3RGVA

A single tcr bound to mhci and mhc ii reveals switchable tcr conformers
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
200
structure length
200
Chain Sequence
DSVTQMQGQVTLSENDFLFINCTYSTTGYPTLFWYVQYSGEGPQLLLQVTTANNKGSSRGFEATYDKGTTSFHLQKTSVQEIDSAVYYCAANSGTYQRFGTGTKLQVVPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Yae62 TCR a chain
publication title A Single T Cell Receptor Bound to Major Histocompatibility Complex Class I and Class II Glycoproteins Reveals Switchable TCR Conformers.
pubmed doi rcsb
source organism Mus musculus
total genus 36
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2011-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rgvA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rgvA01
1FNEB 3MRBA 1DVFD 5I1KL 2JB6A 3UTTB 1MHHB 1CXFA 2CKNA 5IFHL 3ARFA 2Q86A 1BJ8A 3RWFB 4LPVA 2YBRA 4H1LG 4UINL 2YA0A 5E6ID 2IMNA 4OCLC 1CZ8L 4XTRD 3QQ3B 3S36H 1C16B 1F3JB 1IVLA 5DR5L 3MV11 4F37F 5KSBA 5LVEA 1F45A 4KMTH 1AJ7L 2V5TA 5FA3B 1FVDA 2APTA 2F54D 2AI0H 1XAUA 2CK2A 1T0NA 4ZO7A 1JFQL 1M4KA 2G5BB 1AR2A 4WO4A 3U83A 5D1XC 5IIEA 3F7PC 2IWGA 2OJZL 5FKPB 4M8VA 4P5KA 4OFDA 3KDMA 4Y4FD 1MCSA 5FECA 1TQCC 4HW6A 4J3UA 5E2VH 3VI4F 4HLZH 5DFVD 5D1QC 3I50H 3WIFB 4Q9QH 3H3PL 5HYJE 1I7TA 2DWEB 5E2UL 1MOEA 5CKAA 3PWNA 4L8SA 4OM0H 5CMAB 4X83A 4U0QB 3G6JF 5C0ND 1Q9OB 3KLDA 3MJ8B 5MI0B 1RZ7L 3VFNB 2NZIA 1A2YA 4M61A 3JWOH 5DHVB 1OSPH 1KEMH 1KJ2L 1ZHKA 3ARDC 3QDMB 2H41A 4M7JL 4JDVA 1NAMH 2C26A 2FYYB 3QXUA 1I1CA 1T22A 5KVFH 2F53E 4POZC 3LH2L 1BF8A 2XTLA 2O5YH 1NEZG 3HC4L 4P0DA 4K23H 1F90L 4G8IB 4UB0L 4IMKA 3SDDC 4XBPA 2X4UA 2WSKA 4LCIH 5EWIH 3UTOA 3J7HA 4GXVL 5IKCA 3MODL 4WFEE 1PYWB 2DLFL 5I76A 5C09B 5JA9A 4MGXA 1U3YA 2H9GA 2WUCL 5E99L 4JRYA 5CJ8A 4KJPD 5C0RL 4OLXH 2UYLB 2GY5A 5DD5L 5BV7B 1UEYA 3NFPA 4RX4D 3X11A 4ZPTB 2FL5A 5AZ2H 3IDYB 1A6VL 5EO1A 5H37G 3FO2A 1MH5B 4UV4H 4BQBA 4AY0A 2OTWB 1U92A 1Y6MR 4U6XA 1U8KB 2AQ2A 2XV6B 2D2OA 4Z7UF 2DL2A 1FFQA 4YDVB 3EJZC 3KVQA 2ZUVA 4ZFFB 3O6KL 4YEFA 5E1HB 4AQ1B 1MJ8H 4XPAH 1QFWL 1N64H 3GBNH 4I0PA 1EEZA 5LKNA 3T4AA 1AI1H 1M7IA 4PRPB 5FYKD 3VCLA 2VDPH 3CDGB 1DUZB 4WJ5A 3CFCH 5GSRA 3NIGF 1I8KA 5FM4A 3C5ZA 4MXQD 4RWYH 3SY0A 3QPQC 4ZNEE 3RUGA 3IFNH 4X4XA 3QI9D 1G6VK 4JR9H 1ZTXL 4XPGL 1FJ1B 5EIQA 5FCSH 2FJGA 5CWSB 1KJ2B 4OLWH 1K6QH 4U33A 1BFVL 4X9HA 1RZJC 5EZJA 3FB7B 4K94C 4H20H 3N9GL 4JCLA 4KUZH 3QFJD 3R0NA 5IG7A 1XZ0A 2E27H 3S36L 1IAMA 1YJDH 3H2WA 3D9AL 1NGYB 4XVTL 4KMTL 3X3FH 5ITFA 1B0WA 1J8HA 3FFCD 3QNZB 4WWKC 4LNRA 1OL0A 2P5EE 3HRPA 4GG6B 1C12B 4F80A 3ROLB 4G6AD 1J0JA 5EN2B 2N7BA 2X09A 3O2VH 4XMKH 4Z76B 4N1CA 4AENA 5C0DA 4AIOA 5DJ8B 4PYGA 3OX8B 5D6DC 5K9OA 3IDYC 2D31B 1CN4A 1NMBH 9CGTA 3VXMB 3MRIA 5L2KE 1C5CH 1SEBA 3BP4B 4LIQH 5GHWH 2FX8L 2ZUUA 1JGEB 4LMQI 3T2NH 3M8OL 1GGCH 3SKMB 5C0FA 2EDQA 43CAA 1T2XA 5FEBA 4M1DL 4ACPA 5GS0H 4OM0L 4BH7A 1LNUA 1DFBH 2GTWB 4O00A 4CMMA 3NIFE 3UEZA 4F8TA 3JWOL 3G5ZA 1OSPL 4X9GA 4XBGA 1FAKT 5HYJA 3FCTB 1U3HB 5KVGH 4RZCB 1NAML 4WW1A 2APXA 5JW4R 4LKXA 5F9WB 5KVFL 1YECL 4MQ7B 2ZKHH 2ZSWA 3U7AA 5FUCC 3VGEA 3ARZA 4NRYA 4GS7B 1TNNA 5IM7A 1PLGL 3AC0A 4X6EB 1X5IA 5JNYB 2GKIA 4K23L 4Y2DA 4OD3H 3WE6B 2BVYA 2V2WA 1KFAL 4RIRB 3LQAH 4HG4J 4D0BB 2YRZA 3ARUA 1C1EL 2F53A 4U1LB 4U1HA 4LLDB 1QFPA 4XI5C 4L8CB 3F6LA 3PABA 3LAFA 4FQIH 1PZ5B 2ADFH 4OLXL 5DUPH 3FN9A 2APBA 5C6TL 3VFOA 1FDLH 3TT3L 3Q5OA 2DIBA 1JPST 2HN7B 3QA3B 3QWOA 3AFLA 5AZ2L 3BYTA 5K33A 1AY1H 4TPRL 3KYNA 1FL6B 1FYTD 1P6FA 2I5YH 1BGXH 4JM4H 5DMGD 5JZ7C 3I6LE 1Q72H 4NKQB 3PL6A 3BT2H 2YPLD 5TQ2H 1QSED 4RGNE 4UIMA 3HZYA 4XPBH 3VXQA 3LN9A 1UT9A 3MRKA 3EBAA 5HTSA 1MJ7H 3OSKA 2CJUH 3LN5B 3IDXL 2X10A 3FQTA 1MJ8L 5KTEH 3KPRB 1J1XH 1N64L 3ULVH 2NY3D 4AEFA 3VFPB 1CT8B 3K8KA 2VQUA 5DVNA 1AI1L 3DNKA 3G9VA 1M7DB 2CMRH 2NW3A 3VDBA 4HKJB 3RVWD 5JIPA 3D39D 4MNQD 1JUFB 5TE4H 3L7EB 4GW1B 3ME0A 3FO9B 1NC4D 2X4RA 3JV0A 2HP4A 5ETUA 4EI5B 3UTTE 4Q0XL 1TJHH 4JR9L 1NQBA 4OQ1A 2CLRA 3VWJA 2X7LA 3MRNA 3OZ9L 4RAVB 4OLWL 2OXHA 3RZCB 3UJTH 1KCVH 1K6QL 1U8QB 3NAAL 4FQHB 3SGJC 3FFDA 4JM2B 4KUZL 3IDMA 3CC5A 2E27L 4Y4KC 3DRQA 3JUZA 4ZNEA 5F6IB 4DVRH 4ISVB 3BFOA 4MWFB 3T2PA 3K4ZA 2QADB 4HCRA 4LSPL 4KK8D 4PJFF 3IFLH 4QHKJ 3H7LA 1YNTB 3FN3A 3QBTB 3WMSA 4RAUA 3LIZH 5EBWB 5IWLC 4NDMA 1YEEH 4NZUH 3O2VL 4XMKL 2HLAB 2VR9A 1KNOA 2NY1D 3GSXB 2ZOLB 4QXGH 2NMSA 3FQUB 3IB4A 3PGCA 2Y7QA 1NMBL 4P2RD 5LGJA 4LIQL 2FIRT 3RKPA 1FL3B 3L5WB 3IJHA 4P2OB 3DGCR 4WFGE 3T2NL 2VQ1A 4FMFA 1KIQB 3MRPA 3RWGA 2C4FU 5C7XL 3X17A 4JVUA 5GS0L 1JBJA 4NQCA 1DFBL 4UAOC 3CVIH 4AH2A 5JR1H 2FSEB 3ZL4H 2MTPA 2BOBA 3L3KA 1UG9A 4OSUL 3DRTB 1L0QA 3WUZA 4PLNC 3VG0H 3QDME 1OOAA 1HH9B 4OZHF 3RL2B 5B8CC 2A83B 4E5XA 4N9GB 3BI9X 5KVGL 3EO1B 3W9EA 4XCFL 4OFKA 5IB5A 1QPPA 3WXWH 1YEGL 2ZKHL 3EOAB 1R5IB 4FQXA 2BOCB 3TBTA 4JY5H 2AP2A 3QG7H 3RVTD 1G7IB 1Q9KB 3JWOC 1JGLH 4IRJA 4OD3L 1TJGL 5C09E 2W1NA 4YBLC 3LQAL 3MQIA 1MRFL 2O5XL 3RWIA 5LXGH 3V4PH 4UDUB 3BH8B 5IQ9B 2B39A 3UBXA 4XHQA 2DQIH 3U6RB 5TF1H 3V5HA 5HPMB 5I17A 4FQIL 1GGYA 2ADFL 2IC2A 1ED3B 5E00B 4ZQKA 1WF5A 2FX9L 1E4WL 5HHVL 2NY0D 2OCFD 1FDLL 1HSAA 2WIIA 5DO2C 3ZDXF 4ZPVA 1L9MA 1WAAA 5DD0H 3LZFH 2QTEA 3AU1B 3B2VH 1AY1L 1CDGA 2V2TA 3W0WD 1CXHA 2VXVH 4L8BB 1S9XA 2A6KB 2UWEB 1BGXL 4GKSA 4JM4L 4PB9H 4Y19B 2AEWA 4NUGH 4YDIL 5TQ2L 5IB4B 4NQXA 3W11D 2F19H 1T83C 2Z31A 1A6ZB 1MJ7L 4R4FL 3NPSB 2CJUL 5TE6L 2FB4H 1UACH 4PRID 3ULVL 3IGAB 3MRHB 2Z9TA 4PRPE 1FN4B 3DTXA 2WWMD 2XNAA 1I3GL 1YUHB 3BRFA 4JFQA 2CMRL 4P4KB 25C8H 4QRTA 5TE4L 3SGKA 3SDXA 3REWA 5HHNA 1R3HA 3HLAA 1P7QD 4GAJL 2OI9B 3KPSD 4OLVH 3WO3B 5AZEL 5BVJB 1NBYB 1XF2B 1GRWA 5GXBB 3L3GB 3UJTL 4KDTA 4O2EA 3BD5A 4QLRA 4FQPA 1LVEA 3NCYP 3P77B 3QCUH 5DVOA 5KSAC 4PUBL 3RWJB 1OCWH 2PYEB 3GMQA 5C8JA 4ZO6A 2NLJB 3RPIB 4XWOD 1FNEA 1AP2A 3ZE0E 4TSAH 4DVRL 2EIBA 2Z92A 3UTTA 4GG6E 2CGRH 3IFLL 3RWFA 1X6NA 1D6EB 3I85A 2ZPKL 4TNVK 2NTFB 3QQ3A 5DTFB 1C16A 5DI8A 1G9NL 4YDJB 4KVNH 3QHTC 4QXGL 1CFBA 4PD4J 5FA3A 3VFVA 3VXME 5F7WC 4QYOB 3EYUL 4M6OL 2MFNA 1P84K 1DN0B 2NR6D 2VTFA 4UTBL 2EDRA 3HR5B 1LP9F 5HGDB 3WNPA 4LDLB 4OUUA 4UBDC 5JO5B 3PHSA 4PRDB 5HI3D 3U7WL 4TTDD 3ZL4L 1V7NH 5I74B 4YHZH 1FGVL 5DRZA 3AMKA 1FH5H 2DKUA 3VG0L 3FAWA 3QQ4B 1PBYA 4U6TA 3TBSB 3T09A 1QR1A 3CX2A 3HAEG 2RAMA 4R0LC 3WXWL 5GS0C 1Q9OA 2IH3A 2OI9C 3MJ8A 1IMHC 3BPLB 4IOSD 2AJSH 3VFNA 5HHOB 5H35B 1A9BB 5DHVA 2DICA 2VLME 2EH8H 3QT2A 5DZOA 1WWBX 3IFOA 1JGLL 4UT9H 2EXYC 2FYYA 5C0BB 4U1NA 1PG7L 3P4MB 4H88H 3V4PL 5LXGL 1QSVA 3D69B 4E41B 2E9JA 2Y4SA 5TF1L 4G9FB 4G8IA 4NKDB 4BQCA 3T8XB 3KWWA 1SJXA 4NZRH 1PYWA 4N0UE 3VE0B 3CPLB 4KHTH 5T3ZH 4HZAA 5KJRH 2FNBA 3DXAB 3A6CH 3LZFL 5DD0L 1EBAA 1EGJH 3DURB 3B2VL 4MLSA 8CGTA 2VXVL 3LHPH 4LEXH 4PB9L 1F3DJ 4YXHH 2F15A 2AQ1A 5IJVB 5JUEH 4NUGL 4S1DD 3OMZA 3EYVB 3IF1A 4NQSA 4CDGC 2PTTA 2R0LL 4ZPTA 4B50A 1CGTA 1F4HA 3IJYA 3LD8B 3KPRE 2XACC 4OB5H 5D9SA 3SE3A 1F6FB 5FGRA 2FB4L 1MH5A 4PJ5B 2DYPD 1NDGB 5JOPE 1TZIB 2OTWA 3MLWH 3EGSB 4JHWL 5F93C 1MWAH 4PLJC 2ARWA 3AREB 4Z9KB 3PNWB 1M6OB 4ZFFA 1NSNH 3MRDA 3U4EB 1IM3B 2X4QB 4TOYH 3TFKC 4G7YL 4OLVL 3BVNB 4KK9D 4PJ7F 3ULVC 5ENWA 3RGVB 2EKSB 2IQAA 4WVRA 2NCMA 3P0GB 3CDGA 4JGUA 1GGIL 1SJEB 1DUZA 4XNYH 2DI7A 2GJ6B 1VENA 4UQ3B 4OF0A 5HGAB 4LSDA 3QCUL 1B90A 4JGMA 1OCWL 2RB8A 4WI8A 3T0BA 4X6CA 1S9WB 1N5AB 1NJ9B 2VDQH 1FJ1A 2YEZB 5J3HD 5CWSA 2CGRL 1AXSB 1NGQH 5B38B 1RIVH 1Y0LA 4N0YH 3P40A 4ONHB 3O6FA 4V1DD 4WWID 4DKAA 1NGYA 4K8RH 4KVNL 2P44B 3VG9B 3QNZA 4GUPB 2IPUG 1GGTA 4OIIH 4GG6A 1C12A 2ZUXA 4Q2ZA 5D2LB 2CRYA 1XF4B 2XA8L 1AGDB 3ROLA 5I9QB 3JBG7 4U1SB 2LU7A 3PG2A 3WEXB 3KPQB 3MLTB 5FDWA 1FZJB 1G9NC 4FXGB 1DEDA 1QFUH 3HE7D 1EH9A 1Y18A 1A0QL 2D31A 1Q94B 2CDFA 1NH6A 1WFNA 1V7NL 1I1AD 1EMTH 4J3WA 3BP4A 2QQQA 1FH5L 4XCNB 5K59E 1XGUA 4YHYC 3QHZH 2RFXB 2PO6B 1OD7A 2OBGA 2E7CA 3MA9H 1VFUA 4QRRD 4X8JB 5C3LD 1EUUA 2GTWA 1AQKH 3RI5F 1U8PB 2YD9A 3Q3GB 2AJSL 1OAQH 3TWCL 3RGVC 5IB2B 2EH8L 5D7JB 1U2HA 5AD0B 3FCTA 1U3HA 5IEKB 4RZCA 4UT9L 2FJHA 4MQ7A 1AXTH 4H88L 4MX7A 5DA4A 3S35X 5EDXA 1OTTC 3QUZB 4X4MA 3LEXA 2PXYD 4KJQC 3QEHB 4X6EA 1EZVY 5JNYA 3S97C 1MUJB 4X5WA 3JVGA 5CSGA 1PQZB 3MRGB 3WE6A 2VITB 1IC4H 3VXOA 4I8DA 5DT1H 4GBXD 3CFBB 4HS6B 4AIXA 4KRLB 5T3ZL 4KHTL 5KJRL 4KQ4H 2Q8AL 5C3TA 4QOKD 3A6CL 1EGJL 4G5ZH 4U1LA 2C3VA 1XT5A 4LLDA 2UWEE 1WTLA 1ZA6B 3NGBC 5E1AB 1N6QH 3FRUB 4Y19E 4L8CA 3UMTA 4LMQE 1PZ5A 2A9MH 3GB7B 3L3JB 5JUEL 5DEGA 3LV3A 4S1QH 4JKKA 5I6XB 2BJMH 2P42B 4LKCB 3V5DB 1WQVT 3GBLA 3QA3A 1FNHA 5IW1B 4NHCL 4OB5L 4U1GB 4HAFA 3IXTB 4LIQE 1FL6A 5MP6L 3HZKB 1TENA 3MLWL 2IPTL 1MWAL 4K7PL 4WO4D 3BZFA 2CDEB 1RVFL 5ERWB 3G9AB 3LN5A 2AERT 3RTQD 4TOYL 1G7LB 3R0MA 3KPRA 3WJJA 5T5NG 4CJ1A 3MBEB 5IHLB 1SVCP 3BE1L 5C0CD 3VFPA 5JQ6L 4LASL 5EFIA 4L29B 2XG5A 4MXVF 3BEVB 1JUFA 3CUPB 3L7EA 3S9DB 2PYEE 5GGQH 4XBEL 1BBJB 4HWZB 4R96B 3TM6A 4U1MB 3WFCL 5LAXB 4EI5A 4OFYD 3QDJB 2OR9H 1OT2A 1U8LB 2VDQL 5CAYB 4RAVA 5IR1B 4V2BA 1NGQL 1XMWA 1SMOA 2WBJC 3LSOB 2WLYA 1OHQA 1RIVL 1IL1A 3GKWH 4UNUA 4JM2A 2BVPB 3NN8B 3PV7A 2EIZB 3DVNB 1NANI 2DN7A 4WFFD 4ISVA 2XQBH 1N2RA 3GMOB 5GGTL 4MWFA 3EJYD 4RGMB 4OIIL 2MMXA 3LOWA 4ZS7L 3H9SD 1F8TL 1YNTA 4ETYA 5CP3A 4J1UB 3RPKA 1PD6A 2HLAA 3OG6B 1J05B 5JHDD 2KKQA 3Q5YA 3GSXA 2ZOLA 5T5NF 4PJXB 1ITBB 3VH8A 4DKDC 5FO9B 3VA2C 3FQUA 3MUJA 5E03A 4X6BA 4HH9A 1EMTL 4FABH 5A3IC 5IBTL 2VZTA 1I1YA 5L2JB 1HWHB 1FL3A 3VXPA 4PGCA 1BZ9B 2VE6B 4P2OA 3W2DL 1KIQA 3QHZL 1FVCA 5B3NA 1TETH 4ZFOL 5MEND 5IB3A 4HD9A 5HHOE 2FSEA 1R5VB 1AQKL 3L95B 3MLUL 3INUL 3DRTA 1MWAB 4P9HH 3MBEC 4B7IA 4MQSB 5IMMB 1HH9A 2Z0BA 5BQ7B 4EQ2A 3MFFA 3RL2A 1H3VA 2A83A 4N9GA 4RMTA 5HHXL 5C0BE 2R29H 2HMIC 3EO1A 1CIUA 43C9B 4R2GC 3GRWH 1UZ8B 2MHAB 4Y16C 5K9JH 1CWVA 1WV7T 4G3YL 1BVKB 5CCKH 3QEUB 4PJHF 2XKNB 4E41E 1R5IA 2BOCA 3TN0D 5F1IA 4G9FE 4Y4HC 4IJ3B 1G7IA 3CLFH 1Q9KA 1T1XB 1EO8H 4OCYH 3VWKC 1EHNA 3PE9A 4WTZG 4C56B 4CADB 1UWXH 1LEKB 1IC4L 4OKVB 5DT1L 3DXAE 1ORSA 4AL8H 4UDUA 4KQ4L 3BH8A 4JREC 5IQ9A 2BSRB 4G5ZL 1RK1B 3U6RA 1N6QL 5HPMA 2J5LB 4RGMC 3BGFB 5J0BA 2YUVA 5E00A 4S1QL 1G7JA 5HD8D 1LO2H 3FT3B 3MRLB 4PJ5E 1JPGB 2NY5H 1UM6L 2XTJD 3ARBD 2UWEA 1UXWB 1S7SB 4W6WB 3U46B 5IB4A 3BIBX 3WFDH 1CD0A 2BP3A 2P7TB 2CLVB 3DGGA 4NQDB 3BESR 3B5HA 5CZXD 1KTDB 4PLOB 3E2HB 5I8OL 5CJQH 3IGAA 1BP3B 3MRHA 4UOW0 4TUKL 4ZG1A 1FN4A 4FFZH 3GSNL 4L4TB 4F2MB 1YUHA 1AHWC 2VUYA 2CO6B 3D5OF 5DA0B 2V5SA 3S5LA 1S78C 4ZFOB 5GGQL 4HWUA 1QFWM 1F02I 2OR9L 1PKOA 1RJLB 1TXKA 5BVJA 3KJ4C 1NBYA 1XF2A 3L3GA 4HQQL 4NO0B 4HXBL 3BP6B 3P77A 1A7QH 3GKWL 5H94B 3RWJA 2DQCH 5DC0A 3T3ME 3RDTC 2PYEA 4P46C 3SCMB 2NLJA 3RPIA 1SYVA 2XQBL 5D2LE 3QSKB 1QSFD 3V4UH 3C8DA 3QAZB 3QEGH 3K0WA 5KVMC 5B3JF 5FYJD 3MRQB 1D6EA 3OKKA 4GSDL 1Z9SA 2NTFA 1NCNA 3DI2B 5IESH 5DTFA 2NY4D 3DV6B 4YDJA 5C86A 4J8RB 1WITA 3T0ED 4QYOA 4QRSB 1IRAY 1DN0A 4O2CB 4FABL 4OLYH 3WO4B 3C60D 4NO2B 1OTSC 2FECI 1QA9A 4JCMA 2JB5L 3X14B 3IJSA 3MFGB 3GFUA 1QVOA 5JO5A 1TETL 5DLMH 3QHFH 2QSTA 1VB9A 4PRDA 1SHMA 5C07D 4EN3D 3TZVB 2IF7A 3E3QC 1JHKH 2VDKL 2WBKA 5E8NB 3B43A 4XC3H 4P9HL 3PL6D 5CEXA 3DV4B 3QQ4A 2ICCA 2VL5B 1PX4A 2YRPA 4XB7A 5KSUA 4D0DB 1A7NL 2R29L 3GRWL 1BM3H 5K9JL 2BFVL 1FGNH 5CCKL 4JY4B 5HHOA 1A9BA 4JFDA 4ELMF 3LEVH 4CW1B 5C70A 4OCYL 1UYWL 4DZ8B 1H3WM 3MYJB 3NFSH 3RKDC 4RDQG 1MF2H 4PJ9D 5J1SC 3RWDA 4OM1L 3P4MA 3MXVH 2Z35B 1EJ6A 4U1IB 5FIEA 1JPSH 3UDWA 4C83B 4BSWA 2AK1H 1DE4A 3D69A 4UT7H 1O7VA 5CGYD 4G9FA 1Q0XL 3MRMB 2BNQA 2XKUA 4NKDA 2WINB 3I02B 4KROC 4N5UA 2J7LA 1DBKL 3HFML 4O51A 5FUOH 1LO2L 2IPKB 5T1LB 3CPLA 2VSDA 3ARTA 3QG6A 3QDAA 2JELL 1QP1A 3BZ4B 3PF2A 3DURA 4WU5A 2HFTA 4GRWH 2WNGA 2Q7YB 3D0LB 2NY5L 2P5WD 3LB6D 3VXSB 1JRHI 5DRXA 5D1ZA 1I9IH 3U0PB 2MCG1 5IJVA 1DQML 4ZNCD 3QIUC 3EYVA 2BC4A 5JW4M 4BZ2H 3V5KB 3VFGL 3VXRD 5D70H 1SEQH 1AKJA 5L6YH 1KJVA 4LGRB 3QQ9C 4PJ5A 2OK0H 2GAZB 1OAYH 4FG6C 4P2YA 1QKZL 4FFZL 5D5MA 1JGUH 3L3DB 1WIPA 4RDQF 3AREA 1HZHH 2ATKB 1NFKA 3CD4A 4YGVA 1QBAA 4QHLA 1XF3B 1IM3A 2X4QA 3QDJE 5J11C 3QYCA 4NYLB 4NQCD 3QP3A 5T1MA 4JLRB 4UU9B 2BVTA 5INCA 2EKSA 4LAQH 2WUBH 4NO3B 3OB8A 5CGTA 5DS8A 2GJ6A 4UQ3A 4MD4B 3D3VA 2XXCB 5HGAA 1X5AA 1C08B 1CFVL 2DQCL 2CLZB 3GEWB 3G5VB 2DJUA 4LVEA 4HPYL 1N5AA 5TPWH 2FH6A 5EULV 1WGOA 3TGXA 2YEZA 2EIDA 1MSPA 2X4NA 3V4UL 3REVA 1AXSA 1NCWH 4P9MH 3QUXB 2FECL 3O4LD 5F7DB 4TRPH 5A16B 4EBQH 1P4IH 5B38A 3NTCH 4GXUM 2HKHH 2YA1A 4LLMB 4NC1E 2A2QT 2ED8A 4PJXE 5GJTH 1XGRA 2C1PA 4OKDA 1BD2A 4JFOB 5GGVL 1JZ6A 1H9VA 1FIGL 1AGDA 2FGWL 2V17H 1ZOXA 3WEXA 5JOEA 1DBAH 5AWNL 35C8H 1LWRA 1FZJA 2XG4A 4FXGA 1DQTA 4XNMB 4WCYL 3CSYA 3QHFL 3V79C 1Q94A 1G7HB 3G6JB 1JHKL 1UWXK 1Q9WB 5E8OB 4ONGH 5JW4N 5DMIL 4H1LB 2AXJA 5ACMA 2P8PB 3QDGB 2RFXA 2PO6A 4HJGB 2P45B 5IOPB 4L4VD 1YEFH 3H7BB 4X8JA 4JFPB 3F6IA 1XGQA 4MAYB 1U8PA 2R69L 5DSCB 3TA3C 2UZIH 1XF1A 4P9HC 2AJVH 2C4FT 3LEVL 3O11B 4UT6H 4C56E 1PY9A 2RQ8A 4F33B 3PWLB 4KHXH 5D7JA 5AD0A 2A74B 5IEKA 3GMMB 3T77B 1DSFL 1C5DB 4HC1H 1MF2L 4P3WA 4PB0H 1JNHB 1JPSL 1ZEAH 1JK8B 3QUZA 4WI5A 3SDAD 3ZTNH 2AS5M 3QEHA 3BD4A 4UT7L 2VKWA 4Z5RB 4M00A 5EUOF 1MUJA 2NXYD 4OFPA 3MRGA 2C9AA 5GZNC 2FEEI 5CSZA 3VFTB 5FUOL 4LSTH 1VGEH 3CFBA 4HS6A 4M4PA 2G2RB 4YX2H 3MX0A 1YPZA 2ZCHH 2X4OB 1T1YB 4PJAA 1ZA6A 3UZEA 2ZCKH 4KZDL 5DD6B 5IT2H 1F6AB 2F8XC 3EDDA 1UCTA 2X4TA 4APQB 3FQRB 3GB7A 2X2YA 1I9IL 3L3JA 3PWPD 3V2AR 4GXUN 1U8JB 3OGOE 4BZ2L 4NQDE 4LKCA 4L8DB 3EYQD 4LQFL 1UJ3A 1SEQL 5IW1A 4MQTB 4L3AA 5KVDH 1BZ7B 2DQUH 3IXTA 5F72S 4R97C 1NEZB 4L4TE 1AE6H 2OK0L 2NY5C 1I8LA 1JGUL 2CDEA 3ZMRA 1HZHL 3O4OC 1S8DA 4JG1H 4ZAKB 4P5TB 4HBCH 1MCHA 3LKOA 4UILH 4GRLC 1DQJB 3ULUD 2NQCA 4ZS6D 1G7LA 5I66B 3JUYA 3L6FB 4LAQL 3VGFA 4JZJA 5A2KH 4OD1H 3S35H 4D9QE 3BEVA 3CUPA 4S0TD 4N1HB 1BFSA 4KKAC 2BHUA 4RGOH 3SDYH 4HWZA 2NNAA 4G6KL 3GSQB 4JG0H 3E0GA 3QDJA 3KYOB 5IROA 3LKPB 3C87A 3TO4C 5TPWL 1U8LA 3I9GH 1BQLL 5IFAH 2QQLL 5IR1A 1IC1A 1NCWL 2ZJSH 4NN5C 4P9ML 4IHOB 4TRPL 4WV1C 4EBQL 4J3SA 3NTCL 2HKHL 1KLUB 2BVPA 5GJTL 5KG9B 4WENB 4JGJA 2EIZA 3CSPA 1MCOH 3CAFA 2VZ1A 1B6UA 5E8DL 1FP5A 5CLWA 3P4LA 1FNSL 1ZLWH 1R3LB 1F58H 4J1UA 2QHLA 2V17L 1OAUH 1DBAL 2A0LD 1J05A 35C8L 5FO9A 4NBZB 4PJXA 32C2B 4GQ9L 4Z0BL 2XN9A 4YPGB 5KN5B 1VADB 1QRKA 4ONGL 5L2JA 3QWRD 2R8SH 1BZ9A 2D7NA 2VE6A 1OAZH 4FRWA 3VFWB 4ZAKC 4P99A 1YEFL 3ARGD 2D7TH 5I8CB 2DMKA 1R5VA 3O3BB 3HC3H 3L95A 2UZIL 5IMMA 2AJVL 5BQ7A 1OT1A 1MLCA 2J8HA 3BQUB 1A1OB 3KPOA 5I1HH 4HC1L 3BDBA 2C7UB 4U4BA 3HUJF 1J0YA 1UZ8A 1ND0A 2MHAA 4GAYB 1YZZA 4PB0L 1BVKA 3QEUA 2XKNA 5DK3A 3UTPD 4OT1H 4BJLA 1Z2KA 1J0KA 3Q1SH 2RCSH 4OGXH 3D48R 3G6AA 1T1XA 1DVFB 1OW0C 4C56A 4LHQB 4CADA 4PJBA 4UV7L 3KPMB 4OKVA 4PG2C 4LSTL 1A14H 2A9NH 4YX2L 2ZCHL 3VFSB 4FFVC 1UC6A 5E6IB 3ROOA 3VDAA 4D8PB 2BSRA 1RK1A 1KENH 3VXSE 2ZCKL 4WEMB 4YFEA 5IT2L 1TVBB 5B39A 1DLHA 1JWMB 4LOUC 3O3AB 2F54B 3K7UA 4ZXBC 4HWBA 1LILA 4YQXH 4HJJH 4BUHA 3MRLA 4KTEH 3IETA 2CKBH 3NIDE 4KKCD 1MCDA 1JPGA 2G60H 5C6PB 4TUJB 1AE6L 3O9WC 1RZIB 4QY8B 1UXWA 4Y4FB 1S7SA 1RULL 3U46A 2EE9A 1ZLUH 4X8XA 3K74B 1NPUA 4KI1A 2VDML 3KPPB 1RUPH 2P7TA 2CLVA 2ORBH 1KTDA 4B7LA 4YFLI 3TF7C 2NY4C 4I3SL 4MZ2A 3C5JB 4NN6C 4Y1AD 4LPYA 4NHUA 5I1IH 4EZMA 1VDGA 4L4TA 5TJWK 5HDBF 4B0MM 2LU3A 4XHJD 3S35L 1MFDH 5HI5C 1CLZL 3P30H 5C9JB 5JW3L 3U1SH 2DLIA 1BMGA 3I3DA 4F7EA 4NGHH 5BJTB 2ILLA 1A1NB 4ZFZA 2EC8A 3P73B 1D5IH 1P5UA 3WHE0 5BS0E 1RJLA 3I9GL 4GRMB 3V8CA 4PJFB 4WY7H 4MA7L 3MOQA 5ALCH 3D25A 3BP6A 4L9LC 5H94A 2QR0B 1GCFA 1X3DA 5D6CA 1SBSL 3SCMA 5M94B 4OCNC 1ADQH 3MLSH 1VACA 1JNNH 3HG1A 3L5JA 2ICWJ 1UVQB 3MRQA 1RZFH 4XX1G 1F58L 2PYFB 3O8XD 1MVUB 5IMOB 3DV6A 5I1LA 4J8RA 5E5RB 3ZSSA 4HX1B 3G6JE 4DGYH 2IBZX 4QRSA 4MB3A 4O2CA 1R5WB 3RVXC 4BSVB 5IHBA 4NO2A 1CQKA 3QDGE 3X14A 1OAZL 1OB1B 3N1FC 2V9RA 2ERJC 4IEFB 1MRDL 4MA3B 2D7TL 2GK2A 3MNVB 3KHQA 5JXEC 5GGUB 4JN1H 5E8NA 1YQ2A 3SJVD 3DV4A 2VL5A 1B4RA 4F9LC 5DDHB 4LCCC 4I2XB 5F7EH 3V6BR 3WN5B 4GW5B 4DN4L 5I15H 4JY4A 1OPGH 3ULUF 4OT1L 4HUXB 5IK3B 2AJUH 5FV1L 2RCSL 1AQDB 3QI9B 4CW1A 2K9UA 2VABB 3MYJA 3PP4H 4JO2H 1U2CA 1UJTA 1DEEB 4YXLH 5GZOC 1XGYH 2Y9RT 1A14L 5I0ZA 4FTVD 1KULA 2A9NL 2CIKA 4U1IA 3QFJB 5BVPH 1KENL 2VISB 2ZUQB 2WINA 3I02A 3FFCB 1CD8A 5L0QC 3MGAA 4YQXL 3DMMD 3KLSA 5T1LA 5J12B 1IC7H 1ZE3C 5HYSG 4KTEL 2CKBL 1SY6L 2WW8A 5JIHA 2Q7YA 1HINH 2G60L 5GSVA 5L8LB 2W9DL 5L9DL 2ICEB 2FLBT 3U0PA 3GIZH 4PTUB 3O2WL 3V5KA 3E8UL 4JHZA 3PIQB 4OLZH 2HVKA 3V7AG 4NC2B 3DWTA 4Y5XB 2GAZA 4PP1C 4BZYA 5I1IL 5HVHB 3L3DA 1PKQA 1CLYH 3RNQB 1HHKA 1MFDL 3P30L 5J56B 3JV4B 2ATKA 2OJEB 5CIPH 3V6OA 4EDXA 1I9EA 4CAGA 1N7ML 3RA7H 4U2YA 3HNTH 4NYLA 4JLRA 4MDIB 4UU9A 1ZLWK 4NO3A 2GT9A 4OIBA 4HK0A 1A9EB 3IRZA 4MD4A 5I1EH 1QO3B 4N5EC 5ALCL 1UWEH 1G7PB 2CLZA 1FFOA 3G5VA 3B9KD 2HYMA 3B2UD 1HHIB 1ADQL 2C4XA 2VOTA 2HT4D 3WJLC 4FZ8L 1JNNL 3QUXA 1CE1L 5F7DA 5F9AC 1RJYB 4LLMA 1RZFL 5BMFH 2ZUQC 1MIEH 3EFFA 5TDOB 1U8HB 1LP9B 5EBLA 4GRWE 1CICA 4XWGH 1JMXA 3TT1L 4XMPH 2HH0H 3GMRB 5EH1A 1TZGL 5HGBB 3MV9A 4M93B 4MDJB 4JFOA 4DUXA 5SV4A 4DGYL 4W6YB 1ZGLB 2VSCA 1VPOL 2X1WL 5JDSB 1FYTB 1KLFA 3S3JA 2LTQB 3GHEH 3HZVB 4LRIC 2CKBB 1ZT4B 3P11H 3V52H 2YPLB 5E0QA 3DUSB 4PJ8A 1U8MB 3I2CH 1G7MB 3G6JA 4JN1L 4Y5XC 1Q9WA 1RUKH 2QSQA 4M6AA 5E8OA 1ZXQA 3STLB 3HR6A 2NY3B 4H1LA 3SDCD 1JF1A 2P8PA 3QDGA 1DP0A 1M05A 3MBXH 5FGBA 4PR5B 4MNQB 3H7BA 5I15L 3UJIH 2YC1A 2GFBB 4MAYA 2I9LB 5DSCA 1OPGL 3QO1A 1NC4B 2X89A 2XZQL 5ICYB 2H32H 4P3CL 5FAAA 4KY1H 4F33A 1IARB 3ARWA 1D9KD 1LO0H 3PWLA 2A74A 3PP4L 1VEOA 5FYLD 3CCHB 3GMMA 3AUVA 1C5DA 3LEYH 4XH2B 2W65B 4ZUUB 3TNNB 2ZG1A 4XVSL 4YXLL 4OUOA 1JNHA 4YAQB 1UCBH 2FRGP 2ZUYA 4A2MA 4XCEB 5BVPL 4MCZB 1F13A 2BDNH 2F54E 2GCYB 5IW6A 1QBBA 4YXKH 3VFTA 3HAEB 3UTZB 2DB8A 5EBMB 4MYWB 4K71C 5DRNB 2YHGA 4FFWD 3NCYS 1HINL 4S1RH 5DD6A 1F6AA 2NY1B 5HYFA 4APQA 3FQRA 5D72L 4MB4A 5F1OB 2WZPD 3OTTA 4XXCC 1LEIB 1ZMYA 1U8JA 4WW2F 2GSGA 4Z7UA 4P2RB 4KRPB 4L8DA 2VXSH 3TCLB 3W82A 3EOTH 4C57C 4ODHH 3ARXA 2ATPB 3DX7B 4CVZB 3NACH 1KPUB 3VGAB 2OL3A 3BIKB 4IRZH 4UOJA 1NEZA 2E8YA 1OGAD 1IBGL 4QRUB 2EICA 1WZ1H 4P5TA 3C6LA 2H8PB 1DQJA 4OJFL 3RA7L 1YY9D 1YYLH 5I66A 3HNTL 5JMOC 5H2BA 3L6FA 3BKYH 3H6JA 4PJFE 4XCCH 1ZHNB 1UA6H 3CNKA 1AFVH 1NL0H 2FLRT 4O9HH 5IWLA 3TVMC 5CD5D 3VGHA 2DM4A 4TSCL 5I1AB 3LKPA 4CVXB 1XFPA 3OKMA 4HKBB 5EUKB 1HCFX 3VH8G 3B8YA 5I1CH 3SEPA 1ETZA 4IHOA 1WUNT 4KTDL 4CGTA 1FG9C 5BMFL 1MIEL 1BOGB 1KLUA 5KG9A 1U58B 5KSVB 1A3QA 4D9LL 4NO5B 4XAWH 2NY0B 1MCWW 3MRRB 4MAUH 2BNQD 2NW2B 1T04B 3LKSB 3EIFA 2BVOB 1IAIH 3FQNB 5A43C 5CINL 1R3LA 3W0WB 3P9MB 2ZSVA 4X5LA 4X99B 1UM5H 5GRJL 1CDJA 2GJZB 3GHEL 1PEWA 4EQ3A 3RY6A 1JZ5A 3P11L 3V52L 5B8CA 4KRPC 3KLAB 1UXSB 2EDDA 3PJSB 3T08A 4YPGA 1N4XH 2XY1A 2JCCB 3VGAC 5D1ZD 1RUKL 4LPXA 5F21B 5BZDB 4PRIB 5GJSH 1IAII 2IGFH 4KJWD 3D85A 4XVUC 5FYKE 4I2XE 2XWTB 2JJWA 1RK0A 4O4YH 1CF8H 1QQDB 2PW2A 3CLEH 5CUSL 3VFWA 3MBXL 1AKJD 4ONOA 2X1QA 4U0RC 5C08D 4HGWB 5I8CA 2AJXL 3UJIL 3O3BA 2Q76A 5FHBH 1P7QB 2H2PD 4XGZB 3KPSB 2Q1EA 1OARL 2OQJB 3BQUA 5CIPB 1LO0L 1A1OA 4JKPH 3FQWB 5DJZB 4TNWF 4OV6F 4WI9A 2C7UA 3ZDXE 3RAJH 3QIWD 4P4RB 4GAYA 3QFJE 3GM8A 1KC5H 1UCBL 2Y6SC 3RI5K 1TQBC 5IVZB 2BDNL 4YNYB 4LL9A 2GI7A 1DVFA 3PWJB 5F44A 2X1OA 3D3VD 3CDCA 4YXKL 3KPMA 1WSST 4GAFB 3Q6FB 2IPUK 5J7CC 3VFSA 3LQZB 5E6IA 5ILTH 2AV7B 3T0VA 1KUMA 3GNMH 2NYYD 1Z9LA 1TVBA 5J8OA 4GMSH 2AABL 1JWMA 5JHLH 5BRZA 2YSSB 3BDYL 2F54A 1F97A 5F7MC 3PWUB 1EDQA 3EOTL 5DJDB 4ZTPH 3TBWB 1CDIA 4IRSD 2E9IA 1BD2D 3NACL 3S5LG 3DROB 2BNUB 3FO1B 4TUJA 4QY8A 3MOBH 4QF1B 3SKJH 4P23C 3QWQB 3MUHL 5DWUL 2O5ZH 2VQTA 4WHTB 3OXRB 4MJ4A 4R90L 3KPPA 1MQKH 3UC0H 3O2DA 2JJSC 4WRLA 3TYFB 1X6LA 4PRBA 5F6HI 1E28B 1D5MB 4XP1H 1YYLL 3OKNA 3C5JA 3LCYA 5ESVB 4NN7B 2W07A 1GOFA 4XP4L 1UA6L 4O02H 4IOIB 1JTPA 2F8VA 4MMZC 1MCPH 1AFVL 4XZUB 1G7QB 1TVDA 5C71A 4O9HL 5BJTA 1VFAB 3UYRH 3P73A 4YDKH 1CD9B 4MS8C 1RUMH 2CDGA 1TDQA 2H32B 5F8QC 5GIRB 1A6WH 4GRMA 4PJFA 2D7OA 2X4PB 4X9IA 5I1CL 4HC1A 4OQTH 1LP9E 5LWYH 3IFPB 2P8LB 2QR0A 2R1YA 2Z8SA 3X13B 1HHHB 4LLUA 4LSQH 4XAWL 1CGWA 1CK0L 2R1WB 3D18B 3L3IB 5ITBH 1IT9H 3UO1H 4LAJH 2F58L 1FYTE 4NWTH 4IS6A 1UVQA 1OY3B 1IAIL 3QPXL 4Z7QE 3O6MH 3QUMH 1UM5L 2PYFA 1GIGL 4M5YH 3SE4A 2YPLE 3BHBB 1FSKB 4HX1A 4RX4A 1X5YA 5CJXC 4R0LA 2VJXA 4HF5H 4HFWB 1R5WA 4E0RB 4S1SH 2VH5H 4BSVA 1ACZA 3ZKMD 5ABDE 2DYPB 4KUCD 4OZHA 4NCDA 4O4YL 2CSPA 1CF8L 1JP5A 1OB1A 1HNGA 1U91B 3CLEL 4MNQE 3EO9H 4UZGA 4I77L 5JORB 4PJHB 5GGUA 1U36A 4OI9A 2HRPH 3TJHD 4NN7C 1BX2B 1HH6B 3IDUA 1BREA 1MCJA 2XI9A 4JKPL 4U6YA 4N0CC 4X6FB 1HXYB 1DBJH 3WN5A 4BH8B 3RAJL 4GW5A 2YUWA 2B20A 3QUYC 4HUXA 3RWEA 1J1PL 3M17B 3QI9A 1LO5B 4YHIB 5TQ0H 3B83A 2VABA 1YNKH 4JO1H 4EIGB 4PRAB 3HB3C 5IJKC 2HT2C 1BEYH 5E9DD 1FFRA 3LKNA 3ZLQC 3QFJA 4V1DB 3GNML 1M71A 2OR8A 2NZ9D 2MKLC 1A8JH 3RWCB 3RRQA 3GSOB 5IBLD 5JHLL 5HHPB 3FFCA 2CK0H 1P7HL 4P2RE 1P4LB 4I18B 3A0OA 4M1CD 3JV5A 1XGPB 2LQRA 1KJ3L 1J11A 1IGFH 4ZTPL 2DTML 2HTKD 1G0XA 5EC1B 5TFSL 4HPOH 1FSKC 4KK5C 4F57H 1OM3H 3MOBL 4E42A 2ICEA 3HE7B 1LDPH 5F1NB 1NUNB 2EYSB 1MQKL 1S5IH 1I1AB 2BNRB 2R1XA 4J4PD 4L3ED 4ZTOL 3UC0L 5E4EC 4JZOB 4DKFH 3PIQA 5I75C 3HE6D 2EECA 3ETBF 1GXEA 1KF9B 5I1DA 4L4JA 4NJ9H 1NFIA 1MCRA 2IH1B 3MV7D 4LLQB 2IAMB 4HUMB 5I71C 1D5XA 4O02L 3RNQA 4C58B 1QYGL 4KMLB 4Z78B 1MCPL 4NRZB 3JV4A 2OJEA 1EEYB 2DBJA 3PHOB 1U8OB 1P9MA 1F11A 1H8NA 4K3HA 3IDJB 1CD1B 3UYRL 4MDIA 1W0VA 5M95B 4YDKL 1KSRA 5ADPH 4M62H 1RUML 2B5IB 1A6WL 1JL8A 4HSQA 4XMLH 5T3XD 1NMAH 2DI8A 4O2FB 3RBGA 1EEQA 1QO3A 2PXYB 1ZVYA 1G7PA 4PGZA 3KXFA 4N0RA 3U48A 2VLRD 5FYJH 3MREB 4PBWD 1HHIA 4GBXB 2HJLB 4EI6B 3C9NB 2WBWB 1X5ZA 1JWUB 4NWTL 3W0WE 4Q6YA 3QIBC 4Z7OF 1XIWC 2YR3A 4TVSa 2MKWA 5TDOA 1U8HA 1LP9A 2Q86B 1T5WB 3N85L 5D4QA 4I0KA 1A6TA 4ETQB 1IEBB 5JOFA 1RU9H 2JCCE 1GPOH 5KSBB 4M9OA 2IFGA 5EU7C 4PRIE 3GSUB 1SM3H 4S1SL 2UZYB 5J1TC 4LVOB 1NFDF 3GJFH 2FWOA 1ZT4A 1KCKA 1QSEA 4XPFH 1U8MA 1FBIH 3EO9L 4WO4B 4WI4A 1G7MA 4HJ0D 2G9HB 5IIEB 2JIXD 3KPSE 3F58H 2J8UF 1CFTB 3RTQB 2HRPL 5D7IF 1XR9B 4F15B 3STLA 2Q3AA 4ELMB 1KTKE 2IAMC 3QISA 3H9ZA 2Z4QB 3IS0X 2LFGA 1G1CA 3UTSD 1I7TB 2RGSA 4PR5A 3D39A 4MNQA 2CUMA 1EVUA 4QXTA 2I9LA 3T0DA 3G6DH 1NC4A 3MUY1 4L8SB 4RFNC 1MCIA 5ICYA 2Y07L 1NUFA 4YHMH 1EBPA 3ZHKA 3VXUD 2AXFB 1YNKL 1B88A 2MQ3A 5DVKA 1T7WA 2W65A 4ZUUA 2E6PA 4YHLH 1ITCA 1WLHA 4YAQA 1KB9J 1BEYL 2IG2H 2ADIA 4DGIH 4Z0XB 4GKZB 5F8RC 2VDRH 4XCEA 4MCZA 4CMHB 2AVGA 3FT2B 2H45A 1GZPA 2GCYA 2Z91B 3CXHK 4OTXH 4DN3H 1I3VA 4JFHD 4AEIH 3HAEA 4HCRH 5EBMA 5F7YC 2E7HA 3U0WH 1IGFL 3ARFC 5DRNA 4LLYB 5D1XD 2UY6A 3KYMB 2XIDA 5I0DA 4F57L 1OM3L 6FABH 4XCYB 3HG1D 3QUMB 1LDPL 1IQWH 5GRZA 1FC1A 2I07B 4FQ2H 4MXVE 1QD0A 4P2RA 1S5IL 4JQXC 5D1QD 3TCLA 2VXUH 4DKFL 1T66C 2ATPA 3DX7A 4CVZA 3KR3H 1KPUA 3NFPB 4X7CC 2NY2C 2HTLC 1BECA 3I6GB 2CH8A 3MOAL 4PJ7A 2ZUWA 3EAKA 3O3EA 1YN7B 4QRUA 3ABZA 5D2NC 1CDUA 4JKWA 1U92B 4DEPB 3GIVA 5GRUL 4KC3B 3ARDD 2WWKO 4KUCF 2H8PA 1K85A 1MAKA 4NNYB 4POZD 1ZHNA 5FYKU 4XMLL 1BBDL 1EEZB 3SHSA 4U3CA 3TN0B 3JV6B 3SDDD 4HBQA 1INDH 1NAKH 1LEGA 2OYPA 3WNLA 7FABL 2OMBA 2YD4A 3EDKA 3TPKA 5I1AA 4OCWH 4CVXA 1WBZB 4HKBA 3RUGB 2A1WH 4X4XB 4HIXH 4KI5C 3VD7A 5C0AD 1EXUB 5SV3A 3BPOB 1BOGA 2Q6WA 4PPTA 5KSVA 4ZUSA 1CGYA 1ZSDA 4IMKC 3K81A 3ZYOA 3P4OB 1HN1A 3VDCA 3MRRA 4Z8FH 1RU9L 1EAJA 3K4DA 1GPOL 2NW2A 2OTPA 2BVOA 3OKDA 2J6EH 3FQNA 5ITFB 4KGJA 2AEQH 5IVXF 3P9MA 2XTJB 3ARBB 4YBHA 5LBSH 1MI5D 4KFZC 2VLKD 3EJZD 4KK6C 4XPFL 3MLXH 4QRQA 3PJSA 4PJHE 1HQ4A 3QDHA 3WD5H 3WFEH 5C0DB 3F58L 3BRGC 2ARJQ 1V3MA 3E6HA 4PRIA 1EHLH 3MRFB 2XWTA 3OAYK 3QO0B 1QQDA 3VWKA 5E4IA 1N0XH 5HBBA 4HGWA 3QPQD 3V0WH 3OG4B 3G6DL 1P7QA 4Q74A 4XGZA 3KPSA 1LNUB 3MZGB 2D3VA 1NBZA 5EUOB 3UAJC 4I0PC 5DJZA 5IMKB 3KYKH 3G5ZB 3HRZB 5B39G 4YHLL 3VA6A 5IP4A 5BXFA 2IG2L 4V1DE 5HJ3B 1TITA 2VDRL 3K1KC 4TULH 4LKXB 1MELA 2EO9A 3C5ZC 4YNYA 4WWKD 3IKKA 4M4RA 1N5YH 1NMCC 4NRYB 3PWJA 1IM9A 1CDCA 4DN3L 4JKLA 1QSFB 4I9WE 3WDHA 4HCRL 1U3JA 1K4CB 2ARJA 3U0WL 3LQZA 4LVNB 2AV1A 5EZOL 1JWSB 1HI6B 1CYGA 2PTVA 3OXSB 1U42A 1ZGLM 1UFUA 3PV6B 3GMNB 1KB5H 1WBYB 1IQWL 2VAAB 4U1HB 2BNRE 1NLDL 3T0EB 4FQ2L 1EA9C 3PABB 2VXUL 4YHKH 5DJDA 1AD9B 4I3RL 3IU3B 3MV9D 4M7LT 5DGRA 2ITCB 2BNUA 4R4NC 2VXQH 3FO1A 4QF1A 1JZ2A 4WHTA 3OXRA 4EN3B 3GJFB 1CR9H 3QNYB 1A4KB 1RHFA 3M1BB 1WIUA 4PRPD 3TYFA 3PL6B 2BRRH 4DQOL 1E28A 1VESA 4K9EH 4LDEB 1D5MA 3MXWL 3VXQB 3MRKB 3KLHC 3B6SB 4U7KA 3G5YA 1CGXA 2V5YA 3QXWA 1NEUA 1C7SA 4IOIA 2DM7A 3A6BH 5B3JE 5FV2A 2E9BA 1OAXL 1BWMA 3WIHH 1G7QA 4RMSA 2NW3B 2XFXB 1CDBA 1INDL 3QH3B 3OKLA 1NAKL 1VFAA 3NIFF 2HWZH 4PJ9B 5DJAB 1FNLA 4CDHA 2H32A 4O5LH 5E6YA 5GIRA 2YOCA 1KYOK 3GJFK 4YEEA 5ETUB 2A1WL 2AGJL 3SE8L 4XI5D 4HIXL 3VWJB 2X7LB 4NBXB 3IFPA 3ALPA 4Y8AA 3K8MA 3MJGX 4PJCF 2H6PB 4NM4H 3FN0L 1RUAH 3X13A 1HHHA 4NBYB 4NT6B 5E5MB 4Y2DC 1I3RA 3D18A 3L3IA 5KSBE 3IDMB 3AY4A 5GGRY 3VU2A 4Z8FL 4KGLA 3Q2CA 1DLFL 1T1WA 3L5XL 5J1AA 5JZ7D 2AEQL 2P5WB 4HFUH 2JJUA 5J13B 3TIEA 2OSLA 4PY8J 1ONQB 4LARL 5LBSL 2HJKA 4RAUB 1HIML 2RIKA 1ZV5A 1KCSH 4NDMB 4BK4A 3VXRB 5BV7H 4MB5A 1KNOB 5DZLA 3NCJH 3PGDB 3WD5L 3CGTA 4ELME 4E0RA 5F89B 2APFA 2KQMA 4I13B 3T2OA 5LGJB 5A2FA 3F62A 1U91A 5C9KA 2VDOL 3HUJB 5FCUL 4C55A 4F3FB 3V0WL 4PJHA 5F97E 4RSVA 4XP6H 4NQCB 1BX2A 1HH6A 2AAVA 4U05A 4Q9CA 4X6FA 4ONFH 3KYKL 4AYFA 1HXYA 4NZJA 1ZLVH 5FOBB 4A6YA 4X7SH 4D94A 4S10A 3CFKB 3BGAA 4ODWB 4Y4KD 1LHZA 2EE3A 4KI5E 4ZYKB 3O45B 3W9EB 2CPCA 4WFFE 1MFCH 5IB5B 3NCMA 1J18A 5F1KC 3M17A 1N5YL 1JGDB 2N4IA 2P47B 1I75A 2H1PH 4PRAA 4UNTA 3VWJC 3SN6N 3TO2B 1S7TA 3O4LB 1ES0B 4NNPL 2CO7B 2QLVB 3DSFL 4HLJA 4V1DA 1E27B 1KBGH 3ULSB 3U30C 3GSOA 5HHPA 1RI8A 1IEHA 3V5HB 4JKMA 1P4LA 4AMKH 4I18A 3PXJA 2EEAA 4YHKL 5C92A 4MD5A 4EUPG 5J13C 3BJ91 4G42B 2VXQL 3RP1A 1EVTC 2IFFH 4MJ2A 1F2QA 2I26N 3HE7A 1N0LA 1KT2A 4JE4B 1QZ1A 5HSFA 3I3BA 3MLVL 1S9XB 4FMKA 3KYAA 4ODUB 1CR9L 1IC5L 3JWDH 4GKSB 2F9BT 4JZOA 5LCVL 4C4KO 2BRRL 3O3UN 4NQXB 3V6ZB 1W72B 4N8VA 1JIBA 5JXAH 5JA8B 2Z31B 1RY7B 4LLQA 4M9PA 3K2UH 1OTUC 3WKMH 4QRRA 4JVPA 2QSVA 3JSSA 5EC2B 4Z78A 5TDNB 1EEYA 3PHOA 1QSZA 3CXDH 3IDJA 2R2HB 5C2BH 4PRHD 3ZZ1A 1CD1A 3SDXB 5D71H 5HHNB 2HWZL 3RUGE 4O5LL 3CJJA 3TJEH 5KVEH 3BSZL 3SKNB 4O2FA 2OX5A 1T0MA 3SDAB 2PXYA 3OWEA 4NM4L 1RUAL 4FQXC 1INEL 3ARYA 2YD1A 2NXYB 4J12A 3MREA 5DO2D 3OAUH 2HJLA 3GMQB 4IRJC 2LAGB 4EI6A 2FR4B 3JWNC 4FQCL 2FX7H 3VXNB 2H26B 3BH9A 1J8HE 4QOKA 1AP2B 1JWUA 2NY6C 1DANU 4KVCL 2Z92B 4MD0B 2XTJE 4HFUL 1T5WA 1R3IH 1IGCH 1NLBH 1MCBA 5T1KA 3PWPB 5GS3A 1Q8MA 2YD7A 1KCSL 4ETQA 2MOVA 5BV7L 8FABB 1IEBA 1MIML 2XY2A 1P5VA 2VWEE 5DI8B 1KB5B 2WMPA 3NCJL 4NFBA 3GSUA 5BRZD 3MMEB 2J2ZA 4LCYB 5AG8A 5IB1B 3VFVB 4FA8A 4HGKC 2D7MA 2WAHA 1VEPA 3VFRB 3MA7B 2GQHA 5E2TH 1O0VA 4QKXB 4L5FH 3BIAX 4W6XB 2YMXL 3ZDZF 2COQA 4OUUB 1A6PA 5GGRA 2G9HA 1K8IB 3QZWA 1CFTA 3RTQA 3HNSL 2Z31C 1XR9A 4XP6L 5EUOE 4ELMA 3CMGA 5C0CA 1FORL 2Z4QA 4RNRA 2NXZC 5DRZB 4KWUA 2ZNXA 4ONFL 1ZWIB 4HIJB 5EBGA 3WHE1 5KSAD 1QR1B 1OF2B 4NP4L 4RGNC 3SGKC 5I18L 4OFYA 1QFOA 1A6AA 2IH3B 2IMMA 1LK3H 1H3XA 1QSFE 2JJTA 2AXFA 4K2UH 3PDGA 2H1PL 5FYJE 5DURD 1KXQE 3IFOB 3WLWC 5TGBB 5E5UB 4Z0XA 1ULVA 4KDTC 4GKZA 4XNZB 4U1NB 2HA1A 2AEPH 3MSPA 3LY6A 3FT2A 1MFNA 4N8CH 5AYUH 3GI8L 4LPCA 4LLWB 4Y5VC 4OQTA 3T0EE 4Q6IC 2Z91A 3C8HA 4Y88A 1IGYB 3H9SA 2DJSA 4Y19D 2YD3A 4CKVX 3U9UA 5HHQB 4HH8A 2EC9U 3KWWB 4LLYA 4JJ5A 4UBDD 5CP3H 3KYMA 1N6UA 4GAGL 5JHDA 2XT1B 1KEGL 2IFFL 1K2DB 1QTYT 4XCYA 4MVBC 4XVJH 3QUMA 3F8UB 4LEOB 5E2WL 2I07A 2AK4D 1IAKB 3MJ9H 2DDQL 3AAZB 4TUOB 4HIIA 2F5BH 3MRJB 2YN5A 1A7PL 3IF1B 4NQSB 1DDHB 1I8IB 5JXAL 2PTTB 2Y06L 2ID5A 3I6GA 1ZK9A 3IJYB 4IBLT 3VGGA 5GS0D 2VC2H 5MENA 1DZBA 5D9SB 3K2UL 3WKML 3ARGB 5F6HJ 1F4WH 1YN7A 1UKQA 1QUNA 5DEFB 5HYSB 1R0AH 2EH7H 4WV1A 3NH7H 5C2BL 4ODBD 2EXYD 5C0EB 1YYML 5D71L 3ZTJG 3MRDB 4NNYA 4G80B 4Y5YB 1JE6A 3TJEL 5KVEL 2DKSA 5ENWB 3TN0A 2D03H 4I48B 2IQAB 3JV6A 1JYNA 2DL9A 5MI0C 5DJ6B 2ZNWA 5JIKA 4MQXC 5J4MA 1U93A 4XNUH 3F7QA 1WBZA 1U95A 4TSBH 4YC2B 4X6CB 2FX7L 5ECJE 2WWKT 2P5WE 1II4E 1EXUA 4JPKH 1W8OA 2ED7A 1R3IL 1IGCL 4JRXA 3FZUC 3VXRE 4D9RE 1Y0LB 1HKLH 3O6FB 3P4OA 4XAKD 4X7FC 2B4CH 1A4JA 1IAIM 2R2EA 4BKLB 2GIYA 2P8MB 4GLRH 2AI0L 3AVEA 1ZLVK 1X5HA 3ARBA 3MV8D 4PLJD 4Q2ZB 3DUHA 3H9YA 3U79A 3HUJE 1G0DA 1LO3H 5AUMA 1VFBB 4G6MH 1R3KB 2FCBA 5BV7C 3I75B 5FDWB 4NQCE 3TFKD 1Y18B 1S7RB 5ESQA 3ULVD 5C0IB 4Y1AB 1CGUA 5E2VL 3GMLB 4GLRI 2CDFB 3MRFA 3QO0A 2EEBA 3DPBA 3I50L 2J1KA 4Q9QL 2UVEA 1Q38A 1XGUB 4FN0A 1NKRA 4HEPG 5C0BD 5AAMA 2N1KA 3IYLW 1R3JA 3K8LA 1LK3L 1EAPA 5EUOA 5CBEB 4K2UL 2H2SC 1A6UH 5CSBA 5IMKA 4E41D 5AG9A 3HRZA 3O4LE 1KEML 4X9BA 4EJ1C 5F7UA 3BXNB 4OGYH 3FOLA 4I4WB 5HJ3A 1A7RH 2FJHB 4CVWA 3VMPA 4GKOA 4L9DA 1EHAA 2AEPL 2YD6A 4MX7B 4W4OC 3DXAD 4N8CL 5E70A 3O41A 4BQ6A 4J7RA 4WUUD 3LEXB 2B2XH 2O5YL 1QSFA 4LLAA 4WW2B 4QTHB 1G6RB 1CFSB 3KXFD 2BHZA 4X5WB 3RNKB 1PSKH 1K4CA 1T1ZA 1XGTB 3FMGH 4LCIL 4QHUB 1S7QA 5EWIL 3RL1A 3VXOB 4PLKC 3DX6B 1JWSA 1HI6A 3O8XB 4JO3H 1WAAE 1MHEB 3OXSA 1ZHLA 4PV8B 4Y8DC 5DFWH 3O6FC 3PV6A 2AJYH 1NDMB 3GMNA 5HDBE 1WBYA 1L7IH 2C3VB 2VAAA 3T0EA 4K7FA 1CTNA 1HXMA 2EDFA 4OFIA 3RY5A 1AD9A 3K80A 3C60A 3IU3A 4HMEA 4XP9H 1QNZH 2F5BL 5DEGB 3LV3B 1Z3GH 2XZAH 2ITCA 2YN3A 4MA1B 4OD2B 1KN2H 2VC2L 5MEOB 4G6JH 5C07A 3GJFA 4EN3A 3VRJA 3UJJH 1I7UB 4UV4L 1F4WL 4S0SD 3QNYA 1A4KA 4YBQC 3UROR 3M1BA 3RGVD 2HT3C 3SJVB 1R0AL 2A77H 3BZFB 3SDXE 4Q9RH 1ZS8A 4OZIF 3B6SA 3O0RH 1FPTH 3ARRA 1JV5B 4XPAL 5IMLA 3H9HB 1EFXD 1OTTD 3GBNL 3GO1H 5K59F 4KJQD 1TNMA 5DD3H 4LFHD 4K55A 5JDJA 2D03L 1EUTA 2IQ9H 3R8BB 4Y7MA 2VDPL 2XFXA 4JFXA 3TPUB 2B1HH 5EFIB 5IEHB 1LMKA 3CFCL 3QH3A 3R8QA 1R24B 4PTTB 3UYPA 1HQRB 4XNUL 4PJ9A 5DJAA 3K4AA 4RWYL 1U3HC 4FTVB 4TSBL 3HI1A 3IFNL 4H0GA 1PY4A 2IADB 5F9WC 2H6PA 4GS7C 1WICA 3PWPE 2YRLA 1TTUA 4NT6A 1EO5A 3PWVB 5E5MA 1IL1B 1S3KH 1HKLL 4RBPH 4H20L 3JVGC 3DMMB 2Q3ZA 1YJDL 1JHTB 2B4CL 2E3VA 3X3FL 1S7UA 1N2RB 1UKSA 2P5WA 3IAQA 1ONQA 1PEZA 3TLRA 1LO3L 2AJZB 3G08B 3VXRA 4G9DB 3TYGH 1TMCB 3PGDA 4X6DF 3VH8B 4L3CB 4TVPH 4JFED 4JPVH 5F89A 4XX1E 3ZKQD 5F7KC 3WV0A 3V0VB 4X6BB 3T04D 5FGCB 4HH9B 4ZOAA 1C5CL 3NABH 4ZUTB 1FG2B 4FQLH 2FEDC 1I1YB 5GHWL 1RZKH 3ZDYE 2R0ZH 1GL4B 3VXPB 4PGCB 1HHJB 3HUJA 1GGCL 5F71A 3B4NA 4F3FA 1FVCB 1TCMA 4G8GD 5CFHA 1YMMA 3AS1A 5IB3B 5BW7A 1O5DT 3WJJC 5DFTA 2VUOA 1A6UL 2WBJD 4KZEH 1GH7A 2AXGA 2UVFA 5FOBA 5HDQH 3MFFB 3FRPG 3CFKA 4ODWA 4ZYKA 1YEIH 3O45A 4ODVH 3CMOH 1HKFA 3OJDA 1JGDA 5KW9H 2BVUA 4J3OC 1WT5A 4EI5C 5F1IB 4JPWH 4QNPF 2B2XL 4TNWK 1T2JA 4NSKB 3TO2A 3O4LA 1PSKL 1ES0A 3RZCC 3FMGL 4ZUVA 4EVNA 1YA5A 4IDJH 1E27A 1ORSB 4JO3L 5ISZD 3ULSA 4JM2C 4R26H 1A7BA 1I7ZB 4ZODA 2N56A 2VDLH 4DFIA 5F6IC 5A3ID 2YPVH 1HWGB 1FZKB 1E6OH 3OAZH 4WI6A 2QADC 5DUPL 1MEXH 1B0GB 4XP9L 1G7JB 5HHMD 4EDWH 1Z3GL 5ADOH 2E7LA 3PQYD 4G42A 2J6EA 1KN2L 3RVVC 1PDKA 4URTB 1N3NA 1V3LA 3L3HB 3CSBA 5FOJA 3MBED 3ESUF 2I5YL 4ODUA 5E7FA 5E7BA 3DO3A 4ENEC 1Q72L 1DBBH 2MCPH 3BT2L 1BFOB 1UB5B 2EXWC 3V6ZA 1W72A 2HMID 4Q9RL 4MNHB 4XPBL 3SDCB 3TESA 1QOKA 4R2GD 3HMWH 3DGGB 4Y16D 1ZA3A 4P2OC 2LVCA 3O0RL 4L4VA 5KTEL 1J1XL 4Y4HD 5EC2A 1H3PH 2LVEA 1IZKA 4CL7A 3ULVF 5TDNA 3VWKD 1M7XA 3V7AE 2B1HL 4WFHD 2R2HA 4DGVH 1D9KB 4B5EA 1BJ1H 3S5LB 4X4YB 3DYMA 2R2BA 4X6CE 1ZVSB 3VGDA 3WLBB 3ZKNC 1TVHA 2AJ3A 3BYYA 2X70B 2C5DC 1TJHL 3SKNA 4C4KT 3OJVC 4K3EH 3SDAA 4DW2H 2KZWA 1KCVL 1SJVA 1K5NB 3MV01 1D5ZB 5T3ZD 1NC2D 2FR4A 1F4AA 3VXNA 2H26A 2FHCA 1MPAH 1SYVB 3CK0H 4HGMA 4AIZB 1IM9D 5GS1B 4MD0A 5FYJU 1IAOB 3GSWB 3PWPA 3LPFA 1OD9A 3LIZL 3OKKB 2HFEA 1YEEL 4NZUL 1NUDA 8FABA 3PDOA 1KB5A 1YJDC 2B4CC 4Y1AE 4DTGH 3MMEA 4TVPL 5D7LA 4LCYA 5ALBH 5IB1A 3RZWA 5GRVL 4JN2B 3VFRA 1A64A 1V5JA 2XWJB 3MA7A 3NABL 4FQLL 1RQ5A 4LSRH 3MNZB 1S78D 1OGAB 2EE6A 1QA9B 1RZKL 2R0ZL 4KQ3H 1UWGH 4X0KA 3IJSB 2OM5A 1QVOB 3T0WA 1K8DB 4OGZA 2EZ0C 1K8IA 3QB7C 3NPSC 3CVIL 5JR1L 3QQNA 4NWUH 5CEXB 5CP7A 1ZWIA 4HIJA 5JIIA 4KZEL 4O58H 2DQFA 4F7PB 5HDQL 3QRGH 2B1AH 3RDTD 3P9WB 3IAPA 4P4KC 5KSUB 1OF2A 4P46D 1YEIL 5JPMB 2BY1A 4QWWC 2V6HA 4X4ME 5KW9L 3WIHA 4QHKI 4JY5L 3QG7L 4JFDB 4EXPX 1I7RB 4NQEA 3L3OB 2VZ3A 1A21A 2J8OA 4OZ4B 5LG1A 2EDXA 4IOFC 5TGBA 1MFBH 4IDJL 4LHJB 3RWDB 1BQHG 3AB0B 4WHYG 4M7LH 4LLWA 4WI2A 5DJ2A 3I6KB 1FE8H 1CGSH 2VDLL 4BSWB 1DE4B 2DQIL 3T3MF 1IGYA 1XCQB 2BNQB 1E6OL 1OTSD 5SWSA 3RVUC 5HHQA 1MEXL 15C8H 4O51B 5D2LF 4QEGA 4EDWL 3MGTB 5ADOL 1N6VA 3LQAC 3QG6B 1K2DA 1QLEH 3TP4A 1NCUA 4WU5B 2QEJA 3MLZH 4LEOA 2ITDB 1IAKA 3ZKXB 3AAZA 4FNLH 1JJUA 5DD1H 1HILB 5D1ZB 5DRXB 3SJVE 5EA0H 4TUOA 1H3GA 2MCPL 1JZ4A 3QWRA 5IW3A 3MRJA 2BC4B 1DDHA 1GAFH 2F19L 1I8IA 3HMWL 3TVMA 4DKEH 2K1MA 1AKJB 5C08B 1KJVB 1UACL 3ARGA 3HPJA 1H3PL 2WANA 5D5MB 5DEFA 3GMPB 4YHPA 4RBPK 5I74C 5HYSA 3RX7A 4FQJH 3RKDD 25C8L 4MLIA 4NO0D 5C0EA 4MNGB 4WU7B 4YGVB 3X3GH 4GO6B 4FTVE 2M8XA 4QHLB 5K9QG 1HSBA 4G80A 3CU1A 4Y5YA 4KDWA 2BK8A 5T1MB 1BJMA 2EDEA 1KELH 4FQ1H 2W60B 1VERA 3MLRH 4I48A 5INCB 1DTUA 3SE9H 2JJVA 4DW2L 4KROD 4NJAH 3BPLC 3HHRB 5DJ6A 5DS8B 3SO3B 3D3VB 3ZE2F 3IKCA 1WFUA 1RD6A 3CVHH 5EU3A 5GRVK 3DETC 4TSAL 1MPAL 2J88H 2B0SH 2EYRB 5DZNA 2X4NB 3UDWC 2K7PA 3REVB 1NFDB 2I60H 4OGAC 3WFHB 3QIUD 5IQ7H 5CHNB 4C54A 5KOVC 1TIUA 3QJHB 1EX0A 4HWBH 1XGRB 1KOAA 4BKLA 3QQ9D 4IRSB 2C1PB 2P8MA 4DTGL 5CBAB 1BD2B 4J3TA 5ALBL 4FG6D 1E4XH 4LU5H 3FT4B 5FGCE 2VZOA 1JI2A 1R6VA 3IDGA 3VXTB 4U1KB 2X41A 5HI4C 1U41A 1VFBA 4KQ3L 1CS6A 4BSJA 2A6IB 1R3KA 3I75A 3AS0A 1YEKH 5A2LH 3IRPX 4YZFF 3CSYB 1S7RA 2Q20A 5C0IA 4Y1AA 3LD8C 3GMLA 3F7VA 3V95A 1E4XI 1J1OH 4YHZL 4WTWA 5CEYB 1HCVA 1QBMH 2E7MA 3OF6D 1E0OB 5LJYH 1UEMA 1RZKC 1OP5H 3QRGL 2B1AL 3AREC 2W91A 4J3XA 3LKQA 5D93B 4MSWA 5GS2H 3OAZK 4JHBA 4DJMA 1XGQB 4JY6A 5B4MC 5CBEA 1G9EA 3DJ9A 4X7TB 3P0VH 2DKMA 3BP5B 5IGXH 3BXNA 4YHOH 4I4WA 4KKBC 1KIPB 1MCLA 3TBVB 4LBEB 4TN9A 5L7XH 3DLQR 4M7LL 1CGSL 5IHUH 4XNXH 2A6JB 5EU4B 1QR4A 1UZ6F 1W8NA 3ARSA 4WW2A 4HG4K 4QTHA 1G6RA 1CFSA 2BCKB 1JNJA 3RNKA 1XGTA 4YDLB 4QHUA 1NKOA 2JJSA 2RHEA 5DJYA 1F4XH 3DX6A 5CSZB 1FNGB 3O8XA 1IEAB 1IGIH 4NZRL 1MHEA 4IIQA 3BKMH 4ODSH 4PV8A 1YPZB 5KOMC 2UUDK 1QLEL 1NDMA 4J6RH 3FQXB 3KPLB 3MLZL 4PJAB 4YE4H 4JB9H 3VG9C 3LHPL 4LEXL 3C08H 3MNWB 4FNLL 1KIRB 2CXKA 2X4TB 5DD1L 4YXHL 5T1KD 5EA0L 1MCFA 1I85A 3H8NA 5HGHB 4U49A 5E8PB 4I1NB 4FZEH 2X4SA 1EIBA 4OD2A 5I9QC 1UJ3B 4BYHA 3RIFK 5MEOA 4FXKB 4DCQB 2ESVD 3TA3D 1I7UA 4KPHH 3WSQH 5EIVA 1KIUA 2CUHA 4LCWD 3SJVA 5FHAH 3EYSH 4FQJL 1MVFA 1S8DB 3X3GL 3LKOB 1NSNL 4JHAH 1JV5A 3H9HA 2PO6C 5D7KD 5D93C 6CGTA 1KJMB 5EB9A 3ECBB 1KELL 1F3DH 4K3DH 1S9VA 3MLRL 4JZJB 1H5BB 1H0DB 5BS0D 3TPUA 5IEHA 3L9RB 4XNYL 1YC7A 5GZND 1R24A 1YDPB 4PTTA 1P69B 1DJSA 1HQRA 2I24N 5D7JC 2AXHA 2NNAB 3VRLF 3CVHL 1NANH 4FTVA 2KUTA 5E9DB 1N59B 2IADA 1TTFA 2BY2A 2J88L 5HXMA 1P4BH 5DHYB 5IVXB 2QJDA 3QUZC 2L4OA 2I60L 4AG4H 3CSGA 5IQ7L 3PWVA 2D9QB 2OP4H 5HYQA 1VSCA 4N0YL 1NCDH 5SWZA 3DMMA 4HWBL 3JXAA 3KGRA 1JHTA 2JK5A 4K8RL 1AO7D 3HMXA 2A73A 3QJFB 2V9TA 3N06B 3TNMB 1SMAA 4GQPH 4WEUD 3RWHA 1OGAE 4R9HA 1XH3B 4KV5F 3EDFA 2AKRB 1DANT 2AJZA 3G08A 4G9DA 4L3EB 4I3GA 1E4KA 4GRLD 2C3XA 5F88B 5I6XC 4P2QA 2P4AB 3HE6B 4L3CA 2VXTH 1QFUL 2OTUB 3QFDB 1UJ3C 3QUYA 3WKNA 3MJ9A 2XN9B 4U1GC 3V0VA 4CN4A 3OQ3B 1MCEA 3ZE1E 3MV7B 5SX5H 4ZUTA 1FG2A 1ACYH 3D1MC 2X42A 3WS3A 4EUPH 1HHJA 4KKAD 1WC7A 1CE6B 1BWWA 5DJ0B 1RZJH 3MA9L 3FL7A 3TO4D 4BFGA 2Y36H 4WEBH 4JFDE 2FHBA 1OAQL 3TCXA 3ZT7A 2QHRH 3P0VL 5DUBB 1MLCB 5IGXL 4JZJC 4UIKH 3KPOB 4YHOL 3T2QA 3JTSB 1U8IB 5FO8B 5IFHH 3RHWF 1PG7X 1ND0B 3B9KA 2VLRB 1AXTL 5L7XL 1JPTH 1CZ8H 2BNQE 5IHUL 2VLLA 3P3YA 5IROC 2E6QA 2OLDA 5DR5H 4PJDA 4NSKA 2F8OA 3G6AB 4QT5A 4PJBB 3CFDB 3CVHB 1IGJB 2B8OT 1IGIL 1EPFA 3BKML 3VMNA 3B5GA 1I7ZA 3MTRA 4N8VG 3ROOB 3V9FA 3HS0A 1FZKA 3C08L 5FM8A 5B39B 1DLHB 2A9ML 3MCKB 4JRXD 3DSNA 4K3JH 1B0GA 3KPTA 4FZEL 3ILPB 4M6MH 2BJML 4TVPE 2FO4A 3OJ2C 1I4FB 4ZAKD 4A2LA 3IETB 5C08E 5IV2B 4NC1C 3H3PH 4YK4B 3SBWA 3F7YB 1CXLA 2EC9T 3OR7B 2FZ3B 3L3HA 2NPLX 5D5ME 1IKNA 2G5RA 3F12A 4KPHL 4WGWB 2JIXB 4Z77A 1KXTB 2J12B 1BQUA 3GGWB 3N0PB 1BFOA 1UB5A 3VFUA 4MNGE 1ROWA 4MNHA 3SDCA 1RZ7H 4H1LH 5J57B 3ZYJA 3UTSB 2EYTB 4M7JH 1BFTA 2VZSA 3ZKSD 3LDBB 4H5SB 4Z7OE 4K3DL 3EDJA 4NHUB 1JYVA 4BM7A 2GJ6E 3U7YH 2X1XR 2YD8A 4PJCB 3D3VE 5GQBA 3LH2H 1D9KA 3VXUB 1LE9B 4X4YA 3HC4H 2R0WH 4F7EB 1ZVSA 3WLBA 4FFVD 4ZFZB 2X70A 3S8WA 1HE7A 5EU6A 1T7ZA 4GXVH 2DLFH 1NFDE 1P4BL 4LOUD 2GJJA 4ZXBD 2WUCH 4AG4L 4IJ3C 1K5NA 2OP4L 3D25B 1IGTA 3DIFB 3T3PF 1D5ZA 1NCDL 5D6CB 1FL5B 5C0RH 3FO0H 1BD2E 2PF6A 5DD5H 2XPGB 5D1XB 4AIZA 5GS1A 3O9WD 1IAOA 3GSWA 3S98A 1TQCB 4WUKH 4NQTA 1OP5K 1VACB 3QZWG 3HG1B 4N1EA 2P46B 5KAQF 4PD4K 2J5LC 2VYRE 4MJ5B 3BGFC 3HC0B 5D1QB 3L5HA 3EUUA 5CEZD 5I1LB 4X9FA 2VXTL 2Y1VA 4K8RC 2R56H 4NKIH 1HYSC 3O6KH 2OL3H 4JN2A 4DK6A 1JCKA 2XWJA 2HJFA 3NIDF 4LF3B 5HI5D 1QFWH 5AEAA 3MNZA 1OGAA 3MCG1 5HY9A 4L1DA 3ARDB 1K8DA 1QG3A 3IDIB 3B5TA 3DO7A 2Y36L 4WEBL 3E2HC 3SGDH 5EG6C 2DF3A 1ZT1B 1W0WA 4MJIA 3V7MA 4QXUH 2QHRL 5MHSE 1QFWI 2Q7NA 3NMEA 4F7PA 3VJ6B 1ZTXH 4XPGH 1FNAA 4UIKL 3SDDB 2APWA 5JPMA 12E8H 1BFVH 1DR9A 1WWCA 5H37H 3NVQA 1JPTL 3EKCA 2IALB 2D0FA 3N9GH 4ESKA 4PIRF 3SGDI 1XCTB 3S3PA 1I7RA 1QEWA 2KL6A 3CLFL 3L3OA 3D9AH 5BZWB 1JN6B 4OZ4A 4XVTH 1EO8L 4CU6A 3PXHA 5C0AB 4JQXA 3RFZC 1YPZE 4OCMC 3ZTJH 4MCYB 4AL8L 4ZD3H 1CL7H 3NZHH 2CIKB 4PJAE 2VNCA 3I6KA 3SCMC 3S88H 4GG8A 3EO0B 1P84J 1JRHH 1DBMH 5DJXB 3BDXA 3RVXD 1XCQA 3EHBC 3EW3B 4RFEA 3EYOB 5D2NA 3QAZC 4ZOBA 4K3JL 3MGTA 4M6ML 4DUVA 1MI5B 2VLKB 4G8EB 4WTXA 2FX8H 1CL7I 4OCSH 3M8OH 5JXED 3BN9C 5GSVB 2ITDA 4FHBD 3GK8H 1FO0A 2BXZA 4M1DH 1GZQB 1HILA 5TE7H 3VRIB 5FDYA 3HA0A 1RZGB 4K7PX 3WFDL 4OF5A 3WO4C 3AM8A 4F9PA 2HVKB 1RAMA 4NRXA 5C08A 5CJQL 1DQDH 4CN1A 1AGEA 2BVQB 1HEZB 3TZVC 3GMPA 3U7YL 1YECH 4EUPB 1PKQB 5DVLA 1HHKB 4PS4H 5JLZB 4AK1A 1Y6NR 4MNGA 4WU7A 5GZOD 4EDXB 1PLGH 2R0WL 3QIWA 5E9DE 1DN2A 4DZBA 1X9QA 1YMMD 3BZEB 4JEGB 5FM5O 2W60A 5IVXE 1KFAH 2BRQA 2GT9B 4RISH 5J6HA 4WWKB 4R4BB 1X4ZA 1YEJH 1C1EH 4HK0B 4MJ6A 1A7QL 4LSVH 2CUIA 5KZCD 1FFOB 2CRIA 2PW1B 4YO0B 4M6NH 3FO0L 3IDNB 5C6TH 5SX5K 2HLFC 1T3FA 2D7QA 2P43B 3TT3H 2EYRA 4G43A 4WUKL 1NFDA 3WFHA 3QEGL 5J9PB 3UPAA 5CHNA 4TPRH 5EZIH 4L3EE 4X5XA 3EFFB 3QJHA 5CILH 2GSIA 5IESL 5EBLB 1CICB 2W9LA 1ZANH 1QFHA 4PJGF 4IRSA 3C5SB 1YQVH 2XN9E 4PP1D 2J8UA 5CBAA 3MV9B 2R56L 2W0KA 5D7IA 3FT4A 2V5RA 3MV7E 4NKIL 1VGKA 3PDDA 2OL3L 2DQTH 3MJ7A 4NKOB 3IDXH 3ILQC 3VXTA 4OLYL 4U1KA 1I9JH 3WFZA 2A6IA 3WCYA 2PCPB 3O2DH 4F37K 4PJ8B 5DLML 1UH3A 5F7LB 4XPHH 3K3QA 3OHXA 3F5WB 5T3XE 3VI3F 5CEYA 4XC3L 3WS6C 2ZP0T 4QXUL 4M5ZH 3MRCB 4N5ED 4Q0XH 5A2IH 1FIEA 2EDLA 1JF1B 2YS4A 3OZ9H 1BVZA 1M05B 3STZA 3BAEH 2VLRE 1LE5B 4LCUB 1DL7H 12E8L 1V05A 3V6OC 1BM3L 2XWBB 4WHCA 3NAAH 1FGNL 2YC1B 3QO1B 4BA8A 3S6CA 4X7TA 4PJBE 1MHPH 3BP5A 4RMRA 3NFSL 4LSPH 5GRYA 3NA9H 4YWGH 3TC9A 1KIPA 3TBVA 5M7QA 1E4JA 4LBEA 3MXVL 3NFNB 1CL7L 4ZD3L 3NZHL 3SKUD 1F00I 2WK2A 2AK1L 3WUWA 3S88L 5EU4A 2A6JA 1JRHL 1DBML 2DQJH 2BCKA 3EYFA 5HYIA 5IW6B 4NKMA 3QUXC 1FNGA 1IEAA 3PHQB 7CGTA 1U8NB 2DLEA 3FQXA 3KPLA 1CICC 4OCSL 1A22B 3GK8L 2R9HC 3EZJB 3MNWA 4GRWF 4WI3A 5C7XH 1KIRA 5TE7L 5HGHA 4M3KB 1K3ZA 2R0KH 2FDBP 4Q9BA 5E8PA 2GSGB 4Z7UB 1H8OA 4OSUH 5D70L 3UPRB 3UTSE 3RGHA 2IAND 5D7LD 4FXKA 4DCQA 5L6YL 2L7JA 1Z0MA 1NCTA 2OL3B 4PJ8C 3V8OA 1A47A 3L1OH 1T89A 1OAYL 1DQDL 4XCFH 4PJCE 4DAGH 3M45A 1YEGH 3VXUE 2D4FA 2X40A 4PS4L 4YUEH 1ORQB 2EDJA 1WFOA 3C6LB 5FYKH 5CGMA 2Q8BH 5H2BB 1KJMA 1TJGH 5FGBC 3FB6A 4Y4KB 3ECBA 1BLNB 3PGFH 2H3NB 2WUBL 1MRFH 2O5XH 4RISL 1H5BA 1H0DA 4MAYC 2O61B 3L9RA 1YEJL 4JFHE 5IVOA 2VR5A 1YDPA 2Z8WC 4LSVL 3LS4H 3KJ6H 4M6NL 2FX9H 1E4WH 5E9DA 5HHVH 1N59A 4KKLC 1OLZA 4B53A 1QLFB 4KJYA 4M7KH 4JFYB 5DHYA 3OKMB 3HG1E 5IVXA 1MFEH 1BJ1J 4NQED 3D2UA 4N0UB 1C5BH 1ETZB 3P9LB 4OZGF 1P4IL 3U9PH 5EZIL 5L8JB 1FLTX 3BKCH 1FRGH 5EZLA 3ARPA 5CILL 5DJCB 2XQYG 4YDIH 1ZANL 1YQVL 3QJFA 3ORJA 3TNMA 4FS0A 4R4FH 2DQTL 4UAOB 5SWSD 5TE6H 1DQQB 1XH3A 2AKRA 1FYHB 2P24B 2ZSVB 4APQC 4J4PA 1I9JL 4L3EA 4S2SB 5F1SA 1I3GH 3ARQA 5F88A 3QRFM 5B8CB 3O2DL 3HE6A 3SKOA 2OTUA 3QFDA 1IGMH 5CZKA 4XPHL 3UX9B 5AAWA 1KGCE 3MV7A 4JO4H 4GAJH 1AR1C 4M5ZL 3D85B 3DI3B 1RK0B 2RJMA 3C2AH 5AZEH 1CE6A 3TVMD 2PW2B 4QRPD 3BAEL 5DJ0A 4PRHB 1DL7L 4HT1H 5AYQA 4P5TC 3C6LC 1Q0YH 1KXVC 3MC0A 1NAMB 4YBLB 5A2JH 3MYZA 4PUBH 2PKDA 2Q76B 1XR8A 3SQBA 2UZXB 4UT6L 5F3BB 5C0AE 1SVZA 5DUBA 1MHPL 4KHXL 2FEEL 3HNVH 4HUKB 2DMCA 3JTSA 1U8IA 3LRSB 3NA9L 5FO8A 4YWGL 1ZGLP 2VLRA 3S96B 2ZPKH 3N1GC 3L7FA 1ZEAL 3T4YA 1OP3H 4V2CB 3ZTNL 5IHZB 1G9NH 1H15B 1L6XA 2DQJL 4PGDA 4LVHB 4YR6B 2E8ZA 5MEPA 1Y6KR 3CFDA 3ES6A 5I16A 3CVHA 1IGJA 3CFEA 3EYUH 4M6OH 1MI5E 4QGTA 4GOSA 1N26A 4Z7VF 2FIKA 1VGEL 2VLKE 3FKUS 4KRPD 3SPVA 1VKXB 5FF6B 5C2UB 2P5EA 4UTBH 3LQMA 1JF5A 1JPFA 4U3XA 3T1FB 3WNOA 4QXWA 1HYRC 2D7PA 3MCKA 5BRZB 4XVUD 4OI8A 4JVWA 2X6MA 4PJIF 2R0KL 3U7WH 3HCVB 3ILPA 4XB8A 1FGVH 1WBXB 1I4FA 5IV2A 5L2KA 4OZIB 5KVDL 5FO7A 3F7YA 4HS3B 3U2SB 3RY6C 3OR7A 3VD3A 2DQUL 5FB8B 2FZ3A 5L88H 3L1OL 5CS7A 2JIXA 1PKQE 3B9AA 4L1HA 1EERB 5IUSA 4DAGL 3GGWA 1DUYA 3V6OE 4OLUH 4YUEL 3NCFB 4JQIH 4JG1L 4PGEB 3S4SA 4HBCL 1IQDB 5FYKL 4PRBB 4UILL 3UTSA 2EYTA 5KSAB 2QBWA 2Q8BL 2Y6SD 3OKNB 2YUXA 4PJEF 4H5SA 2P49B 3PGFL 3DVIA 4JJHA 1PG7H 2CR6A 4PJCA 4LSUH 4OD1L 5C6WH 2V7HA 3NOIA 3VXUA 3MGOB 1LE9A 5I1JH 4LP4A 4RGOL 1UB6A 3BQUC 5DURB 3LS4L 3SDYL 1RSFA 4Q58C 3KJ6L 3V6FB 4JG0L 4EIZC 4QHMB 4PRNB 3EOBB