3RHTA

Crystal structure of type 1 glutamine amidotransferase (gatase1)-like protein from planctomyces limnophilus
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
252
structure length
252
Chain Sequence
RVLYCGDTSLETAAGYLAGLMTSWQWEFDYIPSHVGLDVGELLAKQDLVILSDYPAERMTAQAIDQLVTMVKAGCGLVMLGGWESYHGLGGNWDQTLLAEVLPVDIKSADDRINFDQPTLAIPAAINSVSHPILQNLPWEDRPPTIGGLNRIAAKAKAQTLLMARVWRPTFSLEHGKTTWEHADHHPLLVVGEAGTGRVAAFASDVAPHWVGGLVDWGDERVTSQAPGAGAIEVGNLYSQFFRQMLEWVAKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (GATase1)-like protein
publication title Crystal structure of type 1 glutamine amidotransferase (GATase1)-like protein from Planctomyces limnophilus
rcsb
source organism Planctomyces limnophilus
molecule tags Structural genomics, unknown function
total genus 65
structure length 252
sequence length 252
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07090 GATase1_like Putative glutamine amidotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rhtA00
1ONSA 3FIJA 4Y0NA 4R7GA 1JVNA 4B5KA 1PDWA 4L78A 3P9QA 2LXNA 3TTVA 3PQ2A 1BXRB 3UK7A 1PV2A 4BIMA 1QVZA 4E5VA 5BV2P 1I1QB 5JZOA 1OX4B 1Q2UA 4OQ4A 4OGGA 2RK6A 4AUNA 1G2IA 3R76A 4BTEA 3TTXA 3TTUA 2GHRA 1U9CA 4RKWA 1GPMA 2H2WA 3ZJ4A 3CZAA 2ZUVA 1P7ZA 3NOQA 2WJZB 1O1YA 1C3OB 2YWBA 4ENPA 3P9PA 1M6VB 4MNTA 4OFWA 3EZGA 3B36A 4Y1RB 4OJYA 4GE3A 1KWGA 3L7NA 2R1TB 1S1MA 1PDVA 2YWCA 2VDJA 3CNEA 4MTCA 4ADSG 4ENQA 3L18A 3M3PA 4B31A 1J42A 4ENWA 3PQ5A 1KEEB 1OX4A 3ER6A 4ENUA 3CY6A 3NONA 3NOVA 4ZGGA 4UCFA 2AD5A 3PQ7A 4L8WB 4RKYA 4Y1GA 3SOZA 4L8YA 2YWJA 1QVVA 2V4UA 3NVAA 3PQ3A 4WINA 2ZUWA 3BWEA 2GK3A 3EN0A 4AULA 3CZ9A 4E08A 4Y1RA 1VCNA 3CYFA 4LRUA 3TTSA 2OR3A 1IZYA 4OGFA 1GGKA 4ZDIA 2R1TA 1A9XB 4ENRA 4L8FA 1GPWB 3F71A 2R1VA 3EFEA 2D7JA 2AB0A 1P80A 3NOOA 3ZR4B 1OX6A 4JQSA 5SY9A 4OIFA 4QYXA 3TTYA 5JZMA 1IPHA 4P36A 4AUMA 1T36B 3MIIA 5LIRA 4BFLA 1VCOA 3WFZA 4B40A 3TQIA 4I46A 3OT1B 3B3AA 2FEXA 2R1VB 4S0ZA 1P81A 1OX5A 3P9RA 4UNIA 4ENTA 1CE8B 1R9GA 2IUFA 4AUEA 3GRAA 3UGJA 1WL8A 3D54D 1T0BA 3PQ8A 2NV2B 1GGEA 1SY7A 1CS0B 4I2NA 1K9VF 4WXYB 2ISSD 1KXJA 4P2GA 3UOWA 1KWKA 1VHQA 2XF2A 2ABWA 4LGYA 3R75A 1L9XA 1OY1A 3RHTA 1T3TA 2VXOA 2A9VA 1UCFA 3EJ6A 3R74A 4B2YA 3OT1A 1C30B 5SY6A 2VPIA 2YWDA 4N0MA 2ZUUA 1Q7RA 3KKLA 3L4EA 5K4AA 4D1YA 1GGFA 5IP5A 4B7AA 1GG9A 1SOAA 1P5FA 2RK4A 5DFAA 3ZJ5A 1FY2A 3PQ6A 3UJNA 2ZUTA 1IZZA 3BHNA 1N57A 1JDBC 2W7TA 1CF9A 1VCMA 1QVWA 3N7TA 1QDLB 4K2HA 4ZDKA 3P9SA 4UOQA 3SF8B 4GUDA 3MGKA 4PXYA 4P35A 5SYAA 1I7QB 4AJ9A 3B38A 2RK3A 4UOZA 4QYTA 4L95C 4N12A 5SY4A 1GGJA 2NV0A 4L7QA 4Y1FA 4ZDJA 2R1UA 3FSEA 2VKTA 2VRNA 4XLLA 4I4NA 5E9AA 4Y1EA 4HCJA 3PQ4A 1QF7A 1FYEA 1KA9H 4MGHA 4UZSA 4ENVA 3L3BA 3VU3A 2ZUSA 3UMMA 4GE0A 3TTTA 3F5DA 3NORA 3SF8A 4ENSA 1GGHA 4P5PA 1OI4A 4P34A 1PE0A 1QWSA 3TTWA 3EWNA 1P7YA 1I7SB
chains in the Genus database with same CATH superfamily
1R7RA 3KV3O 4G63A 4MRMB 4DDVA 5I9NA 1IUKA 5FNVB 2SKEA 4I50B 3GZNB 1U1DA 3I6MA 1NOJA 2JFPA 3HZZA 4AFNA 2QD2A 2PVCA 2HLDD 4KDFA 1SQ6A 3O3CA 4NCXA 3AF3A 4BNMA 2H3HA 3Q9LA 5E4YA 4NHEA 5LXTA 1U9IA 3RQSA 3WNCA 4ER5A 2I7TA 1SCNE 2NU6B 1ZJ5A 1DQYA 4J29A 2B9VA 1Y9EA 2BLLA 4UPEA 1W25A 3GJSA 1LTQA 1XVVA 4XYLA 1PYGA 1NBAA 1EHYA 4LCJA 1DIAA 3ZI7A 4ZI2A 1YK0A 3WP1B 1XJQA 1EZ1A 4DLAA 2EW8A 3R5FA 4LQLA 4WCFC 5IM5A 3Q3CA 4BCDA 4DXDA 1EFRA 5A1TA 2JFBA 3ANNA 1WR8A 5JWOA 1NVUQ 1W88B 1T10A 1NSTA 2X4LA 1ZONA 3ICVA 3QE2A 2IPMA 3L02A 3WHLA 2ZSIA 5EIBC 5DNCA 5L3SB 2VTVA 4YJKA 4JH0A 4RE6A 4Q12A 2XMGA 3JQ6A 5ALQA 2R6HA 1FNNA 1UXJA 2AHOA 2HO4A 3N0RA 1ORVA 3V8NA 3U7EB 3KKNA 4HN4B 2O3QA 5E4FA 1XV5A 5AVQA 4E13A 3Q3HA 2P3LA 1A9XB 1UJBA 4KR9A 1VE1A 2HCJB 1E7SA 4KQGA 2EKLA 1JEJA 2JASA 4R8RA 2WFLB 2AN9A 5J1SB 3CW2A 3BDAA 4C0BA 4CR6A 2VJLA 3HNPA 2OO3A 4KE8A 3RASA 2ZYIA 4EPRA 5FULA 5IJ0A 2QPAA 2DX7A 2B20A 2HJ9A 3FMOB 3BREA 4OHZA 4DN6A 2GLTA 1ECJA 1MD9A 1NLMA 2QTCA 5HKLA 5BSRA 4TN5A 3WGZA 3FG9A 1ZM3A 2E37A 1PFUA 2NO7A 3QOFA 3S0JA 4KUHA 3UJHA 4H7HA 2AQHA 4NBTA 4Q00A 5I7UA 1ZUD1 2HMYB 5T4BA 3W04A 4MGYR 2F8SA 4IQGA 1T2NA 3CW8X 2IOFA 3P9YA 3SX4A 4QGHA 2HV9A 1C30B 4LRYA 4G0WA 3SJAA 4A8TA 1F1JA 3FLBA 1I5EA 5K03A 5K0SA 4C5AA 1KDPA 4JOSA 2FFAA 3BD9A 3OH8A 2JCXA 2ZS9A 1XYGA 4H17A 4B0PA 3MJTA 3T52A 4PF1A 5KQSA 3CNHA 3QKUA 4FCWA 5I4BA 2VWPA 3HYLA 3NTOA 4ISCA 1PEAA 3KRTA 4IJMA 4OQXA 2R11A 5H5JA 3RIHA 3CUWA 2NXNA 1QE0A 5AKEA 4EAAA 2B4YA 2JGDB 4LMRA 1T25A 4GRDA 3T5DA 1JJBA 4K9NA 2PZAA 3C48A 3GJ3A 3VPAA 1SU7A 1ZINA 1E3WA 3OWOA 2H1IA 2X1HA 4A2PA 2K7FA 1H0SA 2QRVB 3EG5A 5ILOA 4R2MA 5CHEA 3OPNA 4H1UA 3UK0A 4P4GA 4BNLA 1SUDA 4D41A 1QFZA 2QMZA 3I0NA 4BVHA 3NBQA 4IQ0A 4XVUA 2RONA 2HB6A 1YRYE 3HGMA 1KAEA 3T12A 1SXJC 1YC2A 3UJ3X 2C61A 2IU4A 4WLNA 4KRYA 5AK5A 4BBAA 1KYQA 3N2LA 5HQTA 3TE6A 1YE8A 2AKEA 3ANYB 3UCEA 5IJ9A 1L4EA 2I4NA 3K4QA 4HPJB 3EGWA 3D3NA 4M21A 4L78A 3STXA 4LXGA 3TTVA 3EMKA 5IABA 1U4NA 1FRQA 4Q48A 1QPBA 2HBQA 1QVRA 1XDWA 4ESOA 5EE0A 5AVOA 1QP4A 2J67A 4GLOA 1K88A 2PZBA 1CV2A 2A58A 2XTNA 3FYSA 2E3JA 4KE9A 3X3HA 3WGQA 2ALJA 3HNOA 1LF0A 2IHVA 5IG2A 2ODWA 3EZGA 5K0GA 1LW7A 2AR7A 4YCBA 2Z6AA 4MRMA 4NQRA 2QTHA 3FHTA 5FNVA 3CNEA 2VDJA 1HGXA 4I50A 3GZNA 1FTNA 1KARA 3AI1A 3PQCA 1TCCA 1RHRA 5KI6A 4XOIA 3WIDA 1VHTA 2GPNA 1R0YA 2WF6A 3LFTA 5EP3A 4MRNA 2I7XA 2ZZNA 1L4YA 1OFGA 3S2YA 4PGFA 4TZKA 5FBWB 2NU6A 1DCMA 2X3YA 3VPCA 1O0SA 3NVAA 3BC1A 1F5NA 1PJAA 2GPYA 3KQTA 3OIDA 2OR3A 2JRLA 2W42A 2PQ0A 1CS4C 4YRZA 5LQMA 4C7JA 2X1MA 1Z82A 2ZBRA 4GPZA 5LR6A 1IRXA 4NZNA 3L7KA 3AVVA 3UMGA 2CFRA 2NQTA 3W8FA 2FSVC 1W88A 3CB2A 4NNJA 5TDHA 3SC3A 4ZK2A 5L3SA 2DYKA 2PH3A 1I2DA 1SXJB 3FHLA 1DXHA 1T0IA 1NTOA 1TMYA 3OT1B 5KOIA 4WY5A 5B1DA 3R3WA 4ARBA 2B1GA 2IUFA 3PCRB 5B7NA 1I7LA 1R5JA 2VBCA 1NM5A 4QAJA 3CG0A 1QFXA 2F3RA 2OMKA 4WLFA 1T2FA 4IHJB 2RHJA 5FOQA 1UZAA 3C5CA 4V1CA 1A9XA 2VNIA 1Y1RA 1YJCA 3IIJA 4HB4A 5MDHA 3LX6A 4LGMA 3B6EA 1CC1S 3PFWO 4Y9UA 2WFLA 2BGTA 4N9QA 4OKNA 1P0PA 4R1OA 1N33B 4O4HF 3FB4A 2M6KA 4JB3A 1KORA 1UZUA 4X64B 1YL6A 5B1YA 1WB5A 4ZIRB 1WDLA 4D8YA 4AZTA 1K27A 3JQAB 4EHJA 1EWQA 4I5IA 3K8YA 3A14A 3GJ6A 1E32A 4FMCB 2BJWA 2D8AA 1O0BA 1A4XA 1OMOA 1YQQA 4QUJA 2O5EA 4UULA 2Y1EA 5KYYB 2RC5A 4W8GA 4Z49A 5HKAA 5KPDA 4B73A 3QU7A 4XD7D 4CMJA 5TX7A 2AMLA 2FUG6 1BW9B 1HURA 1OV4A 1C30A 1Y42X 2R8EA 4B47A 3UFXA 2NO4A 3FNIA 2R6DA 1U8AA 1MVOA 2A59A 2HRCA 2P9QA 2Y0PA 3IP5A 1VB3A 4HYYA 4IEEA 4M8SA 4P83A 4RIEA 3WLJA 4E1AA 5CCEA 4G4JA 3J7AC 1ULSA 1D2RA 2X5JO 3GZTB 5CXUA 3OZUA 2DT8A 4ZVVA 4G5QA 3UAXA 4MEBA 3TE7A 1JKJB 3SYLA 1T4BA 3SK0A 1M6WA 1YD7A 3ISTA 3OE7A 3SDSA 1LBIA 3SXJA 3DXZA 2JGDA 2YV5A 4IDOA 3TTWA 1G4AE 2Q7XA 2GVZC 1I7SB 1UOEA 2IS4A 1D04A 3OFND 4BEBA 5F2EA 1NU6A 3ZHZA 3JAMA 3KQWA 2YY7A 3PVSA 4CRWB 1PV2A 1H69A 2OLEA 2Y1DA 3WKCA 3FGPA 1WWKA 3BXHA 3ZNPA 4CM5A 1OBCA 1DC8A 3GK3A 4ZVUA 3KDPA 4U39A 4IQ8A 2OENG 1IN4A 5JAIA 3DMTC 5HG0A 1U02A 4EUEA 1SA0B 1SQFA 3HP4A 1W9MA 3AHDA 3DEAA 4FKBA 4KDCA 4YONB 1U2QA 1M54A 4X84A 2QYTA 2FW1A 3AQ4A 1BHO1 4HDOB 4HYEA 4OV6B 4ZQIA 3UJ7A 3QMWA 4I9NA 1DT5A 3OHSX 3AIIA 4B8WA 1OZGA 3TDNA 1CUZA 2AC7A 2BZ0A 1EZZA 1NVKA 2AMFA 4IILA 4JFRA 4H59A 1LVHA 2P2DA 3H8VA 2F9MA 4FPXA 2FPRA 4J0CA 3ESQA 2ZFUA 1LV8A 4YAWA 3HI6A 4H18A 4X3PA 4Y0AA 2JFZA 1N2BA 5AIAA 4AYWA 3VM6A 2C77A 1YOVA 2IPLA 3K8OE 4HK4A 4LE2A 4CMCA 3QEOA 3DKVA 1M7BA 3QVUA 2YCBA 4DV7B 2BGJA 2VEDA 2HDNB 3DOOA 3O1HB 1R16A 2QP9X 2WJAA 1FRVA 3OKAA 1CLEA 2YFHA 4KFRA 3VSBA 2F3QA 3VDNB 1AUQA 4AQ7A 2X8WA 3T7AA 4U0JA 4PCLA 5E7JA 1LSSA 3G1WA 4HGZA 3MBOA 3PNSA 3WKDA 1BCSB 2IXFA 3HZHA 2OCGA 2XMQA 4MKZA 3VMFA 4I7EA 1R9GA 3C1AA 3AEZA 4YMGA 3FOFC 4FBMA 5E7QA 4QTUB 1PG2A 4IZIA 3WAJA 4RHXA 4RSMA 1BGXT 1U8CB 2YHIB 3F6BX 3RVKA 2W6IA 4GPIB 5CDUA 1FVHA 2H4XA 1MRZA 2BFCB 4HOYA 1J0BA 3CRRA 1JJIA 2J3DA 1SXJA 2ERXA 2QN3A 3EZNA 3LKDA 3OT1A 4L4XA 5IH3A 2WB2A 2H51A 3UIEA 4RH1A 1JWAB 2GEUA 1XIVA 3RJ9A 5LJIA 1G4HA 2FZCA 3N8NA 3KL2A 3QPUA 2V7TA 4HDAA 1O6GA 3ROQA 3D3KA 1WDMA 1QM5A 1U4OA 3IXQA 3PHLA 1BXZA 4NOJA 3FVVA 4RIFA 1E5LA 4IDPA 4G0XA 4EZBA 3A37A 4D26A 3JD2A 1NP6A 3A4LA 3IR7A 4KH0A 1N6IA 2G9RA 3D59A 3QU9A 1XQ6A 3HB9A 3SF8B 2MSNA 4J03A 5CFNA 4EO7A 1B15A 4L8LA 4ZIRA 3IT0A 2DWQA 4DIFA 1MHTA 1XKLA 3JQAA 2XUAA 4HRVA 5I7FA 3HCEA 4JC5A 2C8LA 3ZIAD 3PEFA 1AHIA 1PVDA 3GFPA 2EW1A 1JAZA 3RT7A 2F8TA 1RACA 3AHJA 5DZSA 2JLCA 5CTAA 2QRUA 4KI7A 2AX3A 4N76A 4HEJA 1YQXA 5KYYA 3LH5A 3O8NA 2ZUSA 3AZOA 1T9CA 4YB8A 3TD9A 2WA2A 3I09A 1RAIA 4M54A 3PDUA 1TT5B 5KNLA 3JYHA 1KDOA 3I9OA 2P3OA 3EGXB 3OAAD 1BW9A 1X9HA 1OZ0A 1POWA 1QDUA 4MJLA 2Q07A 3AOGA 3BWVA 1YDGA 1Q17A 5FBLB 4HUTA 5F9HA 1PDWA 1UDCA 1ZK2A 1T9KA 4ZVTA 3AKDA 1ZIYA 1Z38A 3U39A 4YRGA 1YS4A 1Z7WA 2KLBA 1R3UA 3RV3A 5EJ6A 4ZD6A 3WWZA 3HYCA 2D1TA 2FSVA 1SUCA 1JKJA 3LW7A 5BR7A 3DO6A 4B3XA 5I7WA 1O1YA 1XL0A 2P5SA 1RXCA 3VDMA 4KBFA 4MI3A 4E4TA 4H1WA 1U2ZA 4ABYA 4MLPA 2QUJA 4ZXPA 4CLXA 4YV7A 1T6XA 3NYWA 1GP2A 1VHJA 2HQBA 1P1BA 1VSTA 3M3PA 4Z5XA 1DRWA 1RYEA 1MC4A 2BGRA 3GLKA 1OT5A 3QUQA 4BVFA 3SIXA 5SV2A 4BZPA 1GUBA 2DJ5A 3BTOA 1MQ9A 4KYUA 1R0WA 1RQNA 2AV6A 3L0PA 1CRZA 3UNXA 3FNQA 1X1SA 3HWWA 4BGVA 1WB6A 1Y5RA 3D1VA 4EBFA 2YWJA 4ZI3A 1ECCA 4HHEA 1LPPA 5BYKA 1EHIA 1SA0A 3FPSA 4XZ3A 5CX4A 2H11A 5DT9A 3ZHSA 2FN4A 2MJLA 1QRSA 1MPXA 1AZWA 2ZTUA 3A9UA 2HOQA 3NAMA 3CTMA 5KAMA 1BQEA 2BKVA 3WGKA 3S2GA 3WLPA 1SVMA 4RKFA 3QVTA 4EJSC 2I87A 2WMOB 3S6JA 3QPCA 1JX6A 2EF0A 5JAHA 1EWKA 4R6XA 2NUTB 1IPFA 1YZNA 1M0SA 1TZKA 1VLVA 5K0LA 3MCWA 4GBED 4BFLA 4DBVO 5JSFA 2HR1A 2G0TA 4C0LA 4BZZA 4PPFA 1YF3A 3ELDA 1A69A 4N0PA 4TMXA 4EATA 4MDFA 1OYYA 2WYWA 3F9IA 3IAFA 2JJ2A 4GBGA 1Y8ZA 2VP0A 4MQUA 1GLNA 2XDYA 1LBTA 4PS0A 5I3CA 1SVWA 1RZVA 5AJTA 4BVBA 4Z86A 3KXKA 5EXDA 4RM3A 2JJ1A 3NM4A 3TZCA 2VHJA 1XU7A 1G0OA 2H2FA 2PBLA 2XGOA 3R5KA 3P9XA 1AA6A 3C6MA 1HNWB 4TZ6A 3LMKA 3QQ5A 1LCIA 1SFRA 2C95A 1TX4B 3IA2A 4Y3UA 4BGIA 4BX9A 1KYXA 4KR3A 4GSKA 3NP9A 1IDOA 2GO1A 4OSOA 4OUKX 2ZRHA 4RF2A 1BCSA 1PSDA 3KUXA 4XAQA 1UBHS 5K4HA 1OE0A 4QQFA 4IV0A 4UNRA 1XYVA 3RD5A 1KO5A 5IDWA 5SYMA 1EB8A 4I4IA 1S8NA 2YHIA 1DQRA 3JWIA 3D2AA 3Q7RA 3QZUA 1DKRA 1NVVR 1EX1A 1RVV1 1RYMA 3FDZB 3OZDA 2BFCA 3ZE6A 1K75A 4ZDKA 3Q8KA 4LWPA 2PUDA 1VLMA 2BT4A 1BU5A 3ADKA 3N6RA 5KSPA 4UVDA 4WDRA 1WZ2A 5ITVA 1T9AA 2GD2A 3DMTA 3JD1A 3LT4A 4TMYA 5LQJA 4PQFA 4O3MA 4LDAA 1YJXA 1VMKA 2KWIA 2LKCA 4P58A 5C51B 3B60A 3G23A 2CYBA 3FW1A 1D6MA 2B5OA 1L7NA 2XTMA 3MF4A 1PR0A 4BMXA 5ITWA 5JNRA 4EJSB 5AVTA 1NZDA 4JODA 5THQA 1FQOA 1PF7E 2SICE 4US0R 1UXKA 3O8BA 3UMMA 3NBKA 3KU1A 3SF8A 1IOVA 4RC9A 1MNQA 3FTNA 3MB8A 4PBRA 2QB5A 1HLGA 4EA6A 2EHJA 1WW8A 3KNZA 4MR7B 2OBNA 5E9QA 1PZNA 3KZ1E 3M9XA 5F3RA 1E2QA 3RVPA 3MGAA 1URPA 3NGMA 4H3HB 1PAUA 3WS7A 1QTRA 4MUBA 3HXMA 3KELA 4DSZA 1WV0A 2J8ZA 4YIHA 2QXTA 1WPQA 1PZMA 5FI3A 1HEIA 3SHQA 3W1WA 3KAPA 5C4GB 2FOIA 3CZAA 3RC9A 3EDOA 1TT5A 2FMHA 3L8MA 3EGXA 3D8RA 2B1IA 3X1KA 1A9SA 1KI2A 4GE3A 5DM0A 1BWRA 5K99A 3IE0A 4YCAA 2F3UA 3KVVA 4CLOB 1DRJA 2HJVA 1JIUA 2BF4A 1XEXB 3S2EA 5AW2A 1B41A 1G3UA 4AMZA 2NNLD 4JMPA 4DR3B 3DCJA 3X1WA 1TI7A 4I1VA 4Q3NA 4LTNA 4C0AC 3FUVA 2X58A 4LYHA 5IK2D 1T1JA 1IAVA 1ZD3A 3L0IB 4Z4GA 4MA0A 1WU7A 2R6CA 1KS2A 4EZIA 4E5SA 2XMSA 4IIJF 1H1LB 4YI3A 2CLHB 3SR4A 3HDGA 4KQMA 4BAUA 2ZIEA 4IRUB 2FV8A 3CR8A 2QTRA 3LHDA 4QPNA 2DPXA 5KINB 3ZI0A 1UT6A 1Z4MA 1ZJ4A 4L27A 1ZUNB 4KFCA 4O2BF 3SI7A 2YZNA 3DF9A 4QOHA 1HLDA 4ZVMA 2ZWIA 2BFAA 4YRCA 3MWJA 3FIUA 3ML1A 2QNRA 2BFMA 2GN9A 2VZLA 3PL5A 4U7HA 2HIMA 3HG7A 4ZVLA 5AKYA 5M34A 2PZFA 3OOYA 1VCOA 1UM8A 3WBJA 2QVXX 4OB8A 4XIJA 4UKDA 4AWXA 2EF1A 2O1EA 4I36A 1Y7LA 4OJTA 1Q84A 2QDXA 5AJHA 3VKFA 2I54A 5LUAA 5ILQA 4Y2JA 5A5GA 1Q0PA 3NT2A 1ZLXA 5AW0A 4DWOA 5IM4F 1SG6A 1DEXA 1ODIA 4Q19A 2WAYA 3DZCA 1P31A 1H4VB 1VJ5A 2I2XB 2QUBA 4WXYB 2I5PO 1UBJS 4PLTA 3P96A 5ALNA 2Z5GA 1EXNA 1K6MA 1KI3A 1X1BA 3JW8A 4CQNA 3T0FA 3E4CA 3TGLA 4UARA 1MFZA 4X8OA 2NUTA 2PJZA 4TLMB 4B3DA 3O4HA 1Z2AA 2PHZA 3ZXIA 5IU6A 3NU1A 3WL8A 3NNNA 1EX6A 1N2SA 2XW6A 3ESAA 4AUKA 3TOCA 4GS5A 2O5VA 3EARA 5CT4A 5TXGA 1X92A 3ENVA 3BEOA 3A36A 5DX8A 1IN5A 2ID8A 1CDOA 5F5LA 1QHNA 1Q1NA 2A0XA 2IYOA 5FJIA 4BJ5A 5A6SA 1JDBC 1ZAYA 4IF4A 4ZT5A 1I1HA 5EQJB 1HXHA 1XN4A 5TPZA 1SBZA 3OLWA 2VYVD 4REOA 3E8SA 5LFAA 2E1RA 4J0QA 2L82A 5AK3A 5JSKA 1CY4A 2MSDB 3O83A 2F4VB 3FLAA 2BE9A 4WQMA 5FORA 4QNNA 2C07A 1D5CA 1E2FA 1WKVA 5SY4A 4E11A 2X4DA 3K0FB 1PEYA 4Y67A 3K71B 2OFWA 4RAQA 3ZV5A 2WKQA 4N40A 2QHXA 1DJOA 1JE0A 4KQ6A 3IULA 1PT6A 1VG8A 2PXXA 3IERA 1H6CA 2AX4A 5EJMA 3U0BA 1K08A 5I7SA 1NYQA 2GR9A 5KQLA 4KXVA 2D3TA 1JIQA 3C24A 1OVMA 5JT1A 2PVPA 1Q15A 3GNTA 4MVCA 3FR7A 4DG9A 4EMUA 4F86A 4QXPA 5BVGB 2Z5VA 2CXHA 5T5QA 4BV9A 5ES4B 2RGBA 4EHHA 3PUKA 3EH1A 2JA1A 4RBNA 2RGYA 5BV2P 4EJSA 5JYCA 2VA9A 1Z4PX 2OGZA 4XYBA 3CONA 2JFFA 3FBTA 1ZJJA 2H2WA 4MQFB 1W5BA 2RHHA 4P53A 3KJFA 1LLUA 2MU1A 4J7XA 2XD4A 3UWPA 3SJ7A 2YXLA 2P6UA 2VUIB 3QXXA 4RENA 1NNSA 3IOBA 5KSWB 2HU5A 1ZH0A 3DMFA 2CXOA 4MR7A 4OMFG 1ZGHA 2ZTMA 1YMUA 4IJWA 4URFA 1VJ0A 4XB2A 4XFDA 1TKAA 3SHVA 5M5BA 3RAFC 2CB9A 1TZBA 4L0CA 1DIOB 1WVGA 2DUNA 1AIPA 3ZE2B 1HFEL 2PUJA 3STHA 2XXBA 4G6ZA 3KVNA 2X40A 4XPZA 3ICEA 2VF5X 1Z22A 2WWRA 4YP9A 1FFYA 2ZB2A 3BAFA 2GF2A 3OFKA 3HJGA 3HUFA 1QR6A 3OPYI 4R31A 4C78A 2V4UA 3RTCA 3C3YA 3F7MA 5HDBB 3TUJC 2R8PA 3C74A 3PBKA 1YZGA 3Q15C 2H1SA 3QTBA 3P26A 3VU1A 2FOLA 2J4FA 2W6ZA 1XEXA 3NHUA 2VTKA 3ABIA 1SVSA 1JT9A 1IMOA 2OZKA 4I6JA 2VBGA 16PKA 1U8EA 1KY4A 2JFXA 2QU8A 3UJPA 2WTXA 4AUMA 3PFIA 2VTBA 1FMFA 4KLZA 3IP7A 3NCTA 3O82A 1J97A 3RUAA 2WM8A 1DC6A 4H0CA 4BPRA 4LFAB 1H65A 1H1LA 1FVFA 1KH1A 2CVHA 2HFKA 3LYHA 4INZA 4X3CA 1G2PA 1U7OA 2QDKA 3J81A 5C4MA 3ODGA 4A26A 5CK4A 3VUEA 4JP8A 1ZGAA 1ZUNA 2GZAA 2IEDA 4PZAA 5A7FA 2ZBUA 1X1DA 1ZM2A 4JYPA 1KJNA 3ETCA 4KQWA 1ILEA 2VHWA 2UZ0A 2VKQA 3OT5A 5L6LB 2O1WA 1X14A 2Z5FA 5DWQA 5J2UF 1I2BA 2HCTA 4TKMA 3G7NA 4PFJA 2VPIA 1NQVA 3KKQA 2W6JD 1KEUA 4INJA 2O8EB 1P5FA 2WI8A 3FD8A 4G07A 4EGSA 1REQB 5KZMB 4EABA 3AL3A 3FPHA 5A5VA 1XAGA 1K5PA 3CIOA 4K6FA 3P0RA 1SZJG 5CLGA 3REFA 5DGCA 1GPDG 3IAS1 5T8KC 1FSPA 2DBYA 2ZRIA 3H0KA 3N75A 2VDOB 3D0QA 5SYAA 3IIKA 1Z17A 3LCRA 1VBMA 5HX7A 2PXAA 4OJMX 3EVDA 3HH8A 4ZMBA 2XDAA 4XD2A 2ZVJA 1D2GA 3Q9NA 3TDMA 1J90A 2PYZA 2Z6QA 1YZKA 3V3KA 4A6EA 1F4VA 2BBTA 2WWWA 3Q2IA 1SIOA 4RGVA 4YUXA 2H7XA 2VI5A 2OGSA 1XCOA 3JARA 3L1JA 2ATCA 1D3AA 3LUDA 1CJUC 3M5WA 3E7FA 4NATA 4BN0A 5ENZA 2ZAGA 1PT8A 2JAPA 1DJPA 3CUSA 1GILA 2C94A 3GAFA 1R18A 2OOSA 5CD9A 3W5JA 1EBUA 1T5TA 1Z83A 2IK8A 3RIXA 2YZMA 1QWSA 2PUHA 5DNVA 2FPGB 4D43A 2OQRA 1MC5A 1O87A 3MWEB 4TSFA 3T0IA 1VHLA 2G67A 2VFAA 5IFLA 4TWBA 1UDRA 1KMHB 5F64A 4L4UA 5F2OA 4BBPA 4EQ6B 1SVUA 3K0FA 4ZEOA 1Y3FE 4A6XA 1RP7A 1JEQB 2V9PA 4MWTA 3SHOA 3ND8A 2FP4B 3B6ZA 2VXYA 3GYBA 3H2HA 3OTGA 4PYNA 4JSTA 2GESA 4OUDA 4U1RA 4Y2RA 1TAQA 3PC2A 4I3FA 2VNHA 4CLDA 4Q66C 4JYCA 1JB1A 3VYSB 3KT6A 4ASUA 2VA8A 4HFJA 5ESRA 3WMRA 5A62A 1V95A 1QGUB 2J5QA 1KWGA 4PO3X 1CEXA 1HEYA 2MR5A 2R3SA 4UASA 4G1CA 5EP1A 5BVGA 2OCKA 2O0KA 2OZVA 2CN1A 2ZBVA 4JENA 4C0WA 4XWAA 2CDRA 2W8ZA 3D5EA 2ATIA 3LHSA 1EMDA 4Z1MA 3GFVA 5JLAA 1OXMA 4MQFA 4CLHA 10MHA 1ID1A 2XNJA 4I1UA 2QUZA 4UM5A 1Y7PA 3UV7A 4LZWA 2ZRLA 3OM8A 3NTVA 2G9VA 4YRFA 3JRXA 1VCNA 2QM3A 3GQBA 4TMFA 4DM4A 4EFLA 1M2OB 1NJ5A 1T3GA 3N2ZB 1YR3A 5DLYA 1X8JA 3T54A 3ZLVA 1N7JA 2YYZA 2R87A 4PHFA 2I2BA 1NW3A 1TQ8A 4ZVSA 1UPUA 4J0EA 3K35A 2OV6A 2C9OA 3M81A 4WFQA 2A3NA 1U0GA 3KEOA 2ZPUA 4ZEVA 1QQBA 1E7MA 3V80A 4K87A 4YCDA 3QG5A 1BMTA 1OIVA 2PCLA 2G4CA 1RAGA 3HCOA 5D1NA 4JKYA 3WGYA 2FUEA 1E79D 1SR8A 1WF3A 2JGAA 3A1WA 2F1RA 1GGMA 4BO9A 5IKXA 3NOXA 3JR7A 1XZBA 3SKYA 1YHNA 4R98A 3IJEB 1OUMA 1JQ3A 2XQIA 4JP1A 1L7RA 3ZDAA 1G5PA 2X0NA 1JQ5A 1ETHA 2Q2VA 1W1UA 4C30A 1A1VA 2J87A 4MH0R 2EKQA 1LNSA 1PU2A 2DR0A 4BVJA 1NWCA 1JG7A 1DIBA 5D86A 1X9IA 3ORRA 5TE9A 3UKJA 1K4KA 1RBYA 1JG6A 4FD2A 4H9GA 4MWOA 3VO1A 2NXWA 3IKVA 3PVCA 4FOOA 4YRTA 1EVYA 2AFIE 4B17A 1G2QA 1RXIA 2Z0MA 1LI7A 4X6XA 2QSYA 4B84A 5K9ZA 3KQMA 2A0KA 4RKEA 1P4SA 4GECA 4U2GA 1X1EA 2VF7A 3T3OA 5ICGA 3F4BA 4Y7DA 3HYNA 2Q4TA 3CCBA 4E5PA 2PQMA 1NXPA 1VJ1A 3QX7A 3GRRA 1AHNA 3U4HA 1ZRNA 2OK7A 3L41A 4H7FA 2E9SA 3PSAA 3ZG6A 3S8YA 4KHPB 1DMRA 1AN9A 2N46A 3I5MA 4YWHA 2GN2A 2XWBF 4KR7A 3JRNA 1WLYA 2YN4A 5IXYA 1YA8A 4YALA 2I6UA 5C7YA 3IT3A 5F1PA 2O8EA 4KQIA 3G88A 3WRYC 4P7FA 1REQA 3S1AB 3VZDA 3I72A 1FUUA 1XP5A 1M66A 2QQFA 3OPQA 2PV7A 2BV3A 2WZQA 4MV7A 1H2FA 3HDJA 5EZYB 3OY7A 1TRHA 4LXHA 5FPTA 3L0YA 1MFPA 3U48A 1XXHE 1SK8A 1UMKA 1SJ9A 2NXCA 1V9SA 5J2TF 3S7TA 1KO8A 4CM7A 4NMWA 2R7KA 1ZHHA 3P2OA 2P27A 4IMRA 5F78A 3TEJA 1HYHA 3TFWA 4RPIA 4Q39A 1OXBB 2QQ0A 2PE5A 1XCBA 1YI0A 3KX2A 1QVZA 4HFMA 3D6FA 4LEIA 1XZGA 3ME5A 4IDAA 4UEKA 2W6PA 4KACA 2EKDA 4JJZA 2P6RA 2A0WA 5HE9A 4ZTZB 1Y5IA 1ISHA 3KSDO 3AM1A 2VWHA 4YRDA 1SOUA 1OI3A 1M6VB 1LW6E 3D4BA 1OXTA 2FPGA 3KIPA 1AZTA 1DDOA 4LJSA 3MWEA 1T3LA 3ZTYA 5DEOA 1N5MA 2CCGA 1KMHA 4QECA 5DVZA 4BNDA 3PNMA 4EQ6A 1SOMA 1QAQA 3PC8C 4Y6LA 5EJEA 1JEQA 1V7CA 2WU3A 4RIIA 3ZOKA 4ZYUA 2QGFA 2FP4A 5K8LA 2ZXUA 4ENWA 1YC5A 3IB6A 4G26A 1G5QA 2P9HA 4IYRA 3CU5A 5TT0A 2HF9A 2VOEA 4FI3F 4UATA 5FP0A 5CNKA 4F3TA 1G16A 5NULA 5AVXA 2XRZA 4Q9AA 3Q3EA 3UG7A 5AD1A 4WINA 3BWEA 3E5HA 2AFIB 3U3ZA 1QGUA 1QAOA 3IMFA 4NMMA 5HKBA 2BFFB 2LUOA 4FXOA 3VHRA 2FZKA 2CFTA 3PPXA 3VVLA 4M0MA 3I76A 4L0MA 2MIIA 5H80A 3DD5A 3FOBA 4MW4A 2MWMA 3RYIB 2C9YA 5T8KA 1JHUA 4G0PA 3WTCA 3EDMA 4DA4A 4NARA 3PHJA 4UCWA 1KJ8A 3EZ9A 3R3UA 5FO1A 2EQBA 1LRLA 3ZZ0A 3NHYA 4ZVQA 3B1WA 1SIWA 4AK9A 1M2OA 3ENWA 1YCHA 2A88A 2VJOA 1GPUA 1PR4A 3QHPA 4QEDA 4CGYA 5AUOB 1VBKA 3SXUB 2Y92A 5LBIA 4X92A 2KMLA 1II0A 2EJUA 1Q21A 3EZYA 4LHSA 3U5ZB 2PSHA 1X7ZB 1WQ1R 2GF0A 3GRZA 3UWMA 1RJWA 2GX6A 2WDZA 5HILA 1GNPA 3CH5A 3SEAA 3T8YA 4EF4A 2WJVA 2FSUA 1JEDA 5C8VA 5EJ9A 3WK7A 2ZTVA 3VRHA 1JKMA 2HXGA 4JEHA 3UJAA 2RK4A 3LCCA 4KTVE 4Q9LA 4X91A 3PXBA 3MBKA 3BWYA 3TM5A 3UXHA 2CWDA 3CZRA 5FI0B 5EYPB 1Z18A 3UPDA 3B1ZA 1XD9A 3CEMA 4U7FA 4DQLA 3GGCA 3P5BA 3NV9A 2O8CB 1MO2A 5EIXA 3FWZA 4K9LA 4C9BA 4LSWA 4NU0A 1U2GC 1ZSVA 4FQ8A 2R6GA 3MMXA 1EDBA 2GPJA 4YJFB 1C7QA 4MX8A 3BWDD 1Z6QA 3WTBA 5IX8A 5LQAA 2XKAA 3L07A 4Q9JA 3DDUA 4J1TC 4MMZB 4U7TB 4JYMA 4A5OA 3C15C 5EKSA 1RRCA 1PNRA 3OX4A 4H2DA 4D6XA 2HAEA 4CLRB 3K0SA 2C3PA 2QTTA 3LVBA 4CR7A 4B6GA 3I32A 1HYEA 1NE2A 2ZSBA 4BE9A 4N7MA 4BCBA 2ZYSA 1ZH4A 3ZDBA 3ZLUA 2AK3A 1LRJA 1UC8A 3HO8A 3JD4A 4XUGB 4AJ2A 3GUVA 1TIKA 2DERA 5KYWB 3R3JA 5IWAB 4C0KA 1FS5A 2CYAA 3INTA 1WP4A 1YU6A 3N70A 4KOEC 1IY1A 1EXMA 2ZJ1A 1U3TA 2PKRA 2ZQYA 2IYRA 3RRZA 3N8KA 3S1AA 3I0MA 1DPFA 1CETA 1OX4B 1RWQA 2Q0QA 3GAZA 2WSBA 3LY7A 4JBHA 4K46A 4L08A 2IC5A 3T3EA 4BQSA 1MO4A 3QW4B 1RHKA 5DTQA 5EZYA 5ALYA 1AH2A 2QP4A 3GEMA 1E3DA 2IP1A 3B3JA 1FEZA 2C54A 1ZK1A 4OYLA 2FK7A 1L1QA 4PYKA 5FA6A 1D4AA 1MGPA 3KKOA 2VHQA 3N87A 3H97A 3QUAA 1UJMA 3MD0A 2ZYTX 3AEUB 1W1WA 3B52X 5L45A 3IQXA 1MPTA 4FK8A 2GPAA 2B0CA 1GFWA 2VQ6A 3F90A 3HZOA 3QKSB 4KNWA 4KVFA 1HOXA 4ZU3A 4LKRA 1NPYA 3TJZA 5JAPA 4U2BA 4G97A 4II2A 5GQSA 5FQNA 1S2NA 3LTEA 1V96A 4Q1BA 1R6AA 1M6VA 1RLUA 3BX1A 3CF0A 4NE2A 2Y68A 4DWJA 1GPKA 2GCOB 2BMWA 3AZPA 1EDEA 3MHPA 1U6IA 2VPXA 5P21A 4MYDA 5K6AC 1WTAA 3VR4A 2RCYA 4IV8A 4PYJA 4KGDA 5EZQA 2MSEB 1WLSA 3F8WA 1G1MA 4IVRA 4CIAA 3LP5A 5L4LA 3EODA 3S55A 3U4CA 3SE7A 3JZMA 3TIXB 5CFOA 1H8EA 4EGFA 2JZOA 1A0OA 3I39X 2NIPA 4PYRA 2D4AA 4C3VA 5AH0A 2FG5A 3D4IA 4O4IF 3BKXA 3RW9A 5L4SA 1NHGA 2B1JA 2AFIA 4NZMA 4YR7A 2M6LA 4GVXA 2BFFA 2VPQA 3WRYA 1GDTA 4EDHA 1ODLA 1NMSA 3FTDA 1ZG3A 5MN5A 1CFJA 3AB8A 5C5DA 3BQ9A 2Z56A 3RYIA 4BLUA 3T1TA 4XXHA 4S1WA 5JEEA 3ADOA 3MEQA 3IB3A 4N0MA 2JI4A 3RLIA 3GFSA 2PNFA 1UBSB 4A5SA 4EG5A 4LI3X 1ZKMA 2JFWA 3CT4A 1FY2A 3DYBA 4L6CA 2J3KA 2NVOA 4RW0A 2ZUTA 9ATCA 2UYHA 4EG3A 1OHHA 2IQIA 3DB2A 3E2IA 3IOEA 2WIDA 4PGGA 3ET4A 3LXUX 3D6VA 3QHAA 1M7HA 2FEOA 4GZMA 5DO9A 3SXUA 2GAJA 1S2OA 1ACMA 3GRKA 3UUEA 2D7DA 1DAFA 2DFDA 3I2YX 3OWXA 1P2FA 1XXHA 4YH1A 5FFFA 5JR3A 1X7ZA 2Y4OA 1BQ3A 1M2JA 4ZYLA 5LOVB 2I99A 3LDHA 5K0TA 3WFIA 4DJEC 1GGJA 4I55B 5FH9A 4DS3A 1U81A 3Q40A 3T5CA 4JT9A 4IXDA 3K4PA 1VQ1A 4I3GA 2ZSAA 2DB3A 3N2KB 5DN9A 5CBPB 3PC8A 4YVFA 3M4JA 5PNTA 1MLDA 5SYNA 4ZMSA 5FWXB 2N9UA 2EU8A 4LE0A 5EYPA 2V1UA 4MAFA 3KQHA 4MLDA 2VF2A 3K9FC 5KU7A 2EQ5A 3HEAA 2OCPA 3NM6B 3EY4A 5K3OA 2O8CA 3MC1A 4O4LF 3C6XA 2WIKA 1QUEA 1EFDN 3EEOA 2BR3A 3KQYA 4EMSA 5ER6A 5ALOA 1DOHA 2XAUA 3QKRB 1JDPA 1BVRA 2BUBA 1ZZGA 2XVMA 3PQ2A 5JNLA 4DARA 1K5HA 2IEZA 2WAXA 3GT0A 4KQ9A 4QVIA 1Q3KA 3H9EO 1Z26A 3G0OA 4JC8A 3TINA 4CLRA 3JWPA 4DDWA 3BCRA 5EVCA 3ZJ4A 4G5XA 3FZNA 5I8WA 2PM8A 4GI5A 3RS9A 1U0NA 2Z83A 1BTOA 2RB4A 4CM1A 1Z07A 2ZCVA 3GFBA 3JYPA 4QASA 4P5DA 5AUNB 2P77A 5KYWA 2Q6LA 4F11A 2JAUA 2BELA 1NIPA 1J1ZA 3H8JA 2B8JA 1OX4A 4G5GA 3T35A 1MO6A 2VK1A 1Y5MA 2HF8A 2YICA 1YQGA 1M2VB 3D0RA 3RHSA 4CIYA 5EWLB 2ZPTX 2FX2A 4L8WB 1N32B 5BUQA 2DJIA 1SBQA 1X1RA 3UXEA 1DZIA 4I1SA 4TUYB 1DRKA 2ZWAA 4N8EA 3REQB 4DIBA 4IEFB 1L7OA 4B6JA 4IDHA 1K7FB 3P2MA 4IWXA 3AEUA 1E5VA 1MBZA 4RY0A 4QYXA 3B1XA 4JHLA 4KPYA 3HKCA 3P19A 2R86A 3QKSA 3RAGA 4IRXA 1YASA 3CXRA 5FDFA 1N78A 2VJCA 2IVFA 3WRXC 1ZVJA 2SCUB 4OA5A 4Y98A 4D3FA 4R0MA 1QS0B 2GCOA 4QRIA 3U81A 3C5WP 2PL1A 1FS4A 2E4WA 3ED5A 3GJ4A 4OB6A 4P3PA 5AXBA 5NLLA 2XD9A 4A1FA 4J1TA 1L7DA 3AVXA 4N03A 1KK0A 1B00A 2ZBDA 4FNMA 4BFXA 1H8HD 3IAS6 5JCJD 1YV9A 3BB4A 3GZJA 4JI6B 4V1CI 7ADHA 3W9YA 5CLJA 4MUXA 3PCXA 1RXUA 2CLLB 3VO9A 4C06A 1FMCA 5K2MA 1X2BA 4BB9A 1G6KA 4WT7A 4RY9A 4OGKA 4BJ1A 4EYSA 1QUFA 2FW8A 5JYEA 4YROA 5HJ7A 5FFMA 4R2LA 1U8FO 3MTGA 3L8CA 3W1VA 1QRDA 1XB2A 3G02A 4RS3A 1CQJB 1WS6A 3RUEA 3W9SA 3DDCA 1Z6AA 1IHDA 3WK5A 2HA2A 4FBGA 3ZWYA 4B6RA 4D0SA 3U80A 3HWX1 4A9AA 1N2CB 3E6AA 2C3UA 4FFRA 2WTAA 4D0NA 2QM0A 4XWOA 3IR6A 3MAGA 3SPXA 1KHHA 4ZO7A 2JPDA 3TKYA 3UHFA 3KQLA 2TRSB 5HP4A 1QZXA 1F8GA 2I7DA 4DR5B 3LSTA 4LHZA 1K68A 1FQKA 4OB7A 3QEJA 3R7LA 2C04A 1CEQA 2ZRDA 4HDCA 1YACA 2EARA 3A3NA 2LCFA 1AV7A 3HY3A 1N2ZA 1RCUA 1GL9B 2F1JA 3BAZA 3P4YA 4PQRA 5KTSA 5EJ8A 1FNDA 1J8YF 4DTCA 2JCVA 1YK1A 3K0EA 5LOVA 2BJVA 4AJPA 4R7GA 5A3VA 1V3QE 4KLAA 4ZCLA 4AMVA 2VYFA 4LBYA 4S05A 3MCAA 4F45A 3DHYA 1XYYA 1HFWA 1NAIA 1RC1A 1X70A 3OJEA 4M1EA 4WKGA 5DGHA 4UPDA 1MV5A 2VQFB 5KIAA 1TNDA 2WD9A 3N2KA 3N8IA 2W6NA 1RJDA 1D03A 4BZWA 5CBPA 6YASA 1JR3E 4Y9DA 5FWXA 5JV5A 5EESA 1PJ3A 4PRKA 1VSBA 1XTSA 4EYEA 4KO2S 1NR7A 1TFRA 2A35A 4P93A 4F6CA 4UMVA 3BB1A 1U0OC 1WCXA 2VYND 3OOWA 4ENPA 4FZVA 1QCYA 3WWEA 2QXYA 1OBHA 5ALFA 1QRAA 2B0JA 2GAOA 3QKRA 1FUEA 1CJMA 4DNFA 3L18A 4Q6WA 1Q3TA 3GRYA 3F3YA 3FUUA 3E82A 3ONVA 4OI2A 5FWYB 1SG9A 1VLZA 5JPDA 1NLUA 1RQ7A 2WM3A 3ROFA 5HF5A 1T8SA 1K7SN 2L0XA 1RIIA 1BD4A 2R7NA 2X0JA 3BWXA 1X1QA 4DIEA 2D54A 5KCZA 4EITA 4V24A 2C2ZA 4RKYA 1U5AA 1DTEA 2Z3ZA 3G85A 1JEAA 3FNGA 1SB8A 2E6KA 2I34A 2EJVA 2W43A 3AKCA 3DMHA 3AKYA 1GD1O 4QLBA 1I3MA 5CB4F 4FP9A 2Y4NA 4HB3A 3B8HA 3JZIA 5CLFA 2H4YA 2ID9A 3ZQUA 1A5ZA 2C5LA 3FRIA 4LVUA 1VIMA 2BGIA 4BO2A 4E5KA 4EKGA 3W6OA 4IW3B 1V7PC 5HK8A 3SF0A 4CGZA 3DKPA 2O1SA 2FFRA 1T36B 4ZOLB 2C83A 3I37X 1M2VA 5EUQB 5EWLA 2Y6VA 3PGA1 4P32A 5L95A 1KTIA 5C1BA 3I8SA 5H7XA 4LS3A 3WLOA 1PFKA 2YJGA 1D0SA 4TUYA 4BJ3A 4N41A 1D2AA 1BMDA 3KTFA 3O8RA 4AQYB 2BY4A 3JXEA 3REQA 3U40A 2AN4A 2X5KO 1BXKA 3CGGA 3QBVA 2NWQA 1RADA 3BM5A 3FMPB 4JZYA 4C4OA 4OAPA 1KPIA 3KWJA 4BNHA 3CKMA 4HVTA 3ANLA 4JN6B 4D92A 3USES 4O5AA 3S44A 1S8OA 1UJ2A 2QP3A 2SCUA 4NOKA 3VNAA 2XCSB 5CYFA 3EXFB 3ROKA 1YB6A 2Q9AA 5SZHB 1QS0A 4C07A 1Z0DA 2WJYA 4J16C 4UM8B 1EXWA 3WGHA 1H1TA 4RPLA 1WE2A 2FR0A 3PQ6A 3TS1A 2I4LA 4WBXC 1LRKA 1ZCFA 3VBEA 1U3UA 3GD5A 5B55A 1IWPB 1V41E 4DLUA 2IBTA 4C43A 3AESB 3OZCA 4HWGA 3RSOA 2X7JA 4K2HA 3TSAA 4Y6QA 2R44A 1VMEA 2AN3A 1YDMA 1XDBA 3BB3A 4GRIA 4M86A 3Q85A 4OXRA 1U7HA 5EJGA 3M0EA 3L4KA 1P4GA 1P17A 4PAGA 4AJ9A 4N0QA 3GN1A 3S68A 4E7OA 3D8TA 2YJ6A 1NTRA 3HK2A 3D6TB 4TS3A 5IHPA 4GOOD 1U9YA 3RU7A 2VUTA 4CCWA 4JU9A 1CKEA 1HMPA 4KXMA 3JATA 5EE5B 4LPSA 3B3GA 4Q7QA 2HA7A 3ZK8A 2HMSA 2Z2KA 3KXDA 2EJTA 1SUIA 2VK4A 3A58B 5B2ZA 1CQJA 1S9HA 4CQLB 1JHYA 3TTTA 2FEAA 3F4KA 4DY6A 1DCFA 1NA5A 4K6KA 2NQ2C 4Y2XA 3ROGA 4W99A 5AVSA 1QV7A 4G24A 2WJIA 4QJ4A 2R6ZA 1K1EA 3N0VA 2BCEA 3W06A 2ZVPX 4ZCRA 2DHEA 5FEUA 2ONCA 2V97A 3T1QA 1XROA 1XAIA 1YUBA 2FHSA 4M76B 3T3GA 4CM9D 5A9SB 5IXJA 1B3RA 2XQFA 5DTMA 1AUPA 3D5QA 1L4NA 3CX6A 3JVUA 2GHRA 3OLCX 1U9CA 4J9VA 5EWMB 1YQWA 1DL5A 4DMMA 4EI7A 4J7CA 1U99A 1WSAA 3NIBA 3WRXA 1F4LA 2ZAYA 4XA8A 1JA1A 5SZKB 2ANCA 3A9WA 3C3WA 2WWVD 4BDSA 2O3JA 2XTZA 2HWWA 1GQOA 4TTSA 2OHVA 1B8OA 3FXAA 4F4IA 4X1KB 2YWCA 4HGRA 1PX2A 1G42A 1YIOA 1A9RA 2I7VA 4LCEA 1AMNA 1GYPA 3D0OA 4LWQA 3Q2KA 4X60A 1PZGA 2HU2A 1V4NA 3HY4A 2FSGA 4KQCA 3EWSA 3GOQA 4L8GA 4UMFA 4YRKA 2CVFA 5JXHA 2MHCA 1GTZA 3B5IA 4KX5A 5CG2A 5CGZA 3PQ7A 4OXNA 4Q4AB 4GX1A 1OZFA 2CNLA 4KLCA 3GFGA 3IO5A 2WJHA 3FY4A 4Q21A 4FIDA 1O8BA 1I7PA 4X1OA 3UYKA 5BSVA 1N0HA 5I7HA 3MAAC 1KAGA 1B0PA 2YJ5A 4JXXA 3ZVRA 2XVAA 3ASUA 3VR2D 4PZLA 5FWYA 2F1HA 3E1GA 1UPBA 5HJ2A 5COQA 2ACWA 1N0IA 3GH1A 3NHFA 4QD3A 4QXAA 2ACEA 3EIUA 3L4BC 3ZHCA 2Q5JA 4LBWA 5FOXA 2NUAB 2G77B 3ZCPA 1GQYA 1Z0AA 1PWXA 4DC1A 1OAOC 1CW2B 4FW9A 4RZHA 3CUTA 4Z99A 2CF5A 4UBJA 3SVLA 2BFOA 2YV1A 1C3XA 3A31A 2ZJYA 4WXMA 4Z0HO 2BGNA 1DARA 3IMGA 1T36A 4ZU6X 5ITZB 4ZOLA 4ID3A 3WFJA 4IVPA 3OLVA 3G7UA 2O2GA 2FGJA 3FCOA 1CJVC 3CUVA 2JLRA 3DMDA 3L6RA 4GDMA 3DMPA 4YPFA 1ENPA 1KAOA 4G67A 4N5IX 3DEYX 1YR7A 1O6CA 3UXMA 5EJAA 5JVDF 3L1KA 5CH8A 1Q7EA 1U0RA 4JSYA 3C14C 1FL9A 4YUVA 1GRQA 2JIRA 3KWMA 3B12A 3EDCA 4HGYA 2MSLA 5A4IS 2ZSDA 3DPIA 1LBHA 3EIOA 2ZYVX 3R4VA 3CJQA 2ZT5A 3WIBA 3GY0A 4O6VA 2CXXA 2GJAA 2DPYA 2BC9A 5K01A 1XCPA 5FAKA 4AZWA 1WUTA 1PTKA 2A9JA 2IQ5A 1J8QA 2ZJ8A 3DVRX 3NGLA 2CDNA 4DMHA 3IQDB 3S2SA 2NV0A 4OHKA 4EK9A 4DBLE 3WGUA 3FGOA 3HADA 2V8BA 4NAUA 2P41A 3TR0A 2CK3A 2P7HA 3VV3A 2VAXA 3E27A 2AGVA 4BLTA 1BA2A 1R37A 2XHZA 1H2AS 4URWR 2BP7B 4NFSA 4E14A 2HTEA 2ATXA 2XCTB 4L3OA 4IICA 1FUYB 4LUCA 3AESA 3VH4A 2YIJA 3KU4A 3PX3A 4GPEA 2O20A 2JHFA 2PGAA 1VLJA 3MRXA 4TT3A 3JYLA 5CPFA 4B43A 4ZFNA 4FFVA 3ZXYA 3QE0A 4ZEWA 4X1IA 4DBLC 2JFHA 1Z5GA 2PS0A 3MTJA 2QE6A 1PJQA 5IMBA 3VKUA 1P1CA 1VE5A 3IVGA 2ZYUX 4LC0A 5LUBA 4EQZA 4E5VA 3GWZA 5JANA 4YX9A 5JSUA 5L4NA 4MW1A 2ZS8A 3UWOA 3LBYA 2VCYA 4DDUA 2R7AA 2V7PA 2ZSFA 3CRNA 3QPBA 4QOSA 4CQLA 1NQTA 2Z1MA 5JH7B 4GT1A 4HV4A 3I04M 3E9CA 2QJRA 3OFSA 3O4IA 4MV6A 4S1PA 1WNTA 1I14A 4AJJA 3ZWBA 1WJGA 3NFYA 4X71A 2J3LA 4RQTA 4R3WA 2DSNA 4YAOA 1YJ5A 1A7UA 2IZ1A 1XZQA 5A05A 1FBNA 3TBHA 2PX8A 4JB2A 4BZQA 1Y63A 2OM2A 3FAZA 4IJ5A 3NYRA 1K8RA 1Q14A 2I6FA 4TZTA 3KK0A 3ZX4A 4IZHA 4EY7A 5A9SA 1AQUA 2BONA 5IEBA 2NP7A 2X9LA 4TV8B 1UAGA 5EWMA 2P79A 4RAOA 2PR7A 4HQ0A 3HXLA 1RP1A 3Q8XB 1KMNA 3ZCVA 1SIBE 3QOXA 4I9UA 1HG0A 3W79A 2FP3A 5K8JB 2WTMA 2N47A 4OX9B 4AY3A 2Y3IA 3D6HA 1S2MA 1NVTA 2K5UA 4J16A 3FKSD 4X1KA 1SHKA 1ZD4A 2YBEA 1W48A 1GA6A 1XZKA 3GEPA 3LLUA 4CMEC 3A6EA 3SFTA 5E9WA 4RTRA 2RI1A 2V7WA 3DPUA 2VDLB 2QNBA 2ZE7A 4L3VA 1RABA 1Q0SA 1J21A 3QTLA 2Q2NA 1NN1A 3E2MA 2XQGA 1OGIA 3GFRA 4H3VA 4IS2A 4P84A 4Q4AA 1E2IA 1QZUA 3D1JA 3DEZA 1TM2A 3OZGA 7MDHA 5DNDA 4GX2A 1FX1A 1RS0A 3TLYA 1U80A 1JSZA 5J47A 3PKJA 1W5TA 1KEPA 2AOXA 5FPYA 2DEUA 1XO1A 4X3OA 3ONNA 2BZ1A 1OJLA 3HVHA 2HHHB 4W5TA 4I8DA 3FVTA 5JXGA 3CRQA 4GOMD 3HP7A 3E9MA 3HGTA 1OLXB 3QVOA 1P9WA 2RGEA 1GAEO 3OTIA 2WNSA 1Z06A 3SFZA 3RFVA 5AHRA 3L7BA 2NUAA 1XRPA 1JG4A 5LWQA 2D2EA 4QJIA 2XNHA 3T38A 1G8MA 2R66A 3GNQA 2LBPA 1XN1A 2BMEA 3MGGA 4L4RA 3ZBPA 4MAAA 3IP6A 4HAWA 2H00A 2OT3B 3AR7A 3KEMA 4DAEA 2J6BA 4GP6A 2NTYC 3O38A 2HQOA 3LM8A 4J2TA 3L9WA 3PL1A 4F71A 2Q5IA 3ORFA 2B4KA 4L7VA 5ITZA 5JAOA 5T7BA 4MB6A 4MUAA 2IPOA 3U9SA 5B57C 2CXRA 3QLTA 1PCXA 4HBZA 1RXEA 1T9DA 4K9SA 4H3SA 3WYDA 2QL7A 1JQKA 3G2KA 4EJ6A 4IWYA 4LDJA 3ZVKA 1OKKD 2DH6A 1YZTA 5A4KA 1XALA 5TQ2B 4D82A 4P3OA 2QX4A 1F51E 2HN9A 3G2IA 3A1SA 4S1VA 2C0PA 4GE0A 4UCQA 3U17A 2HF2A 2P4HX 3PA6A 3AFHA 3OCWA 3F96A 2FWJA 2VATA 3FWKA 3QPDA 4JI1B 4WERA 3N0TA 2WU4A 4DLKA 1FFGA 4FX5A 1FRNA 4RM2A 3BIOA 1T26A 2D13A 2Q27A 3F3MA 4YP5A 3ZCSA 3RU3A 1R9MA 3PUJA 1OILA 2G25A 3FPFA 3SYRA 3RWBA 2O50A 2BP7A 3CX4A 2CLSA 1KYTA 1ZD9A 2BEWB 4W5HA 2X3UA 2QN1A 3STVA 1FFWA 1ZNYA 3HN7A 2CL0X 2IPAB 3JX9A 1UXIA 2PMEA 1I0LA 4RTKA 2V54A 3L4BA 4CQMD 2HDOA 2XWJI 1NBOA 2X9GA 3E5MA 4LYYA 4MARA 4QO8A 1MUUA 3UK1A 3DP9A 3ESCA 2C3YA 1A7JA 3QNWA 1E7QA 5A7GA 5FPSA 4EW1A 1EFVB 3HLYA 3T3HA 4DNXA 1F0KA 3K32A 2O2JA 3ER6A 1WUKS 2ODBA 3OMWA 2J5BA 1M6NA 4JL5A 5B58T 2IV2X 1TGVA 3IUBA 1NJ6A 3O4FA 3PGMA 1PJTA 4TRMA 1JIXA 4A92A 5JH7A 1XZEA 1OLOA 1TGYA 2PGXA 1DBVO 3NHBA 1EFRD 1C1HA 2GK3A 1U7TA 1N8KA 1UJCA 4B6SA 4KXNA 4D3XA 5DRYA 3HGQA 3TZHA 4BNKA 3WI7A 2FF5A 3X2EA 2FJ0A 4ZARA 4EGJA 3LQQA 4TS4A 5AP9A 3W90A 3LHFA 1QAMA 5DGDA 3KYJB 4Q3OA 5ALDA 3V1KA 4D9HA 4ZK6A 4L57A 3ZK9A 4EB6B 1QP7A 4P81A 4YAIA 2WMYA 5F5XA 3DDHA 3ZU6A 2IYXA 5K5EA 2IGBA 5KVSA 1LY1A 3SHTA 1F9AA 4TV8A 5HR5A 2CJYA 3K15A 4X8LA 1QO9A 5JQWA 1QCCA 3KJNA 5F7JA 1YR6A 2WAOA 3H4VA 1NVXQ 5FF9A 1M5UA 2F7SA 3QITA 1ENYA 2IYZA 3R0VA 3FPKA 3ONWA 3RJTA 3HMKA 3CINA 2VHCA 4Q3LA 3KLMX 4V0ME 2ONJA 4HR7A 1SKMA 4KBGA 3ESRA 2UAGA 3UWDA 3Q8LA 3D3WB 2YOHA 3CVVA 1VHQA 3MNFA 3T15A 3WXMA 2I78A 3AM5A 4D02A 2D59A 4GLJA 5EZ5A 1TTTA 4FX2A 1IM2A 1OYOA 3HVJA 1O95C 4F8JA 4YQEA 1RYHA 1QGOA 4BFUA 5JCXA 1XRNA 4IGIA 1NJ8A 2NACA 2ODQA 3H42B 2JRCA 3CZPA 3I28A 4DAOA 3JTEA 4DCSA 5B1SA 2I2WA 2RFLA 3ABZA 3CCFA 2QD1A 4TWAA 1A8IA 3A2KA 2HIAA 2DFNA 4IP0A 2BMVA 1JHMA 1OLXA 3SZOA 1RZRA 3VMMA 5LMNB 3AUSA 1LNQA 1JECA 3FYTA 1SELA 3QYAA 4R01A 1C9JA 1M75A 3G8YA 4CV1A 2N3ZA 5AJXA 2DVMA 3JPYA 2Z1DA 5CXSA 2JI9A 2Z2JA 2ZPAA 5F2KA 3SKVA 3TW0A 3UQYS 2P9JA 4BMOB 4GR5A 2OFOA 2ZIGA 3GXOA 4B3TB 5DI9A 4AN0A 1ISSA 2VDNB 3PTLA 3RH0A 4MP6A 5B7QA 1SHZA 2J3MA 2W2NA 3PJEA 3GPBA 3OQVA 3L3BA 1ZK3A 1W4AA 3WLKX 3VPFA 5FWDA 4MRSA 3KEQA 1M83A 1T0HB 3K8QA 1YGYA 1H23A 3WLIA 1V0JA 1DAIA 3U7JA 2O8VA 4CF5A 3E9QA 2DULA 3QE4A 3KKKA 2GXUA 4UBOA 2YC2C 4RE5A 4XEHA 1EGHA 2R4UA 2Q3BA 3Q41A 5DWDA 5LXTF 1XPOA 1UBEA 4KO1S 4PCVA 4RXUA 3RUIA 3TG8A 8MHTA 1N0VC 4CMEA 1ML3A 5TQ2A 4E4RA 1Y7IA 2C9CA 2Z2XA 3VBCA 3NJRA 3OC6A 2IHUA 3TLBA 2JL1A 1OB2A 4TYQA 1QHGA 1TUGA 1VP9A 4EY4A 3GDGA 1BVUA 1NI4A 2D1QA 3R77A 5TJHA 1P7WA 1Z2DA 2P9CA 3MERA 1YBHA 4Q1EA 4NBVA 3CUKA 1E99A 1ATIA 5K3FB 2C4HA 4EG4A 4RTPA 3QVLA 2P35A 4F8YA 3V6LA 2O48X 4WLUA 3RS3A 6Q21A 1V2HE 3TAUA 1VOTA 4BQPA 4YRAA 3DWGA 2Z2YA 1XAHA 1M7GA 1PWEA 3R4CA 2BEWA 1PJZA 1GRVA 1L5ZA 2CY0A 2DMRA 1UPXA 5DSXA 4G0YA 3CLTD 4ZA2A 1HFKA 3L8GA 3MFYA 4ZEXA 4IIBA 1F9EA 2X2EA 3SDZA 3I2JA 1ZMRA 1FYXA 3ZGLA 4MLCA 1X42A 4L5BA 4LOAA 4B3IA 4BQEA 4D6YA 1TAHA 1RRMA 3IPXA 5KU1A 3GFTA 5EQTA 2P1RA 1FXWA 2X8JA 4F3KA 3L8ZA 3K6JA 3QE3A 5I48A 1EFVA 3MUOA 3ECAA 4ZMRA 2WZCA 4J0IA 4JDPA 2ZYWX 1ZN2A 1HE1C 5DP2A 1JSCA 2FPMA 2X0IA 2WFMA 2X6TA 3FN4A 4B4VA 3KOOA 1XDSA 1RWPA 1EJ0A 4S2UA 3RBZA 4PC7A 3OHPA 1QTIA 4RFLA 1K8YB 5L6MB 1ELOA 1J0EA 5AOVA 1ZA1A 1WL8A 2W11A 5I9BA 4WUVA 3QA3E 1D8AA 1G3IA 1K7YA 2CXUA 4KOAA 4LV8B 4XUDA 4QYWA 2GCIA 5LZ9A 2FI1A 2IXBA 1U2SA 4D4LA 2CHQA 3QGMA 4OI0A 1WHTB 4TXMA 1FYVA 4UU7A 4CG3A 1XZLA 1O94C 4LGYA 4LECA 3TW4A 4EB6A 1T2AA 2IYAA 4NFYA 2WHRA 3GB9A 1T1SA 2FE4A 1AG9A 1N9ZA 1P45A 2PKQP 3FCSB 4K0RA 2PH1A 5SY6A 2Q45A 2ZXFA 3VXKA 3L9XA 4WZ6A 3CURA 3OJ0A 4PY2A 4JC4A 4XUCA 5BOVA 4HJRA 2GBFA 2QRGA 4IKOA 3OUTA 4XYGA 3TXYA 1Y1TA 1YR9A 2GO7A 3A9RA 3GA7A 2QZZA 3KYBA 4U9HS 5LBUA 2FPLA 3I1IA 2QX8A 1PQPA 3LGXA 3D3WA 4MR8B 4AG3A 5JYBA 2C5FA 1XPRA 1NMQA 4PNHA 3VSDA 3AFNA 1KNQA 1T5LA 2FWNA 2O2EA 2H2IA 2XMDA 3KDSE 4RNDB 3AUJB 1RCFA 1I7QB 3AUTA 2FNAA 2OOKA 3PR2B 1W5SA 4US2R 3ZD7A 1IL0A 4M3NA 4JBNA 5C1DA 1NYTA 1E0DA 4OA8A 5FOUA 3X1XA 4WFJA 2NUBA 2AJCA 2CMKA 3IMKA 3OIYA 2WWHA 2IUSA 3FPJA 4YLEA 1QP8A 3V46A 3VC1A 3IALA 1JSLA 1PDOA 2JEYA 3RNLA 3V97A 3I45A 3MA0A 3QJGA 3AVUA 1R0XA 4D7AA 4MKFA 4M1SA 5CT5A 1HC7A 2AQIA 3G9ZA 4Q9NA 1S01A 1F6BA 2QLJA 2GZHA 4QT0A 2O2HA 3QXJA 4OQMA 5G2OA 1RPJA 4UEOA 4ZOCA 4ZCMA 2FEKA 4CM8B 4PLCA 3WL7A 5EIBD 3OE7D 3EULA 2ZBEA 3IEXA 1A76A 1RHJA 1WSDA 1FP1D 2C59A 4H77A 3C85A 4BUZA 4IAOA 3CRW1 3QVJA 4E0BA 4K6GA 1WKCA 2B78A 2UVDA 3FZGA 3KSRA 4JOQA 4W4TA 5FNVF 3IUNA 3S2ZA 4C4RA 2C3OA 3T95A 4KBYA 2I76A 2XT9A 4YA6A 2HUPA 3VOSA 1VGVA 1HDGO 2ZZKA 1E96A 1EB9A 1L5HB 2FDCA 4YPVA 4QFBA 4OQPA 4RCZA 5DI3B 8ABPA 3HA2A 2JVKA 3EVNA 5ECDA 5LYJB 1T6YA 1J42A 5F52A 3R1IA 4IOKA 4HI0E 4JCOA 3HBAA 5BOSA 1OIXA 1IK6A 1FDOA 1KJZA 2OD2A 4HGNA 3CGWA 4U7PB 1V71A 2RH8A 4HS4A 6REQB 1C9NA 5HIJA 4LZOA 2O06A 4IGKA 3VI4B 1O95A 1E62A 3WLTA 3V2GA 1RE0A 2P75A 1AGPA 2YV3A 4QE3A 5AW7A 4O0MA 1A8SA 4V0MA 5FL3A 5T6MA 4DGQA 1DO0A 2DC1A 4EY5A 5K3FA 3STWA 3IDOA 3O95A 4UVIA 2XMBA 4XDZA 8GPBA 1W30A 4ABTA 1SK9A 2FE1A 2UYGA 1ISPA 1VG1A 1O6BA 1E64A 1CP3A 1KE2A 4LC9A 3LWDA 3I53A 2WZDA 4TVBA 4AN4A 1P81A 2XNSA 3QEMB 1JDSA 1QFMA 1F2TB 4NV0A 3RS0A 3ZDXB 1JH9A 1RQRA 2CXTA 3O2NA 3JPWA 2OMEA 1R0BA 3CKLA 3HACA 1DIRA 4PSCA 4RKQA 1MG5A 4RJIA 3ZZTA 2ODAA 4M8KA 3RGWS 2MCFA 2HPZA 2EG5A 1U8UA 4XWTA 5FPPA 1YI8A 2HMAA 4YMWA 2X2PA 3PNOA 3U7GA 3KOZA 2QIOA 2I65A 4Q3AA 1NSFA 1HTTA 1EI9A 3ZQ4A 2C8KA 3MUFA 2DH5A 2W6ID 2GZMA 4AKGA 1NRIA 5FKJA 3AHEA 1I4TD 4AQDA 1ZW1A 2G40A 2V58A 3CR7A 2BM9A 2VR1A 3IDFA 3M4YA 5CDSA 1SXJD 1M6HA 5CG1A 3S8MA 4X61A 5C5EA 1TPZA 3CVOA 4JKOA 5CMLA 4JSRA 3ZCQA 1E2NA 3SSNA 2ETVA 3TQHA 1WHTA 3LY8A 1LZKA 1TMKA 4GOKA 2QY9A 4Z9AA 3QFSA 4XRGA 2XUZA 1RJ9B 4W1RA 2QRPA 5DCUA 5CURA 4GM4A 4KV7A 4MYHA 4U3JA 1XWIA 3ED1A 3GNSA 3GEIA 4N12A 1VL6A 4KUGA 4WKOA 1T34A 3QUSA 3AUKA 3RFUA 1L3BA 2X8AA 3WGNA 5H3CA 3AO0B 2P9FA 4ESHA 1AXEA 4B7XA 3UMFA 2PRSA 3JQAD 4X54A 4HQRA 1AKWA 1I10A 1VPWA 2O54A 1MQSA 2FHPA 2UUPA 4FSHA 1WB4A 4JUCA 2IYUA 1CHNA 1U3VA 1CNMA 1LWOA 1HETA 4US1R 3AKZA 2Q1YA 3F47A 1ZPDA 4IJKA 4Y0NA 4FT2A 5CH5A 1NVEA 4X1YB 1PWHA 2FSPA 4TKVA 1U0BB 3PHIA 1WHSB 2HA3A 1UFVA 1A5AB 4R2HA 3C3AA 4Z4FA 3CKKA 3E05A 3W05A 3SBXA 1C3LA 3TBKA 5BV7A 1IWBB 2PGDA 3IAEA 2B2NA 2REBA 4QTZA 4JGBA 5CW1A 4Q4CA 4F38A 1GPYA 2GYWA 2HHAA 1ARZA 1UKBA 4YBRA 3MWYW 3SXPA 3PFFA 1UBKS 4NMHA 1CUFA 5FWAA 3L0OA 2CLDX 4QELA 1FXUA 1NQAO 4CM8A 4QUKA 1KMCA 3L5KA 4NZYA 3I6QA 3V42A 2PLAA 3G3EA 4KN5A 2PSEA 1M2GA 2B7LA 4J07A 3GR6A 1CVRA 2SKCA 2PKYX 1LFDB 2EP8A 4JLKA 4MVJD 4UMEA 5DHTA 4H4EA 4PNPA 1O94A 4AJKA 4D3DA 4MP8A 2JKVA 3FNFA 3DV9A 2JNWA 3C8ZA 3DE7X 3I01M 1KVUA 1QHIA 4HDNB 4KVAA 4PYIA 3WLMA 1U4SA 4QTXA 2B3TA 1J09A 3EGOA 4CKBB 4ECAA 3RADC 5AVJA 2HX1A 2G04A 3N07A 3TTSA 4BO5A 5MHTA 3TRFA 2WU1A 3UT0A 1RJGA 1GEGA 3A7EA 1L5HA 5DM2A 2R4QA 5DI3A 3C3CA 4H1TA 2AB0A 4FNAA 3TJRA 4C7XA 5LYJA 5A06A 1ECFA 1V16B 4WASA 5FTLA 1PLJA 4ZHSA 2R84A 3VNRA 1V1JA 4ND7A 3CZQA 5AJVB 1NPTO 2H3EA 5LU9A 2I22A 1NN0A 4MGKR 4S0ZA 3ZKWB 1MAWA 1MAHA 1HEUA 2WSSA 6REQA 2PYDA 1WXWA 3ZIAA 5A3JA 5KDDA 2VEOA 1ILWA 1JLMA 2AEMA 4HSEA 1V39A 2UVQA 4DLLA 1NAHA 2Z9CA 1NBIA 2IDKA 5B7GA 3ZV6A 1G1AA 1IEVA 3EEYA 3TQFA 2FEWB 2GD6A 3GF4A 2JJ2D 2I6GA 1GTL1 1RLOA 3BTSA 3W0LB 1JQLB 5J63A 1EESA 3I9MA 2XBMA 1HTWA 1R3DA 3AT1A 3LRTA 4I19A 4ZZ2A 4EYGA 4W5OA 3ACCA 2JJ1D 3FA2A 5DH9A 1G19A 1E4YA 1LZLA 3QEMA 1F2TA 2G76A 4LXYA 3RSFA 2OAQ1 4XI9A 2NYAA 2WTUA 4K3VA 2CMDA 1OYWA 5E3JA 5FYDA 4K0KB 4RHYA 1YNOA 1HI9A 1ZMXA 3R7AA 2FSHA 4XX1A 2XHEA 3OKCA 2HK9A 5D2CA 4MVJP 1UFRA 2R2GA 3B85A 3EGEA 3RTGA 4XB1A 1J5EB 4N7BA 4DZZA 1YCDA 1ZM9A 3CZCA 1BOOA 2GYYA 2ZAIA 4FMCF 4MVXA 3TLAA 3ZQ6A 4AF8A 4UUMA 5E1DA 1J06A 1JHDA 2QV7A 1TADA 4IXMA 5DNEA 5JD3A 3IBCA 3KJXA 3A9CA 3G2QA 4EUHA 1CNEA 1V11B 3C70A 3RIEA 2LCIA 4DLVA 2G09A 1PFGA 4NBRA 1XMSA 2CZQA 2WHQA 1J8VA 3Q7QA 2B82A 4PC6A 3CLVA 3OURA 4YACA 1JLSA 5INTA 2W0MA 1RJ9A 2JIBA 4LC1A 2C2OA 1MRSA 1CRQA 3CXUA 3LUPA 1UINA 4RLHA 1E3LA 3WNVA 4CHTA 4KQXA 2CD7A 4XJXA 4FN4A 2GD0A 1MGOA 1ZVKA 2K87A 4HEQA 3VX3A 2R4TA 4IL5A 5IRCD 1CUBA 1Y6FA 4RANA 1EVZA 5BVHB 4WL0A 1J2JA 1DP4A 3B9RA 5HCNA 1CY6A 2FFHA 3FM9A 3BYZA 4XRRA 3SZMA 2P0EA 3HNRA 5KTNA 1ODKA 3EIWA 3FH0A 2N1BA 1E3QA 2GD1O 3DWEX 3G6KA 3PDJA 1VPTA 5DOVA 4ALMA 2YMLA 3ZWPA 2INGX 4J8PA 1IBKB 2X6RA 3PEVA 2CD9A 1B6RA 2CWWA 4N5LA 4X1YA 3KFLA 1WDWB 3FMIA 3P4XA 5AICA 4YIKA 5E2IA 1WHSA 3BFKA 4ETIA 3T7KA 5LNK1 1ODCA 1B2LA 3ZBUA 1VJDA 5CIWA 1JLLA 2GBGA 2VDQB 1RBQA 2TMYA 1M2EA 2XAAA 4CFZA 2VK8A 3BXGA 2BTQB 4RK6A 3FPBA 4RMNA 4LK2A 1BX1A 3GXBA 3OICA 4V3BA 1E1YA 2IIQA 3VPXA 3D8HA 4NBLA 5DB4A 4N3CA 1GUFA 3N2GB 2V0GA 3GAMA 2Q3CA 3R3XA 1KRWA 1B14A 1OXKB 4PX2A 3LLMA 1NRWA 3DE2X 3UHPA 4JR2A 5LZ4A 2K7ZA 5JE8A 5IJXA 5EEGA 1JSRA 2EDAA 4GZ3A 2J7KA 4PR0A 4WA8A 1QGDA 2XCRB 4RPGA 1E2UA 3R3ZA 5HMLA 3B3AA 4HDNA 4D97A 3K5PA 3F6PA 1YBVA 4CKBA 4E2FA 4YRRA 3AI3A 1NNLA 2CJWB 3AL2A 3UG6A 1DEHA 4AAYA 5LDDC 5H9VA 3DAFA 3FJYA 4C0XA 1XZAA 1PL8A 2DFPA 3I4LA 1E1QA 2IYQA 3NETA 4RJLA 3RK4A 3MMSA 1V16A 2GTHA 4HQOA 3MILA 4EGAA 4DEVA 3ZGVA 5BSKA 3E7WA 5KKCA 2QG6A 2QTWB 2W0SA 1K7EB 3C4QA 3ZHXA 5EG5A 3ZKWA 4CKEB 3SQXA 3FNRA 3TL6A 4B6QA 2FWAA 2QPTA 1TC2A 2BMAA 2REQB 3GMSA 4MW5A 3TLKA 4MZXA 4JI2B 2YZ2A 2AOUB 2GJ4A 4HAIA 1DJMA 3A6GA 1QIIA 4IDCA 4NJEB 1N57A 1GXSB 1SKBA 3CKYA 2Z98A 1EVQA 1QKKA 2ZIXB 3K3PA 3MOGA 3UBMA 3V4LA 4LVNA 3NHAA 1B3BA 3O1JC 4K9KA 4O2LA 1WD7A 2DGDA 4LYDA 2J4DA 5IVIA 3LU1A 2PDAA 4QYSA 3P7MA 1KQNA 1DO8A 3LYAA 2ILTA 4KIUA 2EGHA 3LPCA 4FEEA 2JI7A 3NC4A 3QVKA 1J49A 1NE7A 3NHMA 4PC1A 5TPZD 3W8DA 3G0CA 4MKIA 2BEVB 1SUFA 4YT5A 1II8A 3C3MA 3COYA 3LGSA 3HCBA 2P8SA 1ZCBA 1JILA 4JP2A 1JWBB 4WN9B 1L7MA 1R4AA 1ZK4A 3QX3A 1RWMA 1GAQA 1WO8A 2PFKA 3L6UA 1HYQA 5BWOA 2REOA 4X6LA 5LZ7A 4E30A 4WCDA 2E0IA 4DREA 1FTWA 3ABQB 1ONSA 1VE7A 4L15A 1YO6A 1RW4A 1V3UA 4B33A 1Q1BA 3CWCA 3EXHC 2AG5A 4AP9A 3UK6A 1V2GA 3LFHA 3OM1A 4MK4A 4KIWA 5JW6A 1V11A 1XMQB 1JU9A 1L4BA 3L43A 1NUUA 5BSUA 1L5KA 3R76A 5I45A 5K8IA 4UBIA 4PGAA 1HO3A 1GRCA 1PEDA 4DNQA 4BGDA 1A5SB 3OZIA 3O93A 5AXDA 2FG6C 3B36A 3NEYA 2QW0X 3JVVA 2X7HA 3KB6A 1DAEA 3LFUA 4EUSA 1JPUA 3HA3A 1GL3A 1PDVA 4RDCA 1D2MA 1L7XA 3D8BA 4QDJA 4YMIA 3PGXA 4DQKA 1VYTA 4R81A 1CVLA 1G8JA 1C9DB 4R3NA 1UP7A 3ZE8A 5BVHA 3ZZUA 4LF7B 4G0ZA 1TDJA 2ID4A 3R44A 1U1EA 1TPYA 4BKOA 2ZJOA 3K92A 1Q6ZA 1ZI8A 1KAMA 1TFUA 1IMJA 4MW6A 1UDBA 4RTLA 5JALA 1K9SA 2IDMA 2ZSJA 3I52A 4OQDA 5K45A 1BJRE 1CR0A 1X39A 2W00A 4NC9A 2XR1A 3GAAA 1J2RA 2C0QA 3DLIA 3VJKA 5JS1A 2O2CA 4PYOA 3TAXA 1JTVA 3KD3A 4G09A 4MCHA 4HLUC 1EDOA 2ZSHA 5EHGA 2OFFA 4A1OA 4D2IA 5H3HA 5CXQA 1AGRA 3LA6A 4UZFA 5F73A 2WSYB 3KUKA 3MTAA 3HN2A 2BTQA 5F51A 5T41A 2HO5A 2VQDA 3PJGA 2FMIA 1NQXA 3K31A 2XOKA 1GG2A 4PRYA 3TWOA 4KYTA 4PHGA 3EX7C 1Z34A 1KOLA 1NVVQ 4GVLA 1US8B 2VJPA 4CEJB 3W7AA 5I6DA 3N2GA 1YKSA 3E9YA 1OROA 1HE8B 2WSLA 2QQEA 4G25A 1KNXA 3EIXA 5LA6B 2D0PB 5TQ0A 4EZEA 1LQTA 2AEEA 2VJAA 4IFIA 2BKLA 3AR6A 2ZIFA 3M9LA 1EBBA 4G5YA 4E3ZA 2I3BA 3G82C 3U60B 3LO5A 1XDGA 3GH3A 4XTRA 1RC8A 5AESA 1ZQ1A 5J4HA 2Y0DA 3IHTA 4HWPA 1INLA 1NDUA 1E1CB 1HLPA 3AINA 1U28C 4AJHA 4BQIA 2WQ7A 2XYVA 1CEEA 1MT0A 1NQ5A 2WVGA 2CJWA 3D0KA 5AW1A 3DT8A 3L05A 1QHSA 4HDMB 5EIFA 1M33A 1U2PA 2X0KA 3FDIA 3GGDA 1VYVA 3RUCA 4UAJA 4EAQA 1UP4A 3BXFA 3DEKA 3EH2A 1UFKA 2ZTHA 5HRUA 3TSYA 2YNMD 5DYGA 5E4TA 5AJZA 1JYEA 1TQDA 4TWZA 1UFQA 2YRXA 4CKEA 4Z4HA 3GGOA 5DHFA 1GTRA 1EX7A 1ZJZA 2FW6A 2REQA 2NO9A 3Q8MA 1XA4A 1JYFA 5LC1A 3KPWA 2AOUA 3JASA 3EOBI 5AHOA 3P9CA 5C34B 3T3NA 3CUUA 4NJEA 2G1AA 3T3DA 1OGJA 1FSSA 1GXSA 3H5RA 1QLWA 2ZIXA 2Y0EA 2HEGA 4ZO8A 3CPEA 2WTEA 5JOQA 1FX0B 3NORA 1YNSA 3G6WA 2HWKA 4P92A 4AMBA 1CR2A 5LDHA 4YJ3A 1QO7A 4UU1A 1L3CA 3PXAA 4NESA 5GJBA 2YWFA 1UEJA 4CI0B 1DMSA 2JH9A 4PINA 5I47A 5DCLA 4HXEB 1XLVA 3R9WA 5ICMA 2BEVA 1QHYA 9ABPA 1I1QB 2Z57A 4RQAA 3ILSA 4IWNA 5TJ9A 1LC0A 4UBNA 1YXMA 4DJFC 1FU8A 2A9QA 5HFNA 1P1RA 2KYRA 2XKJE 2QL9A 3HKDB 3MVEA 4WN9A 5JO9A 1UBGA 1Y4UA 4F4CA 5GZ1A 4KZPA 2GN0A 4G9BA 1DJQA 1IBLB 3QBTA 1H2EA 3RRFA 5HDQA 2GF9A 3QYPA 1WXIA 2F59A 1L8XA 4GQIA 2QMQA 1I2CA 2R1TB 3FPLA 2I4TA 2YHBA 1PJLA 2WJ6A 3LBIA 4J6EA 3TNFA 4C20A 5L9AA 1Q0TA 2PUCA 5D1HA 1LJUA 3V2IA 1P4JA 5CLLA 4ASUD 2HXSA 3Q5GA 3IT2A 3R8CA 1D07A 3DV2A 3NUZA 1WDKA 2XIQA 3R6LA 1D1QA 2B6NA 2GHIA 3I6IA 2QT9A 4BQRA 4B3BA 4AO8A 3D7MA 1GKYA 5JHHB 3KSAC 3CLUC 1U2EA 4HNTA 1XMIA 3RYHB 4Z0NA 2CJPA 1WY5A 2ZUWA 1EWTA 5AM5A 4B9EA 3G0IA 4D57A 5JARA 2FMTA 1LGYA 3KVOA 2PGIA 4FZJA 4Z1MD 1DKPA 5K8CA 4TWRA 4MA5A 1O0CA 5FAXA 3G8AA 4RZIA 3O26A 4XGIA 1KVQA 3ETDA 2OHHA 5CVCA 3UANA 2B1QA 1GNVA 3V1TC 4NBWA 1JZSA 1RKBA 2F90A 4ZVRA 3THXB 1E5QA 4BRWA 5LIRA 4DTIA 2PZ8A 3PR1A 4EWLA 1CHDA 5E3HA 1BA3A 1XRRA 3A6PC 4PLPA 1NVFA 3KC2A 4YBZA 2C4VA 2NXEA 4JBWA 4EM6A 3P2YA 2B61A 1IB6A 1O3YA 2IYNA 2FPPB 1YVRA 2K2WA 4H7IA 4QUIA 3S4YA 5K7SA 1QNFA 1Z8NA 4WFKA 3WKAA 5CB8A 3K9WA 2L17A 4TTIA 4LZPA 1XWFA 1TE2A 3LPMA 3NTUA 2YXDA 1FFSA 4JIMA 3U13A 5AKXA 2IUTA 2E7ZA 3D4PA 2JKYA 5DBEX 1RR6A 4PSAA 4IF6A 3U4AA 2AI1A 1P0CA 4A2CA 5KYNA 1C81A 1N5KA 2IY8A 2H1CA 3IR5A 3ZWXA 3KKLA 4CETA 4FKZA 4PTZA 1E58A 1H0KA 1FSGA 3R7FA 3EZ7A 1US8A 4WY8A 4CEJA 5E2BA 1L5GB 5L53A 1HNXB 5LA6A 2Z3VA 4CTJA 2O0LA 5E6SB 4X45A 1J9ZA 1Z5VA 2M2IA 3M5CA 3R0IA 4QREA 1OJ7A 2L18A 4ZOEA 2R8BA 4I2VA 1IQ0A 1TQ2A 3ESXA 3LXMA 4Q9HA 2P3QA 4AROA 1ORHA 3IXMA 5B2FA 1E1CA 5LQSA 3QSYA 1DC3A 1Q7BA 4QO7A 3VNVA 2CE2X 5A4DA 2QE7A 1Y3DE 4HDMA 1ZGJA 3DD1A 5CITA 4F12A 4AL4A 3HU2A 1L4MA 1MOQA 4BNIA 5LPNA 5TMEA 3SIPA 2HBRA 4YFVA 5K09A 2C4MA 1R8YA 2YIVX 4DQDA 221PA 3GX1A 3HDYA 4NENA 2HT6A 2ZBPA 2C2BA 2F17A 3BGWA 1DSSG 4RD1A 4QUAA 2E49A 1D9XA 3GJ0A 3RSHA 1C29B 1CIPA 1LUAA 4X20B 1Z2CA 2O0JA 3D6AA 3ORQA 3QWAA 4IUCS 3RSQA 2MYTA 1HDYA 3NDIA 4Z2YA 3SEFA 4YAFA 5G3YA 1Q2UA 3PPWA 4HLUA 4BKQA 4ZN6A 4X62B 2DPGA 1MTZA 1NW4A 2X5NA 3H75A 2DXIA 2H9AA 1FX0A 2F6RA 1C3OB 1SVNA 3R0QA 1VLLA 2PGLA 3EVFA 2YQ4A