q A;  5KKZ B;  5KLV K;  3T97 B;  4JQ0 D;  4RJT A;  5AW2 B;  2J59 M;  2YXQ B;  1NAY A;  1L0N G;  3MD0 A;  5KAF E;  4WVZ A;  1RE3 A;  2WPR A;  1T6A A;  1D7M A;  1AQ5 A;  4LLH A;  3TYY A;  3OAK A;  3TK1 A;  2H89 C;  3B5N C;  3MUD A;  3GHG C;  2KOG A;  3L70 G;  1PP9 D;  1RF1 B;  3A0H H;  1KIL D;  2W6B A;  3AE3 C;  1JTH B;  2E75 C;  3CX5 I;  1KZU B;  5KLV G;  2Z5H A;  3L35 A;  2QJY B;  2J58 A;  2K3R A;  1NH4 A;  3RK3 C;  1LT9 B;  1NTM K;  3N4X A;  1W2E A;  3NMD A;  4PV1 C;  4H13 C;  3CXH E;  3IF4 A;  1KYO D;  3M9H A;  1DD3 A;  2W90 A;  3A2A A;  1FAV A;  1YTZ T;  4U7J A;  3AEF C;  1PV3 A;  3B71 A;  5E79 H;  1HJB A;  3L71 J;  1RH5 B;  3E7K A;  1IK7 A;  2ZT9 C;  4RO0 A;  2KSJ A;  1CI6 A;  1OIP A;  3CCL P;  1NTM G;  2IBZ E;  1KFN A;  3FXE A;  2W6J H;  3H1H J;  1VQM P;  1YQ4 C;  1OWA A;  4N3Y B;  3M06 A;  2NPS D;  2YXR B;  1ZR2 A;  3AE5 C;  4IL6 X;  2KYV A;  3K5B A;  1KIL B;  3H1I J;  1GL2 D;  2A06 D;  2BCC D;  1J1E B;  5H2F H;  1K04 A;  1LTJ C;  3KPE A;  3PP5 A;  2RKL A;  3AEA C;  2XU6 A;  2P10 A;  1NO4 A;  3AEC C;  2GA1 A;  3L71 E;  1OVV A;  4Y28 J;  4L73 A;  3L4F A;  3Q2Y A;  2XV5 A;  3H1K G;  1H0T B;  3L73 G;  4TT3 H;  4ZKP A;  1SS1 A;  2KK7 A;  3H1H E;  5KTB A;  3L37 A;  1Q86 Q;  1G2C A;  1NTZ J;  2Q3E A;  4EYY Q;  1ZN5 A;  1S5L X;  5L8R J;  2FYU K;  2WQY C;  1X8Y A;  3V2N A;  1PZQ A;  1IJD B;  3H1I E;  1LT1 A;  2K9J B;  2YKO A;  1YQ3 C;  1L0L J;  4WY4 A;  4W80 A;  1KFM A;  1OXZ A;  1BE3 E;  1SQQ D;  3JC2 2;  4JBZ A;  5KAI H;  2M5A A;  1HH0 A;  3HRN A;  3AE9 C;  4IFF A;  2ZAE B;  3RK3 E;  2LKM A;  3CC4 P;  2FYU G;  1NTZ E;  1SFC B;  1EDK A;  2WPS A;  1EDI A;  2Y9Z A;  1HVV A;  3HE4 B;  1LTS C;  2RMZ A;  2OYH C;  3A5T A;  1X79 B;  3L72 G;  3NTN A;  4DZO A;  1FOS F;  3CME P;  1VQ5 P;  4BXL A;  2WSF J;  3ZDM A;  1T3U A;  4M3L A;  1BCC G;  3P7K A;  1IC2 A;  1L4A A;  2FKW B;  1QX8 A;  3G3Z A;  4D6T G;  4GOD A;  2QRX A;  3L75 D;  1S1C X;  1NHL A;  2H7H A;  1RF0 A;  5APQ A;  2N9B A;  1M1J C;  2YIU B;  3C8V A;  1BSH A;  2M3E A;  5CBN A;  3U1C A;  1SQV K;  1RHZ B;  4PD4 H;  3TGU G;  4WY4 D;  3CPW O;  1EQ7 A;  1LGH B;  1LTB C;  5APS A;  3AE1 C;  5H2F E;  3L36 A;  3AEB C;  1DD4 A;  5KJ7 C;  1N73 A;  1AJY A;  2CK3 H;  3II6 A;  5APX A;  3WU2 E;  2ZXE B;  2Y0E A;  1KD1 Q;  3VMX A;  3RK2 D;  1NTK J;  1OX3 A;  4H44 D;  1UIX A;  2YNY A;  3E1I A;  1YYC A;  1XTG B;  3EQ2 A;  3TDK A;  4ZNC A;  2HPC A;  2ZXX A;  1OW8 A;  1J1D C;  1SQV G;  3L74 G;  1GDT A;  1KYO E;  2E76 C;  3PHL A;  1P84 D;  2WTY A;  1RQU A;  1HF9 A;  1L4A D;  1EDL A;  3B8E B;  1U57 A;  3FXD A;  5AW0 B;  1ZR4 A;  1A02 J;  1HTL C;  3CCE P;  4BRY B;  3PJS K;  1NTK E;  1JO5 A;  3BCC E;  5KAI E;  1VF5 C;  2XND H;  1VQL P;  5TIS H;  2H8P D;  1LTT C;  1LTG C;  5CCG A;  2K37 A;  3V2R A;  2H43 A;  2R5B A;  5AW4 B;  2A06 E;  3AEG C;  4I2L C;  1JY2 O;  3HUS C;  2P58 A;  1J2J B;  1YHQ P;  3GF3 A;  1PPJ E;  1H8A A;  1VQ6 P;  1SQQ J;  3H1J G;  3T97 A;  1NU1 D;  1X0T A;  1SP4 A;  1KB9 D;  2FBW C;  1RQV A;  3H1L D;  1ZLL A;  2ZYD A;  1M8O B;  3CCU P;  1X9V A;  2V4H A;  3RL0 D;  4AYC A;  2BAS A;  2WVR A;  1ZOY C;  2O1K A;  1BGY D;  2KB7 P;  1USE A;  2V7Q J;  1OW7 A;  3I5C A;  1PIX A;  2N1T B;  3PH0 A;  2Q1K A;  1MKM A;  1TU3 F;  1WT6 A;  2A45 I;  1JTH A;  4C7R A;  4PD4 E;  3I56 P;  2POH A;  2L91 A;  1JY3 N;  1SQQ E;  1KTM A;  3JCU E;  1LT9 A;  4I7Z B;  1SQP D;  4OVN F;  4XFJ A;  3M9Q A;  1K8A Q;  3A3Y B;  2P67 A;  3MIW A;  3CX5 D;  3D71 A;  5KLI C;  2IBZ G;  5CCG D;  3L75 J;  3USS A;  3CWB D;  2R32 A;  1FZA A;  1ZXG A;  4RKU J;  1N73 C;  2ZVO B;  3V5B A;  1RY3 A;  3VMY A;  1SQB E;  2JDI H;  1MV8 A;  3VP8 A;  4W7Y A;  1ZV8 A;  1YJW P;  3L71 G;  3BVH A;  2Y0C A;  1LWU C;  1KIL A;  2E74 C;  2RN0 A;  4RES B;  3L75 E;  2G3A A;  5B5E E;  2OYI B;  3H1H G;  2LXC B;  2BEQ D;  4MN4 C;  2QE7 H;  4OGQ B;  2QJP B;  2KP8 A;  1CSB A;  3PLN A;  2FYZ A;  1NTZ K;  5GTH E;  3H1I G;  1BDC A;  1N7S C;  3M91 A;  2YO2 A;  2FFD C;  1H0T A;  2QJK C;  2WPV B;  1FS0 E;  4U3F J;  2D2C B;  1FZC A;  3A0B E;  1BE3 G;  1SQX J;  1L0N D;  1VDF A;  3V4W A;  2JEE A;  3CXH I;  2WSC J;  1EZV E;  1NKN A;  2K9J A;  4Y99 C;  3NFQ A;  3UIA A;  3H25 A;  4PJ0 H;  1NTZ G;  2QEX P;  2QSI A;  4YPC A;  3OJA B;  1FDM A;  1WRG A;  4K3A A;  2NPS A;  1P84 E;  3GLM A;  5KLV D;  3S4R A;  1JOC A;  2IBZ I;  3SSU A;  1URQ C;  4K35 A;  2NZ2 A;  4U3F E;  3H1L J;  1GL2 A;  1GU4 A;  3FWL A;  3BAT A;  1K05 A;  3B5N B;  3GHG B;  1IFI A;  5EFW B;  1SQX E;  2OTK E;  4EDF A;  1KV4 A;  1GMJ A;  3HE5 B;  1GK6 A;  3HE4 A;  1KMI Z;  2ZJS E;  1FZB A;  2N9Y B;  2JR8 A;  2E75 B;  3M0D C;  3CC2 P;  2ITA A;  3S9O A;  4N6J A;  2FXP A;  2K88 A;  1AV1 A;  4DJG A;  3RK3 B;  2IPP A;  4I6M C;  3IAO A;  3H32 B;  4PV1 B;  1SQP J;  4H13 B;  3TNU B;  3H1L E;  1DH3 A;  4HB1 A;  5AVV B;  1U7J A;  1LTA C;  4I1L A;  1Q81 Q;  1QLE D;  3HD7 C;  3MTU E;  3WMM 0;  1XTC C;  2ZT9 B;  5AW5 B;  2M0B A;  2WWW A;  1JMM A;  2W27 A;  5AW1 B;  1NTK K;  5CCH D;  1JUN A;  2AXT E;  1VQ9 P;  3O6Q B;  1EXI A;  5CJ0 A;  3D6Z A;  1N8R Q;  2Q5U A;  4IFD K;  1UII A;  2BEZ F;  2JP3 A;  3H1K D;  2I1J A;  1SFC D;  1SQP E;  3L73 D;  2I1K A;  3WU2 H;  1GU5 A;  2WSF H;  1MZ9 A;  2WZ7 A;  1FJP A;  2FY8 A;  3KZI E;  1LJ2 A;  1LTJ B;  1X22 A;  2WSS H;  2XDJ A;  3CX5 E;  1G1I A;  1S9K E;  2KS1 A;  2W83 C;  3LW5 J;  1NTK G;  1ZW0 A;  2M3B A;  3BCC G;  2Y9Y A;  3BAS A;  1KYO H;  2PRR A;  2KZI A;  2I8D A;  1Q7Y Q;  2P2U A;  4PJ0 E;  1FZC C;  3GMA A;  3SFD C;  1JY3 P;  3Q5R A;  4BRY A;  4C46 A;  1PPJ G;  2C0X A;  2E43 A;  5APV A;  1NOH A;  4XA4 A;  2E5Y A;  4GDO A;  2JO1 A;  3RBZ A;  2C0W A;  3CCM P;  1IO4 A;  1SQQ K;  4AUW A;  3Q5S A;  3P8C E;  1S2E A;  2QM7 A;  2G8Y A;  1M90 Q;  2NPS C;  1RE3 C;  3L72 D;  3FWN A;  2DW3 A;  3D6Y A;  3MUD C;  2XZR A;  1GL2 C;  4OH8 B;  3W68 A;  1VQ8 P;  1M56 D;  1HGV A;  4ASW A;  1PP9 J;  3CL3 D;  5AVZ B;  5AVS B;  2YKP A;  2HR3 A;  2J5U A;  1L0L E;  4D6T D;  1SQQ G;  2OYH B;  1SQB K;  2KNC B;  4B86 A;  3P32 A;  3TGU D;  1JCC A;  1G1J A;  4UB8 E;  3LIE A;  2FYN C;  1T8Z A;  1BDD A;  1NYH A;  1S72 P;  1E79 H;  2WMM A;  1IFM A;  3VTP C;  1PP9 E;  4LC1 A;  1M1J B;  3JCU H;  1VQO P;  1KIL E;  1HGZ A;  3V4Q A;  2LR2 A;  1SQB G;  3RBX A;  1NAF A;  1MUU A;  2PGD A;  1M57 D;  1CI6 B;  1SQV D;  1DX7 A;  3L74 D;  1KC8 Q;  2AEM A;  1AQT A;  4HJG H;  4NPF X;  4YTP C;  4GKG A;  2MJZ A;  2V7Q H;  2SPZ A;  5AW6 B;  3NXS A;  1A02 F;  3SWK A;  3O8Z A;  3AE4 C;  2BCC J;  5AVR B;  3H1K J;  1LP1 B;  5AW3 B;  1J1D B;  3L73 J;  4JYC A;  3VN0 A;  1PGP A;  3IFM A;  2E76 B;  3BRT B;  1GTW A;  2N1T D;  4GOE A;  1HJ0 A;  2KZJ A;  4O9B A;  2FXO A;  3AE7 C;  1E5W A;  5B5E H;  1SQX K;  2ZFC A;  4PD4 I;  1EZV G;  1QVF O;  1T2K D;  2OQQ A;  3H1J D;  2IFM A;  1VF5 B;  1IFN A;  4EOT A;  3I55 P;  1W2B O;  2QVA A;  1AVO A;  5GTH H;  2BCC E;  4WY4 C;  4NPE A;  2PP6 A;  3L73 E;  5K5G B;  1N7L A;  1R5S A;  3VP9 A;  3P8M C;  3GF7 A;  3A0B H;  3C1L A;  4U3F G;  1FJK A;  1OVU A;  2JWD A;  4L74 A;  3HUS B;  3U59 A;  2KI7 B;  1SQX G;  3RK2 C;  4H44 C;  3CXH D;  3JSV C;  1RF1 A;  4W7Z A;  4WWI A;  2IDB A;  2WT7 B;  4HKZ H;  1KQL A;  2CPB A;  2QM8 A;  1P84 H;  3GHG A;  3EFF K;  1FE6 A;  4H0L C;  2R5D A;  2E74 D;  3HE5 A;  1KQF B;  2IBZ D;  1L4A C;  4OGQ D;  1GW3 A;  2Q6Q A;  1PFI A;  3H1L G;  1ZRT D;  1SLQ A;  3HTK B;  1EXJ A;  1SQP K;  2IX7 C;  3MGN A;  2WSC H;  3AE6 C;  2AEJ A;  4ZMD A;  1RF0 C;  2HYN A;  2D2C D;  1JY2 P;  4HYT B;  1Q2N A;  3A7O A;  3H32 A;  3N7N A;  4KT0 J;  2MKV A;  4WB4 A;  3TNU A;  5KLI B;  1JEK A;  4R4M A;  1GW4 A;  1GD2 E;  3L71 D;  2R3C A;  3SWF A;  3ABV C;  1BSN A;  1WMK A;  1DEE G;  2E42 A;  3QWO C;  1KB9 H;  1EZV I;  4ZKU A;  2M8R A;  1SQP G;  1N73 B;  1LNQ A;  1NJI Q;  3H1H D;  3EFG A;  1OZH A;  1YJN P;  2RH0 A;  3IR9 A;  2PAJ A;  3O6Q A;  3G4S P;  5AVU B;  2HFE D; 
#chains in the Genus database with same CATH homology
 3PH0 A;  2Q1K A;  1H0T A;  5DJU B;  1EDK A;  1FC2 C;  3MZW B;  1MFT A;  4ASV A;  1EDI A;  3S1K A;  1EC5 A;  4HB1 A;  1U7J A;  2LXB A;  4HJG H;  4NPF X;  2B87 A;  2UWJ E;  4WWI A;  2SPZ A;  1U7M A;  4HKZ H;  1EDL A;  2M0B A;  1NVO A;  3FXD A;  2RKL A;  2KIK A;  4BXL A;  2M5A B;  3ZDM A;  1OVR A;  2R44 A;  1LP1 B;  4GOF A;  1OVV A;  1S3J A;  4KJM A;  4ASW A;  1H0T B;  1JM0 A;  4K3A A;  2HR3 A;  1SS1 A;  1JMB A;  4GOD A;  1ZXG A;  2QRX A;  3RGU A;  4GOE A;  2K3R A;  3MHV A;  2B88 A;  4IOI H;  2B89 A;  1Y47 A;  4ZMD A;  2B87 B;  4K35 A;  2KZJ A;  4EYY Q;  5CBN A;  4CPG A;  2P58 A;  1Q2N A;  4NPD A;  5EFW B;  1EDJ A;  1X0T A;  1LT1 A;  5CBO A;  1ZW0 A;  2OTK E;  2QVA A;  1DEE G;  2KS1 B;  5DJT B;  1BDD A;  4NPE A;  2KUB A;  3QWO C;  2KZI A;  2I8D A;  5K5G B;  4JBZ A;  2WMM A;  2LXC B;  2M5A A;  4MN4 C;  2JWD A;  1OVU A;  1LP1 A;  2LR2 A;  4ZNC A;  2ZAE B;  5C39 A;  2KI7 B;  3FXE A;  1BDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...