3RH9A

The crystal structure of oxidoreductase from marinobacter aquaeolei
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
481
structure length
481
Chain Sequence
MIESPLLENLTGYIGGRWKDSAGGATFDVYNPATGSVIAKVPSMPEEDVVAAVEAGQSALRLTNPWPIETRRKWLEDIRDGLKENREEIGRILCMEHGKPWKEAQGEVDYAAGFFDYCAKHISALDSHTIPEKPKDCTWTVHYRPVGVTGLIVPWNFPIGMIAKKLSAALAAGCPSVIKPASETPLTMIAFFSVMDKLDLPDGMVNLVMGKASVIGKVLCEHKDVPMLSFTGSTEVGRKLIVDTAEQVKKLALELGGNAPFIVFDDADLEAAADNLIANKFRGGGQTCVCANRIFVHEKVADAFGQKLAERVNKMTVGDGMNDGIDIGPLINKQGFDKVKRHLQDALDKGASLVAGKQPAELGDGLFFPPTVVQGVDREMCCYQEETFGPLVPMALFRTEEEVIDAGNDTEFGLASYVFTADAERAQRVAAGLRFGHVGWNTGTGPTPEAPFGGMKASGIGREGGLEGLFEFVEAQTVPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of oxidoreductase from Marinobacter aquaeolei
rcsb
molecule keywords Succinate-semialdehyde dehydrogenase (NAD(P)(+))
molecule tags Oxidoreductase
source organism Marinobacter aquaeolei
total genus 141
structure length 481
sequence length 481
chains with identical sequence B
ec nomenclature ec 1.2.1.16: Succinate-semialdehyde dehydrogenase (NAD(P)(+)).
pdb deposition date 2011-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00171 Aldedh Aldehyde dehydrogenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.309.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 2 Aldehyde Dehydrogenase; Chain A, domain 2 3rh9A02
3.40.605.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 1 Aldehyde Dehydrogenase; Chain A, domain 1 3rh9A01
3RHJA 2EITA 2J5NA 4NU9A 1QI6A 1KY8A 3V9IA 3VZ3A 4LH0A 4OHTA 4LGZA 4QJEA 1A4SA 4OUBA 2O2RA 4CAZA 1O20A 1NZZA 4I26A 4IDMA 4OE5A 4OGDA 3V9GA 4CBBA 3R31A 4K57A 4QJEB 3V9LA 3RJLA 3RHHA 4LH1A 4V3FC 5KLKA 4V3FA 4NS3A 3N82A 4GO0A 4I3WA 1AG8A 1O02A 2BHPA 2BHQA 4IHIA 2WOXA 3RHRA 1EUHA 1T90A 3RHOA 4QYJA 1CW3A 5AC2A 3ZQAA 4QTOA 3V4CA 4A0MA 2WMEA 4ZULA 3EFVA 5KF0A 2ONMA 4GO3A 4E4GA 2VROA 4O5HA 1VLUA 2IMPA 4LH3A 4QGKA 3N81A 5L13A 4YWEA 5F2CA 3R64A 4WB9A 4WP7A 4U3WA 2Y52A 3INJA 4I25A 5ABMA 1O01A 4NPIA 5J6BA 4ZVXA 4ZWLA 3B4WA 1WNBA 2Y5DA 1UZBA 2EIIA 4I3TA 3RHPA 4WPNA 4E3XA 4OE6A 4I8QA 4MPYA 4ITAA 5EUYA 1UXTA 3N83A 4FR8A 2J6LA 4QN2A 2O2PA 4OU2A 4ZVWA 3VZ0A 4MPBA 5A2DD 1BXSA 5EXFA 2O2QA 4ZXUA 3ROSA 4I3VA 4L2OA 3VZ1A 4FQFA 4X2QA 1UXPA 2WMEC 4LIHA 5A2DA 4V37A 4PXNA 3V9KA 3U4JA 2XDRA 4DNGA 5EZ4A 2EHUA 2ONPA 2D4EA 3QANA 3N80A 5DRUA 3RH9A 4DALA 2W8QA 2ILUA 4LEMA 4ZVYA 2IY6A 2QE0A 3PRLA 4PXLA 2EJDA 4F3XA 1QI1A 4JBEA 4KNAA 2JG7A 3RHMA 4YWUA 1UXQA 2Y53A 4I9BA 4I8PA 4PXLB 5EKCA 4X0TA 3MY7A 4PZ2A 4ZZ7A 2W8PA 5DBVA 2VLEA 1NZXA 4NMKA 5AC1A 4IT9A 2W8NA 2H5GA 4GO4A 4H73A 4I2RA 4JZ6A 1UXNA 2BJKA 5AC0A 5KLLA 4JDCA 2EUHA 5EK6A 5KJ5A 4C3SA 3RHQA 4H80A 4QETA 3V9JA 2EJ6A 3V9HA 1ZUMA 5A2DC 3INLA 4GHKA 1O00A 4GNZA 4OE2A 1EZ0A 3IWJA 4X0UA 5FHZA 5J78A 5L2NA 2EJLA 2ONNA 2W8RA 1NZWA 1AD3A 2ESDA 4H7NA 1A4ZA 1UXUA 4LH2A 4Q92A 5L2OA 2Y51A 4IDSA 4L1OA 1O05A 2BJAA 4I3XA 5EYUA 5JRYA 4IYMA 5KLMA 3IWKA 4X4LA 1BPWA 1BI9A 3JU8A 4O6RA 4GO2A 2OPXA 4KWGA 1O9JA 3JZ4A 4WJ9A 1O04A 2ID2A 2W8OA 3K2WA 4OE4A 3SZBA 3VZ2A 4KWFA 4NMJA 3EK1A 5J7IA 2HG2A 4I1WA 1WNDA 3PQAA 4I3UA 4ITBA 3SZAA 3TY7A 5L2MA 5DIBA 5KLNA 3SZ9A 4QF6A 2ONOA 5EEBA 2EIWA 4NEAA 1UXRA 1UXVA 4ZUKA 3K9DA 1EYYA 2EHQA 3ETFA 3I44A 3RHLA 2J40A 3RHDA 4YWVA 5KLOA
chains in the Genus database with same CATH superfamily
3RHJA 2EITA 2J5NA 4NU9A 1QI6A 1KY8A 3V9IA 3VZ3A 4LH0A 4OHTA 4LGZA 4QJEA 1A4SA 4OUBA 2O2RA 4CAZA 1O20A 1NZZA 4I26A 4IDMA 4OE5A 4OGDA 3V9GA 4CBBA 3R31A 4K57A 4QJEB 3V9LA 3RJLA 3RHHA 4LH1A 4V3FC 5KLKA 4V3FA 4NS3A 3N82A 4GO0A 4I3WA 1AG8A 1O02A 2BHPA 2BHQA 4IHIA 2WOXA 3RHRA 1EUHA 1T90A 3RHOA 4QYJA 1CW3A 5AC2A 3ZQAA 4QTOA 3V4CA 4A0MA 2WMEA 4ZULA 3EFVA 5KF0A 2ONMA 4GO3A 4E4GA 2VROA 4O5HA 1VLUA 2IMPA 4LH3A 4QGKA 3N81A 5L13A 4YWEA 5F2CA 3R64A 4WB9A 4WP7A 4U3WA 2Y52A 3INJA 4I25A 5ABMA 1O01A 4NPIA 5J6BA 4ZVXA 4ZWLA 3B4WA 1WNBA 2Y5DA 1UZBA 2EIIA 4I3TA 3RHPA 4WPNA 4E3XA 4OE6A 4I8QA 4MPYA 4ITAA 5EUYA 1UXTA 3N83A 4FR8A 2J6LA 4QN2A 2O2PA 4OU2A 4ZVWA 3VZ0A 4MPBA 5A2DD 1BXSA 5EXFA 2O2QA 4ZXUA 3ROSA 4I3VA 4L2OA 3VZ1A 4FQFA 4X2QA 1UXPA 2WMEC 4LIHA 5A2DA 4V37A 4PXNA 3V9KA 3U4JA 2XDRA 4DNGA 5EZ4A 2EHUA 2ONPA 2D4EA 3QANA 3N80A 5DRUA 3RH9A 4DALA 2W8QA 2ILUA 4LEMA 4ZVYA 2IY6A 2QE0A 3PRLA 4PXLA 2EJDA 4F3XA 1QI1A 4JBEA 4KNAA 2JG7A 3RHMA 4YWUA 1UXQA 2Y53A 4I9BA 4I8PA 4PXLB 5EKCA 4X0TA 3MY7A 4PZ2A 4ZZ7A 2W8PA 5DBVA 2VLEA 1NZXA 4NMKA 5AC1A 4IT9A 2W8NA 2H5GA 4GO4A 4H73A 4I2RA 4JZ6A 1UXNA 2BJKA 5AC0A 5KLLA 4JDCA 2EUHA 5EK6A 5KJ5A 4C3SA 3RHQA 4H80A 4QETA 3V9JA 2EJ6A 3V9HA 1ZUMA 5A2DC 3INLA 4GHKA 1O00A 4GNZA 4OE2A 1EZ0A 3IWJA 4X0UA 5FHZA 5J78A 5L2NA 2EJLA 2ONNA 2W8RA 1NZWA 1AD3A 2ESDA 4H7NA 1A4ZA 1UXUA 4LH2A 4Q92A 5L2OA 2Y51A 4IDSA 4L1OA 1O05A 2BJAA 4I3XA 5EYUA 5JRYA 4IYMA 5KLMA 3IWKA 4X4LA 1BPWA 1BI9A 3JU8A 4O6RA 4GO2A 2OPXA 4KWGA 1O9JA 3JZ4A 4WJ9A 1O04A 2ID2A 2W8OA 3K2WA 4OE4A 3SZBA 3VZ2A 4KWFA 4NMJA 3EK1A 5J7IA 2HG2A 4I1WA 1WNDA 3PQAA 4I3UA 4ITBA 3SZAA 3TY7A 5L2MA 5DIBA 5KLNA 3SZ9A 4QF6A 2ONOA 5EEBA 2EIWA 4NEAA 1UXRA 1UXVA 4ZUKA 3K9DA 1EYYA 2EHQA 3ETFA 3I44A 3RHLA 2J40A 3RHDA 4YWVA 5KLOA
chains in the Genus database with same CATH topology
3RHJA 2EITA 2J5NA 4NU9A 1QI6A 1KY8A 3V9IA 3VZ3A 4LH0A 4OHTA 4LGZA 4QJEA 1A4SA 4OUBA 2O2RA 4CAZA 1O20A 1NZZA 4I26A 4IDMA 4OE5A 4OGDA 3V9GA 4CBBA 3R31A 4K57A 4QJEB 3V9LA 3RJLA 3RHHA 4LH1A 4V3FC 5KLKA 4V3FA 4NS3A 3N82A 4GO0A 4I3WA 1AG8A 1O02A 2BHPA 2BHQA 4IHIA 2WOXA 3RHRA 1EUHA 1T90A 3RHOA 4QYJA 1CW3A 5AC2A 3ZQAA 4QTOA 3V4CA 4A0MA 2WMEA 4ZULA 3EFVA 5KF0A 2ONMA 4GO3A 4E4GA 2VROA 4O5HA 1VLUA 2IMPA 4LH3A 4QGKA 3N81A 5L13A 4YWEA 5F2CA 3R64A 4WB9A 4WP7A 4U3WA 2Y52A 3INJA 4I25A 5ABMA 1O01A 4NPIA 5J6BA 4ZVXA 4ZWLA 3B4WA 1WNBA 2Y5DA 1UZBA 2EIIA 4I3TA 3RHPA 4WPNA 4E3XA 4OE6A 4I8QA 4MPYA 4ITAA 5EUYA 1UXTA 3N83A 4FR8A 2J6LA 4QN2A 2O2PA 4OU2A 4ZVWA 3VZ0A 4MPBA 5A2DD 1BXSA 5EXFA 2O2QA 4ZXUA 3ROSA 4I3VA 4L2OA 3VZ1A 4FQFA 4X2QA 1UXPA 2WMEC 4LIHA 5A2DA 4V37A 4PXNA 3V9KA 3U4JA 2XDRA 4DNGA 5EZ4A 2EHUA 2ONPA 2D4EA 3QANA 3N80A 5DRUA 3RH9A 4DALA 2W8QA 2ILUA 4LEMA 4ZVYA 2IY6A 2QE0A 3PRLA 4PXLA 2EJDA 4F3XA 1QI1A 4JBEA 4KNAA 2JG7A 3RHMA 4YWUA 1UXQA 2Y53A 4I9BA 4I8PA 4PXLB 5EKCA 4X0TA 3MY7A 4PZ2A 4ZZ7A 2W8PA 5DBVA 2VLEA 1NZXA 4NMKA 5AC1A 4IT9A 2W8NA 2H5GA 4GO4A 4H73A 4I2RA 4JZ6A 1UXNA 2BJKA 5AC0A 5KLLA 4JDCA 2EUHA 5EK6A 5KJ5A 4C3SA 3RHQA 4H80A 4QETA 3V9JA 2EJ6A 3V9HA 1ZUMA 5A2DC 3INLA 4GHKA 1O00A 4GNZA 4OE2A 1EZ0A 3IWJA 4X0UA 5FHZA 5J78A 5L2NA 2EJLA 2ONNA 2W8RA 1NZWA 1AD3A 2ESDA 4H7NA 1A4ZA 1UXUA 4LH2A 4Q92A 5L2OA 2Y51A 4IDSA 4L1OA 1O05A 2BJAA 4I3XA 5EYUA 5JRYA 4IYMA 5KLMA 3IWKA 4X4LA 1BPWA 1BI9A 3JU8A 4O6RA 4GO2A 2OPXA 4KWGA 1O9JA 3JZ4A 4WJ9A 1O04A 2ID2A 2W8OA 3K2WA 4OE4A 3SZBA 3VZ2A 4KWFA 4NMJA 3EK1A 5J7IA 2HG2A 4I1WA 1WNDA 3PQAA 4I3UA 4ITBA 3SZAA 3TY7A 5L2MA 5DIBA 5KLNA 3SZ9A 4QF6A 2ONOA 5EEBA 2EIWA 4NEAA 1UXRA 1UXVA 4ZUKA 3K9DA 1EYYA 2EHQA 3ETFA 3I44A 3RHLA 2J40A 3RHDA 4YWVA 5KLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RHJ A;  2EIT A;  2J5N A;  4NU9 A;  1QI6 A;  1KY8 A;  3V9I A;  3VZ3 A;  4LH0 A;  4OHT A;  4LGZ A;  4QJE A;  1A4S A;  4OUB A;  2O2R A;  4CAZ A;  1O20 A;  1NZZ A;  4I26 A;  4IDM A;  4OE5 A;  4OGD A;  3V9G A;  4CBB A;  3R31 A;  4K57 A;  4QJE B;  3V9L A;  3RJL A;  3RHH A;  4LH1 A;  4V3F C;  5KLK A;  4V3F A;  4NS3 A;  3N82 A;  4GO0 A;  4I3W A;  1AG8 A;  1O02 A;  2BHP A;  2BHQ A;  4IHI A;  2WOX A;  3RHR A;  1EUH A;  1T90 A;  3RHO A;  4QYJ A;  1CW3 A;  5AC2 A;  3ZQA A;  4QTO A;  3V4C A;  4A0M A;  2WME A;  4ZUL A;  3EFV A;  5KF0 A;  2ONM A;  4GO3 A;  4E4G A;  2VRO A;  4O5H A;  1VLU A;  2IMP A;  4LH3 A;  4QGK A;  3N81 A;  5L13 A;  4YWE A;  5F2C A;  3R64 A;  4WB9 A;  4WP7 A;  4U3W A;  2Y52 A;  3INJ A;  4I25 A;  5ABM A;  1O01 A;  4NPI A;  5J6B A;  4ZVX A;  4ZWL A;  3B4W A;  1WNB A;  2Y5D A;  1UZB A;  2EII A;  4I3T A;  3RHP A;  4WPN A;  4E3X A;  4OE6 A;  4I8Q A;  4MPY A;  4ITA A;  5EUY A;  1UXT A;  3N83 A;  4FR8 A;  2J6L A;  4QN2 A;  2O2P A;  4OU2 A;  4ZVW A;  3VZ0 A;  4MPB A;  5A2D D;  1BXS A;  5EXF A;  2O2Q A;  4ZXU A;  3ROS A;  4I3V A;  4L2O A;  3VZ1 A;  4FQF A;  4X2Q A;  1UXP A;  2WME C;  4LIH A;  5A2D A;  4V37 A;  4PXN A;  3V9K A;  3U4J A;  2XDR A;  4DNG A;  5EZ4 A;  2EHU A;  2ONP A;  2D4E A;  3QAN A;  3N80 A;  5DRU A;  3RH9 A;  4DAL A;  2W8Q A;  2ILU A;  4LEM A;  4ZVY A;  2IY6 A;  2QE0 A;  3PRL A;  4PXL A;  2EJD A;  4F3X A;  1QI1 A;  4JBE A;  4KNA A;  2JG7 A;  3RHM A;  4YWU A;  1UXQ A;  2Y53 A;  4I9B A;  4I8P A;  4PXL B;  5EKC A;  4X0T A;  3MY7 A;  4PZ2 A;  4ZZ7 A;  2W8P A;  5DBV A;  2VLE A;  1NZX A;  4NMK A;  5AC1 A;  4IT9 A;  2W8N A;  2H5G A;  4GO4 A;  4H73 A;  4I2R A;  4JZ6 A;  1UXN A;  2BJK A;  5AC0 A;  5KLL A;  4JDC A;  2EUH A;  5EK6 A;  5KJ5 A;  4C3S A;  3RHQ A;  4H80 A;  4QET A;  3V9J A;  2EJ6 A;  3V9H A;  1ZUM A;  5A2D C;  3INL A;  4GHK A;  1O00 A;  4GNZ A;  4OE2 A;  1EZ0 A;  3IWJ A;  4X0U A;  5FHZ A;  5J78 A;  5L2N A;  2EJL A;  2ONN A;  2W8R A;  1NZW A;  1AD3 A;  2ESD A;  4H7N A;  1A4Z A;  1UXU A;  4LH2 A;  4Q92 A;  5L2O A;  2Y51 A;  4IDS A;  4L1O A;  1O05 A;  2BJA A;  4I3X A;  5EYU A;  5JRY A;  4IYM A;  5KLM A;  3IWK A;  4X4L A;  1BPW A;  1BI9 A;  3JU8 A;  4O6R A;  4GO2 A;  2OPX A;  4KWG A;  1O9J A;  3JZ4 A;  4WJ9 A;  1O04 A;  2ID2 A;  2W8O A;  3K2W A;  4OE4 A;  3SZB A;  3VZ2 A;  4KWF A;  4NMJ A;  3EK1 A;  5J7I A;  2HG2 A;  4I1W A;  1WND A;  3PQA A;  4I3U A;  4ITB A;  3SZA A;  3TY7 A;  5L2M A;  5DIB A;  5KLN A;  3SZ9 A;  4QF6 A;  2ONO A;  5EEB A;  2EIW A;  4NEA A;  1UXR A;  1UXV A;  4ZUK A;  3K9D A;  1EYY A;  2EHQ A;  3ETF A;  3I44 A;  3RHL A;  2J40 A;  3RHD A;  4YWV A;  5KLO A; 
#chains in the Genus database with same CATH topology
 3RHJ A;  2EIT A;  2J5N A;  4NU9 A;  1QI6 A;  1KY8 A;  3V9I A;  3VZ3 A;  4LH0 A;  4OHT A;  4LGZ A;  4QJE A;  1A4S A;  4OUB A;  2O2R A;  4CAZ A;  1O20 A;  1NZZ A;  4I26 A;  4IDM A;  4OE5 A;  4OGD A;  3V9G A;  4CBB A;  3R31 A;  4K57 A;  4QJE B;  3V9L A;  3RJL A;  3RHH A;  4LH1 A;  4V3F C;  5KLK A;  4V3F A;  4NS3 A;  3N82 A;  4GO0 A;  4I3W A;  1AG8 A;  1O02 A;  2BHP A;  2BHQ A;  4IHI A;  2WOX A;  3RHR A;  1EUH A;  1T90 A;  3RHO A;  4QYJ A;  1CW3 A;  5AC2 A;  3ZQA A;  4QTO A;  3V4C A;  4A0M A;  2WME A;  4ZUL A;  3EFV A;  5KF0 A;  2ONM A;  4GO3 A;  4E4G A;  2VRO A;  4O5H A;  1VLU A;  2IMP A;  4LH3 A;  4QGK A;  3N81 A;  5L13 A;  4YWE A;  5F2C A;  3R64 A;  4WB9 A;  4WP7 A;  4U3W A;  2Y52 A;  3INJ A;  4I25 A;  5ABM A;  1O01 A;  4NPI A;  5J6B A;  4ZVX A;  4ZWL A;  3B4W A;  1WNB A;  2Y5D A;  1UZB A;  2EII A;  4I3T A;  3RHP A;  4WPN A;  4E3X A;  4OE6 A;  4I8Q A;  4MPY A;  4ITA A;  5EUY A;  1UXT A;  3N83 A;  4FR8 A;  2J6L A;  4QN2 A;  2O2P A;  4OU2 A;  4ZVW A;  3VZ0 A;  4MPB A;  5A2D D;  1BXS A;  5EXF A;  2O2Q A;  4ZXU A;  3ROS A;  4I3V A;  4L2O A;  3VZ1 A;  4FQF A;  4X2Q A;  1UXP A;  2WME C;  4LIH A;  5A2D A;  4V37 A;  4PXN A;  3V9K A;  3U4J A;  2XDR A;  4DNG A;  5EZ4 A;  2EHU A;  2ONP A;  2D4E A;  3QAN A;  3N80 A;  5DRU A;  3RH9 A;  4DAL A;  2W8Q A;  2ILU A;  4LEM A;  4ZVY A;  2IY6 A;  2QE0 A;  3PRL A;  4PXL A;  2EJD A;  4F3X A;  1QI1 A;  4JBE A;  4KNA A;  2JG7 A;  3RHM A;  4YWU A;  1UXQ A;  2Y53 A;  4I9B A;  4I8P A;  4PXL B;  5EKC A;  4X0T A;  3MY7 A;  4PZ2 A;  4ZZ7 A;  2W8P A;  5DBV A;  2VLE A;  1NZX A;  4NMK A;  5AC1 A;  4IT9 A;  2W8N A;  2H5G A;  4GO4 A;  4H73 A;  4I2R A;  4JZ6 A;  1UXN A;  2BJK A;  5AC0 A;  5KLL A;  4JDC A;  2EUH A;  5EK6 A;  5KJ5 A;  4C3S A;  3RHQ A;  4H80 A;  4QET A;  3V9J A;  2EJ6 A;  3V9H A;  1ZUM A;  5A2D C;  3INL A;  4GHK A;  1O00 A;  4GNZ A;  4OE2 A;  1EZ0 A;  3IWJ A;  4X0U A;  5FHZ A;  5J78 A;  5L2N A;  2EJL A;  2ONN A;  2W8R A;  1NZW A;  1AD3 A;  2ESD A;  4H7N A;  1A4Z A;  1UXU A;  4LH2 A;  4Q92 A;  5L2O A;  2Y51 A;  4IDS A;  4L1O A;  1O05 A;  2BJA A;  4I3X A;  5EYU A;  5JRY A;  4IYM A;  5KLM A;  3IWK A;  4X4L A;  1BPW A;  1BI9 A;  3JU8 A;  4O6R A;  4GO2 A;  2OPX A;  4KWG A;  1O9J A;  3JZ4 A;  4WJ9 A;  1O04 A;  2ID2 A;  2W8O A;  3K2W A;  4OE4 A;  3SZB A;  3VZ2 A;  4KWF A;  4NMJ A;  3EK1 A;  5J7I A;  2HG2 A;  4I1W A;  1WND A;  3PQA A;  4I3U A;  4ITB A;  3SZA A;  3TY7 A;  5L2M A;  5DIB A;  5KLN A;  3SZ9 A;  4QF6 A;  2ONO A;  5EEB A;  2EIW A;  4NEA A;  1UXR A;  1UXV A;  4ZUK A;  3K9D A;  1EYY A;  2EHQ A;  3ETF A;  3I44 A;  3RHL A;  2J40 A;  3RHD A;  4YWV A;  5KLO A; 
#chains in the Genus database with same CATH homology
 3RHJ A;  2EIT A;  2J5N A;  4NU9 A;  1QI6 A;  1KY8 A;  3V9I A;  3VZ3 A;  4LH0 A;  4OHT A;  4LGZ A;  4QJE A;  1A4S A;  4OUB A;  2O2R A;  4CAZ A;  1O20 A;  1NZZ A;  4I26 A;  4IDM A;  4OE5 A;  4OGD A;  3V9G A;  4CBB A;  3R31 A;  4K57 A;  4QJE B;  3V9L A;  3RJL A;  3RHH A;  4LH1 A;  4V3F C;  5KLK A;  4V3F A;  4NS3 A;  3N82 A;  4GO0 A;  4I3W A;  1AG8 A;  1O02 A;  2BHP A;  2BHQ A;  4IHI A;  2WOX A;  3RHR A;  1EUH A;  1T90 A;  3RHO A;  4QYJ A;  1CW3 A;  5AC2 A;  3ZQA A;  4QTO A;  3V4C A;  4A0M A;  2WME A;  4ZUL A;  3EFV A;  5KF0 A;  2ONM A;  4GO3 A;  4E4G A;  2VRO A;  4O5H A;  1VLU A;  2IMP A;  4LH3 A;  4QGK A;  3N81 A;  5L13 A;  4YWE A;  5F2C A;  3R64 A;  4WB9 A;  4WP7 A;  4U3W A;  2Y52 A;  3INJ A;  4I25 A;  5ABM A;  1O01 A;  4NPI A;  5J6B A;  4ZVX A;  4ZWL A;  3B4W A;  1WNB A;  2Y5D A;  1UZB A;  2EII A;  4I3T A;  3RHP A;  4WPN A;  4E3X A;  4OE6 A;  4I8Q A;  4MPY A;  4ITA A;  5EUY A;  1UXT A;  3N83 A;  4FR8 A;  2J6L A;  4QN2 A;  2O2P A;  4OU2 A;  4ZVW A;  3VZ0 A;  4MPB A;  5A2D D;  1BXS A;  5EXF A;  2O2Q A;  4ZXU A;  3ROS A;  4I3V A;  4L2O A;  3VZ1 A;  4FQF A;  4X2Q A;  1UXP A;  2WME C;  4LIH A;  5A2D A;  4V37 A;  4PXN A;  3V9K A;  3U4J A;  2XDR A;  4DNG A;  5EZ4 A;  2EHU A;  2ONP A;  2D4E A;  3QAN A;  3N80 A;  5DRU A;  3RH9 A;  4DAL A;  2W8Q A;  2ILU A;  4LEM A;  4ZVY A;  2IY6 A;  2QE0 A;  3PRL A;  4PXL A;  2EJD A;  4F3X A;  1QI1 A;  4JBE A;  4KNA A;  2JG7 A;  3RHM A;  4YWU A;  1UXQ A;  2Y53 A;  4I9B A;  4I8P A;  4PXL B;  5EKC A;  4X0T A;  3MY7 A;  4PZ2 A;  4ZZ7 A;  2W8P A;  5DBV A;  2VLE A;  1NZX A;  4NMK A;  5AC1 A;  4IT9 A;  2W8N A;  2H5G A;  4GO4 A;  4H73 A;  4I2R A;  4JZ6 A;  1UXN A;  2BJK A;  5AC0 A;  5KLL A;  4JDC A;  2EUH A;  5EK6 A;  5KJ5 A;  4C3S A;  3RHQ A;  4H80 A;  4QET A;  3V9J A;  2EJ6 A;  3V9H A;  1ZUM A;  5A2D C;  3INL A;  4GHK A;  1O00 A;  4GNZ A;  4OE2 A;  1EZ0 A;  3IWJ A;  4X0U A;  5FHZ A;  5J78 A;  5L2N A;  2EJL A;  2ONN A;  2W8R A;  1NZW A;  1AD3 A;  2ESD A;  4H7N A;  1A4Z A;  1UXU A;  4LH2 A;  4Q92 A;  5L2O A;  2Y51 A;  4IDS A;  4L1O A;  1O05 A;  2BJA A;  4I3X A;  5EYU A;  5JRY A;  4IYM A;  5KLM A;  3IWK A;  4X4L A;  1BPW A;  1BI9 A;  3JU8 A;  4O6R A;  4GO2 A;  2OPX A;  4KWG A;  1O9J A;  3JZ4 A;  4WJ9 A;  1O04 A;  2ID2 A;  2W8O A;  3K2W A;  4OE4 A;  3SZB A;  3VZ2 A;  4KWF A;  4NMJ A;  3EK1 A;  5J7I A;  2HG2 A;  4I1W A;  1WND A;  3PQA A;  4I3U A;  4ITB A;  3SZA A;  3TY7 A;  5L2M A;  5DIB A;  5KLN A;  3SZ9 A;  4QF6 A;  2ONO A;  5EEB A;  2EIW A;  4NEA A;  1UXR A;  1UXV A;  4ZUK A;  3K9D A;  1EYY A;  2EHQ A;  3ETF A;  3I44 A;  3RHL A;  2J40 A;  3RHD A;  4YWV A;  5KLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...