3RGUA

Structure of fap-nra at ph 5.0
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
DSVRENLDKMISEAEVLNDMAARKLITLDAEQQLELMKSLVATQSQLEATKNLIGDPNATVADLQIAYTTLGNNTQALGNELIKLNPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insight into the role of Streptococcus parasanguinis Fap1 within oral biofilm formation.
pubmed doi rcsb
source organism Streptococcus parasanguinis
molecule tags Structural protein
molecule keywords Fimbriae-associated protein Fap1
total genus 34
structure length 88
sequence length 88
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 3rguA00
5DJUB 4ZNCA 2QVAA 2KZJA 4JBZA 5K5GB 2M5AA 2KZIA 4HKZH 5C39A 5CBNA 2LXBA 2Q1KA 4ASWA 2M0BA 4HJGH 1FC2C 1BDCA 1Y47A 2HR3A 2ZAEB 2QRXA 3FXDA 4WWIA 4MN4C 1OVVA 1U7MA 4NPEA 2KI7B 2SPZA 3QWOC 2B89A 1LP1B 1NVOA 2KUBA 4NPFX 1ZXGA 4KJMA 2KIKA 4NPDA 1EDJA 2I8DA 1X0TA 2JWDA 1OVUA 1EC5A 1MFTA 4GOFA 1JM0A 5DJTB 1Q2NA 3MHVA 2K3RA 2KS1B 2M5AB 1DEEG 2R44A 1SS1A 2UWJE 1ZW0A 2RKLA 1BDDA 3RGUA 4GOEA 2B88A 1OVRA 4CPGA 4K3AA 5CBOA 4GODA 1H0TA 2LXCB 2WMMA 3PH0A 2B87A 4BXLA 1EDKA 1H0TB 1S3JA 1LT1A 2B87B 4EYYQ 4IOIH 4HB1A 1U7JA 4K35A 2P58A 3MZWB 4ZMDA 1JMBA 3FXEA 5EFWB 1EDIA 4ASVA 3ZDMA 1LP1A 2OTKE 3S1KA 1EDLA 2LR2A
chains in the Genus database with same CATH superfamily
3V4QA 1SQPK 2Y9YA 3E1IA 1L0NK 3R4YA 3B5NA 1HTLC 4LC1A 1PL5A 3O6QB 3VOPA 4KHXA 2JKVA 5CCGA 3L75G 5B5EH 3GF7A 4ZKPA 2W83C 5AVYB 3K5BA 3M0AA 5K5GB 2G8YA 3B5NB 4RJTA 1SLQA 3SWFA 1OIPA 2WWWA 2P10A 2IYPA 1FZBA 1W2EA 2KS1A 3LIEA 4YXDC 2KZIA 1GK4A 1LTIC 1PGQA 4H0LB 1SQBJ 1VDFA 2GUVA 4EOTA 2LXBA 4HJGH 3AEBC 1YITP 3Q2YA 3N7NA 3IF4A 1J1DB 5AVTB 2ZJSE 2ITAA 3CWBE 1BGYE 1URQB 1A02F 1FC2C 4EDFA 1JTHA 2KK7A 3AE9C 3HD7C 2OYIB 2E76D 4WVZA 3LW5H 4OWFA 1Y8AA 3P7KA 1SQQK 3JC22 1ZLLA 2OYIA 2NPSD 1SVFA 3CWBD 3SFEC 2AEFA 2D2CB 2E75B 3R2PA 1IC2A 1VQ5P 1QVGO 1SQXE 1SFCD 1GK6A 2XDJA 1M1KQ 4EI2A 4Y28J 1SQPD 2PP6A 5B66H 1T3UA 1HWTC 1M1JC 2H88C 2KSJA 3HD7B 4NPEA 2ZFCA 2N1TA 5AW8B 1GL2A 2SPZA 3H1LJ 5H2FH 1M90Q 3H1HD 2NPSA 1KILC 1N2DC 2Q5UA 3BCCG 3L72D 2B89A 5AW6B 1ZR2A 1VF5B 3AE3C 4PD4E 2FXOA 4NPFX 1ZXGA 4KJMA 2KIKA 1A02J 3H1HE 4NPDA 5APSA 1OZHA 3NTNA 3VP8A 3TF5A 1MUUA 2I8DA 2I1KA 2QM7A 1PP9E 3GHGB 4D6TJ 3L74J 1GD2E 1OVUA 3L75D 5CCHA 3HE4A 1U57A 1HBWA 3H1IJ 3A2AA 1J1EC 1MFTA 3L73D 3VMYA 3CD6P 1KORA 1T2KD 3PLNA 1KILE 3TGUJ 2HG5D 4GOFA 1P84E 2IBZI 1OFCX 3MHVA 2CPSA 4GKGA 1ZRTD 3L73E 3H32A 3VMAA 1XTCC 1NTZJ 3IN6A 5AW7B 1VQ7P 4I2LC 1JUNA 1OMIA 2C9NY 2UWJE 1GZLA 2IDBA 3PHLA 3AE6C 2IBZD 4XA4A 3VP9A 1IFPA 1Z56A 2R5BA 2RKLA 5B5EE 2RH0A 3MP7B 1OW8A 1AV1A 3HTKA 1KYOE 1UIXA 3L70J 5KJ7D 2ZXXA 1X8YA 1HVVA 1PFIA 3L71G 4YTPC 3E7KA 1KILA 2D2CC 4D6TE 2H8PD 3BCCD 2YXQB 3SWYA 5GTIH 4PJ0E 4C7RA 1KB9I 2O3JA 3I56P 1IO4A 1SQQG 4BXLA 1KQSO 2C9LY 4DOJA 1CI6A 1GU5A 2A06D 3RBZA 3UIAA 1YQ3C 4DCKA 1GDTA 5GTHH 1AA0A 3H1JE 1NU1J 1T6AA 1USEA 4EYYQ 5BU8B 2WTYA 1H0TA 3RBXA 2WQYC 1R8EA 1AJYA 5AW4B 4K35A 5AW9B 1JTHB 4L75A 2O01J 4ZMDA 3AEAC 1IZNB 2E74D 5AVVB 1VF5C 5EFWB 1S5LH 1LGHB 3FWNA 4UB8H 2Y9ZA 1SQQD 2P1JA 2OTKE 2ZT9B 1LTJA 1N7SB 3M91A 3S1KA 1JEKA 3CCVP 2JWAA 2KP8A 1GW4A 1EDLA 1NH4A 1YYCA 1G1JA 2LR2A 3BCCJ 3MTUE 3CCJP 3JCUH 1K04A 5KAIH 2IZ1A 3TNUA 1KB9H 1L2PA 2N1TB 3A0BE 3QH9A 1NTZK 1SQVK 1NTMD 3EFGA 1E79H 2FXMA 2JO1A 3B71A 3GHGC 4JBZA 3USSA 1NTZE 1NU1K 5KLVJ 1USDA 1NWQA 3H1HG 1RH5B 1L4AC 1LWUC 4H44D 2H89C 3P8MC 4RO0A 1DIPA 2FYNC 2A45H 4IL6X 4HKZH 1NTME 1GL2C 3KZIH 5CBNA 1QL2A 3TGUE 3CCEP 1BE3E 2E74B 1NTZD 3AE2C 1JB0J 2JP3A 2Q1KA 5L8RJ 4ASWA 1EXIA 1URQC 2OYOA 5TISH 1WT6A 4RKUJ 3V2PA 2M8RA 2QJYC 2QJKC 1S2EA 4OH8B 1IK9A 1DD4A 1G2CA 2E74C 5APYA 3TGUD 4XFJA 2V7QJ 4I1LA 4PD4H 1NOHA 2FYNB 1RHZB 2R32A 1DX7A 2WPRA 2H7HA 1P84H 1WRGA 3H1ID 2CPBA 3FX0A 2WT7B 1YI2P 1SQXD 2FYZA 3H1LG 2K88A 2A06G 2QG4A 1PGOA 1KMIZ 3AE8C 3G9RA 4WWIA 3H1JJ 3CX5H 1OVVA 2QM8A 3M9HA 4MN4C 4Y99B 2ZVNB 1U7MA 1FBMA 3A0HH 2KI7B 1KV4A 3ABVC 3GG2A 1NGMB 1R5LA 1L0LD 5TJHA 4LLHA 3T97B 3CCUP 4I6MC 1FZCB 2A45I 1URQA 1JY3P 1LT9A 1KYOI 1Q81Q 3L72G 4XE5B 2GUSA 4WB4A 5AW5B 4N78D 4RESB 5KLIC 4PD4D 2D2CD 3L74G 1SQQJ 2Q6QA 2KUBA 3G6EP 1VQKP 2W90A 2I1JA 2E75D 3CLQA 2OTLP 2O1KA 1CW5A 1L4AB 2OQQA 4IL6H 2JEEA 3JCUE 3MUDA 2Q7CA 1MZ9A 1SQPJ 4PD4I 4R4MA 3M0DC 1T8ZA 1PP9G 3PP5A 4U3FG 5E79E 3AEGC 1P84I 1J1EB 2IBZE 2DW3A 1NTZG 2KLUA 3KDPB 3CC7P 1HGZA 2IFNA 2LKMA 1G2CB 1EC5A 3H1KJ 3AEEC 3CMAP 1K8AQ 1FOSF 1ZOYC 4IFDK 1SQXK 3CX5I 1RF1A 5CJ4A 1BCCJ 1JCCA 4UB6E 3Q5RA 1JM0A 1NTKG 2AEJA 4W7YA 1NTKE 1ZRTE 2KLVA 1EZVE 1Q2NA 2FXPA 3L35A 5AW3B 3RK3C 2Q9IA 5KAFE 2FYUD 1VQ9P 1FDMA 4H13B 2G3AA 3L71J 3Q5SA 2OYIC 2KS1B 1L0LJ 2AXCA 1DEEG 2WSSH 2A06E 1CSBA 3L70G 3V2QA 1NAFA 5B66E 1ZW0A 5BVZA 3CMEP 4BRYA 1NTKD 1Q90D 1NTMG 3BATA 2QJPB 3HE4B 1BDDA 1PV3A 2AXTE 3H1JD 3RGUA 1S9KE 3S4RA 2BCCJ 3Q5PA 5M1BA 2PFXA 3MD0A 2OYHA 4CPGA 2C0WA 1OX3A 3HD7D 5APXA 1FJPA 1KTMA 2E76C 1GL2D 1RF1C 1NYHA 1Q82Q 2WMMA 3PH0A 1S9KD 2B87A 1YJWP 3VYIA 1KFNA 5KTBA 2IX7C 2ZYAA 3GHGA 3RK3E 2YKOA 4KT0J 3Q1MA 1IFDA 1ZR4A 1Q7YQ 2Z4EA 5KAIE 2YMKA 1JY2P 2H43A 1UIIA 3WU2H 4C7NA 3TSIA 3HD7A 3AEDC 3RK3D 2WSFJ 3V2RA 3L72J 1S5LX 1AVOA 1OW6A 2N9YB 2Y0EA 5CHXA 3MGNA 4AQRD 1VQNP 3FGAD 1BGYD 1AVYA 1SFCB 1JMBA 4R4LA 1KQFB 3WUUA 2R3CA 5E79H 5KLVG 3BVHA 5BU5A 1BE3G 1EDIA 2WSEH 1BE3D 2NRGA 2KXPB 1BSNA 1FDIA 2K9JA 3TK1A 3CCLP 1NHLA 4DZOA 4O9BA 2FYUG 1SP4A 1KZUB 1X22A 1IFMA 3CXHE 1BGYG 1HUCA 3KQGA 3H1HJ 3L4FA 2KNCB 5DJUB 3V4WA 4GIFA 2HPCB 2QVAA 1QLED 1N8RQ 4M3LA 1SQPE 1K9MQ 2OTJP 4Y99C 1AFOA 4H13D 1PIXA 4PV1D 2Y0DA 2IBZG 4WY4C 1L0LK 1FS0E 2C0XA 3II6A 2E75C 3TNUB 2P2UA 2WSCH 3H1IE 4EIJA 1FZGA 3H1IG 2YMYA 3RK2D 1MFZA 1LT9C 3PRJA 3HRNA 1T3JA 3CWBJ 3AE5C 4U3FD 3A0HE 2P7JA 2FY8A 2XNXA 5AVQB 2OYHB 2M3BA 1NTMK 3NMDA 2QJYB 1HGVA 1PGJA 3A5TA 1W2BO 2OGUA 1NKZB 4L76A 1BCCG 1KQGB 5AVUB 2HPCA 2XKMA 1FZAA 1RE4C 1SQVJ 5CCHC 3U59A 1HF9A 3U1CA 2Y0CA 3H1JG 2ZYDA 1YJ9P 1H88A 1X79B 4I7ZC 4PV1B 1PPJG 1L4AD 1L0LG 1RF1B 3H1LE 2BCCE 3D6YA 1JY2N 2A45G 1DH3A 1JY3O 3F89A 2WT7A 4A7PA 3I55P 3BRVB 4WY4D 2WSCJ 1GW3A 1HH0A 2IPPA 1G1IA 4JQ0D 4OVNF 2HODB 3VMZA 3RL0B 4DT0A 1SQXJ 2AXTH 3C9IA 2Z5IA 1QVFO 1SFCA 3N4XA 1E5WA 2HLOA 4TLFA 5TISE 3RK2C 1L4AA 1EXJA 5KLVK 2E43A 2W8ZA 3A0BH 1LP1B 3HE5B 4H0LC 1NVOA 1PP9J 3MIWA 4U3FJ 3RK3B 1EZVG 2YIUC 3CC2P 3JSVC 1IK7A 1AQ5A 1JMMA 2KNCA 5KLIB 3D6ZA 2P67A 4LGDE 4OGQC 3KPEA 3AEFC 2BEQD 1LTAC 1X0TA 1X9VA 2YKPA 3RK2B 3V5BA 2JWDA 1JY2O 1JNMA 5AW0B 3WU2E 5KLVE 2N9BA 2WPSA 1R5SA 1J2JB 1RE3C 1ZP0C 1KD1Q 5AVSB 1L0NG 2BEZF 3G71P 1KQLA 1RF0A 1CZQA 1N7SC 1NTMJ 2L5GB 3G3ZA 1BE3J 2E76B 5KKZB 3L71D 1H89A 1QGKB 4BRYB 2ZT9D 3OAKA 2K3RA 3MUDC 1BGYJ 2HYNA 1WMKA 2NZ2A 2WSEJ 1JO5A 1D7MA 1K05A 1LJ2A 3B5ND 4H44C 3VTPC 2R44A 1BCCD 2BCCG 1SS1A 3CXHH 2QJPC 3HTKB 3ITKA 1K73Q 3L70E 1RY3A 4L74A 5GTHE 1VQ6P 4PJ0H 1J1DC 2POHA 3A3YB 1OXZA 3EFFK 3EQ2A 2QA4P 2GA1A 3G4SP 4H44B 2V4HA 3AE1C 3L36A 1YJNP 1OVRA 5APQA 1FE6A 1VL2A 3AECC 1PP9D 1YIJP 4K3AA 5CBOA 1LWUB 1LTSC 2HODA 1LTJB 1EQ7A 1N7SA 3WMM0 1RE3A 1NKNA 2CK3H 2IZ0A 1RQUA 4I7ZB 4C7NB 2RN0A 3L73G 1LWUA 2W6JH 5H2FE 3H25A 3NXSA 4L73A 4HH2A 4JYBA 3CXHD 1KILD 2ZVOB 1NJIQ 1OWAA 1FZEA 1S3JA 1TU3F 3WUTA 4N6JA 1S5LE 4U7JA 3F5HA 1SQBD 2E5YA 1HJBA 2ZT9C 1N86A 2VRSA 1VQMP 4HB1A 4BWNA 1U7JA 4AYCA 3CXHI 2P58A 3IR9A 4D6TG 1JY3N 1FZCA 3MZWB 5CMZA 1L0ND 2FYUJ 2YIUB 3GW6A 1M56D 4W80A 1LTBC 3KYQA 3P8CE 1RF0C 3SFDC 1M57D 2GM4A 1SQVD 3E1RA 2W6AA 3FXEA 1LTTC 3H6PA 3OJAB 4TT3H 1NTKK 2J59M 2YNYA 1LP1A 3U1AA 3ZDMA 4ASVA 1GTWA 2KB7P 3HUSA 1KYOD 2N1TC 3CWBG 3P8CD 1YTZT 3H1KD 4ZNCA 1KC8Q 2J5UA 1FJKA 1YHQP 1SQPG 1FU1A 2KZJA 3L74E 2FFDC 1QL1A 1W5CE 4C46A 3D70A 2WPQA 3BRTB 2M5AA 1L0LE 1ZV8A 2NPSC 1RQVA 1DD3A 1N7LA 3H1KE 2PRRA 1DEBA 3H1KG 1M8OB 3C1LA 5APUA 3CX5E 1SFCC 2BCCD 3CL3D 3L75J 3NFQA 2PAJA 3TYYA 1S4XA 3L74D 2JJLA 1Y9BA 5C39A 2OYHC 4QMAA 2M0BA 3CCSP 2Q3IA 1NTKJ 3GF3A 1N73B 1FZCC 4JYCA 1VQOP 1S72P 2FFDA 3M0DA 3GLMA 1BDCA 1ZMEC 1N7SD 1Y47A 2HR3A 3BASA 4H13C 1LTGC 3KZIE 1LNQA 1YBKA 1XTGB 2AEMA 3M06A 3CCRP 3L37A 1Q86Q 1SQBG 3HUSC 2ZAEB 2N1TD 1LTJC 3H1LD 1H8AA 3AE7C 1SQXG 3B5NC 2QRXA 3HUSB 4GT1A 1M7LA 3FXDA 2WSFH 5KJ7A 3V2NA 5CJ0A 2FKWB 2J58A 1GU4A 4B86A 4HYTB 3W68A 2MKVA 2O1JA 1OW7A 2FYUK 1EZVD 2B9BA 3HE5A 3QWOC 5AVXB 1PZQA 1VQPP 1NU1D 2FYUE 2E42A 3RL0D 2XNDH 1N73C 2Z5HA 5AW1B 2Q3EA 3P32A 2XZRA 1MV8A 2L91A 2O01N 3C8VA 5CCHD 3D71A 1VF5D 2ZYGA 3B4SA 1GL2B 2MJZA 2RMZA 3FWLA 3CC4P 1KFMA 1NU1E 1PPJE 4WY4A 2WVRA 2NPSB 2XU6A 5KKZC 3VN0A 3M9QA 3VMXA 3CCMP 1EDJA 1L0NJ 1VQ8P 2FFDB 1IFNA 4ZKUA 1JCDA 4WY4B 5KLVD 1N73A 3L70D 3KXDA 4IFFA 4JPZB 1PPJD 2BASA 2IFMA 1S1CX 1M1JB 3WUVA 3SWKA 3B8EB 3I5CA 4YXWH 5KJ7C 3L72E 3T97A 3LW5J 4JF7A 5AVRB 3M9BA 2OARA 3L71E 1M1JA 1YQ4C 1SQBK 3H32B 3OA7A 4H0LD 4OGQB 2QE7H 1MKMA 5DJTB 4PV1C 1FDOA 5CCGD 2KOGA 3KHUA 1BSHA 3GMAA 1P84D 1KYOH 2KSEA 2YXRB 1BCCE 4OGQD 2K9YA 1CI6B 5AVZB 1QEXA 2K1AA 2M5AB 5AW2B 1FOSE 4N3YB 4N78E 3OW2O 3Q3DA 2M3EA 3L75E 2R3SA 3O8ZA 3CPWO 2HFED 3L73J 4UB6H 4W7ZA 1PGPA 1SQBE 1JOCA 2R5DA 2YO3A 3CCQP 1NO4A 3AE4C 4GOEA 3PTZA 2B88A 5KAFH 5APTA 2QIWA 2WZ7A 3RL0g 4D6TD 1YTZI 3LIDA 1QX8A 2JR8A 2V7QH 2ZXEB 4GODA 4UB8E 2K9JB 2K37A 1SQVE 2LXCB 3TDKA 3A7OA 1SQVG 1ZN5A 2YO2A 5AVWB 1IFIA 2YKQA 4Z1MH 1NAYA 1H0TB 1EDKA 1KN7A 3V6IA 1IJDB 2QEXP 1FAVA 2E5TA 2PGDA 1GMJA 2QSIA 2QJKB 4IFMA 2W27A 1LT1A 1KB9D 2B87B 2WPVB 4U3FE 5APWA 5CCGC 3CI9A 4AUWA 4WBAA 1RE4A 1IFJA 2O01H 2FBWC 3EWKA 4IOIH 1AQTA 2JDIH 3IAOA 2KYVA 4IL6E 5APVA 1L0NE 3S9OA 3SSUA 1FZFA 1EZVI 3PJSK 1VPCA 2XV5A 1LT9B 2IYOA 3IFMA 1T2KC 1VQLP 1KB9E 4YPCA 3CX5D 3BCCE 2W6BA 4DJGA 3TGUG 4GDOA 1HJ0A 3W67A 5GTIE 1KILB 1SQQE 3O6QA 1VQ4P 1NU1G 1URQD 2WITA 3RL0C
chains in the Genus database with same CATH topology
5DJUB 4ZNCA 2QVAA 2KZJA 4JBZA 5K5GB 2M5AA 2KZIA 4HKZH 5C39A 5CBNA 2LXBA 2Q1KA 4ASWA 2M0BA 4HJGH 1FC2C 1BDCA 1Y47A 2HR3A 2ZAEB 2QRXA 3FXDA 4WWIA 4MN4C 1OVVA 1U7MA 4NPEA 2KI7B 2SPZA 3QWOC 2B89A 1LP1B 1NVOA 2KUBA 4NPFX 1ZXGA 4KJMA 2KIKA 4NPDA 1EDJA 2I8DA 1X0TA 2JWDA 1OVUA 1EC5A 1MFTA 4GOFA 1JM0A 5DJTB 1Q2NA 3MHVA 2K3RA 2KS1B 2M5AB 1DEEG 2R44A 1SS1A 2UWJE 1ZW0A 2RKLA 1BDDA 3RGUA 4GOEA 2B88A 1OVRA 4CPGA 4K3AA 5CBOA 4GODA 1H0TA 2LXCB 2WMMA 3PH0A 2B87A 4BXLA 1EDKA 1H0TB 1S3JA 1LT1A 2B87B 4EYYQ 4IOIH 4HB1A 1U7JA 4K35A 2P58A 3MZWB 4ZMDA 1JMBA 3FXEA 5EFWB 1EDIA 4ASVA 3ZDMA 1LP1A 2OTKE 3S1KA 1EDLA 2LR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DJU B;  4ZNC A;  2QVA A;  2KZJ A;  4JBZ A;  5K5G B;  2M5A A;  2KZI A;  4HKZ H;  5C39 A;  5CBN A;  2LXB A;  2Q1K A;  4ASW A;  2M0B A;  4HJG H;  1FC2 C;  1BDC A;  1Y47 A;  2HR3 A;  2ZAE B;  2QRX A;  3FXD A;  4WWI A;  4MN4 C;  1OVV A;  1U7M A;  4NPE A;  2KI7 B;  2SPZ A;  3QWO C;  2B89 A;  1LP1 B;  1NVO A;  2KUB A;  4NPF X;  1ZXG A;  4KJM A;  2KIK A;  4NPD A;  1EDJ A;  2I8D A;  1X0T A;  2JWD A;  1OVU A;  1EC5 A;  1MFT A;  4GOF A;  1JM0 A;  5DJT B;  1Q2N A;  3MHV A;  2K3R A;  2KS1 B;  2M5A B;  1DEE G;  2R44 A;  1SS1 A;  2UWJ E;  1ZW0 A;  2RKL A;  1BDD A;  3RGU A;  4GOE A;  2B88 A;  1OVR A;  4CPG A;  4K3A A;  5CBO A;  4GOD A;  1H0T A;  2LXC B;  2WMM A;  3PH0 A;  2B87 A;  4BXL A;  1EDK A;  1H0T B;  1S3J A;  1LT1 A;  2B87 B;  4EYY Q;  4IOI H;  4HB1 A;  1U7J A;  4K35 A;  2P58 A;  3MZW B;  4ZMD A;  1JMB A;  3FXE A;  5EFW B;  1EDI A;  4ASV A;  3ZDM A;  1LP1 A;  2OTK E;  3S1K A;  1EDL A;  2LR2 A; 
#chains in the Genus database with same CATH topology
 3V4Q A;  1SQP K;  2Y9Y A;  3E1I A;  1L0N K;  3R4Y A;  3B5N A;  1HTL C;  4LC1 A;  1PL5 A;  3O6Q B;  3VOP A;  4KHX A;  2JKV A;  5CCG A;  3L75 G;  5B5E H;  3GF7 A;  4ZKP A;  2W83 C;  5AVY B;  3K5B A;  3M0A A;  5K5G B;  2G8Y A;  3B5N B;  4RJT A;  1SLQ A;  3SWF A;  1OIP A;  2WWW A;  2P10 A;  2IYP A;  1FZB A;  1W2E A;  2KS1 A;  3LIE A;  4YXD C;  2KZI A;  1GK4 A;  1LTI C;  1PGQ A;  4H0L B;  1SQB J;  1VDF A;  2GUV A;  4EOT A;  2LXB A;  4HJG H;  3AEB C;  1YIT P;  3Q2Y A;  3N7N A;  3IF4 A;  1J1D B;  5AVT B;  2ZJS E;  2ITA A;  3CWB E;  1BGY E;  1URQ B;  1A02 F;  1FC2 C;  4EDF A;  1JTH A;  2KK7 A;  3AE9 C;  3HD7 C;  2OYI B;  2E76 D;  4WVZ A;  3LW5 H;  4OWF A;  1Y8A A;  3P7K A;  1SQQ K;  3JC2 2;  1ZLL A;  2OYI A;  2NPS D;  1SVF A;  3CWB D;  3SFE C;  2AEF A;  2D2C B;  2E75 B;  3R2P A;  1IC2 A;  1VQ5 P;  1QVG O;  1SQX E;  1SFC D;  1GK6 A;  2XDJ A;  1M1K Q;  4EI2 A;  4Y28 J;  1SQP D;  2PP6 A;  5B66 H;  1T3U A;  1HWT C;  1M1J C;  2H88 C;  2KSJ A;  3HD7 B;  4NPE A;  2ZFC A;  2N1T A;  5AW8 B;  1GL2 A;  2SPZ A;  3H1L J;  5H2F H;  1M90 Q;  3H1H D;  2NPS A;  1KIL C;  1N2D C;  2Q5U A;  3BCC G;  3L72 D;  2B89 A;  5AW6 B;  1ZR2 A;  1VF5 B;  3AE3 C;  4PD4 E;  2FXO A;  4NPF X;  1ZXG A;  4KJM A;  2KIK A;  1A02 J;  3H1H E;  4NPD A;  5APS A;  1OZH A;  3NTN A;  3VP8 A;  3TF5 A;  1MUU A;  2I8D A;  2I1K A;  2QM7 A;  1PP9 E;  3GHG B;  4D6T J;  3L74 J;  1GD2 E;  1OVU A;  3L75 D;  5CCH A;  3HE4 A;  1U57 A;  1HBW A;  3H1I J;  3A2A A;  1J1E C;  1MFT A;  3L73 D;  3VMY A;  3CD6 P;  1KOR A;  1T2K D;  3PLN A;  1KIL E;  3TGU J;  2HG5 D;  4GOF A;  1P84 E;  2IBZ I;  1OFC X;  3MHV A;  2CPS A;  4GKG A;  1ZRT D;  3L73 E;  3H32 A;  3VMA A;  1XTC C;  1NTZ J;  3IN6 A;  5AW7 B;  1VQ7 P;  4I2L C;  1JUN A;  1OMI A;  2C9N Y;  2UWJ E;  1GZL A;  2IDB A;  3PHL A;  3AE6 C;  2IBZ D;  4XA4 A;  3VP9 A;  1IFP A;  1Z56 A;  2R5B A;  2RKL A;  5B5E E;  2RH0 A;  3MP7 B;  1OW8 A;  1AV1 A;  3HTK A;  1KYO E;  1UIX A;  3L70 J;  5KJ7 D;  2ZXX A;  1X8Y A;  1HVV A;  1PFI A;  3L71 G;  4YTP C;  3E7K A;  1KIL A;  2D2C C;  4D6T E;  2H8P D;  3BCC D;  2YXQ B;  3SWY A;  5GTI H;  4PJ0 E;  4C7R A;  1KB9 I;  2O3J A;  3I56 P;  1IO4 A;  1SQQ G;  4BXL A;  1KQS O;  2C9L Y;  4DOJ A;  1CI6 A;  1GU5 A;  2A06 D;  3RBZ A;  3UIA A;  1YQ3 C;  4DCK A;  1GDT A;  5GTH H;  1AA0 A;  3H1J E;  1NU1 J;  1T6A A;  1USE A;  4EYY Q;  5BU8 B;  2WTY A;  1H0T A;  3RBX A;  2WQY C;  1R8E A;  1AJY A;  5AW4 B;  4K35 A;  5AW9 B;  1JTH B;  4L75 A;  2O01 J;  4ZMD A;  3AEA C;  1IZN B;  2E74 D;  5AVV B;  1VF5 C;  5EFW B;  1S5L H;  1LGH B;  3FWN A;  4UB8 H;  2Y9Z A;  1SQQ D;  2P1J A;  2OTK E;  2ZT9 B;  1LTJ A;  1N7S B;  3M91 A;  3S1K A;  1JEK A;  3CCV P;  2JWA A;  2KP8 A;  1GW4 A;  1EDL A;  1NH4 A;  1YYC A;  1G1J A;  2LR2 A;  3BCC J;  3MTU E;  3CCJ P;  3JCU H;  1K04 A;  5KAI H;  2IZ1 A;  3TNU A;  1KB9 H;  1L2P A;  2N1T B;  3A0B E;  3QH9 A;  1NTZ K;  1SQV K;  1NTM D;  3EFG A;  1E79 H;  2FXM A;  2JO1 A;  3B71 A;  3GHG C;  4JBZ A;  3USS A;  1NTZ E;  1NU1 K;  5KLV J;  1USD A;  1NWQ A;  3H1H G;  1RH5 B;  1L4A C;  1LWU C;  4H44 D;  2H89 C;  3P8M C;  4RO0 A;  1DIP A;  2FYN C;  2A45 H;  4IL6 X;  4HKZ H;  1NTM E;  1GL2 C;  3KZI H;  5CBN A;  1QL2 A;  3TGU E;  3CCE P;  1BE3 E;  2E74 B;  1NTZ D;  3AE2 C;  1JB0 J;  2JP3 A;  2Q1K A;  5L8R J;  4ASW A;  1EXI A;  1URQ C;  2OYO A;  5TIS H;  1WT6 A;  4RKU J;  3V2P A;  2M8R A;  2QJY C;  2QJK C;  1S2E A;  4OH8 B;  1IK9 A;  1DD4 A;  1G2C A;  2E74 C;  5APY A;  3TGU D;  4XFJ A;  2V7Q J;  4I1L A;  4PD4 H;  1NOH A;  2FYN B;  1RHZ B;  2R32 A;  1DX7 A;  2WPR A;  2H7H A;  1P84 H;  1WRG A;  3H1I D;  2CPB A;  3FX0 A;  2WT7 B;  1YI2 P;  1SQX D;  2FYZ A;  3H1L G;  2K88 A;  2A06 G;  2QG4 A;  1PGO A;  1KMI Z;  3AE8 C;  3G9R A;  4WWI A;  3H1J J;  3CX5 H;  1OVV A;  2QM8 A;  3M9H A;  4MN4 C;  4Y99 B;  2ZVN B;  1U7M A;  1FBM A;  3A0H H;  2KI7 B;  1KV4 A;  3ABV C;  3GG2 A;  1NGM B;  1R5L A;  1L0L D;  5TJH A;  4LLH A;  3T97 B;  3CCU P;  4I6M C;  1FZC B;  2A45 I;  1URQ A;  1JY3 P;  1LT9 A;  1KYO I;  1Q81 Q;  3L72 G;  4XE5 B;  2GUS A;  4WB4 A;  5AW5 B;  4N78 D;  4RES B;  5KLI C;  4PD4 D;  2D2C D;  3L74 G;  1SQQ J;  2Q6Q A;  2KUB A;  3G6E P;  1VQK P;  2W90 A;  2I1J A;  2E75 D;  3CLQ A;  2OTL P;  2O1K A;  1CW5 A;  1L4A B;  2OQQ A;  4IL6 H;  2JEE A;  3JCU E;  3MUD A;  2Q7C A;  1MZ9 A;  1SQP J;  4PD4 I;  4R4M A;  3M0D C;  1T8Z A;  1PP9 G;  3PP5 A;  4U3F G;  5E79 E;  3AEG C;  1P84 I;  1J1E B;  2IBZ E;  2DW3 A;  1NTZ G;  2KLU A;  3KDP B;  3CC7 P;  1HGZ A;  2IFN A;  2LKM A;  1G2C B;  1EC5 A;  3H1K J;  3AEE C;  3CMA P;  1K8A Q;  1FOS F;  1ZOY C;  4IFD K;  1SQX K;  3CX5 I;  1RF1 A;  5CJ4 A;  1BCC J;  1JCC A;  4UB6 E;  3Q5R A;  1JM0 A;  1NTK G;  2AEJ A;  4W7Y A;  1NTK E;  1ZRT E;  2KLV A;  1EZV E;  1Q2N A;  2FXP A;  3L35 A;  5AW3 B;  3RK3 C;  2Q9I A;  5KAF E;  2FYU D;  1VQ9 P;  1FDM A;  4H13 B;  2G3A A;  3L71 J;  3Q5S A;  2OYI C;  2KS1 B;  1L0L J;  2AXC A;  1DEE G;  2WSS H;  2A06 E;  1CSB A;  3L70 G;  3V2Q A;  1NAF A;  5B66 E;  1ZW0 A;  5BVZ A;  3CME P;  4BRY A;  1NTK D;  1Q90 D;  1NTM G;  3BAT A;  2QJP B;  3HE4 B;  1BDD A;  1PV3 A;  2AXT E;  3H1J D;  3RGU A;  1S9K E;  3S4R A;  2BCC J;  3Q5P A;  5M1B A;  2PFX A;  3MD0 A;  2OYH A;  4CPG A;  2C0W A;  1OX3 A;  3HD7 D;  5APX A;  1FJP A;  1KTM A;  2E76 C;  1GL2 D;  1RF1 C;  1NYH A;  1Q82 Q;  2WMM A;  3PH0 A;  1S9K D;  2B87 A;  1YJW P;  3VYI A;  1KFN A;  5KTB A;  2IX7 C;  2ZYA A;  3GHG A;  3RK3 E;  2YKO A;  4KT0 J;  3Q1M A;  1IFD A;  1ZR4 A;  1Q7Y Q;  2Z4E A;  5KAI E;  2YMK A;  1JY2 P;  2H43 A;  1UII A;  3WU2 H;  4C7N A;  3TSI A;  3HD7 A;  3AED C;  3RK3 D;  2WSF J;  3V2R A;  3L72 J;  1S5L X;  1AVO A;  1OW6 A;  2N9Y B;  2Y0E A;  5CHX A;  3MGN A;  4AQR D;  1VQN P;  3FGA D;  1BGY D;  1AVY A;  1SFC B;  1JMB A;  4R4L A;  1KQF B;  3WUU A;  2R3C A;  5E79 H;  5KLV G;  3BVH A;  5BU5 A;  1BE3 G;  1EDI A;  2WSE H;  1BE3 D;  2NRG A;  2KXP B;  1BSN A;  1FDI A;  2K9J A;  3TK1 A;  3CCL P;  1NHL A;  4DZO A;  4O9B A;  2FYU G;  1SP4 A;  1KZU B;  1X22 A;  1IFM A;  3CXH E;  1BGY G;  1HUC A;  3KQG A;  3H1H J;  3L4F A;  2KNC B;  5DJU B;  3V4W A;  4GIF A;  2HPC B;  2QVA A;  1QLE D;  1N8R Q;  4M3L A;  1SQP E;  1K9M Q;  2OTJ P;  4Y99 C;  1AFO A;  4H13 D;  1PIX A;  4PV1 D;  2Y0D A;  2IBZ G;  4WY4 C;  1L0L K;  1FS0 E;  2C0X A;  3II6 A;  2E75 C;  3TNU B;  2P2U A;  2WSC H;  3H1I E;  4EIJ A;  1FZG A;  3H1I G;  2YMY A;  3RK2 D;  1MFZ A;  1LT9 C;  3PRJ A;  3HRN A;  1T3J A;  3CWB J;  3AE5 C;  4U3F D;  3A0H E;  2P7J A;  2FY8 A;  2XNX A;  5AVQ B;  2OYH B;  2M3B A;  1NTM K;  3NMD A;  2QJY B;  1HGV A;  1PGJ A;  3A5T A;  1W2B O;  2OGU A;  1NKZ B;  4L76 A;  1BCC G;  1KQG B;  5AVU B;  2HPC A;  2XKM A;  1FZA A;  1RE4 C;  1SQV J;  5CCH C;  3U59 A;  1HF9 A;  3U1C A;  2Y0C A;  3H1J G;  2ZYD A;  1YJ9 P;  1H88 A;  1X79 B;  4I7Z C;  4PV1 B;  1PPJ G;  1L4A D;  1L0L G;  1RF1 B;  3H1L E;  2BCC E;  3D6Y A;  1JY2 N;  2A45 G;  1DH3 A;  1JY3 O;  3F89 A;  2WT7 A;  4A7P A;  3I55 P;  3BRV B;  4WY4 D;  2WSC J;  1GW3 A;  1HH0 A;  2IPP A;  1G1I A;  4JQ0 D;  4OVN F;  2HOD B;  3VMZ A;  3RL0 B;  4DT0 A;  1SQX J;  2AXT H;  3C9I A;  2Z5I A;  1QVF O;  1SFC A;  3N4X A;  1E5W A;  2HLO A;  4TLF A;  5TIS E;  3RK2 C;  1L4A A;  1EXJ A;  5KLV K;  2E43 A;  2W8Z A;  3A0B H;  1LP1 B;  3HE5 B;  4H0L C;  1NVO A;  1PP9 J;  3MIW A;  4U3F J;  3RK3 B;  1EZV G;  2YIU C;  3CC2 P;  3JSV C;  1IK7 A;  1AQ5 A;  1JMM A;  2KNC A;  5KLI B;  3D6Z A;  2P67 A;  4LGD E;  4OGQ C;  3KPE A;  3AEF C;  2BEQ D;  1LTA C;  1X0T A;  1X9V A;  2YKP A;  3RK2 B;  3V5B A;  2JWD A;  1JY2 O;  1JNM A;  5AW0 B;  3WU2 E;  5KLV E;  2N9B A;  2WPS A;  1R5S A;  1J2J B;  1RE3 C;  1ZP0 C;  1KD1 Q;  5AVS B;  1L0N G;  2BEZ F;  3G71 P;  1KQL A;  1RF0 A;  1CZQ A;  1N7S C;  1NTM J;  2L5G B;  3G3Z A;  1BE3 J;  2E76 B;  5KKZ B;  3L71 D;  1H89 A;  1QGK B;  4BRY B;  2ZT9 D;  3OAK A;  2K3R A;  3MUD C;  1BGY J;  2HYN A;  1WMK A;  2NZ2 A;  2WSE J;  1JO5 A;  1D7M A;  1K05 A;  1LJ2 A;  3B5N D;  4H44 C;  3VTP C;  2R44 A;  1BCC D;  2BCC G;  1SS1 A;  3CXH H;  2QJP C;  3HTK B;  3ITK A;  1K73 Q;  3L70 E;  1RY3 A;  4L74 A;  5GTH E;  1VQ6 P;  4PJ0 H;  1J1D C;  2POH A;  3A3Y B;  1OXZ A;  3EFF K;  3EQ2 A;  2QA4 P;  2GA1 A;  3G4S P;  4H44 B;  2V4H A;  3AE1 C;  3L36 A;  1YJN P;  1OVR A;  5APQ A;  1FE6 A;  1VL2 A;  3AEC C;  1PP9 D;  1YIJ P;  4K3A A;  5CBO A;  1LWU B;  1LTS C;  2HOD A;  1LTJ B;  1EQ7 A;  1N7S A;  3WMM 0;  1RE3 A;  1NKN A;  2CK3 H;  2IZ0 A;  1RQU A;  4I7Z B;  4C7N B;  2RN0 A;  3L73 G;  1LWU A;  2W6J H;  5H2F E;  3H25 A;  3NXS A;  4L73 A;  4HH2 A;  4JYB A;  3CXH D;  1KIL D;  2ZVO B;  1NJI Q;  1OWA A;  1FZE A;  1S3J A;  1TU3 F;  3WUT A;  4N6J A;  1S5L E;  4U7J A;  3F5H A;  1SQB D;  2E5Y A;  1HJB A;  2ZT9 C;  1N86 A;  2VRS A;  1VQM P;  4HB1 A;  4BWN A;  1U7J A;  4AYC A;  3CXH I;  2P58 A;  3IR9 A;  4D6T G;  1JY3 N;  1FZC A;  3MZW B;  5CMZ A;  1L0N D;  2FYU J;  2YIU B;  3GW6 A;  1M56 D;  4W80 A;  1LTB C;  3KYQ A;  3P8C E;  1RF0 C;  3SFD C;  1M57 D;  2GM4 A;  1SQV D;  3E1R A;  2W6A A;  3FXE A;  1LTT C;  3H6P A;  3OJA B;  4TT3 H;  1NTK K;  2J59 M;  2YNY A;  1LP1 A;  3U1A A;  3ZDM A;  4ASV A;  1GTW A;  2KB7 P;  3HUS A;  1KYO D;  2N1T C;  3CWB G;  3P8C D;  1YTZ T;  3H1K D;  4ZNC A;  1KC8 Q;  2J5U A;  1FJK A;  1YHQ P;  1SQP G;  1FU1 A;  2KZJ A;  3L74 E;  2FFD C;  1QL1 A;  1W5C E;  4C46 A;  3D70 A;  2WPQ A;  3BRT B;  2M5A A;  1L0L E;  1ZV8 A;  2NPS C;  1RQV A;  1DD3 A;  1N7L A;  3H1K E;  2PRR A;  1DEB A;  3H1K G;  1M8O B;  3C1L A;  5APU A;  3CX5 E;  1SFC C;  2BCC D;  3CL3 D;  3L75 J;  3NFQ A;  2PAJ A;  3TYY A;  1S4X A;  3L74 D;  2JJL A;  1Y9B A;  5C39 A;  2OYH C;  4QMA A;  2M0B A;  3CCS P;  2Q3I A;  1NTK J;  3GF3 A;  1N73 B;  1FZC C;  4JYC A;  1VQO P;  1S72 P;  2FFD A;  3M0D A;  3GLM A;  1BDC A;  1ZME C;  1N7S D;  1Y47 A;  2HR3 A;  3BAS A;  4H13 C;  1LTG C;  3KZI E;  1LNQ A;  1YBK A;  1XTG B;  2AEM A;  3M06 A;  3CCR P;  3L37 A;  1Q86 Q;  1SQB G;  3HUS C;  2ZAE B;  2N1T D;  1LTJ C;  3H1L D;  1H8A A;  3AE7 C;  1SQX G;  3B5N C;  2QRX A;  3HUS B;  4GT1 A;  1M7L A;  3FXD A;  2WSF H;  5KJ7 A;  3V2N A;  5CJ0 A;  2FKW B;  2J58 A;  1GU4 A;  4B86 A;  4HYT B;  3W68 A;  2MKV A;  2O1J A;  1OW7 A;  2FYU K;  1EZV D;  2B9B A;  3HE5 A;  3QWO C;  5AVX B;  1PZQ A;  1VQP P;  1NU1 D;  2FYU E;  2E42 A;  3RL0 D;  2XND H;  1N73 C;  2Z5H A;  5AW1 B;  2Q3E A;  3P32 A;  2XZR A;  1MV8 A;  2L91 A;  2O01 N;  3C8V A;  5CCH D;  3D71 A;  1VF5 D;  2ZYG A;  3B4S A;  1GL2 B;  2MJZ A;  2RMZ A;  3FWL A;  3CC4 P;  1KFM A;  1NU1 E;  1PPJ E;  4WY4 A;  2WVR A;  2NPS B;  2XU6 A;  5KKZ C;  3VN0 A;  3M9Q A;  3VMX A;  3CCM P;  1EDJ A;  1L0N J;  1VQ8 P;  2FFD B;  1IFN A;  4ZKU A;  1JCD A;  4WY4 B;  5KLV D;  1N73 A;  3L70 D;  3KXD A;  4IFF A;  4JPZ B;  1PPJ D;  2BAS A;  2IFM A;  1S1C X;  1M1J B;  3WUV A;  3SWK A;  3B8E B;  3I5C A;  4YXW H;  5KJ7 C;  3L72 E;  3T97 A;  3LW5 J;  4JF7 A;  5AVR B;  3M9B A;  2OAR A;  3L71 E;  1M1J A;  1YQ4 C;  1SQB K;  3H32 B;  3OA7 A;  4H0L D;  4OGQ B;  2QE7 H;  1MKM A;  5DJT B;  4PV1 C;  1FDO A;  5CCG D;  2KOG A;  3KHU A;  1BSH A;  3GMA A;  1P84 D;  1KYO H;  2KSE A;  2YXR B;  1BCC E;  4OGQ D;  2K9Y A;  1CI6 B;  5AVZ B;  1QEX A;  2K1A A;  2M5A B;  5AW2 B;  1FOS E;  4N3Y B;  4N78 E;  3OW2 O;  3Q3D A;  2M3E A;  3L75 E;  2R3S A;  3O8Z A;  3CPW O;  2HFE D;  3L73 J;  4UB6 H;  4W7Z A;  1PGP A;  1SQB E;  1JOC A;  2R5D A;  2YO3 A;  3CCQ P;  1NO4 A;  3AE4 C;  4GOE A;  3PTZ A;  2B88 A;  5KAF H;  5APT A;  2QIW A;  2WZ7 A;  3RL0 g;  4D6T D;  1YTZ I;  3LID A;  1QX8 A;  2JR8 A;  2V7Q H;  2ZXE B;  4GOD A;  4UB8 E;  2K9J B;  2K37 A;  1SQV E;  2LXC B;  3TDK A;  3A7O A;  1SQV G;  1ZN5 A;  2YO2 A;  5AVW B;  1IFI A;  2YKQ A;  4Z1M H;  1NAY A;  1H0T B;  1EDK A;  1KN7 A;  3V6I A;  1IJD B;  2QEX P;  1FAV A;  2E5T A;  2PGD A;  1GMJ A;  2QSI A;  2QJK B;  4IFM A;  2W27 A;  1LT1 A;  1KB9 D;  2B87 B;  2WPV B;  4U3F E;  5APW A;  5CCG C;  3CI9 A;  4AUW A;  4WBA A;  1RE4 A;  1IFJ A;  2O01 H;  2FBW C;  3EWK A;  4IOI H;  1AQT A;  2JDI H;  3IAO A;  2KYV A;  4IL6 E;  5APV A;  1L0N E;  3S9O A;  3SSU A;  1FZF A;  1EZV I;  3PJS K;  1VPC A;  2XV5 A;  1LT9 B;  2IYO A;  3IFM A;  1T2K C;  1VQL P;  1KB9 E;  4YPC A;  3CX5 D;  3BCC E;  2W6B A;  4DJG A;  3TGU G;  4GDO A;  1HJ0 A;  3W67 A;  5GTI E;  1KIL B;  1SQQ E;  3O6Q A;  1VQ4 P;  1NU1 G;  1URQ D;  2WIT A;  3RL0 C; 
#chains in the Genus database with same CATH homology
 5DJU B;  4ZNC A;  2QVA A;  2KZJ A;  4JBZ A;  5K5G B;  2M5A A;  2KZI A;  4HKZ H;  5C39 A;  5CBN A;  2LXB A;  2Q1K A;  4ASW A;  2M0B A;  4HJG H;  1FC2 C;  1BDC A;  1Y47 A;  2HR3 A;  2ZAE B;  2QRX A;  3FXD A;  4WWI A;  4MN4 C;  1OVV A;  1U7M A;  4NPE A;  2KI7 B;  2SPZ A;  3QWO C;  2B89 A;  1LP1 B;  1NVO A;  2KUB A;  4NPF X;  1ZXG A;  4KJM A;  2KIK A;  4NPD A;  1EDJ A;  2I8D A;  1X0T A;  2JWD A;  1OVU A;  1EC5 A;  1MFT A;  4GOF A;  1JM0 A;  5DJT B;  1Q2N A;  3MHV A;  2K3R A;  2KS1 B;  2M5A B;  1DEE G;  2R44 A;  1SS1 A;  2UWJ E;  1ZW0 A;  2RKL A;  1BDD A;  3RGU A;  4GOE A;  2B88 A;  1OVR A;  4CPG A;  4K3A A;  5CBO A;  4GOD A;  1H0T A;  2LXC B;  2WMM A;  3PH0 A;  2B87 A;  4BXL A;  1EDK A;  1H0T B;  1S3J A;  1LT1 A;  2B87 B;  4EYY Q;  4IOI H;  4HB1 A;  1U7J A;  4K35 A;  2P58 A;  3MZW B;  4ZMD A;  1JMB A;  3FXE A;  5EFW B;  1EDI A;  4ASV A;  3ZDM A;  1LP1 A;  2OTK E;  3S1K A;  1EDL A;  2LR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...