3RGVA

A single tcr bound to mhci and mhc ii reveals switchable tcr conformers
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
200
structure length
200
Chain Sequence
DSVTQMQGQVTLSENDFLFINCTYSTTGYPTLFWYVQYSGEGPQLLLQVTTANNKGSSRGFEATYDKGTTSFHLQKTSVQEIDSAVYYCAANSGTYQRFGTGTKLQVVPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Single T Cell Receptor Bound to Major Histocompatibility Complex Class I and Class II Glycoproteins Reveals Switchable TCR Conformers.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Yae62 TCR a chain
total genus 36
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2011-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rgvA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rgvA01
3O3DA 2E9BA 3VWJB 1J18A 3QUMA 1QLFB 3VFWB 5IQ9A 2IG2H 3WDHA 1MFNA 3IJSA 3HRPA 5B8CA 3HG1A 2JJTA 3ULVL 1MCWW 3AFLA 3RTQD 5GISL 1Z6JT 15C8L 1FORL 4WIQA 3GBML 2FWOB 3CSYA 4NN7B 3CFJA 4DQOH 1XGPA 4O58L 4HUXA 4DUXA 3QPQC 2EO9A 3FFCE 4DVBB 2FBJL 3BMVA 1MHPL 3EZ8A 2BOCB 5ESAA 3U4AA 4IRJD 4NRYB 4H25A 3SCMC 3QQ4A 1QO3B 3OTTA 2FEEL 1MJ7L 5EORH 5EO0B 3BGMA 1T03L 1FPTH 2A6IA 3NN8A 4JPIB 4D2NA 1S9VA 4H26B 3SN6N 4K3EH 3OAZH 1Y18B 2O93L 2AK4E 3MRIB 4YDJA 3ULVH 4HQQH 1IAIH 2DBLL 4S1RH 5IJVA 4X4ME 4J6RL 1R3JB 2XKNB 2OJEA 3IETB 3KPLB 1P69B 2BSRA 3P4MA 3DYPA 4O4YH 3S96B 2B4CL 4UQ2B 3KXFB 3GMPA 1D5BA 4KJYA 1YEGL 4PREB 1P7QB 3SCMD 1BJ1H 5FUZH 3M07A 4DZBB 4UUJB 5GRZA 3UPAA 3QT2A 2HFFA 5D1QC 5GXBB 4WUKL 2BXYA 2GJ6E 5FXCH 1I8MA 4FFYH 3BP5A 5JDSA 3WUZA 5D7JC 4QY8A 3MRGA 1NUFA 5D7IB 4BZ2H 1XCTA 5EC1A 4JFFE 5JMOC 4Y1AE 3SO5A 4FG6C 3SPVB 3MMEA 1RZKL 4GMTH 2ZUTA 3UTZA 3O9WA 4WCYH 2ARJA 2V5YA 3BFOA 4PLKD 3TPUA 2XTJD 4WEBL 5FKAA 5EFIB 3QJHB 5ERWB 1NFIB 1JF1A 3WUWB 1JFQH 5DJZB 3LQZA 4QY8B 1CWVA 3HNVL 4M6OL 5GJTH 3CIQA 3NOIA 4RAUB 1A6ZA 3BP5B 2FX7L 2PW2B 1FGNL 2AW2A 4NM4H 3MO1B 5CJXA 5F1SA 3G6JE 4G9FA 3MLWH 1I1AA 1I9JL 4K94C 3MLSH 3MGOB 4UAOB 4F7CB 1L4IA 3RQ3A 3IJYA 4PJ9A 5EIIB 4HZAA 3HB3D 1KYOK 1YEJL 4GW1B 3DMMA 3CFBA 4LEXH 1XH3A 1G84A 1L7TL 3ARED 5JW4N 2OSLA 4NZJA 1B3JA 4PRDB 5C0NC 8FABB 3ETBF 5ID1A 3SO3B 2GK0A 4JFHD 4HIHB 2JLLA 4RMTA 1NUDA 4UZGA 1C12A 1RULL 1XFPA 3JTTA 1BVKB 3PWPE 5E56A 5D7LB 4MNQE 1V8HA 4OLXH 3STZA 5KG9A 2GITA 4HXAL 1OGAE 4QOKB 2OTUA 2JCCA 4CJ1A 1MRCL 4PB9L 2BSSB 4WV1C 4M8VA 5FCSH 1LEKB 1IARB 2R1XA 4H8WH 5DQDH 5GIRB 4ONFH 3BQUA 4M6NL 2AI0H 1K9TA 3MRPA 3JTSA 5FDWB 5FGCE 1T21A 1OWWA 3ISWA 1T0PB 2X09A 4JDVB 4OFIA 5IJKA 4M7ZC 2ZCKL 2E5EA 4AG4L 5I66B 1PG7X 3HZYB 3S36L 1NBYB 3SGDH 1I7RB 5L8LB 5IMKB 2V5TA 3UTQB 5HHOB 3SDXA 3MLUL 5EZOH 3SJVB 1RI8A 3GSRB 3MRLB 3V8OA 1T1WB 4Z7WB 3FO0H 4DGIH 3EOTL 1VGEL 2V2XB 4R96B 1PSKH 4LDEB 4OQ1A 2EXWC 5JNYB 3F5WA 2Z0BA 5IEHB 3ZSSA 1AHWA 1YYMH 4U6TA 2GKIA 3I9GL 1CDYA 4F7EB 3IDNB 3VDCA 3QUXD 2BNRB 3BKML 3UBXA 5M95B 3O4LE 1EJOH 4GMTL 3U0PB 1PG7H 5I1IH 2GHWB 5CD5C 5J1TC 3L95A 5EU4A 3SHSA 4E41B 4YQXL 1A0QH 2YPLD 3QCTH 4O51B 3V52L 2CUIA 1A9EB 1E4XH 1QHOA 3MNZB 1IM9B 3HFML 1JL8A 3MLYH 5C3TA 5BZWB 2BRQA 4WUKH 5CMAB 5HD8C 4QCIA 2IALA 2AJZB 5E03A 3VXMB 3MR9B 1LDSA 4NFCA 5D1ZA 3N85H 4FXGA 1TNNA 5IBLD 5EO0A 4KDTA 1KJ2A 5EUKB 1MCQA 2RJMA 1X6NA 1P6FA 2NZIA 1FH5L 4JFHE 5DD0H 1PX4A 3ARXA 2C7UA 1T0MA 4WU7B 1ZANH 3GSXB 4NQEE 4N90D 3HC4H 3JV4B 2JE8A 2ZUSA 4HUXB 2NLJA 4LVHC 4EQ3A 5E8NA 3KDMB 3CSYB 2EDXA 1T20B 2DKUA 2NR6C 1JN6B 3P2TA 4X4ZA 4EIGB 3OXSB 4GLRI 5C08B 1AO7A 3LEYH 4GKZA 1W2KT 4YHZL 2CRMA 3PNWB 3NIFF 2HLFD 3ARDA 4GKSA 1ZLVK 1NQBA 3NGBB 4KUCF 5FA3B 2EYRA 1FJ1B 5JHLL 1FPTL 2DQTL 4NQEB 2OP4L 1ACZA 1DEEB 4AQOA 1DBKL 1WEJL 5IGXL 4N68A 3QR2A 2X4OB 4A2MA 1ZHNA 4NQTA 4R7NA 5I8EB 5FUOL 3RTQC 3FN9A 2F74B 5CBEB 2Q7YA 3QEQD 3TBTA 1CI5A 3QI9B 4Z18A 4P9HL 2R9HD 4YUEL 4HGKC 4DQOL 4AQ1B 4D9LL 4PRPA 3QHFL 1K8IA 2FD6L 4Z95L 3V2AR 1SM3H 1KPVB 5CZXC 4XH2B 3Q5TA 4R4BB 4ZFGH 3BZEB 3BEWB 5I30H 1CD1A 2V9QA 5L7XH 1I7ZB 4V2CB 5D5MB 4Y1AD 1NGXA 5IHBA 3PXJA 4TN9A 4XX1G 5D1XD 1DN2A 3RX5A 5CBEA 3TBVA 3PWPB 4PJBA 1CGSH 4TVPH 3CVHB 4OLWH 1A6VH 4JFDB 3CVHH 1ETZB 1BIIA 1U92A 4IDLA 3UZEA 4M7LL 4KFZC 4KZEH 3B5TA 3EUUA 4O00A 4U1KA 5HJ3A 3Q6FB 3VFTB 3RWJB 2DJSA 5EU5A 3E6HA 1ZGLA 2R2EA 2EKSB 1JMZA 3QYCA 2CSPA 3RZCD 3QDGA 4TSBH 3WLWD 1FGVH 2Y07L 2IPTH 1DQQA 3CK0L 3JVGA 2XXMB 2NY4D 1DE4B 5KS9B 4QGYA 5EC2B 4CMHB 4QXGL 1U2CA 4LFHG 4JFYA 3GSQA 1F02I 1W72B 2RCSL 3MLPA 3T0EB 2Q3AA 4JLRA 2XKUA 5JLZB 2VISB 3OR6A 1MFCH 4NKOA 1OOAA 3TO4C 4XVJH 3C2AH 4CUCA 4PJHE 4PTUB 1CFTA 3T2QA 2AKRB 1PLGL 4PRDA 4OIBA 3MYJA 3QCUL 1EZVX 1YYLL 3NH7H 4GW1A 1ZLWK 3V5DB 1U8HB 5MERB 4QRUA 4QRTB 1G7MB 4FHBD 3L3HB 3OGCA 2YKLL 2O61A 3BT2L 4LSDA 2HMID 5AYUL 3WHXA 3MRLA 4A6YH 4C54A 3PWLA 1U6AH 5MHSE 2APBA 1VGEH 4GW5A 4Z7NE 3A6CL 1QSFB 1WQVT 4POUB 5H2BA 4I4WB 1Q9OB 3QIWC 4FTVA 2NY2D 1UM4L 1NANI 1NCAH 4RZCA 1I1AD 4NQCB 4CVXB 1SJHB 4KROD 4PJ8D 5IFJA 3MXWL 4G5ZL 4GMSL 4LLYB 1J8HB 1QSVA 1P4BL 2IANA 1T2QH 4JPVH 2QKIB 1BZ9A 2ZG2A 5C0GA 2X4TA 1UM6L 4HKXA 1RU9L 4R97C 1MFAL 4OF0A 1JNHA 1QBML 1LQSR 1MNUH 4PY8I 1CD9B 3FN3A 1CDHA 4FFVD 2CD0A 2GFBA 2VABB 4G6JL 2CMRL 1T7WA 2Y5EA 2BJMH 4OLXL 1NGQH 4U1NB 5JW5A 4OD2A 4X0KA 3L9RA 4NZTH 2A6JA 3MRJA 3TP4A 1INDH 4DW2L 4JFDD 2DQHL 4RX4A 1CGYA 2BDNH 4JDTL 4GOSA 4EIZC 3FHAA 1AD0B 5EOCH 3LVEA 1J1PH 4HKXB 1ZXQA 4L3AA 4OCWH 4BFBD 4YHMH 3H2WA 4OZHB 2AQ3A 3N06B 1UWEH 4NZDA 4RGOH 3P9WB 3X12A 5HGDB 5I2IA 4JANB 1NC4B 1HHGB 3QPXL 3MV8A 2VAJA 2FR4A 3GNML 1CXIA 2DQJL 3OR7A 3BHBA 5T3ZD 1G9EA 3FB8B 4Z7VB 2AS5M 1G9NL 4NRYA 5C1MB 1MCLA 4F3FA 2VDOH 1ZT4B 4OQTH 4YE4L 1KCRH 2X1PA 4BZYA 4Z0BL 5CINL 2N7AA 2AJ3A 1OP5H 3VXTA 1I3GL 3MROB 4KVCL 4NHUB 4MJIB 5HSFA 4L5FH 2Q8AH 3VD7A 1ZTXL 3HI6H 2C3GA 1U8NB 1V3KA 4PIRF 4IIQB 1ERNA 3JUZA 3ULVE 4LOUC 1ZTXH 3MRMA 2F19L 2Q7NA 5MEOA 2UUDK 3L5XL 4G9FD 2J2ZA 3WIFB 3CU7A 4FFZH 2KH2B 1TENA 1LNUA 3SKJH 1KYOJ 2PO6B 3AS1A 4RRPG 2B2XL 4GT7A 3VI3E 3RJDA 3VXNB 3GB7A 4D0BA 1ETZA 3L7EB 1FC1A 5D7JB 2OR8A 1ZHKA 5FK9B 4IHOA 2W38A 1YMMD 3EHBC 3BQUC 1YEGH 3TO2A 5IB2A 3TO4A 4OLWL 4EQ2A 3D3VA 5KBNC 3SY0B 3IRZA 3C87A 1QFPA 3LMJH 3U1SL 3TNMB 3ZHDA 2NY1B 2VKXA 5HHXH 3I02B 1H8OA 5FYJE 1J8HE 5A40E 3O0RH 5MEND 1DQLH 3VCLB 2K1MA 1HHJB 3O6FC 4ISVB 4YHPB 2X5PA 1EA9C 2ORBH 3KPSD 1CCZA 1UWGL 3JV6B 5A2FA 3QDJA 4RGMC 4XP4L 5F7FA 2VDKH 4ZUWB 1ACYH 5I8CA 2XFXA 4OKDA 3DJ9A 2BOCA 4GKOA 3UC0H 1U92B 3QNXA 1Q0XH 1F3JB 5DEFB 3UXFA 1OGTB 1J05B 5IMOA 3VFOB 3K2UH 5E9DE 3CFJB 5KSVA 3MRCA 1JGDA 3PXHA 4FNLL 2ITCA 1JV5A 4ODHL 4KUCD 1A1NB 5DXWA 4OI8A 2YD5A 4I0PB 5IW6B 3W9DB 2RGSA 2ICWB 2ADFH 4YZFE 3WIHH 3MSPA 3ULUE 1AXTH 1D9KD 1F3JA 1LDPH 5DLMH 4AM0B 1X5AA 1MIMH 5GZOD 1F97A 4YNYA 3UCRA 2XTLA 1HILB 1TETL 2NW2B 4Y8AA 3H8NA 1P9MA 3BP4B 4Q0XL 3EYOA 2YXFA 1YUHA 3H6JA 3I02A 4NC0B 3DWTA 2AXHA 1MQKL 1N64L 2NW2A 3LKNA 3EYUL 2X4SA 2AJXL 2CIIB 3KPPA 5AZEH 5C07A 5IFHL 4JHZA 3NPSB 5C09E 4P23D 5I73B 1T83A 1E4XL 4XAKE 4YGAB 4XI5C 4CU8A 2MHAA 5IESL 4LHUG 5TF1H 1PGRB 4TSCH 3TBSA 5L2JB 3FFDA 4L9LB 2WANA 5DEFA 4PJDA 4Z7OF 5JO5A 3IFNH 4OCYH 1KJ2L 1G6RL 3NIFE 2A9NH 2H2SD 4A2LA 5TH2B 2VQTA 5CZXD 1PVHA 2R4RL 2ITCB 3FN0H 4P3CL 5IOPA 3ES6A 5DFVC 2PYED 2Q6WA 2H32H 1O7SA 4GRWH 2AP2A 3F65A 1P2CB 2CGRH 3HC3L 3UTQA 4YLQT 3THMH 1NMCB 1QZ1A 4MHHI 4R4ND 3MV8D 2IPTL 1I3RB 5D7JD 4E42A 5SWZD 4PJCB 43C9B 2MSPA 1SMAA 3NCJH 4NCDA 3OKLB 3DSFH 4I18A 5DURB 1TXKA 2FRGP 4LEOA 1GZQB 1F6FB 1RMFL 5J12C 1FCGA 4OZHF 3O2WH 1AQDA 5LAXA 3FT4A 4K9EH 5D2NC 5K9QG 4WGVB 1BLNB 3O45A 4LPVA 4PJFF 1ZLVH 3SBWC 1MRCH 1XGRB 5TFSL 5HGHB 1YQVL 2WWKT 3VWKC 4EDWH 4IMKA 2VLME 2R4SL 1ZS8A 4WY7H 1YPZB 3SJVA 3I3EA 1JI1A 2APFA 4KTEL 5ESQA 4PJAA 4R3SA 2A73A 3GJEB 4HUVA 4K8RL 3DGCR 4ONOA 4U1SA 2IFFL 1CF8H 5JOPE 1KCKA 1TZIB 4K3DL 3WUWG 1ODAA 2NZ9D 2QADD 5DGQA 4YDLB 5ESQB 4KVNL 3PJSA 5FDWA 2NTFA 1QD0A 1YPZA 2V2WB 4L4TD 4XPBL 1RUML 1MCOL 4JY5H 5HGHA 4LCUA 1P7KB 4HJ0C 4XHQA 3FB8A 2VLRA 1KJ3H 1KEML 1JPTL 3OF6D 3MUZ1 4P23A 1GGCH 3U7YL 1P4IH 2AERT 4LQFH 3DI2B 4HKZA 1U8JB 2C26A 1UA6L 1I9IL 4KKBC 1A4KA 1P7KA 3IDYC 3OJVC 1Q8MA 4LEOB 3HNSL 4JG1L 2HG5A 1TZHA 4JFPA 4K7FA 4X6BB 3PJSB 1QQDB 4F15C 1J9CT 2EDBA 3DTXB 3RIAK 1EUUA 2LVCA 1AXSB 2HFEB 2ID5A 1KNOB 4HWBH 4NNPL 3D69A 2F53A 2NZ9C 4WCYL 4RCAA 1U8IB 2W60B 5E8PB 5F7EH 2I07B 1RURL 4UQ3B 1UZ8B 3GSWB 1TJGL 4LU5H 1K8DB 5IHZA 1OAUH 2UZYB 1BREA 3I50H 3JWOC 2AEPH 2R1WA 1K4CB 3B6SB 2YMXL 3V6OA 4G7YL 5BRZA 1MWAH 1OAXH 5BV7H 1HYRC 5MHSD 5DHVH 1WIUA 2W9EH 3QEHB 1NH6A 3NBNA 3GMOB 1EEUA 5DR5H 4OCSH 4P5MB 5DD5L 5DSCA 2B4CH 4Z7WF 3DURA 1EJ6A 4P3WA 5F1IA 3HPLA 2YWYA 2ED8A 4EN3D 4HKBB 1A3LL 2GYSA 5CSGA 2QR0B 3C6LC 1QRNE 2FX9H 4D9QD 1S9VB 3F7QA 4LHUD 2V2TB 1I3UA 2R8SL 3RAJL 4XMKL 3NN8B 1IC7H 3GSQB 2UWEF 2HT4C 4RISH 2HRPL 1LO2L 2XZZA 3S4SA 1A14H 4KKLC 1I4FA 3IAGC 1P4IL 1J10A 4Y4FB 1S7VB 4WW2A 3ZDXF 4JN2A 4PRAB 3BSZH 2NCMA 43CAA 3MC0A 1MSPA 3TVMC 1QFUH 4P46B 4QTHA 4UDUB 3X13B 4HMEA 4MJ2A 1XGPB 1MJJB 4GG8A 4HLJA 1MHPH 5F44A 2O5XL 2FWOA 3NACH 2HT3D 4L1DA 2OCFD 3WFCH 1OGAD 2AK1H 2QSCL 4LSQL 3P4MB 1DTUA 4HBCH 2G75B 4FQPA 1E4KC 3GBMH 3BRFA 4MA3B 1G7MA 1IC4H 1IEAB 5I1HH 3RKPA 2P5ED 3BZ4B 4ZPVA 2P47B 1M05A 2IG2L 3RIAF 1V5JA 5CEZH 1Q1JH 4IOFD 5K9QI 1S7WB 2JK5B 5DEGB 2HVKA 3VJ6A 4ZFOL 4UI2A 4MB5A 4PJFA 4ZSOB 5JLZA 4PJEF 4BFEA 2AXFB 3CDGA 4YXLH 2NXYB 3B3IB 2XY2A 3P4OB 4B7IA 5IV2A 1U8QA 4P57B 1RZ8A 4P5TC 4LEXL 4I18B 3DO7B 2XI9A 1ZGLB 2VYRE 4G8EB 2J88L 5D2LF 2WBJC 4NKMA 5IEHA 5CSZA 4XP1H 3MGAA 3P9LA 2EIZB 1U3HC 4KHXL 4DTGL 5BRZE 1V3JA 3BRDA 1HXMB 2VSDA 2K3TA 5B39G 3E6HB 1U8PA 1RJLA 3VXSE 1KN4L 3MRNA 1I8IA 3I3BA 2VJXA 5KSBB 2WIIB 2EIZA 4LCCA 5E6ID 4IEFB 5D1ZD 4NKMB 5D93B 4U7SA 4GUPA 4WEBH 3SDAA 3BESR 3QEQB 3SKOA 2B2XH 4XMPH 1F58H 4PJHF 5JHDD 3P9LB 2NY6D 5HHVL 5GGUB 1NPUA 2MFNA 5EO1A 4L3CA 4ODTL 5L0QB 3DRQA 5DUMH 4F33A 2NMSA 1YEEL 2YRPA 3WFBL 2F19H 4R2GD 1CU4H 2VZOA 4QOKA 3ZYOA 4DGVL 3U30B 1KFAH 5B4MD 1P6AB 1QLEH 4EOWL 4L4VE 3JTTB 2UUDH 1DP0A 5DHYB 5INDB 3INUH 5DD6B 4MD0B 1AGBB 2QJDA 4HMCA 3D0LA 3MNVB 3LRSB 4GKSB 4P9ML 5BJTB 2Y25A 3GJFH 1EBPA 3GHBL 1UZ6E 3MA9H 1DSFL 1E4KA 4BH7B 1UYWH 1JWSB 3U6RA 4M1GL 4X4MA 4XNZB 2NNAB 2QQNL 3RA7L 4K8RD 1WTLA 5HVGB 4JDZB 2XNAB 3BPOC 4QXTA 5B8CC 5EOCL 1KJ2B 3MV7A 3T0VA 1FCCA 2XRAH 3GSXA 3GO1L 4OAWA 3K2UL 3FJTA 5FYKH 5C0BD 1XGUA 1U0QA 5KOMC 2OZ4A 4QNPE 1U3ZA 1HNFA 4MDJB 4OLVH 3BSZL 2PW1A 2R0LH 1RIUL 4NHCH 3FO9A 1GPOH 4C4KO 2CMRH 3A67H 4OF6A 3LZFH 4ZSOE 1NC4A 2XQYK 2HT2C 4JFDE 1FYTD 4P5MA 3X3GL 2VDRL 2VQ1A 4BFIA 1EO5A 3P0YL 3MXVL 4BELD 2VDLH 4JPKH 4R8WH 2HJKB 4P0DA 1P5UA 2F9BT 3ARYA 1VEOA 3EYFB 5A16B 1A4JB 1JHLL 4PJCF 3L1OH 4PJ5D 1GIGL 3VE0B 1F2XK 1BAFH 3MXWH 3AS2A 2XN9A 4PJXA 5C7XH 3CAFA 2H32B 4FN0A 5F1KC 5E5MB 2W9EL 3ZKXB 3D9AL 2DMBA 4Z7OE 3VXNA 4GLRH 4GAFB 2YRLA 2PYFB 3CDCA 1C08B 4NO3A 5DJ0A 1N59A 1FDLH 1RVFH 4NCC1 1UACL 5DHXB 3OXRA 3RWEA 3SDYH 2IGFL 5TPWH 4N8VB 5MENB 3BH8B 2YD6A 2NY5H 3UTTB 2V2TA 1UT9A 5EUOF 4ALAH 3LS5L 3M17A 4DK3A 4HPYL 2QR0A 4P2CG 4L8DA 3ARZA 5GGTH 1KNOA 3WIIH 2GJ6A 3UPRB 4FXKA 3WJLA 2CRZA 1FYTE 2NY0B 2YK1H 2NY4C 4MNHA 5IEKB 4WW1A 4DAGH 3TYFA 3WKML 3MACH 3LD8C 4KQ4H 1A9BA 4F8QA 1HN1A 4YFDB 5FYLE 5L6YH 3BKJL 5E9DA 1U91A 4XC3L 5D72H 1K4CA 4FXKB 4X9HA 4KDVA 1CQKA 5I73C 3E2HB 5HXMA 4QXGH 3ILQC 3MREB 4UIKL 3EO9H 1MCOH 3NIDE 2Z35A 1K6QH 4NYLA 3QO0A 4YHML 3CC5A 4ETQA 1P1ZB 5CAYB 1P5VA 2XZCH 4FZ8L 2B1AH 4TQEH 4HGWB 4JFDA 4N90E 3V7AE 1OP3H 2L4OA 5F7UA 1D5BB 1A6ZB 4ZAKA 3KGRA 1CG9B 4GSDH 2VMFA 4ESKA 2DQEH 2CLVA 3MO1A 3ABZA 3QIUD 1W0YT 3IDIB 4L4TB 1ED3A 4PGZA 2OX5A 4GRWE 3TO4D 1BFOA 1JGVL 3CLEH 5B38G 3FO2B 3TFKD 1CE1L 2GSIB 4R0LA 2ICCA 5I0ZA 3PDOB 5D5MA 3MJGX 2Q8BH 1XCTB 5EC1B 3MRGB 4DVRH 4WRLA 4MXVE 5HYSB 1T66D 1MI5E 5GHWH 3EFFB 5IVNA 5CJ5A 5I1EH 3KLHC 4MCZA 5TDPB 2QSTA 3HUJA 3RL2A 4WW2F 3QHFH 4MJ6B 3Q5YA 1Q94A 1MWAB 1OLZA 1XMWA 3OKEA 2A83A 1N26A 1XGTB 2SEBA 2J8HA 4QHMA 5LWYH 5L2JA 5K9OB 3D2UD 1S7XB 3WDIA 2R69L 1G7IB 4ERSL 4MCYB 2XWJB 4X5XA 4FA8A 4EI6B 4W6WB 2O61B 3LN9A 1MEXH 1KTLB 2R15A 4G42A 3IFPA 2WQRA 5DURD 3RX8A 5FEBA 4KTDH 3STLB 4UINL 1VFMA 4P59L 1U8QB 4JHAL 4P57A 2VH5L 5I8KL 5T3XL 1TQCC 4XNYL 3EYOB 2J12B 1XT5A 1ZHBB 2X4SB 3OKLA 3D0LB 3V0VA 1I8LC 4PJCA 3QUXC 3GM8A 4HLZG 2DQFB 4HPOH 4HS6B 3V0AC 1KJVB 3FO1A 2E7MA 3MBEC 4S10A 3QDGE 2CK0H 5GJSH 3MLZH 5D8JL 3GBNH 2AEPL 1MFCL 5F1NA 2Z9TA 5I1HL 3SE8H 2OMBA 4IDJH 1W72H 4ZUUB 5IT2H 1K3ZA 1J0HA 5I1CH 5IBTL 4ZTPL 1C5CL 2IAMA 3P30H 1JRHI 4YX2H 5HPMB 4QYOB 4ELME 4X5WA 1EHLL 2P5WE 1UJ3B 3MJ9A 4I77H 2Z31D 3MUHL 4AMKL 4I0PD 2Z8WC 4QRPB 5ENWB 4PRID 1MCIA 1YDPB 3WIHL 2WLZA 2EH8H 1LE9A 4QXUL 1G7IA 3AREB 5T1MA 4XMKH 1R0AH 4P5TD 1U8PB 4Y5VA 1DVFC 4KZEL 4LAQL 3RWGA 4XXCC 4PJFE 1WV7T 3MR9A 1YNKH 3U46A 1P7QD 3HS0A 2ZKHL 1A5FH 2W92A 1FVEB 2ZUWA 3MCKA 3TNNB 3ZE0E 1REIA 1BOYA 2PR4L 3SKMA 5K9KB 1ZHBA 3VG0L 5E00A 5EBMA 2B1HH 2H1PH 1A9EA 2APWA 2XKSA 5GGUA 1F4WL 5GPRA 3RVWD 5KZCD 1QLRB 4K8RH 4MHHG 1INEH 4MGXA 3S5LA 2XICA 5B21A 2R9HC 4ZQKA 4HDIB 4Z95H 1BJ1J 5D2LE 3EW3B 2NY7L 3D3VB 3EDJA 5ADPH 1A1NA 4JHWH 3CFEB 3GKZA 4NN5C 5IMLB 3O9WD 4JGMA 4P46C 1GZPB 1CXKA 4Q9BA 3T4AA 1MFBL 2QQLH 4FQIH 1AGEA 2UY6A 3MJ8A 1EUTA 3PIQB 4I3RH 5EU3B 3VRJA 1A22B 3SGDI 4DUWA 1JN6A 5D6CB 2VN7A 1OM3H 2NLJB 1YEKL 3QQ9D 1UWXK 1YC7A 2P8MB 1UCBH 2FEDC 4U0QB 4JCMA 4JJ5A 3BP6A 3AXLA 1HCVA 4XTRC 1UG9A 3LIZL 5F9JB 4LLUA 5IFAL 3NVQA 1DBML 1S7WA 4MMZC 3QDJD 4Y5XB 2BHYA 2XPGA 3F7VB 1WCBB 5FHBH 1KB5A 3ARBB 1NAMB 2ITDA 1HSBA 1JGUH 4X7TB 3O4LB 1ND0A 5E6YA 1E4XI 3DGGB 4EDXB 4L8DB 3RUGE 4K3GA 1SYSA 1X5IA 5I1LA 5AZEL 3MYZA 4GG8B 3G6JB 3X13A 4RMQA 4F7CA 4YFEA 1AC6A 1IGIH 2ZSWB 2FHFA 3MLXH 5IB4A 4QRPD 3OPZH 3P77B 3FT2A 4JDTH 4O9HL 5E4IA 4WFHE 2CUMA 3RL1A 4PRHD 3RWIB 5DJYB 4TULL 5T1LA 4LMQE 5HDLA 3ARGC 4NJAH 2AQ2A 1R3KA 3EYQC 1DZBA 5F1OB 1EERB 4POYA 1XF2B 4UQ2A 4KUZH 5DJZA 2PUQT 1DBAH 3WUWA 4DN3H 5BQ7B 5A3IC 3QJHA 5DLML 2R1YA 1CTNA 4ZFFA 2BERA 1J0YA 1ZLSL 3IDGB 4L29A 5I1EL 2J8UB 2DYPA 4PV8A 3UDWC 2H8PB 1RZFL 4P23C 5CLWA 3B2UD 3QIWD 4ZO6A 4J6RH 3TA3D 4F57H 5JDSB 4ZFFB 1IC5H 5HVHB 1UB5B 1JYXA 3IKKA 1L6XA 3IGAB 1BD2B 1MLBA 1OPGH 3JWDC 1NCAL 3WHXB 4PJ5E 1RHFA 3LB6C 2A9MH 5EZLA 2IPUG 1QSFA 1L6ZA 4NSKB 2VDKL 3VFUA 4M48H 3N1PC 3C60C 2ZNXA 3V0WL 1NC2D 4LNRA 5HI5C 1BOGB 3KXFA 4UNUA 3ZDZE 5C07B 3WFDL 4MB3A 3MYJB 1KTKE 3VGAB 4JQXC 4CW1B 1CFTB 2YD9A 1TJIH 4N0CD 1BZ9B 5HHMB 2ZPKH 3ECBB 2FYYA 2Y23A 1SJXA 5GRJL 4UIKH 3V7MA 2HT2D 3ZZ1A 4DUVA 5L0QC 5C0CB 5JW4R 2Y1VA 3GMNB 3NMEA 3C6SB 4WO4A 3N50A 1BFVL 4FTVB 1ORQA 5D6DC 3UPCA 5JPMB 3TN0C 4Z6AT 5H2BB 5KOVC 1MCPH 4OIIL 2NW3B 5DMGD 3VFPA 1K3IA 1KLUB 3LN5A 1UXWB 1KPRB 3MACL 3GEWB 3O81A 4N1EA 2V7HB 4DAGL 1RK1B 4KK5D 3GMLB 2V5RA 2MMXA 1IEBB 2NNAA 3EDKA 2X4RB 1JTOA 4BZ2L 4Y89A 5DI8A 2EE3A 1R5IA 3L3GB 3Q6GL 4U6YB 3LEVL 4ZS6C 1I9RH 3SQOH 3T0EE 5HYQA 5IK3A 4I2XA 3QFJB 4HEPG 3NZ8B 4DKFL 3OKYA 3FTGB 4CKVX 4A6YA 1I8KA 5DK2B 1FLRH 3G6DH 5F7YC 5C09D 3I6LD 4IRSC 3VI4E 2X10A 2RBLA 2VR5A 2WWKO 1BJMA 5CKGA 1QLRA 1CXLA 5F7KC 5E95B 3MGTB 5D6DA 3OJMB 4RGOL 1Z9LA 2AJUL 2CDEA 4ZQKB 1WISA 1OWRM 1A7QH 3BUYB 3LS4H 1CL7H 5LVEA 1CGUA 4PYHA 4PY8J 4S1RL 1DVFA 1IAIL 3FQTB 4PR5B 2DQHH 2BHUA 1OTSD 3D48R 2VDPL 1A1MA 3QDMA 1EMTH 1KN2H 2E27H 2WP3T 4WWID 3G6JF 1INQB 1F4YH 3ILQD 3IVKB 1CFVL 3WN5B 3FOLA 4IOFC 5ADOH 5FA3A 4Y4KA 1AD9B 3ZT7A 5EORL 1RUQL 4QHNA 3LQAH 3ARDB 3PNWA 2K7QA 4PFEA 4ZFOA 3FQUB 4OD1H 5CILL 3RWGB 1BVZA 5BW7A 1IM3A 3T0ED 2IFGA 1WC7B 1RSFA 1BFSA 2ZUQB 5HHOE 2WBJA 5E8OA 1HQRB 4NWUL 4KVCH 4UOW1 4X80H 1AP2A 4YHLL 3GRWH 4ZDHA 3MBED 2DQCL 3BN9C 5AZ2L 4K07A 4AK1A 2BNQA 4NBXB 3CX5K 1DL7L 3VXRA 4KRPC 4NT6B 1OGAA 1UB6A 1SJEA 1UM4H 1OVZA 1NDGB 2AXFA 3CDGB 2YPKA 5ECJE 2HRLA 1F90L 3RNKB 3SGJA 4JM2A 4XNXL 5IBLC 4YC2B 5F71A 4WFHD 5MEPB 1WBZA 4NGHL 4J1UB 1FHGA 4N9OB 1VFAA 3MNWB 1SMOA 1YPZF 4Y1AB 1N6QH 1NDGA 3MUGA 1TFHA 3MOQA 2FB4L 32C2B 2ZUUA 4OUUB 3VH8B 2YZ8A 4NQEA 4JY4B 3VD3A 5I1DB 2EYRB 5HHME 4KTYA 5BS0D 3GIZH 1FZKA 4GG6B 1CU4L 1AFVH 1QEWB 4RAVB 2VXTH 4NZTL 3R06A 3HFMH 4M48L 3V52H 3QEQA 2MQ3A 1XGYH 4WU7A 3V4VL 1NGYA 1HINL 3W2DH 5I8CB 3BZFA 4F57L 5DJ2A 3NTCH 1Q72H 3MUJA 2CQVA 2KZ1B 3MRHA 1FNGB 2IPKB 3C09B 4IRJB 1PSKL 5ISZA 1NGZA 4GFTB 4F7TB 1N6UA 3OKEB 4PLJD 2DS4A 5DD3L 4QRQA 2IBBA 4YDVB 5E1AB 1ES0A 2XZQL 5CGMA 1TVBB 5MP6H 3QXAB 4XB7A 4R0LB 2MKLC 2DM7A 1FZMB 2VXSL 4G9FE 3QULA 4OLUL 1Z9MA 3DUHA 4X7DC 1YPZE 3Q48A 5EOTA 2FECI 1OP3K 4AENB 1BGXH 1N7ML 5JPMA 5I1KH 2FJFA 2LAGB 3R8QA 4JPWL 1K5NB 4MNGA 1RAMA 2VLLA 2EDWA 3P77A 3W0WB 1DQDH 4DKEL 3L3DA 2P5EE 4JFQB 4JCLA 1TTUA 3CXHJ 4FTVD 3BGAA 4CU6A 3CFBB 3BI9X 3VXMD 5J13C 3OG4B 3QCUH 1VADB 4UT7L 4XP9L 2CXGA 1ZVSB 4Z8FH 4L8CB 1F11A 3ZDYF 3OWEA 4GAGL 3WSQH 4JM4H 5TDOA 1IC4L 2DTMH 2AKRA 1S5HB 3MLTB 3ULVF 3OKDB 1WZLA 5E2VL 3TH3T 3T3PF 1MJ8L 1YEJH 1O7VA 3RU8L 3SQBA 4HWZA 1GAFH 3W81A 4G8IA 4WI4A 2R1XB 1QFUL 1ORQB 3OKMA 1WFUA 2Z8SA 4LGSB 4LHQB 1JNHB 2HJFB 3MV8B 2DQIL 4MA1B 2J4WH 1DFBH 3KJ4B 4G8IB 1VENA 4K94L 1SY6H 4OGYL 1ZEAL 3SDAD 5EOTB 5J3HD 1G9ML 5SX5K 4V1DB 1UQSB 5EN2A 5H37G 5I1AA 3RWCB 2GK0B 2Q1EA 5JW3L 3NIDF 4HWBA 4X7FC 1U36A 1PD6A 4PY7A 3LPFA 2ZCLL 3WLWC 1TZIA 1TDQA 3QUZD 3H9SE 4PP1D 1IEHA 2IQ9H 4FFWD 1UJ3C 1Y0LB 3HA0A 1MUJA 1CFSA 4KV5E 1M1SA 3KAAA 3UROR 2DICA 4Q9QH 2OL3L 3ZE2E 3RZCA 3BO8B 2NYYC 5EZLB 3SDDD 2OQJA 5J11B 3HE6A 1XF3B 5A2IH 2FIKA 4XVTL 1YQ2A 2BVTA 5JOEA 2VL4A 1G7HA 4RGNE 4NKQB 2HJKA 5DQ9A 2X4TB 1A6TA 4KWUA 5F7DB 3MODH 3HHRB 3FT3B 5ACLA 1XR8A 3D69B 4NUGH 5EULV 4YUEH 1O5DT 5EPMA 2D7OA 2NX5E 2ESVD 1G7QB 3LRGA 3UYPA 1CD0A 1W8NA 1K4DB 4FQ2L 4OFYD 3S3JA 4FFWC 4PUBL 2ARWA 5E7BA 2Q7YB 3V5HB 1NFDE 3JZ7A 4H25B 2ZJSL 1SEBA 2R0ZH 2WW8A 4JN1H 4R7NB 5I8EA 3UTSB 1I1YA 4X83A 3MRDA 3FO9B 4YBLB 3RVVC 3MTRA 2V9RA 1HOCA 1I85C 2UV3A 1YJDH 4H1LG 1BD2E 1JPTH 1LE9B 4GKZB 3QIUA 1BFTA 1WBXB 2HTLD 2X40A 4AG4H 3UJTL 3HAEA 4RQQA 2AABH 5K9JH 2HT4D 4YHOL 3VXRB 4ZAKD 5GS0D 2FBJH 5C0AE 3VFWA 3F7YA 4YFLI 1IZKA 4YXHL 1BQUA 4S1QL 1JV5B 5AAWA 3IXAA 4ZOAA 2EIDA 4S0TD 5IJVB 2LE9A 4PB9H 5EUKA 4RBPK 2DDQL 3QIBA 3HC0A 3MRKB 2UZIH 3HZKB 4JO1L 4FFVC 4N5UA 4QRSA 4QHNB 3O4LD 4J1UA 4H8WC 1OCWH 4HIXH 3WN5A 5HDOA 3T0XA 2MCPL 4HDIA 4LLUB 4YK4C 4J3SA 2AXJA 3TBYA 4YGVB 4YIQB 1UM5H 4JZNA 4ISVA 4WWKC 3QI9C 3REVB 3VXPB 5HD8D 3LV3A 4JM2C 1ADQH 5FUCC 1BQSA 2CDFB 4XP5L 3DUSA 4DGYL 4LHUB 4FQCH 4KMTH 5ANME 4Q6YA 3KPRD 5DO2D 1G9MC 2EE2A 1HZHH 2ZG3A 4XPHL 1U41A 1SYVB 4NJ9H 3VXUE 5AYQA 1H3GA 4LF3B 4D8PA 3OKKB 4WHCA 5DJDB 4OB5H 4JRXA 4IRJA 3OAUH 1IAMA 3HE7A 3P11H 5I16B 4XCCH 2HH0H 4MCZB 2NX5A 3H0TB 3WIFA 4NM8H 3OKKA 1ADQL 3IFNL 4OCYL 5I1GH 4YHPA 4HK0A 3JV4A 4ONHA 4HT1L 2A77L 5CSZB 2DD8L 1YNTA 2JIXB 1QEWA 4LCYB 4JRYD 4PBVC 1IBGL 3MX0A 1OT2A 5DT1H 4UT7H 3OV6A 2I60L 4JO1H 4V1DD 4L4TA 1KIPB 2VR9A 4WEMB 4S0SD 3BWUC 5DJ8B 3D85A 2A74B 5L88L 3B43A 4P5TA 1FZJA 3C6SA 4E9LA 4NQCE 4BSJA 4TPRH 2HVKB 3GK8H 4M03A 1CE6A 4R2GC 4YEEA 5F3BA 5F6HI 4MZ3A 2W1NA 4U7MA 1L7TH 1ZWIB 3G9VA 3K3QA 1D5MA 3VXQA 1NAKH 4Y2DD 1N0XH 4ETQB 1RJYB 3RWDB 4YHYB 3FFCD 2C1PA 1PYWB 4U1MA 1ZLUK 4NYLB 1LHZA 2Z31A 5TQ0L 3X14A 3ARFA 3E0GA 4R90L 4QHLB 5MP6L 3LKPA 3GSNA 4MWFA 3DARA 2NY2B 1NJ9B 4HQQL 3A6BH 1QACA 5GZOC 1JGEA 4XBGB 1S7XA 3WNLA 3L9RB 1A6AA 2ZSVB 2A0LC 1J0JA 4KJWD 1P53A 3DMMD 3HTLX 2ZOKA 4IRSB 4KKAD 4NWUH 3C5ZA 1R3HA 4U1NA 3VRIA 4NN6C 1HINH 3W2DL 3WE6A 2XA8H 3G08A 4QRRE 1LE5A 2Q76B 1A02N 4XGZA 1YJDC 3NAAH 1FNFA 3GMNA 4HIIB 4HXBH 3U82B 3S3PA 3RWCA 5C0CA 4OZ4B 5I1AB 5EPMB 4RWYH 4RIRB 4XAKD 2ORBL 4LLYA 1BQLL 1JGLH 4PGCB 3DX7B 1V3LA 1Z3GH 5EU7E 2DB8A 3W11C 2F5AH 5GGQL 3ROLA 4G9DB 5DK3A 4XWOC 2J6EL 4LPTA 4I4WA 2H26B 3FB5A 4NGHH 4PJDE 4D0CB 2EYTA 4MJ4A 1B0WA 1MHCB 1VB9A 4O5LL 4KKAC 5C7XL 3MRJB 2OS7A 5JIIA 5GGVH 2A2QT 3C9NB 1X5LA 5JW5B 1T6WA 1JTTA 5C07D 3SDXB 1KCUL 3ARPA 3D5OF 3HE6B 3VWKD 4JG0L 5IK3B 3EJJX 3WHE0 4Y4HB 2VZTA 2VLKD 5F9OL 5FV2A 3ZDXE 3O8XA 2YEZA 1KCSH 4N8VG 3AAZA 3ALPA 2PTTB 2Z92A 1JRHH 2OK0L 1J8HA 4JO2H 1I75A 3BIKB 3T04D 4YHNB 4XC1L 3W11D 4M93C 3MRQA 1KPRA 1RZJC 4N0RA 1ND0B 2HA1A 4MX7B 3O6FA 4J3OC 4WWKB 4HZLA 1XGUB 4GRLD 3QEGL 2N4IA 3QDAA 3ARGD 3QH3A 5E99L 4DVBA 5J4MA 3WS6A 3C08H 4Q9CA 4JREC 4WJ5B 1AR2A 1JZ4A 2DQJH 2I9LB 3IDXL 3NFNA 4CAGA 2UVFA 2YSSA 3EKCA 4KAQL 1XR9A 3V8CA 4WENB 5H37H 1WJ3A 2V2WA 3V6ZA 3KPOA 1JHTB 3TBWB 1DSFH 4OFVA 4ZMAT 1YMHB 2E9WA 2V17L 3UTPE 2CKBH 2WBKA 3CXHK 1QR1B 3T77A 4APQD 3FRUB 1PEWA 4GRWB 3IDMA 3D6GA 4C83B 4HJGA 3D18B 5CIPB 1P7HL 4HX1B 3TA3A 3RY6C 4KRPB 5E9DB 2EIBA 3PHSA 2H32A 1J7VR 3NFPA 3PP3K 1INDL 5DFTA 5KAQG 2GJZA 1NMCC 4DKFH 1F3DJ 4OLUH 1KGCD 4J3WA 4MA8H 1U58A 1J5OL 2IADA 2Y7QA 1WAAA 3HCVB 2P7TA 1IGTA 1VFBA 4H1LH 4XZUB 1N3NA 1HHIB 1OD7A 5GS1B 2IEPA 1KCSL 4D9QE 1VSCA 5T1DH 4Y1AA 2NQCA 5ACZB 2RIKA 1H0DB 1CIUA 4NM8L 5KN5A 5D7IE 4JRYE 4FG6D 2CR6A 1KCUH 3R0NA 3ELAT 4K71B 2KUTA 4PJAE 1AJ7L 1RPQA 4RAHA 5EA0H 5LG1A 5EU3A 3VRJB 4WFGD 1NLBH 4Y19D 5A1AA 4XNMA 4EZMA 3RGVD 1PG7W 3C5SB 4DN3L 1VGKA 1C5BL 5J13B 4ZG1A 4DTGH 2QLVB 4H5SB 1WT5A 4AEEA 1KEGL 5DA4A 3S98A 2G60L 5DJ2B 4PJIE 2OR7A 4FQCL 3HUJE 3DLQR 2ZSWA 4G8FA 3AY4C 4YDIL 1E27B 1BPVA 4BJLA 4HH9B 1KBGL 4JR9L 1XGQA 3SDDA 3VH8A 4RGND 2X2YA 3O3EB 1CD1B 5GGTA 5KSAA 1HHHA 2P44B 1IJ9A 3CFKB 2MPAH 4FOMA 3AS0A 1CE6B 4BQCA 3O4LA 2F58H 1Q1JL 4HG4K 1GVIA 1RV6X 3KJ4C 1F00I 2Y06H 4UTBL 2VO5A 3TESA 2OR9H 1UENA 1W72A 2CRYA 2VAAA 4QO1A 1NBVL 3C60D 1PKOA 1LK3L 2Z4QB 2AJSL 3CDFA 1F4HA 1M4KA 1P9MC 1U95A 3QNZB 2QSCH 3L5JA 2Q20A 4PRPE 5CEXA 3PE9A 3MJ9H 2H2PC 5C0AA 3UAJC 1MF2L 3VWKB 3KPMA 3MA7A 4G6KH 4ONHB 5EUOA 4MWFB 3SDAB 1MIEH 3HUJF 4TPRL 4ZYKA 3OL2A 2AGJH 4JN2B 4OCXH 1H15A 1MLCA 5D1QB 3CZFA 1QSEB 2CJUL 4PRIE 1DLFH 3GZKA 4XPGL 2PCPA 4FABH 4H88L 2BOBB 4OGXH 2VDPH 4NO0B 5B38B 2SEBB 4TYUA 4MJ5A 3FQXA 4OFYA 5EBWB 1A7OH 1MWAA 1I7RA 5ALBH 2VDNH 4XVUD 1MCRA 3RNQB 4LBEB 1IGCL 4ZTOH 4NP4H 2NY0C 1S8DA 5D7LD 2HVJB 5J12B 5FB8B 4MAYC 4DZ8B 1DUYA 1JZ7A 3ULSB 3C6LB 4EXKA 4C59B 3C8KA 1YNTB 3LHPH 4ONGL 5D2NB 5CZVL 5EUOE 2F54A 3O4OC 3I85A 3IS1X 3BQUD 4WO4B 1DBBH 5E6IA 3HE6D 2BVOB 5ID0B 5I18L 4LCIL 1AHWB 4U1GB 5HI3C 3OZ9L 2PR4H 1KENL 3OJDB 4DFHA 1HZHL 4XPHH 5DZOA 3RZCB 5D7JA 2JB5L 5JW4Q 2ZP0T 3IFOA 4KMTL 5GSVA 2IPUK 3FCTA 3B9KD 4DGYH 4UB0L 4KKCC 2RFXB 5T33L 4IIQA 4W81A 4TVPE 4U4BA 5C2BL 4RQQB 1AO7E 4DKAA 4V1DA 2FO1A 4OSUL 2D7NA 1X5KA 1A6WL 1BQHG 2QEJA 1QYGH 2WZPD 4WI3A 4ELKB 1AGCA 5HHMD 3JUYA 3E8UL 4KRLB 4QTIL 3AROA 4LP4A 3LN5B 5DUPH 5JUEL 1OW0C 1AR1C 3FQNB 4JO3H 1HHGA 5DUBB 1G0DA 3K80A 1FZOB 1OAZL 3X17A 1JYNA 3U2SA 4N1HB 3BHBB 1BD2D 2NX5D 5IM7B 1N4XL 5BZWA 2OM5A 1A3QA 1F6AA 4X6CB 1C1EH 5B3JE 3TZVC 5DDHB 3GSNL 3EYSL 4ODVH 3H9SB 4OF3A 4JRWA 4JY6A 4N8CH 3OHXA 3PL6B 1FFOB 3ZKND 1DBJL 1A7NH 3FRUA 1JZ6A 3BPCA 3F7YB 2CO6B 5IB1A 3KLSA 4XNYH 1A0QL 3EYVA 3MFGB 4N8VA 4OZIB 3BX7C 1OSZB 3GKWL 1M71B 4PJBE 2QL1A 4PG9B 3B6SA 2X7LB 4O02H 2R1WB 4UIMA 3F5WB 1Q9KA 2H26A 3C60A 1IGYA 1A7OL 1YYML 1RK0B 1U3JA 1NCDH 2EDTA 4M7JH 2ADIB 3WL9B 4U1IA 2BNQD 3GGWA 3FMGL 3Q3GB 2KQNA 2VQUA 1W0WA 4X6DA 4H0HB 4M3JA 2EYSB 1PBYA 1RZIA 2DQUH 4LRIC 5KTEL 4P4KB 2W0LA 4KDWA 3NCJL 2DYPB 4PV8B 5D2LA 4F2MB 5KW9H 3VFGH 3I2CH 2BP3A 5KTEH 3HPLB 2VWEE 1YEFL 4QHKJ 1VFUA 3CZJA 5CBAA 1VACB 4OI7A 4LLVB 1C5CH 4DOHE 2AI0L 4OZFH 3BD5A 3T08A 5DJXA 3SGJC 3HRZB 3ARDD 3T2PA 2WP3O 4MS8C 5F89A 3QQ4B 5I71B 2HFFB 4B53A 4YBQD 4HXAH 3BH9B 5TE6L 3T0AA 1UKQA 4ZAKB 4EJ1C 2FGWH 3QDHA 5FKPB 5T1LB 4Y19A 1B9ZA 4TOYL 2NXZC 3QUMH 5C6TH 5IB3A 1T1YB 4NO2B 4XRCA 4M9PA 3EYSH 1BP3B 4CL7A 2OSLB 4LVEA 2WK2A 4YWGL 4G6FB 1ZEAH 1BJ8A 4WTWA 2FHCA 2ZCHL 4KK8C 5B8CB 1ZWIA 3IETA 3EIFA 1CFNB 2FBOJ 2Z31B 4L8SB 3P4NB 2VISA 5C0BE 1KXQE 1CXFA 1U8OA 4PTUA 1KIPA 2VIRB 3MLWL 4MS8D 4PJIB 5GRUL 3RU8H 2YBRB 2X70A 4NM4L 4CADB 5T3ZL 1FZJB 2PXYB 4G43B 4LQ1A 1DQML 4P5TB 3G08B 3BEVA 2XN9E 3C5ZB 4JFYB 4AL8H 2ESVE 2JB6A 3WXVH 1DE4A 1CLYL 2BC4B 2NXYC 3MLVH 3V4UL 2VZUA 4AY0A 4DCQA 4I0PA 5EOQL 2EDLA 3CH8A 4J3UA 1T2XA 3S3SA 1T22B 2EC9T 1NBZB 2DKMA 2CLRA 2NY6B 1MCDA 2ATKB 2BHZA 3UC0L 4ZPTA 4HWNA 1P84K 4XWGL 1U3YA 5IB5B 3C5JA 4MDIA 2IGFH 3RI5K 1UWGH 4QWWC 3MNVA 5JO5B 5BVJB 2ZOLB 1BLNA 4QGTA 5DD1L 4PRNB 2VXSH 1LO5B 4U6HB 2XZCL 4FZ8H 1RJZB 1MHCA 2PYEB 3NCBB 5GRVL 2NY3B 2PKDA 4XP6H 1FNEA 4M43L 3FHQA 3SGKC 2IAMB 4DZ8A 4GAJL 4X6CF 1HIMH 3Q2CA 3FFCB 4GAYB 1JHLH 2WINA 3K74B 3VI3F 1HQ4B 3ZMRA 3MXVH 3P0YH 3WXWH 4EI5A 5J7CC 5D72L 1OSPH 2PYEA 5ICZB 3V4VH 5SWSB 1NDMB 3HB3C 1PY4A 3QJFB 2E7BA 3D39D 2BCKA 2OL3A 2PN5A 3DVGB 3AREA 4LLMA 3IFLH 3QFJA 1X5YA 4Z7UF 5CUSL 3RKDC 3SDDC 4K7PH 1KG0B 2VDML 3L5XH 3ET9F 1N6VA 1MVFA 4NQDE 1BVLB 3VGBA 3TPKA 1R24B 3GRWA 2XNAA 1IEBA 1CLYH 4JFFA 4GQPH 2AAVA 1EVUA 3N1GC 4F9LC 5JHDB 1T66C 5GS2D 2OBGA 2HJLB 3O6LH 3T0WA 1QR4A 5T3ZH 1HKLL 2FGZA 3EDEA 4L1HA 1NC2B 2ADJA 3PQYB 3SGEI 1INQA 1JPGB 2KQMA 2Q87A 3ZTJG 1RZ7L 4CU7A 1DL7H 4K9EC 2ZUYA 2XWTB 4UINH 5I2IB 4HC1L 3MRKA 2J5LC 4YO0A 1HWHB 2CKNA 2FX8L 1J1PL 2GEEA 2VE6A 4XPTL 2LTQB 4Y5YB 4JZJB 4X4YB 5MEQB 3U0PA 1QLEL 4NT6A 2BDNL 2VXUL 5DMYA 5HDQH 1OTUD 4U2ZA 3MUY1 4J3VA 4E41A 4PBXA 3UTTD 5IIEA 3HLAA 3LZFL 1ZHKB 4HCRH 3ARSA 1MPAL 3HAEB 4NUJA 4Y2DA 5HYIA 1S9WB 3D87B 3CCHA 2H41A 5JTWA 2FIKB 3QIUB 4HX1A 1OL0A 4XNMB 5FFLA 3LSOB 3DIFA 4MXWL 1OSPL 5F7HA 4Y4KB 5C6WH 3ZE0F 1GSMA 1JPSL 1U93A 5KVFL 2EXYC 2OXGA 4G6AC 1MQ8A 2YPLE 1HIML 2Q8BL 3HN3A 3K8KA 4L8SC 4OIAA 4OM0L 1ZKAA 5C3LD 1Y6MR 4OJFH 2CPCA 1FRGH 1DN0B 3QDME 4HUWA 1EH9A 3I6GA 1T0NA 2WWMC 1AXSA 4EVNB 1T5XA 2R2HB 5E6IC 2V7NA 3JVGC 3U9UA 1T80A 5DWUH 3EAKA 2VKWA 3TO4B 3REVA 1X5JA 1X5HA 4TULH 3VXPA 2HAZA 3WO4C 1A9BB 3E3QC 2GW5A 3C5ZC 4LARL 2GAZB 3VJ6B 1M7DA 1ZA6B 5IG7A 1FVDB 3OG6B 1QFHA 3ZYIA 3V6OC 2FL5B 5FYLL 2I60H 4BK5A 4L8CA 2MCG1 1YYLH 3NH7L 1PKQA 2EDYA 3IU3B 3MLVL 2Z35B 1YZZA 2CLRB 2FO4A 1S5HA 3MLTA 5C9KA 1P1ZA 3PP3H 3UTSD 2A38A 1ZA3B 4PJHA 4PS4L 1FE8L 4D3CH 3C08L 2VC2L 5C0DA 1FVDA 3WYRA 1QFWI 3SJVE 3MZGB 4JKKA 3QPQD 2DI8A 1KB5B 1OLLA 1T7ZA 2X4QB 4G7VL 1RUPL 4PJ9C 4FZEL 4FQLH 3ZKNC 2RAMA 1CXHA 1NFIA 2AVGA 2EECA 3IJHA 1UH2A 1N0LA 3D1MC 5I17A 2VR4A 5CJXC 1Q38A 4U7KA 3CFDB 4LPWA 4NOFA 2NY5L 3AXLB 4ELMA 3LQZB 1ES0B 3CPLA 5HI4D 4RFNC 3VFSA 1PJ9A 4YWGH 4KQ3L 5D7KE 5F9OH 2R8SH 2FIRT 1R5VA 1DDHB 4FTVE 2E9JA 5C6TL 4E0RB 4HIIA 3SGKA 3T65B 5D7IA 4Y4HA 3RRQA 4CGTA 3H3PL 5L2KA 1IGJB 3QWOB 4OCSL 2H2SC 1QBBA 3PQYE 4AEHL 4Z7QE 4OV5A 1HHKB 2ATPB 2NY3D 5E5UB 3CVHA 1MHHA 5GS0L 1NGYB 2FLBT 2BSRB 5FIEA 1BD2A 1MLBB 4R8WL 5C0RL 2KDGA 1NJ9A 3ROLB 3ZKMD 1SBBA 2FEEI 4OV5B 3FT4B 1F4WH 2VLMD 5CJBA 3BP7B 4MNQB 3QWOA 5C0GB 4X7SH 5DRNB 1FL3A 4QOKD 3A67L 4DEPC 1NCCL 4YBQC 2DKSA 4NNXB 3EYFA 4APQC 3QXAA 1TQCB 4K7FB 1WITA 1CD8A 1HH9B 3QISA 5I15H 1YECH 1PEZA 4C58B 3K2MC 4GW5B 1I8LA 4R6UA 3V6FA 2UWEA 1UA6H 3DV4B 3FB6B 4JZOB 4TRPH 4X6EA 2DQGH 3QXVA 3OKMB 3MV8E 4LQFL 1B4JH 3D25B 3WNMA 1S7TB 3G5VB 2MKWA 5K59E 4R90H 1IKNC 3W0WD 3GMMA 2ZUXA 5ENWA 4TVPD 5J06A 4LPCA 1JWSA 3U6RB 1JE6A 3AMKA 3X3FL 4BH7A 1NAKL 3WJJA 3QIUC 5HDBE 3P30L 1MOEA 4KRNA 4U31A 5L8JB 3S35H 3O3DB 1FFOA 3QO1B 5AG8A 3MODL 2AJSH 4GRMB 3LSOA 5EU6E 2UZXB 4L3EE 1E4WL 5C9JB 1CZ8L 1DBMH 4XVTH 1QLFA 3JWNC 4JFZH 1RUKH 4P2QE 2EE6A 1ZS8B 4HFUH 5F1NB 1CVSC 3HMXA 4LP5A 4XBEL 3MLYL 1DVFB 2R4SH 4WY7L 4YJZL 2FH8A 5CMAA 3UZQA 1A6WH 1UCBL 2GT9A 5ANMB 1HNGA 3UBXG 5E6IB 2X89A 5F6HJ 3T1WA 5DC9B 5D2NE 4NC2B 4JHAH 3HPJB 5L2KE 3BP6B 3BDBA 1MH5B 1FNEB 4PPTA 5JQ6L 2P8MA 5E4EC 1DUZB 1FFQA 5AUMB 3SDCB 1K8IB 4BSWB 3WXVL 3H9HA 3QQ3A 3GMQB 4NWTH 2BNRE 3ARBD 3U46B 4RMSA 1DLHB 3QCVH 5K93A 4ZAKC 5GS0C 1EGJA 3VFOA 4CJ0A 1U93B 3ARRA 5EU7C 3BAEL 4I0PC 5D1XA 4LMQI 3K1KC 5HGBB 4KPHH 3WFZA 1INEL 2QHRL 4ZNEE 4I1NB 4G6MH 3VGAC 3FN0L 3GIVA 1OTTC 4P3CH 3HR5A 4M1DH 2R0WL 4NDMA 1R5IB 3IXTA 2P45B 4H8WL 4LPXA 5DTFA 1FO0L 3WIHA 6CGTA 3X3FH 2WBJD 4XH2A 2UWEE 1WUNT 4HD9A 2D03L 4XB8A 1FYTB 4TUOB 1U95B 2E8ZA 3GSVA 4G6FD 1J5OH 3VMPA 1B4JL 1BECA 1G0YR 1AQKH 32C2A 1CTOA 1JUFA 1KXTB 4F7MB 2DDQH 2IH1B 2APXA 1RUKL 2CJUH 2XQYG 1PZ5B 4XPGH 1E4WH 3ZKQD 1MAML 3OR7B 4GRLA 3T0EC 4KKNA 3U7WL 1U8OB 2BFVH 3QWQB 4LNVA 1VA9A 3WFCL 4KJPD 5D1QA 3SDCD 3QAZC 2YPKB 1RMFH 2R23A 3D18A 4WI9A 4LKXA 5I71C 2EDEA 3DX9A 5M7QA 3O3BA 1H3UA 2YC1A 4ZTPH 5CEYB 1YN7A 3VXRE 4Y19B 4GXVH 5C0BA 1L7IH 4S1DC 1KXVC 1AIFA 1NFDB 5CEXB 2FX7H 3FZUC 1I4FB 4Z5RB 2ZJSH 3PV7A 5GRWA 2X4UA 1EEYA 4TUKL 5F8RC 3IKCA 3LRHA 4FQHB 1VKXB 1FYHB 3LH2L 4OF5A 3B2VL 2GJ6D 3HRZA 3JXAA 4N0FB 4E0RA 3BIAX 1Y6NR 3TIEA 3LKQA 3QXDB 4WHYH 3MMEB 1R5VB 4OM1H 2JB6B 3WHE1 4H1LB 3LDBC 3BEVB 4N8CL 4K8RC 4JB9L 1EV2E 5IROC 1T6VN 3V5KA 3P9MB 1MQKH 1N4XH 5D7SH 3KNBA 5E2WH 2DI7A 1N6QL 4U1JA 3MOAL 3STZB 3R1GL 5IB4B 5DFWH 3CX2A 2ESVA 1IAII 1BBDL 4HWZB 1CFQB 5E08H 3ARTA 5DJYA 3MFFB 3MZTA 3NCMA 1S78C 3BKYL 4X99A 3G5XB 2EEBA 4P2OA 5ICXA 5I8OH 5KVGH 3C5JB 2P46B 4U1JB 4O2EA 1AC0A 1VPOH 1G9MH 1H3XA 2ERJC 2HTKC 2H9GB 4WDIB 1E6JH 3IU3A 3RDTD 3HI5H 3BDXA 5JXEA 5AZ2H 2W9DL 2K7PA 4KC3B 3NFSH 4MA7H 4FNLH 3W0WA 5DRZB 1KEMH 2BSSA 3TH4T 4KJQC 1D6VH 5J89A 5H35A 5JXAH 2NW3A 4K7PY 2D7TL 2PTUA 5KSUA 2DM3A 1CFBA 3S35L 2ZOKB 1RZJH 3DO3A 4X98A 1A6PA 1FORH 1NKRA 5F93C 1QKZL 2FJGB 1C5DA 5DWUL 4D3CL 2CKBL 4RNRA 4RMUA 4GAGH 3WSQL 3RIFF 4NO0D 1KELL 3F7PC 3BIBX 3BIKA 6FABL 1VEPA 1QR1A 4WNQB 5TQ0H 1I9EA 5FYLH 4P2OC 3REWB 3RJQB 1MI5A 2R39A 1AD0A 3QFJE 1ZT1A 1AH1A 4JFQA 2W65B 2B0SL 4Y4KC 4BKLA 2VLJB 1GGUA 5I9QC 5DVKA 3FCTB 4PJDB 2X9WA 4F9PA 1OAQH 1OARL 2EC9U 4J4PD 4Q9RH 3WKMH 2PO6C 4Y2DB 1EO8L 4NSKA 2QADC 5C0ND 3FQWA 2VERN 4HZLB 4MAYA 1EZVY 3SQOL 2BJML 1EHXA 2VITA 4JO2L 3QDJE 5DJXB 3TJHD 1JF6A 5C0IB 1S3KH 5DRZA 4G6KL 1E6JL 4NRXA 5C0EB 4GW4B 2GTWA 4RA3A 1RU9H 5ABDE 1TJHL 3HS0B 3T1FA 4FQXC 4RGMB 5I1JH 1Q72L 3T2NH 5DUBA 5K9KA 4Q6IC 3BKYH 4HC1H 2ARJQ 2JIXD 4U33A 4J8RA 5D2LB 4F2MA 4Z0XA 4P4KA 4WU5B 4Q58C 1BBDH 2VL5B 2Y06L 1IKFL 4KK5C 1FFNB 5HGBA 3B4NA 3U4BL 5EO9B 2Z91B 3GNMH 3VFRB 4HIJA 3CSGA 2VZVA 1QFWH 2G2RB 4NUJB 2P48B 1GZPA 3CMOH 2NY2C 4QXTB 4XXDA 4HMDA 2MPAL 4JFEE 4EEEA 2GY7B 3S7GA 4JDZA 3O3BB 1C16A 4UIMB 1I3VA 4URTB 1HYSC 1AP2B 4Y7MA 2WSKA 4TVSa 4XMLL 3PHQB 4ZUTA 5CEYA 1R3JA 1YA5A 2GTZB 5IQ9B 4X4YA 4RA0C 4K3JH 1DUZA 3VFRA 4WW2C 1S9XB 4P48A 2DQDH 2X4PB 1UKTA 3EO0A 5DGRA 2YUXA 2IH1A 5DJAA 3FOLB 1QVOB 2P8PA 1FL5B 4AEIH 3JV0A 1EFXD 2FGWL 1AXTL 1HSAA 4NBZB 3KR3H 2P5EA 3D85B 4N0UA 4LAJH 1B6UA 3ZYZA 1I7TA 3UO1L 3KPTA 5GGSA 1H3WM 1V05A 1MCEA 2BNQB 4NDMB 3LB6D 3MV01 5KSAB 2QQKL 5LKNA 1G7LA 4L9LC 4CMMB 4EBQL 3TLRA 4M7KH 3O3AA 4HH9A 3LN4B 2M1KA 2Z93B 3NPSC 3X11B 4X5LA 3RWJA 2BRRH 1OAYH 3DUUB 2Y5TA 1EO8H 3H42L 3VXUD 5HVFB 3N0PB 1CGXA 3CLFH 4LIQH 2ATKA 1SYVA 1G6RA 4BZ1H 3CFCH 1T22A 2XFXB 4I13B 2A74A 1HEZB 3O2DA 4I48B 3UDWA 4HS6A 1ZGLP 3ZT5A 3H7LA 4GAJH 4LK4A 5HY9B 3JV6A 5DD5H 3DO7A 2WBWB 2X9YA 2LU3A 4AZ8A 1KIUA 3F12A 4GQ9L 4NQDB 1EFQA 1KJMB 1GGYA 1D6EA 1OAXL 5BV7L 1T04B 4G6ML 4QNPF 3S34L 5DD1H 5CGYD 5D71L 3SE9H 3PDOA 2YMXH 4YIQA 3OAUL 2ZOLA 2FD6H 3H0TA 1DVFD 2FECL 3FONB 4TTDC 3VWJD 3LEVH 4LCCB 4OLZL 3PWUB 3IS0X 1NLDL 2K9UA 3OKOB 5EBWA 4XP1L 1RURH 3WO3B 2FSEA 4OZHE 2I9TA 3FOMA 1NEZA 4NWTL 4X9GA 2DLTA 5C0FA 1J8HD 5SX5H 1IQWH 3QZWG 1OP9A 1NBZA 1R3IL 3RVXD 4HG4J 3HUJB 3RL2B 4J4PA 1SJVA 1KPUA 4XNUL 5HGGS 1S7TA 1ZT1B 1BOGA 1BEYL 3TM6A 3TT1H 5ITBH 1ZHLA 3S6CA 1CDBA 1JZ5A 3W82A 3WLBA 4PJ9B 5AD0A 1JZ8A 2QADB 1IQDA 1QRNA 1W0VA 3VWKA 2MCPH 1DFBL 5T33H 4X8JB 3FB7A 1J0ZA 1EEQA 3LKSB 4GG6E 2PXYA 4G43A 3Q0HA 1J12A 3KLAA 4BUGA 4OCNC 2X05A 4MD5B 2NR6D 1QRKA 4MAUH 4OI9A 2R29L 2JK5A 5DEGA 2GSGA 4PJBF 5I0DA 1DQJB 4IJ3B 4NO5B 2F8OA 4KK9D 4FQXB 1CDIA 4EI5D 1FFPB 2FR4B 3V0VB 4YFLF 5KJRH 5C6PB 2KZWA 3KYKH 1YN6A 5FM4A 4O51A 5C0CD 1XIWC 1QSZA 3L95B 5EU4B 2A73B 3GJEA 3B9KC 1S7QA 1S7UB 4P4RB 3BP7A 3RP1A 4UILL 3AAZB 3S97C 3GMMB 2A6KA 5D70H 2DWEA 1MREL 2ADIA 1KTRL 2E6PA 4TNWF 2NY0D 1A7RL 1D9KA 4KY1L 3VXME 4HHAB 1DCLA 4KI5E 4PRIB 1H5BB 4W4OA 3CLFL 3T77B 4E5XB 4LSVH 4ZD3L 4Y16A 2EXYD 3Q5OA 1AQDB 3RGVB 3DX7A 1YEFH 2YUZA 4WNQA 5FOBA 3OSKA 4EI5C 3VD5A 1CDGA 2NY4B 3D39E 4EUPB 1X7QB 3NFNB 2MJWA 1KOAA 1BBJA 5T1KD 1TZHB 2XXCB 5ALCH 3KYOB 2FEDD 4XGZB 4JKPL 3I3DA 5FF6A 3EGSA 3PV6A 3UYRH 2F5BH 4OT1L 5IVXA 2BVQB 1LK3H 3QIWA 5H35B 2KPNA 2CO7B 4U1IB 4OZGA 1CK0L 3KYNB 2IMNA 1F3RB 5LBSH 1RK0A 1YMME 3DX8A 4I8DA 4GJTB 4PG2A 5JQHC 3NFPB 2VSCA 2ZCLH 2BSTA 2F58L 4NQXA 1QPPA 3FZUD 1S7QB 2DMKA 5DT1L 5IIEB 1D5XB 1FNAA 3W9EA 3WFHA 5KJRL 3GSNH 4ODVL 4RFEA 3ARQA 5CEZE 4WTZG 4RAVA 3DX9B 5ITBL 3VE0A 2FZ3B 4P49A 4M5YL 3NGBC 1KBGH 4JR9H 3DGGA 4EDXA 1M7DB 1ZA6A 3T4AB 4JFPB 1JHTA 3U7YH 3CSPA 1WCBA 4YBHA 1T89C 4L4VA 3SO3C 5T3XD 4H26A 3L3IA 3T0EA 3TZVD 3W39A 1DANT 3P11L 2G60H 5IF0A 2HKHH 1LO0H 2OJZH 3QQ3B 1C5BH 1ZAGA 2R2HA 4TUOA 4PJIF 3I6GB 5EBLA 2BY0A 5C09B 1DN0A 2R56L 3U79A 4K3DH 2ADFL 4BK4A 4EUPH 1KPVA 5HBBA 1QNZL 3GMRA 5FO9A 1T5XB 3MLRL 3LKQB 3QXDA 1JCKA 4X80L 1DQQB 1EAJA 1V7ML 3P40A 1T4KA 4TOYH 5DQDL 1QUNA 1EIBA 2Y72A 1SEQL 3B2UC 4CN6A 2W0KA 4NP4L 1AGEB 4Z78B 2E9IA 4EUPG 5TDNA 1M7IA 3GI9H 3IXTB 1U3HB 2JJTC 3CFCL 1C8PA 3QUMB 2DLEA 3OZ9H 4Z5RA 2NX5B 2VOTA 2DQEL 4XCEB 3QRFM 3MJ7B 3MV9D 3KG5A 1H15B 1N7MH 4HFUL 2E7HA 1BIIB 4PGBA 3FFDB 2YPLB 2MHAB 3PF2A 4MYWB 3GMPB 3MJ6A 4OV6F 2B1HL 5CD3B 4I3SL 2AJUH 1GOHA 2ZKHH 3F12B 4OM0H 1YY8B 3D3VD 3BVNA 3DV4A 3MJ9L 1H3PL 3UJTH 3QXTA 1ONQA 1NCWH 5IV2B 4L3CB 1I9JH 4LBEA 1I3RA 3QUXA 3QI9D 1KELH 5GS3A 4DOHB 2E7LA 3R0MA 3QAZB 4ZPVB 3FKUS 5DYOB 8CGTA 3RTQA 3GKWH 1I9RL 3SKJL 5I15L 2EICA 4FFZL 3SJVD 4KQ4L 3CFKA 3O2VL 4R2GB 1MCJA 5C0JB 1J1XH 4Y16C 4Z7UA 5HDQL 1TPXC 4JJHA 4O2CB 5CIPH 1ITBB 4ZS7L 1I7UA 1A64A 2CKBA 3T3ME 1AGFA 1JK8A 4M8QA 3MCG1 4OBRA 3KWWA 2NY1D 4E41E 3C6LD 1W72L 1KTDA 4X4XA 2HP4A 4G8GD 2MOVA 1FVCB 3ZKSD 3RTQB 2O5YL 3KLDA 3SDXE 4J2XA 2FATL 3HZVB 1RZ8B 4XPAH 2VAAB 4QF1B 4HJ0D 3B9KA 3WS3B 3QZWB 1A6UH 4NC1E 4ZO8A 4NN7C 3UEZA 3QWRA 3VXQB 3PHOA 5SV4A 3HZYA 4LLMB 5F3BB 3S4SG 3U4BH 1A6UL 2BCKB 5EZJA 4N0UE 2EDNA 5DD6A 3LDBB 3QWRD 1A1MB 4P5KB 3VDBA 5LCVL 5T3XH 5I8KH 4JE4B 4EUPA 4HUUB 2EDHA 3BKMH 4XNUH 5CKAA 4GW4A 4C56D 4XMLH 5JW3H 2JJWA 3VD4A 2XG4A 1MAJA 4N1CA 4LCWD 2M26A 2GITB 5FYJH 2YD3A 5D7LA 5KG9B 5IVZA 5JNYA 5E2UL 4LNRB 3LQAL 2YS4A 4LRNL 3QIBB 2DWEB 4HXBL 1MJ7H 3IDNA 5I18H 3ARFC 1EAPB 5BMFH 1EMTL 2E27L 5EDXA 2A83B 4HJJH 1IL1A 2GFBB 2OQJB 4BKLB 1ORSB 3RUGF 5D71H 3SE9L 2KKQA 2P42B 3QO1A 4TUKH 4HK3N 1NFKA 2BXZA 3L3GA 1FIGL 2OL3B 5DO2C 1GXEA 4O58H 1K8DA 2HFEA 5IHZB 2D7QA 4JDVA 4MVBC 1NBQA 4M6NH 1CL7L 3HE7D 4UQ3A 5HHPB 4ZO7A 2DTML 3IB4A 5HHNB 5DFVD 5F88A 2ICES 3KYOA 4AT6B 4GXVL 3RY4A 2GTWB 1LO3L 1G7PA 1UYWL 4LPYA 1U8JA 4KU1A 1UQSA 5EN2B 2FJGA 3GHBH 4U1HB 4XNQA 2I26N 5T3ZE 5JA8B 3GMOA 2B4CC 1R3LB 3SKNA 3ARBC 4OGXL 2HN7A 3R8BB 3LKSA 2C9AA 3TC9A 5E99H 3VGDA 2OYPA 2NPLX 1FN4A 2P43B 4LSUL 4JFOA 3HI1B 3KXFD 3PGCB 4WVRA 5F7LB 5AYUH 3BW9A 4PP2A 4F7PB 3GB7B 4D0BB 4GBXC 1G7PB 5GGSY 4G3YH 4NKDA 5C70A 4KJPC 5IBUG 1IAOA 1JIBA 4GXUM 1MF2H 3IDMB 4X8XA 5DVMA 2XTJB 1S7SA 4F58L 5E70A 2M8XA 1A6TB 2HT3C 3NFSL 2PTTA 2C3VB 3MRMB 1F4XL 3FRPA 5MEOB 2XYCA 5CINH 2W60A 5E8PA 1HI6B 3UO1H 4WUUE 4OQTL 4ZFZB 3EHBD 3V4PL 1T1XB 3H9SA 1IL1B 3PP4L 4OBSA 4R26H 5KVGL 3BW9B 4F7PA 3NTCL 3QIWB 35C8H 3BWAA 2BVQA 2X44D 4WW2B 2BVPA 1VACA 1IAKA 4Z7VA 5CBAB 3BJLA 5GRJH 2IH3B 3SCMB 2KBGA 2DQDL 5B3JF 5A16A 4MA7L 4IOIB 1FO0A 4BH8A 3K4AA 1X5GA 3AC0A 4KHXH 2AEQL 5FYJD 1N2RB 3O9WC 5FYJL 4I48A 4G80B 4LLAA 3NABH 2DAVA 2EZ0D 3EYQD 1RVFL 5D6CA 4EVNA 4JQIH 3GSOA 3OXRB 1A2YA 1AKJD 5EU5B 5A3ID 3AY4A 4LCCC 3VG9B 1RZIB 2GJJA 5LCVH 4WFFD 1R3HB 1P7QA 3WNOA 4MLSA 5FYJU 3X11A 3QQ9C 4Z76B 2DL2A 5FO7A 1CICD 5HGAB 2NY7H 4PRBA 4S2SA 4PLNC 3M8OH 1HKLH 3DIFB 1I85A 3FONA 3WJJC 4GG6A 4XWOD 2O5YH 1HWGB 1I7UB 2HTKD 3K7UA 3HAEG 4QHLA 1X4YA 4WFGE 3VFGL 3X14B 1F4XH 4EN3A 4YHKL 1K85A 3RWDA 3G04A 2P24A 4Q7DA 3L3DB 1GPOL 5IUSA 3T4YA 3NAAL 3HMXL 3MBEB 3TN0B 5FUOH 4Y4KD 3P3YA 2Y6SC 3O41A 4FQQA 5FM8A 3RNQA 4YNYB 4UT9L 1R0AL 4JQVA 1L9MA 4Y5YC 1OQOA 3ZHKA 4C56A 3IU4L 5D70L 4PLKC 5EC2A 2R0ZL 5FV1L 1TVBA 3A6BL 4U1GC 1KSRA 3B83A 1JNNH 2WV3A 4FMKA 1AIFB 1NFDA 3V6BR 4RRPA 5DS8A 1F4AA 2VRAA 1VDGA 3DYOA 1T7XA 3RDTC 1KCVH 1BVLA 3ARFB 3FOMB 2N7BA 5I1LB 1X9QA 1UJ3A 4XVJL 5DR5L 1KPUB 4RSVA 4ETYA 3BZFB 5HPMA 5F7NC 2D7TH 3DX6B 4GXUN 3FAWA 4H20L 4J4PC 4JO3L 1U3HA 1C7SA 4YHIB 4HJJL 4PYGA 5C8JB 4QTIH 3DXAA 4QRRB 1ZMYA 2DQFA 2WINB 3ULSA 5HYFA 1DUYB 5E2UH 3QJFA 4OSUH 4RBPH 1GOGA 2HVJA 5HHVH 3NA4A 4M02A 3O4OB 3QEUA 4F33B 4AENA 4IMLA 5JOFA 5CD3A 4QEGA 4MSWB 1UWXH 4FQ1H 4UNVA 4MAYB 4WV1A 4NQSA 5EBMB 4M1DL 5B39A 1QPXA 3F6IA 3KHQA 4U6HA 3SKMB 5E94A 4MD4A 1MCPL 2BOBA 5KSBA 3CZFB 4GKNA 2RFXA 5LWYL 4QWWD 4R96A 5JR1H 5D9SB 5D1XB 1YNLL 3BD3A 1T1WA 2FDBP 1GGCL 2CLZB 4Z7WA 5L2KD 5E2WL 1LO0L 5IVOA 3SDXF 2HFGH 1QG3A 5DK2A 2ED7A 3GSUB 5JHDA 2J8OA 4JFZL 1XEDA 5CP3A 4LCWA 4G7VH 1KT2A 5TDPA 5I30L 1XZ0A 1AO7B 2XIDA 5DF0A 4WFED 4Y88A 1T20A 4XHJD 4O2CA 1T21B 2NXYD 5DI8B 4MQSB 3MV9A 1ZT4A 4YHOH 1IRAY 3ALXA 2H45A 3CGTA 4ZNEA 3CLEL 1Q9LB 3STBA 1J1XL 1AD9A 3VXTB 3QRGL 1QSFD 2I5YL 3O2VH 5CCKL 1JNNL 4IJ3C 4WI2A 4P9HC 5JOPD 5I19L 3NIGE 3QDMB 2PXYC 4GSDL 4L8BB 4PJGF 4UDTB 2A9ML 4CMHC 3PV6B 3IU4H 5HGDA 4AIZA 2X4PA 4LVOB 1URLA 1UFUA 4YHZH 4Y5VB 3PL6C 1G7QA 3KS0J 1J1OL 5HPOA 4OT1H 3L5WB 5T5FL 2EEDA 2PNDA 3IXAB 1MRDL 2G9HA 4ZUVB 4JM2D 3X12B 1RD6A 5JPNB 5FOBB 3HMWH 3W9EB 1UB6B 5E5RB 3RGVA 3S5LG 3I84A 3KPQB 3QHZL 4W4NA 3DVIA 5BV7B 3TBWA 5J57B 2BSTB 1YMMA 3N1FC 5EO9A 4TRPL 4FS0A 2W59A 3L3KB 3VXRD 1Q9KB 5EBGA 3MROA 5C0RH 4XXDB 3F7RA 4H5SA 5FKPA 4D0DA 4D9RE 5I75C 2IANE 1RHHB 4RFOH 1JPFB 3GI9L 1NKOA 1BZ7A 4QT5A 3QDJB 1JMXA 1RQ5A 4APQB 4J8RB 1A21A 4P4KC 2IWGA 4PJ5A 5EZIL 1T5WB 3O11A 1IGTB 3JSSA 3H3BC 1A7PH 2VXTL 2WLYA 3KYKL 1WIOA 3CPLB 3H9SD 5EBLB 4CADA 1B2WL 5E7FA 1LP9A 1MCCA 2H6PB 4Z7UE 4NFBA 4NPYA 4AYFA 4OTXH 4QHKI 2IH3A 3SCMA 2OL3H 2H2PD 5ILTH 1X5ZA 2C4FU 4NJ9L 5T1KA 1IGYB 1NMAL 3C60B 4YDKL 2R29H 4L4VB 1EDQA 3BWAB 4UNTA 3R4DA 1LD9A 4MJID 3DV6B 4P3DB 1NFDF 3Q3GA 1RUPH 3RL1B 5KVDL 3E8UH 1NL0H 3FT2B 1GIGH 5L2KB 2DM4A 4R7DB 1MAKA 1D3CA 2R23B 4R26L 4HV8B 1WSST 5GQBA 4IMKC 1FE8H 5MERA 1EEZB 1BEYH 1U8LA 1CBVH 5ETUA 1NAMA 1LD9B 4P3DA 4J23A 7FABH 3WNPA 1CLZL 2BNRD 4PJDF 1SYSB 1BIHA 5JIKA 5EU6D 1RIUH 5AWNH 4MA8L 3CFDA 2UZIL 3G6AB 3SE3A 1K5NA 2D4FA 5F9AC 3RBSA 5IHUH 4CNIA 5FCUL 4RAUA 3IDIA 4K7PL 5I76A 2AXGB 1Q9OA 3SGEH 1CL7I 5GSRB 1RFDH 4F15B 2LV4A 3D0VB 5ADOL 2B0SH 4LARH 5HYSG 2X4UB 1KJMA 3P0VL 4IRSA 4NQDA 4QRRD 2LU7A 3QEQE 3IDYB 1A6AB 1ZHLB 4WDIA 1JGEB 5TDOB 3F58L 3L3HA 2BK8A 1XH3B 3LMJL 5FHAH 2WM0A 3N1QC 2VLRD 4Y16B 4IIQC 5F3HA 3AM8C 4L4JA 2XTJE 1IGCH 4ODWA 2QSQA 2NXZD 4ZTOL 2FSEB 1RZJL 2ICWJ 1IAIM 3F8UB 3PWPA 2QSVA 3HNVH 3PWUA 4M6OH 5GJTL 4XPFL 4OD2B 1AGBA 5GSVB 1CFQA 5B22A 4C55A 1PY9A 4UOJA 3KPSE 3U4EA 4D0CA 4G8GE 5B4MC 1JF1B 5LGHL 1IT9L 2APVA 2XZQH 5E2TH 3QUZA 4PB0H 3TIEB 1RJCA 3BDYH 4C4KT 3U30C 3LPWA 1MCSA 2AEIT 3UTTE 3PQYD 5CS7A 3C6LA 1P4LA 4U2YA 2GSGB 1RIHH 4JZJC 5FUZL 3O8XB 2ILLA 2YEZB 2R1YB 4Q9QL 3MCKB 2VB5A 1PKQE 2ADJB 3PQYA 4R97B 5FM5M 1G9NH 2PCPB 1DQMH 4PJ9D 1C08A 4NO3B 2AK4D 1TPXB 5DVOA 4HKJB 4NQUA 2B8OT 3HZVA 4AEIL 3MV9B 3O6KH 4PJ7F 3PWJB 4JO4H 5FDYA 2AJXH 5JPNA 2VXUH 3QUYA 4IBLT 5DS8B 3BN3B 1T0MB 4XVSH 1WBYB 3B8YA 1OD9A 5F97E 4IS6B 4QRPA 4RWYL 3PWJA 1U8MA 2X1WL 3U83A 1R3IH 5J9PB 2JJSC 1MH5A 1FG2B 1FFNA 4FQLL 1FNLA 4OF8A 1GYAA 2X4NA 3QUML 1KEGH 1KULA 4Z0XB 3UTSE 1JPGA 4U6VH 4FXGB 1CFVH 2QTEA 4AIZB 1NLBL 4XX1E 1KN2L 1TQBB 1SY6A 4N8PA 4ORGB 1ZGLM 1U8MB 3TNMA 1MFDL 3KJ6L 4LSQH 1CS6A 4F7EA 4PRPD 1TCMA 4Q2ZA 4JRXD 2IBZY 1TCRA 4G3YL 1S3KL 4DFIA 2GJZB 5E8NB 1X6LA 5GRYA 4JRYB 5EU6A 3L7EA 5FO8A 5T1MB 3VWJA 1DBAL 3M45A 4IRJC 2VXVL 4GKNB 1YEDA 1GGBH 4RISL 5JW4M 3H42H 3DVGA 4YEFA 4LSPH 5LJYH 3FMGH 4P2RB 4S11A 4Q9RL 3O0RL 1OAKL 3MRDB 5EU6B 2EC8A 3IT8D 5KN5B 25C8L 4MQXD 2CDFA 1PX3A 3OQ3B 4Q2ZB 4LSTL 5CLTA 3BKCL 3EOAB 3TZVA 4MJIA 1SEQH 4MXQD 5GGRA 4BH8B 1FO0B 2D31B 4M61B 1VERA 2NY1C 3QDGD 4WUUD 3B3IA 3TCLA 1GGIH 4R4BA 3BZEA 1PLGH 5E9DD 1EFXB 3IDXH 3HZKA 4QRSB 3QEHA 2EH7L 5I76B 4U0RB 1AI1L 5BRZB 1N3NB 4CNIB 1NGWB 3TN0A 3QEGH 4WGWB 1FL5A 2IF7A 3GI8H 3VXOA 1ED3B 5JDJA 4PJ7B 4U6VL 3EOBB 4Z7NF 3ROOB 1XF1A 3VDAA 1ZHNB 3RY6A 1I1RA 1WGOA 3U0TB 4XCNB 2DLIA 2FO4B 2Q86A 5TDNB 5TJWK 3HZMB 4BSVB 3W5NA 3PGDA 3SKUD 4WFFE 2OK0H 1C16B 3E3QE 3T65A 1X4ZA 2UYLB 3AU1A 3HI5L 2DJUA 4LHUA 1MJJA 2HWZH 5IW1B 3AUVA 1T83C 1VGKB 3CMOL 4U3XA 2X89D 3MV11 5BXFB 1F90H 3O6KL 4MJ6A 4FQIL 4LLQB 4M7LH 4XBEH 5T1KB 5IP4A 2AXGA 2E6JA 4PJ8C 4LDLB 3O41B 4FQQB 1G1YA 1GC1C 2YBRA 3O9WB 2VIRA 5HYJD 3FAXA 2AJYH 5ILTL 4V2BA 4RDQG 5IHLB 1H0DA 3M1BB 1CICB 2DQCH 1RIHL 3L3JB 5FKAB 5ETUB 3KHOA 2D4DA 3QNYB 5ALCL 5DJ6A 5CZVH 1BQHA 3RKDD 4WI7A 1NC4D 3ARWA 5E1HB 1IT9H 5D1XC 5T5NG 3HE6C 5TE6H 1VADA 4KUZL 5EB9A 3B9VA 4QTHB 1XCQB 1MUJB 1UADC 4G9FB 3A0OA 4ODBD 3ZL4L 1KIRB 3ZKXC 3WXWL 1UVQA 5IG7B 1DBKH 1WEJH 4Q97A 3DVNB 5K9OA 5KVMC 1S5IL 4M00A 1RZFH 5KANG 1XGTA 3OAZK 2VE6B 4U49A 4M43H 1RJYA 3RPKA 2PXYD 2D7MA 3VRLE 1N5AB 3UMTA 1JHKL 1PDKA 2B5IC 4NQCA 4CVXA 1C5DB 1F6AB 4KI5D 5CZKA 1A3RL 4U3CA 2GK2A 3QXWA 1LP9E 1KIQB 3PHOB 2VZ3A 5FA4B 3U7WH 1MRFL 3GHEH 4L8BA 4HIEA 2WUBL 2VUOA 3Q6GH 2IAND 4MD5A 3N85L 4JFFD 4KRMB 3RBGA 1IGIL 4WO4D 1J87A 2XV6B 1T1XA 5L88H 3WE6B 4HPOL 2X7LA 5I19H 5EOQH 5D7IF 3DSNA 2AK4A 3ZSTA 4GO6B 2Z92B 4UOW0 4UMGA 4OZGE 3VA2C 5IKCB 3BN9D 1ZK9A 1UGNA 5HYJE 2R56H 5JZ7C 3C2AL 4NKDB 4Z7WE 5DVNA 5I8OL 5DMIH 1S7SB 3RHWF 5I75B 1MFBH 2CIKB 1IQWL 2MQCA 1JWUA 2FJHB