3RGVA

A single tcr bound to mhci and mhc ii reveals switchable tcr conformers
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
200
structure length
200
Chain Sequence
DSVTQMQGQVTLSENDFLFINCTYSTTGYPTLFWYVQYSGEGPQLLLQVTTANNKGSSRGFEATYDKGTTSFHLQKTSVQEIDSAVYYCAANSGTYQRFGTGTKLQVVPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Single T Cell Receptor Bound to Major Histocompatibility Complex Class I and Class II Glycoproteins Reveals Switchable TCR Conformers.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Yae62 TCR a chain
total genus 36
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2011-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rgvA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rgvA01
1NUFA 4OB5H 5EC1A 1P7QD 3OXRB 3DRQA 1AGEA 3CZFB 4O2FA 1LD9A 4YO0A 4QHKI 4PLKC 5BVPL 3W9EB 1REIA 4IOSD 1MCWW 4ELMA 4Z18A 1JZ4A 1S7TB 1JV5A 3DV4A 3GSVB 5JHDB 2JK5A 4F15B 2NXZD 2BX5A 4RFOH 3FMGL 3KPOA 1JGVH 2PYEB 2VOTA 2E27L 2YD1A 4ZMAT 3AREB 3P30H 3C6LA 1JWSB 4NBZB 2BRRH 1JHKL 3MROB 4E41B 3QUYC 4ZOEA 3M8OL 5C0GA 4LLUA 2VNCA 4LASL 1ADQL 1CE6A 3B9EA 5CEZE 1MCBA 1AR2A 2Y9RT 1VESA 4OQTH 2OMBA 4LLQA 3BEWB 3EKCA 1QYGL 2VWEC 3TCLA 1XAUA 1T1XB 3D0LA 4FTVA 1BOGB 1T0PB 2FX9H 4WFHE 4KHXL 2C3VB 3KPRE 2CLZB 3JVGA 1TQCB 1YY8A 2XRAL 3BXNA 4X4MA 1Q9KA 2YMXL 3TO2B 3EO1B 1A3RL 3WIHH 4ODTL 3TT1L 4LF3A 2A83A 3VWKA 4X80L 4P2RB 2J6EL 5EBWA 4BH8B 5CP7A 5HI3C 3S5LB 1KIQA 2FZ3A 1JNHB 1AY1H 1PAMA 1KB5B 5DJDB 5SWQB 4UUJB 3KJ6H 2DQJH 3QQ9D 3VFMA 3ZYOA 2CK0H 4QRRB 2KPNA 5IHZB 3D2UD 4Q9RH 1VGEH 5CZXD 1X5GA 1AGCB 1HSAA 2OI9C 5HDBE 1ES0B 4KTDH 4XHJC 3FOLB 5DO2C 3AS0A 1CLYH 4PGDA 5IW3A 1KN2L 5IFHH 2YEZA 4WTWA 4YDIL 2VAAA 4NZTH 1ITCA 4KKAD 4D3CH 2XG5A 3MMEB 4APQD 3VWKD 4LSSL 2BY0A 4RA0C 3QDJA 4QHKJ 1I8IB 1OOAA 3GK8H 4UNVA 5INDB 2A6DA 3IJHB 3QEGH 4PLKD 3SKOA 1BX2A 3V5DA 5J3HD 1BFVL 2QADD 1V7ML 4O5LH 4UT9H 2CK2A 2OR7A 3NFPB 3GBNH 1I7TB 4NQDE 4LHJB 4P4RB 1RIVH 1NC4A 1QFWM 3X12B 4BZ1L 2AJ3A 4XHQA 1FGVH 2OP4L 4JRYB 5IB3A 3GFUA 3LH2H 4S1QL 1KENL 5K9OA 2FO4B 2GSIB 2KQNA 4WU7A 2CGRL 2CO6B 4RBPK 5E2UL 3MNZB 3GSOB 3LRGA 4U7MA 1NGQL 5ADOH 1B6UA 1C7SA 1FNHA 2APBA 1MHCB 4IRSA 3P9WB 1Q72L 3SDXB 2C1OA 2BJMH 3HC4L 3GI9H 1BD2B 2QSQA 3MLRH 3S96A 1ZHLA 4OM0L 4QWWC 5E8DL 1FE8H 2RJMA 5CSBA 1D7FA 1I8LA 9CGTA 1B0RA 1T4KB 3JTTB 3U36B 3GMLB 2Q8AL 3RVVC 4AIZA 4WEMB 4TQEH 1Y18B 1T6WA 1ZT7B 2JCCA 3ZTNL 1ZVHA 3ULVL 1E4KC 4OZIA 2FR4B 1TZGH 4NQCE 1N6QH 4JJHA 5KG9A 5CZXC 4UILH 5FB8B 4MXWH 2NXYD 1MFAH 3MLYL 3T1WA 1U93A 5I1GH 1J8HD 1FL6B 1RUQH 1GAFL 4RMVA 2LV4A 3MBEC 4PB9L 5TPWL 1EO7A 2VDLH 4R2GC 1CICC 1G1YA 4JQVC 4RZCB 1T21B 4U1JB 2O61B 5LCVL 1UWXH 3QP3A 4QOKB 1JMZA 1QEWA 4DKDC 3RWFA 2KL6A 3ZDXE 2H3NA 4MS8C 4QF1B 5EB9A 5IMMB 5IMLB 5D7SL 5HGHB 4N68A 4W81A 4XP4L 5BVJA 5E7BA 2AP2A 5CIPH 2F8VA 2R2BA 1FO0B 5A43C 5DDHA 4K8RH 1URLA 1UKQA 2A77L 3QIUD 2A0LD 1MUJA 3ES6B 1NCTA 1YN6B 3BPLC 4PRAB 5DMKA 3ARUA 1S8DA 1H0DB 1BLNA 1QBLH 2QEJA 2B1AL 1NFDB 2WIIA 8CGTA 4Y19A 4GRMA 3NACL 4UT7H 4YDVA 4TUJA 1QSEA 5EZJA 2IFFL 4I77L 3L6FA 1K8IB 1MFBL 1JF1A 5GS0H 3P4MA 2UYLA 2NY3C 4X80H 1GC1C 3QA3A 4XC3L 1PG7X 3LZFL 1I9RH 4GG6E 4AG4L 3QULA 1ORQB 4GKNB 2YPKB 4M7JL 2XN9E 3MLZL 1K4CA 3S8WA 3BZDA 4LLYA 4HIEB 3Q5YA 4KKNA 1S7SA 3Q6FB 3TZVC 2HJFB 4RIRA 1MFNA 3BUTA 4QF1A 2AEQH 3BP7A 4OZHA 4OCRL 3TNMB 1RZJH 4WHTB 3FT4B 1BVKA 1NCDL 1OGAB 2MKWA 4F3FA 3JV5A 1LWRA 3CVHH 2EKSB 4TTDC 2FL5B 3FB7A 4R8WL 2CK0L 5C08B 5CEZL 5IHUL 4MVBC 3MOBL 4HLZG 25C8H 3SBWA 3DBXB 5FKPA 4EQ3A 5ICYA 2VSDA 1HHKB 3A67L 5AZEH 4J3WA 3SDDA 3JUYA 1AD9B 3GSWB 4MJ4A 4NO0A 1ERNA 2V17L 3ISWA 5I71C 1JYWA 3P4NB 3FZUD 4P57A 4YBQC 1JPSL 1LILA 4MNQD 5E1AA 2ZJSH 4O51A 1PSKH 3V6FA 5E94B 4HZLB 2KKQA 5DK0B 3ULUD 1IM9D 3MRIB 3B5TA 4B0MM 2CIKB 4OKVB 1NEZB 1A4KB 5CBEB 3W9DA 3BDXA 1RMFH 1AKJA 3OB8A 2J12B 4KKCD 3WXWL 3T0EE 5C0JB 4YAQB 1U8MB 3KAAA 5DC0A 4WRLA 5FO8A 3MJ8A 4XNYH 4O5LL 4OI8A 2IF7A 1BREA 3L7EB 3I02A 3JVGC 3Q0HA 4MA7H 4XNXH 3Q3GA 4KXZI 4HFUH 5DD1H 3RDTA 4BH7A 2B20A 4NO0D 1PKQB 2VB5A 3CVIL 1W72A 5K93A 1E4JA 1NCAL 4OD1H 1AGEB 5D6DA 4R8WH 1IFHH 4OM0H 1MLBA 3G5VB 3VXNB 1BBJA 1BAFL 2H1PL 4A6YL 3CCHB 2AJXH 2WBJD 1JNLL 4M00A 2DI9A 3GSUB 4OUUB 3H9YA 1XF2B 1KJ3H 4PRPB 3BKML 4QRQA 1M71B 5FYKD 1NGQH 4GS7B 5IEKA 2C1PB 3TCXA 4WI4A 3NZ8B 4HAFA 1RV6X 5I19L 1ZWIA 3H7BB 1GOHA 4I3GA 5DUBB 4L8DB 1CR9L 2OSLB 3DSFH 3QBTB 3I3BA 1ZT1A 3L9RB 4XPAL 4FOMA 3S3SA 1YYML 1IC5H 4QNPE 4DN4L 3RUGB 2Q76A 1MPAH 5I1KL 3BRFA 1C16A 4YHIB 3ARRA 1OGAA 2N1KA 1QD0A 4OLXH 2O5XH 4JN1H 2BVYA 1J18A 1TETL 4L29A 4LLVA 5F7DA 2VZUA 1XZ0B 1TZGL 1ZSDB 1FFOB 2XKUA 4RNRA 1MIMH 2ITCA 4C56A 2AK4A 1Y6KR 1LDSA 2FGWH 4AENB 2R15A 5I66A 4XPGH 4OV5B 4X99B 2CH8A 1AXSA 5EBWB 4BH8A 4N9GB 5FEBA 2MHAA 4ZPVB 5IKCA 5CINL 5EZIL 1OAXL 3D25A 5ACZB 2R1YA 3JWDC 1D9KA 4K9EL 2VR9A 3MRDA 1PJ9A 4XNUH 2HVKB 2R56H 3PUCA 5E1HB 1I3UA 3H3KA 4Z7UB 5JOPD 2F54E 5HPMA 4FQLL 4ZFGL 1FDLH 3MNVB 3VD4A 4XPBL 5ESQB 3S37H 2Z31B 1G9NC 1JWUA 3B43A 3L5IA 3RX5A 1MWAA 3H3BC 4D9QD 4PJDA 3JSSA 2YC1B 3CC5B 3BQUA 4KDWA 3CFDB 2BHUA 1WCBA 3VFWB 3VRIA 1LEKA 3QCUH 1CWVA 1SY6A 4A6YB 1A64A 4IOFD 4WI2A 4WW2A 1T04A 1RZ8A 4I2XB 4ZUUA 1NL0L 2X05A 3V6OC 1T4KA 4R7NA 4WW1A 2OQJB 1CFSB 1AE6L 3VXOA 3L3HB 3U0TA 4N8VA 4K7PX 4H26A 5ALBH 3U9PL 1FNSH 4WHYH 4ESKA 2B1HL 2JELL 4FMKA 3EDEA 2ARJB 2X4NA 1IGYB 5EIVA 1YNLH 2IGFH 3LZFH 1UWXK 1V7NH 4D3CL 1YYLL 4HIXH 3GMQB 4HS6A 4YO0B 2OTPA 3BKYH 5J1SC 4MQ7B 2H2PC 5LXGL 2EDXA 1UYWL 3MCKB 2VL5B 5I74C 4GKZA 1KT2A 4YIQB 5JOFA 1T21A 4N90E 5F1NA 1Q38A 2V7NB 3FO0H 5I16B 2LTQB 1F8TL 1WZKA 3UROR 3SJVA 3T4YB 2P24B 2HA1A 1FYTE 3KXFA 1OPGL 5IVXE 2EC9T 4P5KA 2BXYA 3TM6A 5ITBL 1JPSH 2VKXA 5DFVD 1CIUA 1A14L 3C6SB 4KI5C 3ECBB 4F37F 4H0HB 2CRYA 4JO1H 4MNQA 4WTXA 1BJ1J 1GRWA 3O2VH 4QRTA 4QHLB 5EU4B 4KI5D 5DGRA 2DKMA 5D93C 4HUXA 3DO7B 5MEOB 3KS0H 4OCXL 4D0DB 1BD2A 2VRAA 1LEKB 4HUWA 1BQHA 2FATH 3FRPG 2QTEA 2Y36L 1KEGL 4D0BA 1SYVB 5I0ZA 1WEJL 5ADOL 2QBWA 4LHUD 3OJ2C 4PJIA 4RGMC 4ZFOA 2XWTA 3WIHL 1IAOB 4UNUA 3LS4L 3CVHA 1H3UA 1ZMYA 2KUTA 1NAMH 4JG1H 1QLEH 4JLRA 5MI0C 3WHXB 3NTCL 3F7QA 1I1FB 4OCNC 1VENA 1CLOH 3PV7A 1C08A 1WWBX 2ZUSA 1Z9SA 1QSFD 4TQEL 2VDML 4H8WL 4GAGL 5I17A 2N56A 3CFDA 3V2AR 2V7NA 3FT2A 3HPJB 3HZKA 4GMSL 4X6DB 5BCAA 3UTOA 4GXUN 4LIQH 4HH8A 1GGIH 4Y4FA 5C0RL 3VI3F 3O6FA 4OGXL 3C09B 2GEEA 2RR3A 2VQTA 3RY6C 2VUOA 4X8JB 2YXMA 3OKOB 4P9HC 5I76A 3HC0A 1ONQA 3Q2CA 2OJEA 4Y8AA 3FO2B 5MERA 3L3HA 4O4YH 4R26L 3FQRA 5I30L 3BJ91 5F9OL 3ARDC 5MEPA 3UJJL 4RDQF 1RHFA 4MAYD 5HVWA 3PJSA 3VMPA 1DE4A 2X4PA 3OGCA 4P2QB 1CBVL 2V2TB 1ROWA 4YHLL 3VWJC 1G7MA 1FZKB 4Z0BH 4RZCA 2O61A 1RULL 3PHSA 2P5WA 1N8ZA 4ZUVA 4JG1L 2BSSB 2DN7A 3DLQR 4FXGB 3LRHA 1K3ZA 4C83A 2IPKB 1FVEB 4ODVH 5KZCD 5ILTH 2R23A 4G9FB 2F54A 1C5BL 3BO8A 1MPAL 3SKNB 1HK6A 1U3YA 5LQBL 4DUWA 4MAUH 4KJYA 1CD9B 3FRPA 1RSFA 5E6ZA 2EDOA 3GBLA 4UT6L 4ZXBC 4Y8DC 4P99A 5F8QC 5I17B 2O5ZL 4K9EC 4XMPL 1X44A 2NXYB 2COQA 5D5MA 4BQ6A 4NNPL 3C6LD 2A38A 3MRQB 3FT4A 4JFYA 5CGYD 4F7CB 3ULUE 4OFPA 5I1IL 3ARFB 4QKXB 2DLGA 3BPCB 4UV7L 4TTGA 2H26B 1H3WM 2IQAB 1U58B 2Z8VC 3VFNB 5D8JH 4ALAL 4LQ1A 1H3VA 5IBUG 1NL0H 3G5VA 4GRWE 1RJLB 1ZLUH 3TYGL 4URTB 1KLUB 3W2DH 3MACL 7FABH 3WD5L 4J6RH 3LQZB 1RURL 4YZFF 5HYSA 2NZ9C 3GSWA 4JDVB 5F1OB 4MXWL 2BVEA 4HHAB 3LY6A 4QHNB 5F9JB 5BZDA 4H25B 3IXAA 5JIHA 3MSPA 4LK4A 3H7BA 2V9TA 4PREA 1VPOH 3G6DH 5CIPA 1HHHA 2OX5A 1UA6H 3RKDD 1ZGLB 1W0VA 3ZKMD 5E7FA 2XRAH 2I60H 1Z3GL 5CZKA 3WKNA 3FO0L 2J8HA 3UTQA 5MEQA 3ARBD 4GLRH 2IPUG 2E9JA 3LEVH 4LCCA 2HFEB 4LCWA 2R0KH 2Z91B 4R4FH 4KRPB 1AGFB 4PJXE 5F71A 4KJQC 4XPHL 4DQOH 3TJEH 3RZWA 2R0WL 5DDHB 4D9QE 1A6AB 3HFMH 2VLRA 1QSEE 2DM2A 3KDMA 3L5WB 3OKNA 5D70H 5EOCJ 3K3QA 5GRVK 3IS0X 1CGSH 5JO5A 1U3HC 5J12C 1M6OB 4JFOB 3QIBC 3NPZB 4JDZB 3VA2C 5C0EA 4L4TB 5JW3L 4PY8J 4PJCF 2BNQA 3GMPA 4KDTC 5ITFB 1DDHA 4U1KA 5ISZA 1HINH 2EIBA 4CVXB 1VACB 3SY0B 3IFPB 4ZQKB 1TENA 4KI5F 4C54A 3BPNC 5DK0A 5E4EB 3HAEH 2IEPA 1NEZA 4MD0B 1LHZA 4MA3B 4GW1B 2JLLA 4NPYB 3GB7B 5ACLA 4HDIA 2W60A 1JZ6A 3WUZA 3QCTH 1MWAB 1IVLA 4YDKH 3QIWA 2DTML 1TQBB 2VZ3A 3U0WL 4JHWL 1R3JA 1EJOL 1JFQL 3HCVB 1T1WA 2JE8A 2IFGA 5DZLA 1AGBA 4NN7C 5C0CE 1V3LA 2BNRD 4YBLC 4YFEA 4LLDA 4IRZH 5D1XC 1N5AB 3K4ZA 4H8WH 2V2XA 2IQ9H 3B3IB 3MLUH 1BGXL 4J3OC 5GRUL 4KK8C 3NPSC 4Z0XB 1JPTL 3OPZL 1RUPH 3K8KA 3UYPA 1K8DB 4H1LH 4ODXB 1QBMH 3EFFA 1I9RL 4OFYD 1MNUL 4LCCB 5CD3A 5HDOA 4AMKH 3SGDI 3WO4B 4YNYA 2JJUA 3ULUH 2GFBB 4PRHE 1LD9B 1CXEA 3LN4A 3OTTA 4DCQB 4EN3C 4Z77A 1H5BC 5SWZE 1F42A 3V52L 1U8OB 3VH8G 2YD3A 4PP1C 2X2YA 4LPVA 4P59L 5HYQB 1G6RB 3BP6B 2VXSL 5CUSH 2PYEE 3AREA 2GUOA 3MUGA 3UJTL 1N0LA 3GI9L 1JRHL 3I50H 4M1GL 4NC2B 1P53A 4PBWD 1BQHG 2EDLA 3FB8B 1IARB 1J05A 1U41A 3MOBH 1QRKA 3WEXB 3SGEI 5EUKA 3MR9B 1AC0A 2C3HA 3QIWB 1S8DB 2Z91A 4L8BA 1TCRB 1V8HA 5IR1B 4NSKB 2Y5TA 4Y16D 3U0PB 2FX7H 1FDLL 3QEUB 1GJIA 5FGBA 5JXAH 3QUMH 5HPOA 1EX0A 3QQ4A 4U3XA 5FHBH 3T0XA 5CD5D 5EU5B 4KK5D 3MRHA 3BYTA 4H88L 1D5ZA 2Z31D 5TE7L 2FBOJ 4L8CA 2DQUL 2GK0A 1PQZB 3MRDB 4LPWA 1EBPA 4PV8B 4OAWB 3IDGA 3V0VB 2YD6A 5FO7A 3QDME 4LPUA 5H2BB 1T5XB 1U8LA 2YUVA 3RQ3A 4JY5L 5GS1B 4N0FB 3VFSB 1NC2A 2VIRB 1I1FA 3OR7A 1S5IH 4OFKA 2DKUA 3BYYA 2EDBA 3CC5A 2AW2A 4QRRE 3BH8A 1KTLB 3FONB 1OT1A 4RRPA 3UTTE 5GGVL 3P4OB 4RFNB 1QLFB 3O81A 3V7MA 3RWEB 4P9HH 1EIBA 3MRFB 2AEPH 2WWKO 4WW2F 5ANMB 4DGVL 4MA1B 3QDJB 4JM2B 5I8OH 3M45A 3O4LA 1U8QA 5KJRL 3HC3L 5C86A 2O93L 1OQXA 4ODXA 4V1DB 3WN5A 1Q9LA 3DO7A 5I1JH 1GGBL 3SO3C 3PWPD 3GHEL 5DMIL 1YNTA 2I07B 3CLFL 1IKNC 4IS6B 1A6VH 4J6RL 5HDQH 4NRXA 4X4ME 1A1OA 4J3XA 4U6TA 5IB2A 12E8H 1HH6A 1IKFH 2ITDA 1J1PL 3CXHK 4L29B 4LLVB 3QHTC 4HKXA 4HT1L 2H8PA 3IKCB 4PJEB 3C08L 4K7FA 3MLZH 4XPGL 3DUHA 3F7YA 3RNKA 3HUJE 1MAML 4BUHA 2VE6B 5DWUL 4M1DH 1IL1A 2VITA 1PLGL 5GIRA 3AB0B 5DC4B 3GSXA 5CSZB 1Z3GH 5C0IB 4RMTA 3W81A 1GZQB 3VRJB 3GSNA 4IRJD 3C6SA 4PJ9C 3P2TA 1CLZL 2NZIA 4PJDE 5EU6A 1KG0B 1LEGB 3REVB 3PQYE 1A6WH 2APVA 3HB3D 1F4YH 3C60C 1FN4B 2XQBL 2CUMA 5DC9B 5LWYH 4JREB 4EIZC 1UM6L 2YBRA 4BSVB 4WGWB 1FIGH 5FGBC 1E4XI 4RAUA 2AKRB 4CBPA 4RFEB 3GHEH 5C0DB 3LS5H 4HKZA 2CLRA 2XKNB 4RGND 3RU8H 3BPLB 2MWCA 1DQJA 5IIEB 4PRBB 3VMOA 2JB6B 2AXFB 1IGFH 1KTRL 5E2VL 4PRHA 3QWRA 5KG9B 2YPLD 3P77A 5EU6D 3QCTL 3U2SB 1XGPB 4MSWB 4NGHH 4JDVA 4EI5C 1CDIA 3PGDA 3PWJA 1ZK9A 4X83A 4H25A 4U6XB 1FL6A 2M2DA 4PTTB 3C5SA 3UO1L 2XZAL 4Y7MA 2QQQA 1X5XA 1WV7T 2FX8H 4KV5E 2AV7A 4E0RA 4G80B 5TDOA 3NAAH 3QUYD 4LVHB 4GW4A 4P59H 3PHQA 4M62L 4NNYA 4PJFE 1QUNA 1L9NA 3UYRH 2A6KA 3G5YA 1MJ8L 1C12B 1A9BA 3LEXA 1KBGL 1JL8A 4ODWB 1MCFA 5DRXB 1T7YA 3O4OC 3THML 4R6UA 1Z9OA 2KZWA 4PRAA 1YECL 3GRWH 3CDCA 1XGRB 1FFPB 1WSST 3ILQC 3KPLA 4K94C 1FSKC 1NC2D 3W11C 4U6VH 4RWYL 2AQ2A 4JFYB 2PTTB 4F7CA 5I1DB 3V5HA 3G5ZA 1D9KD 5CP3H 4L9LA 1UXSA 1ZLSL 2H45A 3F58L 3QIBA 2FECL 4LPCA 4DVBA 3S37X 5FXCH 1LK2A 5IW1A 2CLRB 3MJ9H 2YD7A 4Y16A 5FHAH 1ZS8A 2YRLA 1KPRA 4ODBD 2BNRB 4X6BB 4P2YA 3RVWC 1MJ7H 4NQUA 4QRSB 2QV2A 2ERJB 3UZQA 4KRMB 1H8NA 3ZYZA 3WDJA 5GSVB 3BPOC 3QFJD 4HIIB 4DGIH 1JNLH 2N7BA 4L8SA 3TN0B 3V95A 1KXVC 5IB5B 4LSUL 4XP6H 5J1AA 4JFQA 3MLXH 3B5GA 3SE4A 4PS4L 5GGVH 2FGWL 5SX4I 1RZIB 4LCWB 3PL6D 4LAJH 3W0WB 3PV6A 5I75C 4NM4L 4P4KC 2BFVL 4CADB 3O4OB 3T3ME 2CJUH 1KLUA 4KRPC 3STLA 3LKNA 3ARVA 4E9LA 1TTUA 1IC5L 3DX6B 4JN2A 5T1KA 4MJ5A 1YMMA 4OBSA 2XWBA 1I9JH 4HS6B 3MUZ1 1LVEA 3ZSTA 5FF6B 1DBML 4Y19E 2VLJA 4QYOA 1HHKA 1KCRH 4PBVC 2BY1A 3WIHA 2A6JB 5DSCB 5IG7B 1CBVH 3VH8A 4YFLI 1HHHB 1CZ8L 4HT1H 2CSPA 5T1LA 1WT5A 3W5NA 1KJ2H 3FB6B 2WP3T 4X5XA 1MCJA 5DEGA 4JZJB 4C4KO 4O4YL 2B7DT 4JFZH 3E2HC 1ND0A 3Q6GL 2A6KB 3S98A 4HC1A 4DGIL 2ZNXA 4JKWA 3MRRA 3LEXB 2R23B 4Y2DD 4NHUA 3CZJA 1X6LA 4QTHB 4L8BB 1P4IL 2BSRB 4GW5B 4E5XA 3CDYA 1FO0L 3J7HA 1IZJA 4XXDA 4KC3B 4OLUL 4JANA 4M6MH 2K3TA 3HRZA 5D2LA 4ORZC 4PJHF 5JQ6H 5I1IH 5EWIL 1MREH 5FGCB 4NQDB 2IAMB 3FB5A 3VXSE 5JUEL 1VKXA 4S2SA 3LIZH 3F7PC 4K23L 5HD8C 3MRGB 2BVOB 2E6PA 4GW1A 4QRQB 3CCHA 2EE2A 2BNQE 2VIRA 1DUZB 4D9LH 4ELMF 4XVJH 2HVJB 3O41A 2X4QB 3VXRE 1OSZA 1HQRB 4XAKE 3U4EA 5A2JH 1KPUA 4OLVL 1G9MH 3L3GB 4PPTA 3BX7C 4JFDB 2VZVA 4K55A 5ETUB 4YHNB 3NPSB 3ULUL 1L7IL 2QADB 5KVEL 3L3IB 5E95B 2WW8A 4NJ9L 1VPOL 2OL3A 2UZYB 5GPRA 5JW4M 4UT7L 4J3SA 2I27N 2DDQL 3LEYH 3L9RA 4HWEL 4P23D 4P2OA 2MQ0A 4PTUA 4P2QD 4YXHL 4UINL 4MCZA 4WU5A 4ODHL 4OLWL 2R2BB 4JRWA 3QEUA 4X9IA 4MHHG 4Y88A 4Z77B 1ZSDA 2DQHH 1I1YB 1PW3A 3HFML 5AYUL 1ZVYA 3NIFE 3F7RA 1HI6B 3A6OA 3FT3B 4CDHA 2NXZB 5C6WH 4WWKA 4XAWH 2CIIB 5GS0C 3RZCA 4GXVL 2RFXA 3CFBB 3ZDZE 5CP7B 2GUOB 3MUGB 4D94A 4IDLA 1IBGL 3VRLF 3GIVB 2XFXB 5B4MD 3FJTA 4OFDA 1CXFA 2DL9A 2UYLB 5JZ7C 5IVXA 3MYJB 1KG0A 4I8DA 3ESVF 3QUXC 1R5WA 4J8RB 4WI6A 3QSKB 4DN3H 4HJJH 1JYXA 5JNYA 1BWWA 2EDWA 4EEEA 3QPXL 2NY2D 5L6YL 4P5TC 5FDWA 1G9NL 5JPMA 2IH1B 4L3CA 1BFVH 1HKLH 4HUNB 4HWZB 5EH1A 2PCPB 2NY7H 2VL4A 2ZKHL 2R9HD 4IIQC 3IDNA 43C9A 1U3JA 5ICZA 2NY4D 2KDGA 3CH1A 4ZNEA 1CLCA 5IVOA 2Z93B 3DTXB 1KEMH 4FQQB 1DBKL 2ADGA 1RK1A 4ZNCD 2YWYA 2Y25A 1GZPB 4K9EH 4PJEF 5C0FA 1GOFA 1JF5A 4PJ8B 3GMQA 5GRZA 1JNJA 1AI1H 4PJ9D 3GO1H 3ROOB 4HEPG 5IT2H 5T1KD 2HTLC 1TQCC 2WP3O 4RBPH 5CSZA 4AK1A 2AS5M 3ZE2E 3HAEB 1U3ZA 3RZCC 3ARFD 2XIDA 1RU9H 3VCLA 4XI5C 2MCG1 4LKXA 4G8IB 5CJ5A 1DQMH 4Y4HD 4CVUA 1DLFL 1U36A 2L4OA 1DBJH 3Q5TA 4TUOB 2FJGA 4BZYA 1DANT 5E5UB 5F97E 4WY7H 1ZTXL 3TYFB 5J6HA 5CJOH 5B8CB 1I8IA 5LBSH 2PNDA 5GGQL 4G6MH 3ZL4H 1A7PL 3G9VA 1CI5A 1AE6H 1BOYA 3V5HB 5C92A 4FQHB 1AXIB 3QXDB 5D1XB 1MCEA 3L7EA 1G6RH 3QUML 4NSKA 2XACC 2R1WA 2A77H 4WDIA 1JYVA 3V5KA 3DNKA 1T7WA 4PJ5E 2BC4B 5CZVL 1CR9H 1JNHA 4L3ED 2ZOLA 5JA8B 4LCWD 4DKAA 5LXGH 4U6HA 1HH9B 2Z31C 4X6BA 4OD2A 3ZDYE 2FR4A 1AGDA 1B90A 2FO4A 4Z7NF 1GZPA 2DBJA 1LK3H 1U9KA 4PG9B 2NTFA 4JEGB 1WBZB 3PXHA 5D7JD 5IWLA 1TETH 3B6SB 1NGPL 4HMDA 1KB5L 5DR5H 4HC1L 4N1HB 5GISL 3HMWL 3KPNA 3U79A 3T0EB 1RU9L 1U8IB 5J4MA 1PX3A 1ORSB 5DFTA 3T0DA 3RA7L 4A2LA 4QNPF 1D5MA 4YHPB 4YQXL 5JQ6L 2FL5A 2NY4C 3FB7B 4H1LG 1U92B 3AAZB 3CX2A 4PJGF 1PKQE 2DI8A 3BFOA 3CJJA 2UVFA 2ED9A 4MD5B 3QZWB 3NH7H 1FG2B 3FQRB 4UBDD 2VERN 3OGOE 4R4FL 1MCPH 1J1PH 5JPNB 1E0OB 4PRPE 4U6XA 1A0QL 5J7CC 4NQXB 4HZAA 2V2TA 5DRNB 4HWBH 4ZPTA 1WWCA 3BRGC 2X4TB 2OXGA 5L9DL 5KSBB 4GH7B 3K4AA 3P4LA 5GGTL 4CMHC 5DK2A 2FRGP 4MNGB 5IJVA 2DOCA 5ID0A 3HAEG 4C83B 3EYSL 4HXAH 1OLLA 2X4OB 4LHUB 2C3XA 4XMLH 1KN4H 3B2VL 2EXWC 4AT6A 3D0VB 4XCEB 1S9WA 4J1UA 2EXWD 2QQKL 5C09D 5FHAL 4PJFA 1RIVL 3CU7A 2R1XA 3K1DA 1YA5A 3CFIC 3Q48A 4LP5A 4OF5A 3LN5B 3IDUA 5EU6B 5T1DH 5I1DA 4EDWL 4FXLA 2XYCA 2Z9TA 2FECI 1LE5A 4RGOL 3HE7A 2ARWA 4XP5L 3MGAA 2D0HA 1TZHA 4AIXA 4YBHA 3NCYS 5FYJU 2J5LC 5C09B 4OF0A 3I9GH 5ID1A 3VXMA 3P9MB 5DHXB 4EOWH 1YEEH 1KGCE 5BRZB 4RAUB 2LVCA 1JZ3A 1UWEL 4K7PH 4L1DA 4JQXC 4KMLB 2A9ML 2UY6A 3NN8B 1PG7L 4GBXD 4ODSH 5KSUA 3V4PL 5CSGA 5E4EC 1FVCA 4YX2L 3QHFL 1V05A 5D71H 2R8SL 2VDKH 5E8NA 3QH3A 1HQ4A 5CJXA 3GSQA 1Z0NA 5DUBA 1MFDL 4M43L 2ESVE 4NQXA 1EXUB 1ZVSB 2PUQT 3I6GA 1I7RA 2VDQH 1RJZA 4MYWB 2VWEE 1KEGH 3GBML 2HT4C 4NFDA 3JWOH 1J11A 5JXAL 4JM2A 1HZHL 1XF5B 4U33A 3V6ZB 3SJVB 3T4YA 2OTUB 4L9DA 3L95B 4PJAB 5IFJA 3HR6A 2VXSH 2LE9A 2X1XR 3DSFL 4M3KB 1H8SA 3QDGD 2NNAB 1NCAH 5A3IC 1KJ2L 3MPCA 3FQNB 3LRSB 1AGFA 4HUMB 3PDOA 3TPUB 5JW5B 2H8PB 3WUWG 3S36L 3BDBA 3I84A 3UX9B 3EO9H 1FNEA 5CJOL 5IG7A 5DJCB 1JHTA 3EHBC 4N0UA 4AL8L 3U4AA 2W59A 1IM3B 1MCOH 1LP9B 4HUVB 3FN0L 2VZSA 4HF5L 4OF3A 3S5LA 4JFOA 4W4NA 4QTIH 5TE6H 4OF7A 5JTWA 1AR1C 1FBIH 2PETA 4M6ML 1DFBL 3KPSB 5INCB 5IV2A 2B4CC 2DQFB 2EH7L 4IRSD 2R8SH 5C9KA 3QQ3B 2NZ9D 4LVOC 3UXFA 3WV0A 4S1QH 2DQDH 1BM3H 1ZA6A 5E9DB 3VFWA 3E2HB 2EC8A 1A4KA 5CBEA 1KJVB 4J3TA 1JCKA 2VXUL 3IFNL 2YBRB 2ADJA 5LAXA 2AJUL 5FDWB 2O5XL 4I2XA 1ZLVH 3REWB 1YEKL 4R3SB 2IANB 3TN0A 5DR5L 5C0CB 1FFRA 4KZEL 4ZFZA 1EO8H 4UTAL 3EOBB 4M3JA 4H26B 4XHJD 5KANI 1UH4A 4GRLC 4U1GB 3N50A 1DVFA 5KW9L 1KTDB 1CVRA 4XX1G 2FHFA 1N64L 2K7PA 3GI8L 1EEZB 3ELAT 4NQCA 1A6UH 2ADGB 4PIRF 5F7DB 5CWSA 1Q9WA 4WENB 5TDPB 4RNRB 4J4PC 1OAZH 5T1KB 3MRKA 4HS8L 4DCQA 5IHZA 1T20A 4KQ3L 4IMKC 4ONHA 4Q6YA 1UZ6E 5FV1L 4X99A 1OAYL 3QG6B 4U2ZA 3LKSB 3MGOA 4HC1H 5HHOE 1G7MB 2P4AB 1F58L 3PF2A 4P4KB 3CFKA 4GRLB 5IOPA 1C12A 3IGAA 3ECBA 2G2RA 5L88L 5T3XH 1M7XA 4YQXH 4NZRH 4Q9QH 2XTJB 4YLQT 3QHZH 4U6YB 5C0AA 2Q76B 5MENA 1J0ZA 3O4LE 2FO1A 3ALXA 3RL2A 3BZEB 5FO8B 3SDXA 1RUPL 1YQ2A 4UDTA 5F7UA 3M8OH 3U0PA 1G7PA 3MUY1 4GO6B 3TWCH 5D7LE 3VI4F 5CLTA 3BE1H 1AHWA 2P5EB 1PSKL 4CNIB 5JLZB 1AH1A 4R2GB 3OKKA 5HI4D 1W72B 3V5KB 1R3LB 1A21A 4ZTPH 3UTTD 5E6YA 4M7ZC 4YPGA 4YGAB 1YDPA 1BF8A 4AEFA 3D3VB 3RNQB 1IEHA 2CUIA 1AD0A 1W72L 3RFZC 1GC1H 3GNMH 4HULB 2IFFH 3LKRB 3NCBB 4WWID 3MLWL 1C08B 3T0BA 3LS5L 3GSUA 4OUUA 3LKPB 2DQFA 4BFIB 5DYOB 3ROLB 1OP3H 3MNZA 4DTGH 4MAYB 3AY4A 4CU6A 5BS0A 5IWLC 1D5BA 5E9DA 4KUZH 4OJFH 4HWBA 1A7NL 4OD1L 2OK0L 3L3DB 4M61A 1JTPA 4IMKA 3PWNB 3ARGB 4JB9L 2DBLH 4Y89A 3HRPA 1WCBB 1NLDH 4HIJB 4MNQE 5EO9B 3Q5OA 2YD2A 5HHPB 5KVMC 1A7OL 1ZGLA 2VZTA 2GAZA 1RI8A 4QRPA 4F7TA 5EOTA 3D6GA 3UO1H 2HT2C 3FAXA 3TT3L 5JHDD 3VXQB 2MJWA 3DUUA 5ELIA 5DJ2A 4HG4K 1TTFA 1CLYL 4JRXB 4KJPC 2E8YA 2F53D 2F19H 2NY5H 1MUJB 1HYSC 4Z7QE 2AXHA 1JK8B 2AEIT 2DQGL 1KBGH 2I07A 2O26U 3TBVA 3G6JA 4EI5A 3EDKA 5E8OA 3PQYD 4RAVB 4PJ8A 2HLAB 4EDXA 4KRPD 4OV5A 5T5FH 1NGWA 1EO5A 4NKIH 4P23C 3MRMA 1UGNA 3ZYJA 1EJOH 1JFQH 4MJIE 5I30H 3NBNA 1U2CA 3IJSB 4TYUA 2XWTB 3FO9A 4PJCE 1UXWB 2HH0L 1NJ9A 3BO8B 4OD2B 4YIQA 1Z5LA 2LAAA 5FOJA 4P4KA 4FXKB 5D7IB 5HYEA 5IBTL 5J13C 4M03A 5IB1B 3S88L 1GGIL 1HXMB 4U1LA 4PD4J 4PGCA 4YUEL 5B38G 4NHUB 4P5KB 4L8SC 5DMJB 1KFAL 5B8CA 3JUZA 3D5OF 4FQPA 3RPKA 1GGCH 3OHXB 4HCRL 1P7HL 4FQ2H 3MJ7B 4LLAA 1I9JL 5T3XD 1GXEA 4PGBA 4GUPB 1OY3B 4WW2B 3DVGA 5TE6L 2C7UA 3DO3A 3HMXH 3BP5A 1P4LA 1R24A 1ZA3A 3AMKA 3HMWH 5ABDE 4MQXD 4M7ZB 4YH6A 2WIMA 4X8JA 1M7DA 5F1SA 2EH7H 2OXHA 1D5XB 2WANA 2MKLC 4N9OB 3OAYH 2W0FA 5KSUB 4YNYB 3RAJL 3V4VH 3PGCA 5BZWA 1OAQL 3BP4A 1E6JH 4MQSB 5KSAB 1A6UL 1DVFD 4MSWA 3FQTA 1KJ2B 4M4PA 3C5SB 1AXTH 1INDL 1FCCA 4LLWB 3X12A 3UCRA 4HQQL 5K9JL 4JRYE 3ARBC 5C1MB 2W91A 5CKGA 4R2GD 2WUBH 4JM2C 2X40A 2GTWA 5DQDL 5D6DC 2CRZA 4GMTH 3MGTB 4UTAH 1UG9A 4AZ8A 4KPHL 3U30B 4QRPB 1Z6JT 4ODWA 4RISL 4F7TB 4PJFB 1F97A 1PY4A 4Y4FB 5JOPE 3AAZA 5BJTB 2FX9L 5F89A 1EBAA 3ESUF 4P9MH 2VQ1B 2Z35A 3F8UB 4KK6C 3GDBA 1HHIA 2FYYB 4KFZC 3TA3D 5JDSA 4GAYA 1E28A 1A3RH 2DS4A 1H5BA 4NYLA 3QI9B 4OLXL 4AEIH 4DAGH 1FG9C 7FABL 5TQ2L 4WIQA 1UJ3B 3QIBB 3DETC 1U3HA 1NFDF 4P3DB 4JFHE 3VMNA 4AG4H 1AD9A 4OQ1A 5SWZB 1P69B 5KSBA 4X6CB 2B4CH 3SCMC 1R24B 2VR5A 4GG6F 1OGTA 4KVCH 4EDWH 5CBAA 2PTVA 1D5ZB 4Z95L 3QUYA 1OSPH 15C8L 1B4JL 4RX4D 5KSVA 1TVBA 3K8LA 3TVMD 3ZKND 2EDTA 3G6DL 3FQXA 4TUKH 1FLTX 3IF1A 4JLRB 4PLJD 4I0PC 1UENA 4TPRL 2DYPD 5CEYA 5BXFA 3QH3B 5L8JB 2DJUA 4HBQA 2ZCLL 1ZT4B 1YPZF 4WJ5A 1EXUA 4U6HB 3W9DB 4GRWH 1AJ7H 2VISA 4LCIH 4WTZG 5TQ0L 1U8KA 4K23H 3WIIH 1GOGA 2E3VA 2X4UB 4GKSA 5B8CC 5I8KL 3WDIA 4QOKE 4PJBA 1F6AA 4N90D 3PP3H 1BIIB 3KPNB 5JW4Q 3O2DA 3QCUL 3T0VA 3N9GH 5LGJB 1IE5A 3EGSB 4YXLH 3WFCL 2Y4SA 3D39D 2Z93A 1QO3B 2YA1A 3VFOA 1YMMB 3QAZC 2E27H 4QT5B 4XNQB 4OCSL 2CD0A 1ZHKA 1J12A 3LKNB 3BQUD 2LU4A 5BV7L 1GPOH 4YK4B 1VA9A 2UV3A 4UMGA 4NKDB 1JWMB 3BQUC 1AO7A 1GH7A 4NP4H 1M71A 3FFDA 3S34H 4J12A 4Y19B 1WUNT 3T8XA 5FOBA 4YDVB 1B9ZA 5HVHB 2X09A 3KDMB 1EMTL 5I1EH 1FZKA 3GSRB 4EUPB 2YRZA 3L3JB 1WTGT 2GJ6E 1OTUD 4PJCA 3VWJB 1RVFH 5C0EB 4X5XB 3K2UH 1T66D 4FQIL 5C0IA 3CMGA 3SBWC 3GJEA 5T1MA 1IGCL 4V2BA 1VHPA 2X1OA 2F19L 1JGLL 3TYFA 3EYOA 1XH3B 2APFA 3FRUA 1MHPH 5L2JA 4RQQA 2HFEA 4X7TA 2VDOL 2YK1L 1WVZA 4L4TD 1IRAY 2VLJD 4A6YA 3HI6L 5E5RB 1R5VA 3SKJL 5F7FA 3MA9H 1OTSD 1CGWA 4XWGH 2YOCA 2AQ1A 1Q1JH 3KYMB 3K8MA 4TSCL 2IQAA 1NUGA 4XMLL 3EGSA 4I0KA 4LF3B 3V4UH 1TZIB 4JHZA 5DD0H 3U0TB 1EAJA 5CBAB 5BMFH 2EKSA 2CLVA 1VEPA 3BJLA 3TEUA 3QEQA 1UM5H 3MYZA 5D1ZB 2NY1C 3B8SA 1WBYB 1U8HA 1U0QA 1QFWH 5FUCC 4K94L 4W6XB 3ETBF 4AY0A 3S35X 5DUPL 4M4RA 1VFMA 3LD8C 4PJDB 2ZOKB 3TP4A 4K8RD 4GBXC 5H35A 3CX5J 5F1NB 3S35H 5HDBF 3GGWB 1IC4H 5ALCH 1QFWI 4LEOB 5SX4H 1FNLA 2YD9A 3IKKA 3C9NB 3C2SA 1QPPA 2IH3B 5ESAB 2V7HA 3UPAA 4LDEB 4LGRB 1FZMB 4OZHB 4FQCL 4KJWC 1A5FL 5LGJA 4PTUB 4G42A 3WN5C 4X9BA 4Y2OA 4JE4B 2R4RH 3H9SD 5GGUA 1D9KC 2P7TB 1KTDA 6CGTA 2W9DH 1RZ7L 4Z7VE 5GRJL 1IAKB 2MCPL 4R0LA 4NZUL 4ZNEE 1Q9KB 3UEZA 2BVQA 3DX9B 4X6EB 1FFPA 1IGIH 5C2UB 3I6LE 3KPQA 3IYLW 4QRUB 5D2NA 1EUUA 3IAPA 5FECB 3TC9A 2E5EA 1LO2H 1MY7A 4O2EB 5IGXH 5I8EB 5BOZG 4R97B 2HWZL 5SWQA 1LO0H 4NKMB 4HFWA 4FXKA 4XBEL 3ULVD 1FBIL 1H3GA 5F7WC 4WU7B 1FGNH 5H2BA 2G60L 3N1MC 3P11L 3T0ED 3CGTA 3H42H 2PW1B 5CZVH 3MQIA 4J8RA 4Q0XL 3VFUA 2EDKA 5C0AB 5MENB 3L7FA 4PJ7E 5INCA 4PRIA 2YHGA 1KIUA 2YEZB 4HJGA 1AGBB 5TQ0H 4PJBE 1YEJH 4G6KH 4M8VA 2YPVH 4ZO6A 2XPGA 3DURB 3C9NA 4NWUH 3DGGB 4JG0L 4OQTA 1PYWA 3KLHC 2AI0H 2B5IB 3FFCE 2IANA 4KUCF 5T3ZH 1C16B 1MCDA 2HFGL 3BMWA 4MA8L 5T33H 1GIGL 5DGQA 4M7KH 1FV1B 4P46C 4O00A 4NM8L 4PJ5A 1YY9C 4LSPL 5EZLA 4MQTB 4I0PB 5B38B 4G6AD 1DVFB 2EKJA 1PEWA 2DJSA 2HG5B 1T1YA 2XKSA 3ARDD 4PUBH 2EICA 1JPFB 1SJEA 5KSAA 1WAAE 5BV7H 1DQDH 4K3EH 4MAYC 1UFUA 4BSJA 4DKEL 2C4XA 4KZEH 2ERJC 1WF5A 3QWOA 3RDTC 5D7IA 4XBEH 1DUYA 1FL3B 1MCNA 2CKBA 5KVFL 3I2CH 1FVEA 4YXLL 4D2NA 5DRXA 4U1LB 1EHLH 3U9UB 2F54B 5JXEC 3IJYB 1HSBA 4DVRL 1NLBH 4EIGB 5KOMC 3FCTB 5F89B 2Q3AA 1ND0B 3LRSA 4LCWE 3RY5A 2P8LB 1BX2B 3HPLB 3DXAA 3V5DB 4FFVC 3S7GA 2XY1A 5HHXH 3IVKA 1EHXA 4KY1L 3G6JF 3QXDA 4AEHH 3LOWA 1AY1L 3LB6C 3C2AH 2HFGH 1LP9A 4OLVH 5D1XA 4P3DA 5EU5A 5J1TC 5F96H 4HUVA 4PP2A 1EMTH 2ADIB 3O9WC 5I1EL 3A6CH 4I3RH 1MFDH 1P84J 1S7XA 3MO1A 2E7LC 5EZJB 5I8CA 4HXBH 3EYQC 2EYRB 4F57L 1SY6L 3VXOB 2VH5H 4B50A 4NZRL 1T2JA 5ISZE 4PJ5B 2YA2A 4HJ0C 3QIWD 4HWNA 5HYSB 4HFWB 3QA3B 4FFZL 4JPIA 2GTZB 3RNQA 3GSXB 2XZQL 3PP3K 4OM1L 4OSUH 2AABH 3SN6N 3IDJB 1DUZA 4EQ2A 2UVEA 4QHNA 5F9JA 1IQDA 5DYOA 1UCTA 4CAGA 3C8KA 4WW2C 3BHBA 2QLVB 4HK0B 3MA9L 2LTQC 3SPVA 4OFYA 3O0RH 3ABZA 3VRIB 3CSYA 3T09A 2IPTH 4JHWH 4XI5D 3QWRD 2X1PA 2IAMC 2GSGA 1R3HB 2A1WL 2Y5EA 4XZUB 5I1LB 2H2SD 3IETB 4PGDB 1CL7H 3IU4H 1TPXC 3QUZA 3BD5A 2NW2B 1A9BB 4YE4L 4Y5VB 5HHPA 1E28B 3JV4A 2B0SH 2XKNA 5HHVH 3C2AL 2AXJA 4KJPD 5D1QC 1NKOA 1BZQK 3T04D 3S6CA 3IFOA 1FIEA 2JCCE 3RWGA 2CJUL 2HT2D 5D1QD 4FQXD 3K7UA 2X4TA 3PP4H 4HHAA 3QUKB 2UWEE 3WNMA 5I18L 3VXRB 2ARJQ 5E5MA 3OAYK 5LQBH 1J5OL 4LP4A 1ZGLM 3PGDB 4J4PD 3HI5L 1P2CA 1CFNB 2AK4D 2HRPL 3NGBC 1GGYA 1LMKA 4MA7L 5EUOB 4P2OC 12E8L 2JB5L 1PVHA 4XTRD 1T0NA 4IJ3B 4GW4B 5IB3B 4JZOA 4PJGB 5AWNL 1IAIM 4HIHB 4PB9H 1YEDA 3GMNA 4J1UB 3X14A 4JANB 4P5MB 4U1SB 3N1QC 4NYLB 1T1WB 5T5FL 3DXAB 3NIGF 3KS0J 5KW9H 1L0QA 3FMGH 3WE6B 3MNWA 2EYTB 2X9XA 1SBBA 3CFEB 4XCNA 3ARGC 5HYJA 4FQXA 2E9WA 3O8XB 4NUJB 3OB0K 3MV7D 3ULVF 3RPIB 1M7IB 4GRWF 5L8KB 4BH7B 3WIIL 3EFFB 3VXMB 3OMZA 2EE6A 2F53B 4XVTH 4OZIE 5BS0D 5GJTH 2FIKB 5T3ZL 4Q7DA 4NNPH 1BBJB 1CE1H 1MJUL 4BFIA 5BRZE 2ZUXA 5B39B 2CXKA 4YBLB 1HQRA 4HSQA 2HFTA 4BFBD 1XF2A 4YHMH 1J10A 1TQBC 5TE4L 1UWGH 3IDJA 4WY7L 5DVLA 1X5ZA 1JGUL 1HQ4B 4U0QB 1IQDB 1O0VA 2W92A 5EIIA 3B9VA 5HYJD 3ZE2F 5E08H 4HUKB 4JZJC 5EO1A 1FYTA 5C71A 2OTUA 2VDNL 4Y4KC 5J1AB 5FFLA 4XNMB 1DVFC 1T2QH 1BJ8A 5IFJB 1T0MA 4PJAE 5IMMA 1SMAA 4OZFH 5GHWL 3MCLH 3HG1E 2FGZA 4LDLB 1XGRA 2HKHH 4TUOA 1MVFA 1GHFH 4U1NA 3FQNA 4S1RL 5ECJE 3RIAF 4GQ9H 5GS0L 3ARXA 3BPCA 4WEBH 4WFHD 5FA4B 4OGZA 4PJHA 3EO0B 2FWOB 4GMTL 5J13B 1VERA 1S9VB 2RHEA 4X6CA 4QXUL 4XRCB 4HH9B 1OGTB 5EORL 3DHJA 2ID5A 3GIZH 4Y5YB 3U7WL 5T5NF 3UZEA 2ZCLH 1HNGA 1U8MA 3O2DH 2R2CA 4KJYB 3ZYIA 2DLFH 1QFPA 5HXMA 5FGRA 5I15L 1Q8MA 3ZT5A 2VC2H 2NY0B 2YXFA 3OQ3B 2JJTA 4HWZA 3M17A 3VXRD 1OM3L 3BOVA 3REWA 4X4XA 4UQ2A 2EIZA 1QG3A 4IIQA 3RIFF 4DGYH 4F33A 4OTXL 1U58A 1LDPH 4R96A 1HEZB 3BKJL 2P49B 1JUFB 1D5MB 1YN7B 2ORBH 1IC4L 3STLB 5IVNA 2IWGA 2YMXH 3RHWK 1DSFH 1Z9MA 1HHGB 1EUTA 1T5XA 1U8LB 3TT3H 4XNZC 1MCOL 1IGYA 4UBDC 5TDPA 4GXUM 1IBGH 4N0FA 4NQEA 4FQCH 4ONOA 3VFSA 4WEBL 3FQTB 4FFYH 3DROB 4N9GA 5C08A 4V1DD 1EAPB 5TFSL 1U8PB 1IFHL 1ZWIB 2JK5B 4NQDD 1P6FA 3TZVB 2Q8BH 3MTRA 2IPTL 5DF0A 3O6FC 4LLUB 5DK2B 3LKOA 2WM0A 1SJHB 2VXUH 5IHLB 5FYJH 3EYUL 4LGPB 4PFEA 4JKPL 1HSBB 5IVXF 2YC1A 1PZ5A 1ED3B 4M6OL 3TBWA 1P7QA 4X7SH 3IS1X 4XVSL 1CFVH 4DK3A 4U6YA 5D5MF 2XTJE 1XCQB 3IU3B 3ALPA 1BLNB 4H1LB 1RUKH 4HKBA 5ADPH 3RX8A 3IVKB 2BVQB 2CDFA 2MQCA 2VDLL 2AJVL 2ITCB 4RMRA 4C56B 1A9EB 1T7XA 4JFPB 4BFEA 1Y0LA 4ORGA 3UPRB 2VDKL 4DZBB 4JFED 1KIRB 3Q1SL 5FA3B 4YPGB 2YWZA 4X8XA 4PRDB 4K71B 4PJHB 5CD5C 4NQDA 2VE6A 3OKKB 1CGYA 1JGDA 4LHQB 1XR8B 5B39G 3CVHB 1MFEL 5C0CD 5HGAA 2GFBA 3MLVL 1DBAH 3SOBH 3RTQC 4JPIB 1MCQA 1E4WL 4F37K 3GSNL 2IAND 2WBJB 3O6LL 5GGRB 1S7VB 1ZKAA 2J8UB 1DLHA 2B1AH 4HIEA 4PY8I 1R5WB 1D6VL 4ZDHB 4HBCL 3L3KB 4BELD 4QLRA 3U1SL 4TSCH 1NGYA 4R26H 3PNWB 2ZP0T 1G0YR 5FYJD 1MRFH 3SCMA 2XICA 4QGTA 1KNOB 4PUBL 4HUUB 5FM4A 5HI3D 3QXUA 1R3HA 5I1LA 1SM3H 3FN3A 2FJFB 2DLEA 1G6RL 3AB0C 1NFKA 3R4DA 4MZ3A 1IT9L 4PGEB 3IXTB 3VXQA 4TSBL 2D7TL 4NBYB 3DVNA 3INUH 4P46B 3CDFA 3CXHJ 5GZOD 5KVFH 4JRXE 3VA6A 1GGTA 3CXDH 5JMRA 4DEPC 3VE0B 1OW0C 2QHRL 3HUJF 4LSVH 3TIDA 3QIWC 4G8FB 4WV1A 2LU3A 2HKHL 2XI9A 3RBGA 5D4QA 4YFDB 1QBBA 1FNEB 3LQAC 5C0FB 4PRDA 1NGWB 4OI7A 2D4DA 3QR2A 1TLKA 3QWQB 4L3EB 2VDNH 3QDMB 2HWZH 2ZSVA 5JIIA 2C4FU 1KPRB 2FBJH 3BP6A 5T1MB 3GIVA 3QJHB 3AROA 2X44D 1MCSA 3X13B 3MA7B 4HPOL 2VR4A 5D7IE 4X98B 3A6CL 1FLRL 5AG8A 5GGTH 1ITBB 4WVRA 4I4WB 4G7YH 3SJVE 1YEDB 5C0ND 1E4XH 3FT2B 4WCYL 4LSDA 3U7WH 4ZFFB 2PTUA 4PYHA 1GHFL 3JV6A 2WINB 1TJHL 3V6OE 3ARDB 5DZOA 5E2WH 3WJLC 1VFBB 2V9RA 4PGBB 3QDJE 5JORA 2ICEB 4XPFL 1S9YB 2VXTL 3U36A 3S9DB 1Q9LB 1T5WB 5FDYA 4DKFH 4OCXH 4P4KD 3T3PE 3VWKC 1LP9E 2HJKA 4LRNL 1A4JA 1J8KA 1AP2A 2MTPA 4PJIE 1FIGL 5IFAH 3LSOB 1ZLWH 3VWJD 3BP4B 1MQKL 5MP6L 4XGZA 1L0XA 2H41A 5J3HC 4G8GE 4HFUL 2AK1H 2W9LA 4FTVD 3QG7L 3RJDA 3PWPE 3EZJB 3L3OB 1KTLA 1XF5A 2EC9U 5CIPB 3GUTB 3NCYP 5GGSY 5C08D 2NY6D 2PYEA 1RUMH 3O3AB 1CYGA 3QEQD 3HR5B 5JHLH 4MZ2A 4JGUA 4WHYG 4Y5XB 5IESL 5F1KC 1WGOA 3JWDH 5IJKA 1W72H 2C3GA 4EBQL 4ETQA 1XZ0A 3I9GL 3O3UN 2PR4L 3KPQB 1DP0A 1MY5A 5D2NB 4YXHH 4NFBA 5JDSB 4AQOA 4IRJB 3VE0A 1UCBL 4YDIH 2EE9A 1FC2D 5E9DD 1MCWM 1N59B 2F74B 1MH5A 2DQTL 5KN5A 5GGSA 2NY0C 5C09A 3G08A 3O8XD 4N0UE 3PABB 3LKQA 4KDVA 3SO5A 3QQ3A 3NFNB 1TVDA 4DUXA 1F4WL 4D9RE 3SY0A 3ARFC 3QAZB 3P77B 3NCJH 2P48B 1VFAB 1N2RB 3F58H 1WIPA 1ZHNB 3T2PA 5C70A 3P9LA 4YEEA 3UBXB 1YUHB 1WWWX 1MI5A 4NT6B 2IAMD 1T2XA 3TIEB 4F9PA 3HE6D 4R3SA 5ESVB 3UZVB 4LBEA 2JJTC 3U6RA 1AGCA 5DD3L 1YEHH 2WWMD 3DRTA 3PE9A 2X4UA 4HJJL 4XXDB 5DJ6B 2AVGA 1S3KL 2AV7B 5DUPH 5J06A 1K4DA 2VDPH 3U4BL 1ZHBA 4KROB 3S5LG 2PKDA 3JBG7 2RQ8A 5F3HA 3WXWH 2WLYA 4P48A 3S97C 1GGBH 3LD8B 4Z0XA 3HZKB 1JGVL 4HIJA 4G9DA 3VFPA 1XF1A 3B2UC 4QXGH 3VFVB 3WUWA 3C5JA 5EN2B 2YD4A 3TVMA 5HJ3A 3BAEL 4Z7QF 5FKPB 2HG5A 4XNQA 2AXFA 1NDGA 1ONQB 2PTTA 1XCTA 4ZG1A 1INQA 5IB4B 1NPUA 2D7PA 3LDBC 3EO0A 2DQTH 2UWEA 5FO9B 4POZD 1X5KA 3CK0L 4NZUH 1CGUA 2Q8AH 1P5VA 4XCFH 4YGVB 3AS2A 2WAHA 3RWCB 1JMXA 1CICA 4JQVA 3TF7C 2X70B 4MA3A 3BIKA 3QQNA 4DOHE 2XN9A 3RWIB 1N8ZB 3F65A 4G8EA 4WHCA 5I9QB 2HLFD 3ZSSA 2GW5A 1T0MB 4MNQB 2H6PA 4P2CG 1OAKH 1E4KA 2YRPA 1RUQL 4HPOH 3MJ8B 1PD6A 5DXWA 2IMNA 1CFTB 4F9PC 5T3XL 1BPVA 3LPFA 3HE7B 1X4YA 4M5YL 5ICXA 1FORL 1EH9A 1XIWD 4O58L 4O9HL 5F3HB 4ZFOB 3IFLL 5DUML 4WFGE 3QFJB 5CEZD 3QNZB 1RZIA 1GPOL 1YN7A 1ETZB 1I8KA 1NFIB 3HLAB 1CD1B 3RZCB 4CVXA 4JDTL 4XBPA 2BOBA 4MXQC 5T1DL 32C2A 3QDGB 2I9TB 4XCCL 3EJJX 3BIBX 5E2TL 5E8EA 1CL7I 3FTGA 3OR7B 1WFNA 5CGYC 5IV2B 4TVPH 2IPUK 4Q6IA 5I8OL 5B39A 5C6TH 1S7TA 1UKTA 4KTYA 5IMOA 3E8UL 3I6GB 2R2EB 1W8NA 4L8SB 5K33A 1RK0A 4FQLH 4UINH 1PDKA 1JTTA 1UB6A 4MS8D 5E0QA 3SKMB 5E08L 1VSCA 1CDYA 1L0YA 3V4PH 4G8EB 1U95A 4HLZH 1ED3A 3UPCA 5INDA 1OP5H 1G9ML 4OCWL 4IBLT 1JIBA 4M43H 2DBLL 5AAMA 5KVEH 4ZD3L 2OYPA 1Q9OB 4YHML 3TJHC 1CGSL 2VDQL 3MCLL 4WO4A 4XX1E 3ZTJH 1JGEB 1NCCL 4DZBA 3LN4B 4O58H 5DJAA 5EG6C 2P5WD 3IFOB 3K81A 1CDJA 4FFZH 3ES6A 3ARSA 5FECA 4RDQG 3FQUB 1R6VA 2FD6H 4BM7A 1RZGA 1J8HE 4MDIB 4OCRH 2NY5L 3ZDZF 4L8CB 3KPTA 3QNXB 2MHAB 2ZJSL 3QIUA 5ACZA 1X4XA 1P2CB 2CKBH 2YUXA 3VXSB 4PD4K 4K2UL 4ZPVA 1R3LA 5SWZA 3TBYB 1K5NB 2X4RB 5CJ8A 5JXEA 1AFVL 4JB9H 3TBTA 3A67H 3T2QA 1DDHB 3UC0H 3OJVC 3GMNB 3OKLA 1JWUB 1VACA 4HXAL 4XRCA 4OLYL 1G7JA 4J23A 3QFDB 3X11B 4JHBA 4ZUSB 1BJ1H 1T03H 4YHKH 2DQIL 4R7DA 5IMOB 1JPTH 4QTIL 3GB7A 3RVUD 2GCYB 5CUSL 5BV7B 3GSNH 4LLYB 3SE9L 1QNZH 5CJBA 3SKMA 3KYNA 1I1AD 3GJFH 5E8DH 2A74B 4KAQH 3RP1A 4AIZB 3M1BB 5BO1L 4JO3L 1M7DB 4H20H 2AKRA 2GAZB 1PQZA 3MOAH 5DHVA 2VMFA 3O6MH 4LAQH 4F7EA 3UTSE 1G9NH 3LQAL 1HN1A 4LNVA 4LVHC 1V3JA 2CPCA 3K46A 3F12B 4GG8B 3HMXL 3KJ4C 3JTSB 4XNXL 3MRGA 4TNWF 5JHDE 1ZHKB 1Q9WB 1BD2D 3IKCA 4NOFA 4LSTL 1O7SA 2VC2L 4BZ2H 3NCFB 5BZDB 1JWMA 1A1NA 2CKBL 5FM5M 3SQOL 3V0AC 1ZEAL 3ARBA 1RJYB 3EDJA 4E42B 4O2CB 5CHNB 2PO6A 1FAIL 4JY6B 2PW2A 3LMJL 3MBXL 4JRYA 5KVGH 4HMEA 5HYQA 1Z5LB 2D9CA 4JKLA 1OP9A 3GO1L 4F9LC 4D9RD 4X0KA 3HI5H 3E6FA 5DJ0A 4OFIA 4JM2F 4S1DC 4ZS7H 3V6BR 1WCQA 3D87B 4NRXB 1UT9A 3T4AA 1NCWL 2J7LA 3ARQA 3SKOB 2MPAL 4HKXB 5GSRB 5A16A 4FZ8L 3FFCA 4K7FB 1BFSA 4RMSA 3WLWD 1P9MC 3VGGA 4JDZA 1MVUA 4RAVA 4YDLB 2Q20A 4JFPA 3CK0H 1FORH 5E2UH 1GSMA 1XF3B 1ZTXH 2HJKB 3ZDYF 5IW1B 4Z7NE 1LO3L 3NABL 3P0GB 1G84A 2QQLH 3FN0H 5DLMH 4FQQA 2HYMA 3BKCL 3EYFB 4KI1A 5GGVY 4XGZB 1FVCB 2FJHA 1P4BH 1UQSB 2QSCH 4Y1AB 5IB1A 4NT6A 2O5YL 3GSQB 1NMCB 2BFVH 2Y7QA 4EN3A 2LAGB 4HGMA 4ZUSA 1EGJH 5GHWH 2WBJA 1UB5A 2CRIA 4E0RB 5F1IB 4KTEL 4RFOL 4JCLA 2OZ4H 4WWKC 1VFUA 4LLMA 1J0JA 6FABH 2NLJA 1IGTA 1CLZH 4AEIL 2QR0B 2OSLA 3CLFH 1P9MA 3PWVA 5C9JA 4HK3J 5CD3B 3HTLX 2EDYA 2G75A 4I5BB 1N4XL 3JV4B 2OK0H 1A4JB 2FJGB 2MFNA 2NW2A 3BN9C 4JFFB 5A2LH 3MBEB 4UI2A 4JFDD 1XGPA 3HA0A 4QHUB 3A6BH 1H5BB 2VDRL 5F6HJ 5C2BL 4PRID 2CO7B 2A73B 2FHBA 1ACZA 3TYGH 4ELKB 2ED7A 2MOVA 1CG9A 1I3VA 4YEFA 4GAJL 5IQ7L 4OSUL 4GG6A 1CFNA 3NFSL 2XTJD 4CJ0A 1A14H 2GJ6A 3D25B 3RVXD 1S5HA 3MBED 1DZBA 3ZLQC 3HR5A 3FB8A 1P1ZA 2HFFB 4Q2ZB 1EVTC 3L95A 1NBVL 1YPZA 4S1DD 4JFFD 4Z7UA 5D1ZC 3WNKA 2DQJL 3MRNA 4F9LA 2PW1A 4YR6B 5F7MC 5HGHA 3HI1A 2V2WB 5LGHL 3B2UD 2JKXA 5A2KH 3DX7A 5J6HB 1JJUA 4E5XB 4PJBF 4F7MB 4JO2H 4RFNC 2VQUA 1XF4A 4KROC 2B0SL 3CUPA 4XVJL 1IC7L 5F7HA 1JHTB 1U8NB 3AFLA 1H9VA 2AJZB 3BP7B 5D7JB 1QNZL 1RIUH 1ZA3B 3HLAA 4JY4A 4OZ4A 2NX5E 3GMLA 4JVWA 4P46D 4W6WB 1WBYA 2P43B 4LSSH 2JJWA 1S3KH 4Z8FL 2WBKA 3DJ9A 1SEBA 5E6IB 5EOQL 3QEGL 2F53E 2IMMA 1CD0A 4OZIB 1I3GL 2D03H 2D7QA 5FYJE 2Y36H 5BV7C 1HXYA 1NCBH 1NBZB 4KJQD 4ZO8A 3RX7A 5AUMB 2AEQL 1T1YB 1FH5H 2RGSA 1T03L 4PJ7B 2DQIH 2QL1A 1MRCH 2A9MH 4PLOB 3IAGC 1D3CA 3D39E 3IDMA 4LCUA 1TXKA 4JQXA 2X10A 5C0CA 4PJBB 3QRGL 4V2CB 3MRRB 4KXZH 3RY4A 1CE6B 3W0WA 3S35L 3SGJC 3UDWA 3UP1A 1B3JA 3UTQB 3CDGA 1B6DA 2X1QA 2Z8RA 5IK3A 5AD0A 1NKRA 4UB0L 1A1MB 3OF6A 4JN2B 1MFEH 4R0LC 5D96B 1AC6A 4WV1B 1H0DA 4BZ2L 2OJZL 1A5FH 3BVNB 4HPYL 3I02B 3EO1A 3MRBA 2ZUVA 3DV4B 2DWEB 3RWJB 3VH8B 5C09E 1J0HA 4XMKL 1YEGH 4XC1L 1JI1A 4MJIA 4FZ8H 3P0VL 1I8MB 2ENYA 3EHBD 5SWSA 4P5TB 3OJDB 1BWMA 2F74A 2XZCL 4MNGA 4JM2D 1J9CT 3P4MB 4U1KB 2PF6A 3E1F1 4XNYL 3VFMB 2HKFL 3WO4C 1CN4A 2BRRL 2IBZX 4O51B 3DOSA 3ZE1F 5D6CB 1KB5H 1QA9A 3HE7C 1FN4A 3GJFK 1SEQL 1ADQH 4KMTH 5AUMA 3QFDA 1CZ8H 1P4BL 1JTOA 2G9HA 5E99L 1MI5B 2DYPB 5DEFA 5FK9A 3QNYA 4AQ1B 5KS9F 4UU9B 3FHQA 2B39A 1A6TA 3DMMC 2C3VA 4ALAH 4PRNA 1NBYB 1OGAE 4U1HA 4X4XB 1WISA 1I85C 2AJXL 4X9HA 2Q86B 2A74A 1IGIL 1G9EA 2I26N 3QI9C 4UB0H 1KCSL 3IDNB 3EYVA 4CU7A 3IFNH 4PJXA 4F7PB 1F8TH 5ICZB 2D2OA 4FQJH 1J1XL 5TF1H 4YZFE 1QSVA 4NWUL 5CJXC 3VFTB 2OLDA 3OR6B 4UUJA 4FS0A 2XQBH 3CPLB 3BAEH 3SE8L 1KACB 4MDIA 4MQ7A 1IT9H 3O41B 4ERSH 4WNQA 4ZXBA 4X9GA 1K6QL 2JCCF 3TNNA 3EZ8A 4QXUH 3MRMB 2R0LH 1XCTB 2NMSA 2EEBA 3CIQA 4G6JH 1A6ZB 1YNKH 3CFBA 4P2OD 3MXVL 4Q9QL 2VABA 4HGWA 4X5WB 3KXFB 2ZOKA 2QADC 1UJ3C 6FABL 3VXRA 3NZ8A 5DSCA 3TN0D 5HGDA 1T1ZA 2QQKH 5IQ7H 4I0CC 5E70A 3LKOB 4EUPG 1U2HA 5DK3A 3LS4H 2PN5A 3VI4E 2GJJA 3EJZC 3IU3A 2HMIC 1YMHB 4O02L 1XH3A 4OT1H 1EGJA 3BW9A 3G04B 4YHIA 4YHOH 1CE1L 4PR5A 5H8DA 1EHLL 1ADQA 1SYVA 1CXHA 1P84K 4Z9KB 2YSSA 1TCRA 2IANE 1I1YA 2RIKA 1BMGA 2F8OA 2ZUWA 1OARH 1IAKA 4GJTB 1FZOA 4ZOBA 5I1JL 3MNWB 4WCYH 3GJFB 5DHVB 4H5SB 3EOAA 3BUYA 3G08B 1T04B 5CCKH 4N8CL 4YHYC 1YQVL 4LIQL 4WUKL 1J0KA 3WHXA 4KI5E 4ZYKA 4DEPB 4YX2H 1U6AH 3DV6B 1M05B 1RIUL 2XXCB 1I1AA 4QRSA 1Q0YL 3O6KH 2NY0D 4U6VL 5BZWB 2PYFB 2Q1EA 1T2QL 4TULH 4Y1AA 5EUOE 1DCLA 4Z7OF 4TUKL 5IESH 5J0BA 2LQRA 3WNOA 3HPJA 1WBZA 1HYRC 5D93B 1ULVA 3P30L 5C8JA 4HW6A 2BY2A 3VJ6B 4IMLB 4LSTH 4PJ8C 3UTZB 4GSDL 1BFOA 5DTFB 1SYSA 4MCYB 5ADPL 5IMLA 4N5UA 1W0VB 2C7UB 3AREC 4OQTL 1X5FA 5FM8A 35C8H 4TNVK 5C9JB 5ANMA 3NZHH 1MCHA 3O4LB 3JTTA 4K3DH 4PJAF 1F3JB 2Y07L 4JPKL 1ZT7A 4WI9A 3R8QA 3TCLB 5D7LB 3HPLA 4S1SH 4FQHA 2P5EE 3PGFH 2BZDA 1CDGA 1YJDL 5TGBA 5H94A 1FZJB 5C6PB 2IQ9L 3B2VH 2FSEB 4JFXB 4PJEA 1NSNH 1BVLA 3HZMA 2IALB 4LOUC 2NTSP 4ONHB 1EDQA 2FNBA 3DWTA 3ARBB 3DXAD 5DD6A 4JJ5B 3VWKB 1RAMA 1RZGB 1U91A 3D3VE 4M9OA 5GS2D 3SCMD 2W9DL 4R4BB 1A2YA 2HVKA 1D6VH 3O45A 5E03A 4KK9D 5BOPA 1RVFL 5D7JC 4FHBD 2YPKA 3ORJA 4HH9A 4NDMB 1I1AC 1V5JA 4UIKH 3BZ4B 4RMUA 2KH2B 3NCCB 1TMCB 3MRJB 3ZKNC 3G5XA 5DI8B 1NANI 4YE4H 3WSQL 1JGLH 4POUB 2ENSA 3CLEL 3NIDE 2B2XL 4JKMA 5JR1H 3VJ6A 5EU3B 2QSCL 2GITA 3AC0A 2DICA 2R1WB 4G8GD 1NFIA 2DIJA 2R69L 3BUYB 2YA0A 4XPAH 1H3XA 1F5WA 2CDEB 1H15A 1TDQA 4ISVB 4C58B 2NR6D 1YDPB 3E6HA 2DKSA 3MO1B 1AI1L 4I3SL 5DD0L 2WSKA 3GMOA 1X7QB 5TGBB 3QULB 4L9LC 3LKPA 5DRZB 2Q6WA 2GTZA 1R3IL 5DQDH 2Z92A 2DLIA 3AUVA 5E00B 1OAKL 3K74B 3GSRA 4EUPA 1MJJA 1AHWC 3ZKXB 3EBAA 2OP4H 2AGJH 3T2NH 4NQED 4IRSC 4F2MB 2P42B 3HZYB 1SVZA 1YC8A 4RIRB 5EZIH 5E56A 3GUTA 1E6JL 1S9WB 3SDCA 3I3EA 3MJ6A 4YK4C 1N5YL 2J6EA 3SGJA 3MV01 4UQ3A 4UV4H 4OB5L 3IFLH 3BH9B 2NW3B 4G9FA 3ZHLA 3OAZH 5CLWA 3FZUC 4Y5XA 5JIKA 3CDGB 4PJGA 4Z7WF 2YKLL 1Q0XL 1PZ5B 2P8LA 4M9PA 2GK2A 5F7KC 5B3JE 3KNBB 3B83A 3QXAA 3D69B 3HC4H 4Q6IC 4XVTL 2OJEB 4X6DF 3RZCD 2ZSWA 4HX1A 2FWOA 5D2NE 4G6JL 4GUPA 1I9IH 4RRPG 5C0AD 2FSEA 5MEND 3OKEB 1ZHLB 4KKCC 4XT1C 5J6GA 2W9EL 1CGTA 3OKDA 4RA3A 4S10A 4Y16B 1UWGL 2E8ZA 2J8UF 4NN6C 4NZDA 3NN8A 3MREB 4ZFGH 1HXYB 1A6WL 5T3XE 1SHMA 1SM3L 4MXVE 4OGYH 3MYJA 4NO2B 3BKCH 1UZ8B 1A0QH 1OT2A 1BQSA 3L5JA 4YHZH 5BS0E 3PWPA 1FGNL 1YUHA 5SX5H 2DLHA 4LLDB 4KKLC 5DQ9B 1N0XH 3ALWA 2D03L 3NCEB 4QO1A 4Q9RL 1JHLH 3HZVB 4M93C 3CU1A 5EDXA 5T1LD 3TT1H 5L8LB 3AXLA 4PJ5D 1B0GA 4XP4H 2PR4H 4OIAA 4QRPE 1NCUA 2ZUUA 3MRFA 1PKQA 5HHMB 3WKML 5DD1L 4ZOAA 1IGJB 2DM3A 1JPST 1P5UA 2J6EH 2P7TA 1P4LB 4M8QB 4NZTL 3MLPA 2EDJA 3RTQA 3DRQB 3BVNA 4RGOH 5AZ2H 3QZWG 3NZHL 3DX6A 2XTJC 4P2QE 5DFWH 5GGRY 1U8PA 5IBLC 2DWEA 3OV6A 1J7VR 4U1NB 3V52H 5IUSA 1JV5B 1TJIL 2A1WH 1IM3A 4QY8B 1X5HA 4FQIH 4GOSA 1VGEL 1RIHL 2D9QB 1XMWA 2VN7A 1MHHA 2AXGA 4B7IA 5DA4A 3WO3B 1KCVH 2ADFL 2P1YA 4JY6A 5ACMA 2DLFL 3RWCA 1IGML 1X5LA 1DQQB 2D4FA 3VCLB 4QXTB 1E27A 4NBXB 5TFSH 4G43A 5ESAA 4XPFH 3NTCH 2FH8A 4KAQL 1DBKH 1AQKH 5D7IF 3FOMB 3N85H 3JZ7A 4JZOB 3SGKC 4MJID 5F8RC 1M1SA 4FQ2L 2G9HB 3RVXC 3R06B 1NUNB 3A6BL 2Y5TB 4NJ9H 5C2BH 3KPPB 4LKCB 1A7BA 1UVQB 4GW5A 4XCEA 3GHBH 1NMCC 2P45B 3MC0A 2ORBL 1MCCA 4WV1C 2HKFH 2GI7A 2XTLA 1LO5B 2X9YA 2CLZA 1MVUB 4U31A 2JB5H 3NA4A 1N5AA 1W8OA 1RZ8B 1JGDB 3ARFA 4ZUUB 5DD5L 1CK0H 1T7ZA 3OX8A 3N1GC 1FGVL 2W1NA 3NGBB 4P5TA 4NQVA 1WIOA 3EOYG 4LL9A 5ERWA 3S36X 1DEEA 2DMBA 3EOTH 5I1CL 3TH4T 4Z8FH 3S36H 1JZ7A 4FZEL 1GCFA 3ZL4L 1XGYL 2R56L 4G6AC 2WK2A 4PGJA 1UM4H 3ULSA 2BSTA 5T5NG 3OSKA 4HQQH 4BKLB 3U2SA 2H9GA 2XZQH 3QXVA 1EAPA 4YXKH 4JPVH 2Z4QA 4XVSH 1F6FB 3AU1A 4BFGA 5BQ7A 2P24A 3UTZA 3LB6D 3PG2A 1ZVSA 3TZVA 1DR9A 3IXTA 5T3ZE 1C5BH 4POYA 3FOMA 1A3QA 3DUSA 4Z7WB 3TNMA 5TE4H 3G04A 2FHCA 2JIXB 1IGJA 3GHBL 4F33B 1T1XA 1F4WH 1G7PB 3MV8D 1RQ5A 1CXIA 1EERB 3S4SA 3B9KA 4ETQB 4FG6D 5IW6B 2EDHA 5BW7A 2ESVD 2HN7B 5IR1A 3KJ4B 3QNXA 2J4WH 2D7TH 5DRNA 1LQSR 4MWFA 5F93C 1MFCH 1F3DJ 3ZE0E 3HS0B 3KPOB 3TA3A 5DJZB 1J8HB 1NGZA 2PO6C 4Z76B 1KFAH 1KB5A 5DJDA 1JBJA 1AIFB 3VDBA 3GMPB 3IDIB 4N8VG 4OD3H 1J5OH 1QQDA 2DWDA 5IHBA 5CJQL 4GAFB 1KJ3L 3SEPA 1A7QH 4ZAKB 1AJ7L 4LCIL 5EPMB 1FL5B 3O11A 3VFRB 3GJEB 2CIKA 4OKVA 2VTFA 4JPVL 5DO2D 4W70A 2EYSA 4XPTH 4OGYL 3QI9D 2A9NH 2GT9A 1FYHB 4FTVB 5H35B 5C0JA 1ACYL 4K3JL 1RZFH 1SMOA 5J9PB 4C56D 5D1ZD 4LEOA 1E6OH 2WV3A 4EZMA 1NGYB 3WFBH 4ZD3H 5HYJE 1WTLA 5GS1C 2XG4A 3QT2A 3QNYB 4OZHE 4MLIA 3SDXE 3DVGB 4LNRB 1I8LC 3RUGA 2F54D 1FSKB 3O2DL 2CDEA 4JN1L 1SEBB 5E6IA 3KLHD 4PRHB 3IT8D 5E2WL 5FM5O 1QOKA 4QOKD 3UYRL 1MAJA 2YPVL 3FL7A 1CS6A 4Y4HC 4X4YB 5CAYB 4Z7VB 4RAHA 3UTSB 1FZJA 3LEVL 2A0LC 1YY9D 4NO3A 4XTRC 4CGTA 4GS7C 1I7TA 3OXRA 3RVTD 3SDYH 1CXKA 2XWBB 5DVOA 4RISH 4Y2DA 1HHJB 5C0BB 5BW7C 2X4SA 2Y6SC 25C8L 5C3LD 1MJJB 1I7RB 4F80A 4RWYH 3UC0L 3ARGA 3EJZD 4RGNE 2HMID 1BF2A 3MRKB 4XNUL 4F2MA 2GSIA 4MJ6B 1OP3K 3T1FA 3ME0A 4O2CA 5GRYA 4L3EA 1IEAB 1CF8H 3H9SE 3MGTA 4JVUA 4TOYL 1B4RA 3MX0A 4K3EL 2DI7A 5GISH 5DEGB 5D9SA 3VRJA 1DQLH 4D8PB 1U42A 3V6OA 1TVHB 4PJ9B 5GZND 4OUOA 3BD4A 3O3EA 1YECH 4U1GC 3QXTA 4HAGA 2Z35B 4OLZL 1JK8A 1K6QH 4MHHI 4I3RL 2C1OB 2OCFD 4MQXC 1RZKC 3WFBL 2GITB 2YZ1A 1A9EA 4UNTA 3NIFF 2HTLD 1BEYL 2V17H 4JKPH 4GRMB 1FYTD 4RWHA 3MRHB 1AHWB 3UAJC 1NFDE 1UH2A 2B1HH 3VRLE 3CLEH 5DD5H 5K9OB 3STZB 4OLWH 4N8VB 2A83B 2BMKB 2AJVH 1ZE3C 2QJDA 4G8GA 3WFHA 3BI9X 4Y4HA 3TBSB 2MSPA 5A1AA 4HKJA 3EAKA 2Q3ZA 4DOHB 3U0WH 3UBXG 4Y2DB 5MHSE 1FAIH 3RGVB 1GZQA 4ONFH 1DLHB 4X6CF 3UTTB 4IOFC 3BH8B 3RHWF 3KLAA 2F5BL 2VKWA 5F1IA 2NTFB 2GT9B 3O3DA 1KT2B 1MF2L 5JOFB 2UUDH 2DIBA 3FONA 5HGGS 3GEWB 3PHOA 4KK6D 4MJ6A 2WQRA 1OPGH 3S96B 3BWAB 3DURA 1BIIA 4MX7B 2APXA 1LEIA 3C5JB 4Q9CA 1FRGL 1GAFH 1WBXB 3N1FC 5F70A 3VGBA 2BVUA 3DMMD 4XC1H 4M1GH 4OF8A 4Q74A 3QFJE 1SBSL 1KUMA 3CPLA 1JZ8A 2NY1B 1NAMA 2J8OA 5HSFA 5KZCB 2ZSWB 4POZC 5SV4A 3CSPA 1XGQA 4E41D 3LDBB 5FUZL 2YN5A 4PJEE 4Q9BA 5F7EH 4KVNH 3QDGE 4JFFE 1JRHI 3V8OA 5TDNB 1N7ML 1TNNA 4HG4J 1BQLH 3OKNB 4XBGA 5C08E 3G5ZB 4NHCL 1X5JA 3WFEH 3FQUA 3L6FB 2A73A 1MIML 1HILB 4KRLB 4GSDH 5F88A 1A8JH 1LO0L 4NCC1 2NXZC 1F4XH 3INUL 5IQ9B 4NN6B 1WWAX 4Y4FD 3FN9A 4Q0XH 1EHAA 3VXPA 4X7EC 2D0GA 2RCSH 2BDNL 2QHRH 4LSVL 4DUVA 4ONGL 3WS6C 1HDMB 3WS3A 5BVJB 3NIGE 3TESA 1N2RA 5HI5D 1RHHB 1RZKL 2KZ1B 3H0TA 1MF2H 1TJGH 2MMXA 3FRUB 5L2JB 1TNMA 2W07A 3DECA 2ZUQB 5IBUB 1JYNA 3RUGF 1LGVA 5D96C 3OAUL 5IMKB 4ZUWB 4YC2B 5JORB 5HVHC 5JO5B 4S2SB 3U46B 32C2B 4FABH 2ADIA 5HTSA 2NCMA 2I9TA 3B9AA 1EK3A 1FPTH 4LFHD 4ENED 5FUZH 4F7EB 1NCNA 1CU4H 1ZANH 2C4FT 4U05A 2NX5B 3STZA 3PWLA 1OSZB 1BQLL 3ULVH 4MJ5B 5TF0A 5MEPB 5JQHC 2JCCB 2BSTB 1FNGA 3ET9F 3BEVB 3KYOA 5FYLD 2C3WA 3WFDL 3KR3L 2ZUYA 4NM4H 1MJUH 3ROOA 3HCVA 3C08H 1KJMA 1I85A 1R5IB 1UEMA 3T0EC 1BFOB 1QPXA 2ZUTA 4NCC2 1INEH 1YNKL 2V2XB 3D39B 3IDMB 5C07B 3U1SH 1CDCA 4JCMA 4IRZL 4QGYA 1BVKB 2VZOA 2AJSH 3LAFA 4PJGE 4KGJA 1AO7D 5I6XC 4GQ9L 1A1MA 1L6XA 5TQ2H 1JHKH 2JELH 1UACL 2H6PB 4LRIC 3U82B 3WHE1 3SJVD 4XMPH 4W6YB 3DXAE 2ZPKH 5EC2A 4NQSB 3VFVA 4M7LH 3WUWB 2BSRA 4HK3N 2DB8A 4Z7VF 5L9DH 3OX8B 2HTKC 5LCVH 5D2LF 3WFCH 3BZFA 1BP3B 3PJSB 1CTOA 5D7LD 2VUYA 4R4ND 3ZT6A 4WUUB 3HUJA 2GK0B 2Y23A 2ZUQC 2BNRE 3O4LD 1ETZA 4RSVA 3WD5H 1II4E 4OM1H 2HT3D 2NY7L 4TUJB 5HHOA 3WLBB 2YKLH 2CMRL 3QUZC 1SJHA 1QA9B 3O11B 1HDMA 5GGRA 3QUZD 1VB9A 2A2QT 2FBJL 3MFFA 2H32A 1I4FB 3PQYA 3RDTD 2MNUA 4YFLF 4XP5H 4PJ7F 5I1CH 2VXQH 4OTXH 4TULL 5E8PA 1XGYH 4QEGA 4PG2A 4ORGB 4XP1L 3BKMH 4OZGE 2E6QA 2JJSA 1WJ3A 5CP3A 3W11D 5FIEA 4KTDL 3DX8A 4XC3H 3AXLB 4YUEH 5EIQA 2QKIB 1MJ8H 2LABA 2VDOH 2YK1H 1FAKT 1CFBA 1G6VK 3HNTH 4NGHL 1TCMA 4U3HA 4KWUA 4WFEE 3PGCB 4BA8A 4XWGL 4ELMB 4XWOC 5IHUH 4JFFA 3W5MA 2VAJA 2OBGA 5I8EA 1JPFA 1SJEB 3QO1B 4TNVF 5HD8D 5EOCH 1NLBL 4Y1AE 2Z4QB 3JWOL 4NN5B 4N5EC 5DVKA 2X1WL 1A7PH 2M26A 4JKKA 3ULVC 5C7XL 4ELKA 2P5WE 1KPUB 2EECA 1HWHB 1S7QB 5C0RH 4GRLA 5IOPB 3CFCH 2DM4A 3IAQA 3VDAA 4K7PY 1WT5C 1I75A 2G2RB 4FFYL 4Z78B 5AWNH 4ETYA 4KUZL 4OJFL 4AH2B 2CXGA 4U1IB 2FLBT 4PRHD 5F44A 4OBRA 5GGUB 3MFFB 1U8QB 2VQ1A 3OKLB 2EIDA 1IKNA 2VYRE 1PFCA 5F7EL 3R0MA 1A7OH 4MAUL 5D1QB 1CGVA 5MEOA 4ODUB 1O5DT 3I75A 1T66C 3BGAA 4HF5H 5F7NC 3RL1B 5I74B 3S37L 2I25N 2P5EA 4R90H 2EO1A 4J3VA 1LE5B 3G6JE 4UILL 4PS4H 1R3IH 1S9YA 1DFBH 4J3UA 3F7YB 4I9WE 2ILLA 2R1YB 1RUKL 1F4HA 3E0GA 1AQKL 2K7QA 1P7KA 4K94H 1ZOXA 2BNQB 1C8PA 3QUXB 1A7RL 1VKXB 2ICWB 1UQSA 1KCLA 4NKIL 2RCSL 4PG9A 3PWUA 1FVDB 2VLMD 1C5CL 4LIQE 4X98A 3NA9L 2HVJA 2AJUH 4PRIB 4AEEA 4X7CC 3MACH 4L5FL 3U48A 1LNUB 1U3HD 4BSWB 3UTPE 4FQ1H 3S3PA 3O3DB 2LVEA 3MLVH 3RJQB 3PHOB 4QWWD 2CKNA 4UV7H 5IM7B 1UB6B 3O3AA 3TO4B 4WHTA 5D9SB 3MMEA 5EBMB 2DLTA 2OTWA 4PJ9A 3ZDXF 1UYWH 4EVNA 1INEL 1J05B 1KGCD 1QHOA 4Z7VA 4I77H 2PO6D 3FO2A 1WZMA 3ARGD 4TTDD 1KV3A 3JWOC 4CU8A 4NKDA 2A6DB 3IJHA 4D0BB 5JPNA 1SVCP 5E8OB 1I7ZB 4B41A 4JFXA 3DI3B 3F12A 1IGFL 5E2VH 3TBVB 1UZ6F 1DQLL 3S4SB 2C5DC 5T33L 4OCWH 2VL5A 2C9AA 5DJCA 1A7RH 5EORH 4MNHA 2UWEF 5EWIH 1H3PH 2ICWA 5J8OA 4N0CD 2K9UA 2XXMB 3DYMA 4FG6C 5KVDH 1IQWH 2F5AH 4Y0GA 1TJHH 4N8PA 2F8XC 4G6FB 1OHQA 4D8PA 4A2MA 4FA8A 5B22A 4YDLC 5K9JH 4NDMA 1H8OA 3C5ZB 4H0IA 1OVZA 4G9FE 5HPMB 1C5DA 3WMSA 3KYAA 4ZDHA 2CDGB 4DW2H