3RHTA

Crystal structure of type 1 glutamine amidotransferase (gatase1)-like protein from planctomyces limnophilus
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
252
structure length
252
Chain Sequence
b'RVLYCGDTSLETAAGYLAGLMTSWQWEFDYIPSHVGLDVGELLAKQDLVILSDYPAERMTAQAIDQLVTMVKAGCGLVMLGGWESYHGLGGNWDQTLLAEVLPVDIKSADDRINFDQPTLAIPAAINSVSHPILQNLPWEDRPPTIGGLNRIAAKAKAQTLLMARVWRPTFSLEHGKTTWEHADHHPLLVVGEAGTGRVAAFASDVAPHWVGGLVDWGDERVTSQAPGAGAIEVGNLYSQFFRQMLEWVAKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (GATase1)-like protein
publication title Crystal structure of type 1 glutamine amidotransferase (GATase1)-like protein from Planctomyces limnophilus
rcsb
source organism Planctomyces limnophilus
molecule tags Structural genomics, unknown function
total genus 65
structure length 252
sequence length 252
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07090 GATase1_like Putative glutamine amidotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rhtA00
4JQSA 4ZDIA 5BV2P 1KWKA 2RK6A 3PQ4A 4GE3A 3RHTA 1QF7A 3TQIA 3TTUA 5LIRA 3TTXA 1PDWA 1R9GA 1BXRB 4I2NA 2YWDA 3UJNA 4OGGA 2GK3A 3OT1B 2V4UA 3CZAA 2YWJA 4LRUA 4MTCA 3WFZA 1G2IA 5K4AA 1J42A 2ABWA 4L78A 4UOQA 3CNEA 1UCFA 3UOWA 4ZDJA 1GGJA 1VCMA 2W7TA 2WJZB 1K9VF 4BFLA 2A9VA 1I1QB 2NV0A 2R1UA 3NONA 4AUEA 1OY1A 1JDBC 2R1TB 1IZYA 3EJ6A 3B36A 1KXJA 2ISSD 4L8YA 4UZSA 1SY7A 4OJYA 3R74A 4B31A 1I7QB 3NORA 3R75A 1KEEB 4ZGGA 3L7NA 3GRAA 1QVZA 3EN0A 1L9XA 2VKTA 4ZDKA 1Q7RA 2YWBA 2ZUVA 3BHNA 3SF8A 1T36B 2ZUUA 1OX4A 2VXOA 5IP5A 3CYFA 1A9XB 1WL8A 4R7GA 4GUDA 4UOZA 1CF9A 4QYTA 3ER6A 3L18A 1I7SB 4OQ4A 4ENWA 3TTTA 4N0MA 3TTWA 3UMMA 2AB0A 2VRNA 4BTEA 3CZ9A 2VPIA 4P5PA 3EFEA 5E9AA 1OX6A 4B40A 2ZUWA 3B3AA 4L95C 4LGYA 1OX5A 3TTVA 3ZJ5A 1S1MA 4GE0A 1CS0B 3N7TA 3PQ2A 3M3PA 3P9RA 4L8WB 4P35A 1GG9A 4ENUA 4WINA 3OT1A 3NOQA 2AD5A 3EWNA 4AJ9A 1T0BA 4ENQA 3TTSA 3L4EA 2YWCA 1KA9H 1VHQA 4Y0NA 2R1VB 4MNTA 1N57A 4Y1RB 4P34A 4BIMA 2IUFA 3CY6A 1U9CA 2D7JA 1O1YA 4Y1FA 5SY4A 4WXYB 4MGHA 2R1TA 4E5VA 4Y1EA 1JVNA 1PE0A 5SY9A 3NOOA 4RKYA 3PQ5A 1P7YA 1GGKA 4HCJA 3SOZA 2XF2A 4AUNA 4B7AA 3PQ6A 4N12A 4UCFA 5SY6A 1GGHA 3PQ8A 1OI4A 4UNIA 5JZMA 1ONSA 2LXNA 1FY2A 3P9SA 4ENSA 2NV2B 1P80A 4PXYA 5DFAA 2RK4A 1GGFA 4S0ZA 3KKLA 3NVAA 4OFWA 4RKWA 1CE8B 2VDJA 4ENRA 1T3TA 3P9PA 1IZZA 4B5KA 3PQ3A 3ZR4B 1P5FA 1PV2A 2RK3A 3BWEA 4P36A 4I4NA 4XLLA 4B2YA 1C30B 1QVVA 4QYXA 4D1YA 5JZOA 3UGJA 2FEXA 3P9QA 4L8FA 1IPHA 1GGEA 3TTYA 4AUMA 2GHRA 1P81A 3L3BA 4L7QA 2H2WA 3FSEA 3D54D 1SOAA 4K2HA 4ADSG 1VCNA 3B38A 1GPMA 2R1VA 2ZUSA 3EZGA 3MGKA 3MIIA 4I46A 4Y1RA 3VU3A 4ENTA 1Q2UA 1QVWA 3F71A 1FYEA 4P2GA 3SF8B 4E08A 2ZUTA 1OX4B 3PQ7A 4OIFA 4ENPA 1QDLB 1C3OB 3UK7A 1GPWB 1PDVA 1VCOA 1QWSA 3FIJA 4OGFA 1KWGA 1P7ZA 2OR3A 3F5DA 1M6VB 4Y1GA 3R76A 3NOVA 4AULA 4ENVA 3ZJ4A 5SYAA
chains in the Genus database with same CATH superfamily
1B7GO 2I71A 1TQ6A 2OO7A 2W00A 3MSCA 3O90A 2A9JA 3G89A 4IDNA 2J0UA 3TSWA 1X15A 3I2KA 2TS1A 1KFEB 1CY7A 3A4IA 1WXEA 2AWNA 4HDKB 5MN6A 4HWOA 3OMWA 1NWHA 4LZJA 3DNMA 3VR6H 4BFWA 2YDXA 5M29A 3W2HA 4IIXA 4KJXA 5CBPA 1DB3A 2X7XA 3EVTA 3AUSA 1M6HA 5KKCA 2ZZMA 3MPOA 3M5PA 3U60B 2A3NA 4EMBA 1I9CA 1Y8CA 3EDRA 3NDPA 1BHO1 4K3UA 4CEIB 5BR1A 1FP6A 3A1CA 3IJ5A 4OY3A 3Q10A 4AG6A 1IE3A 2MMGA 3GZNB 4I9GA 4FONA 4BGEA 5A9SB 3KKMA 2C8KA 2JLQA 7ADHA 3DTNA 4RS4A 5K01A 5AP9A 3WC4A 4I5EA 1CY6A 5C7IO 2YVUA 3IA2A 2GEJA 4LTDA 3D1JA 4JJAA 4WCDA 3NG1A 4LOJA 4JKIA 2WT4A 1TMYA 4TV8A 1YRLA 2VQDA 3KQHA 1DRWA 3NAZA 1DP4A 2JAPA 2ZQ5A 3E15A 3I23A 4J76A 3G5MA 1B8OA 3A14A 5GP1A 5JO0A 5K8LA 4G5RA 2WWTA 3ER6A 5CYFA 2ZE6A 2BZ0A 3AYXB 4OYRA 3FOBA 1QK3A 1SVMA 2BM9A 3KJXA 1RVV1 4LJAA 5ENVA 2WTXA 2C1EA 3MTQA 5B36A 3ZGVA 3N5CA 4BS9A 5JQGA 3AM1A 5K8IA 1PLLA 1SVLA 2FSVC 2W2KA 1JDVA 1MDBA 4JHLA 4MUFA 3ZZ0A 3GFFA 4TXJA 1TTQB 5CG2A 4BVGA 8LDHA 1ZN7A 2G36A 1F17A 1XJCA 3LX6A 5E7QA 1V7QA 2QW0X 3FW1A 2QSUA 2I6QA 3H04A 2E4XA 4FILA 1NJFA 4PIVA 5FWNA 3KQYA 3BWYA 1JZTA 3KLPX 4GVXA 4IOJA 4D9HA 4JIGA 3R7FA 1P73A 1Y5NA 5IT5A 1ZEMA 4BNDB 5G0SA 1XV5A 3VKVA 4AI6A 1J21A 1I4LD 4PAMA 4JC8A 4DUPA 2MSDB 2XUJA 1Y42X 4GBMA 4GOJA 4RD1A 4S2UA 4W1SA 1AK1A 4ZVLA 1T8RA 2DLDA 1H0KA 4ENSA 3TOCA 4UQPA 4DV5B 3TUJC 5KHLB 1W96A 3EG9A 2FPGB 1S4MA 3PWZA 4RPKA 5L4SA 4R6XA 1D4OA 2RH8A 4LMBA 1PL8A 4BEVA 1QYWA 3VNVA 3X44A 1LW6E 4TLCA 2FR1A 1QCCA 4KQHA 5DV9A 2J87A 3VU9B 4J4BA 1GVHA 1MQAA 4JJFA 1GCGA 3AFIA 4JQOA 4G5GA 1IHOA 2DSNA 3ZQUA 3TUIC 2VNHA 4PZEA 3HJFA 1AU9A 4L8FA 3QK7A 4OXYA 5FOQA 1FJGB 1MENA 2WB4A 3C3YA 1UQRA 1S8AA 4WJKB 1ZNWA 5AM5A 2WKQA 3E18A 4JEMA 4CR7A 3GP5A 3D54D 3ZNNA 1SU4A 1JBKA 4RTKA 4XIFA 3L6OO 2LD4A 1SURA 1CQJA 4XR9A 2OQVA 4DL9A 3GLIA 3I4FA 2P2DA 3GGDA 3KZMA 2VK8A 3P5SA 4LOHA 1RPZA 5EWJA 1PK7A 4S05A 1NOIA 1II0A 2JZCA 1Q3HA 4G4GA 4FCWA 4J1SA 2XNKA 1MA3A 2HEGA 3STVA 2UYHA 3G2LA 1RQXA 4XCXA 4J3JA 2YYZA 1GCIA 3FWNA 5GZ1A 5JBQA 3ZWYA 3M5DA 1QVAA 2O3JA 2Z83A 2I7DA 3BC1A 1M2NA 3CEHA 3AR9A 3A70A 2WP0A 2GXQA 3C14C 3MNFA 2IYNA 3JVUA 1KRWA 3JPYA 1J42A 2ZOSA 5BOSB 1AGPA 1D6MA 4F1JA 1P1BA 2FHPA 1GNQA 5FTNA 3ES9A 4PCUA 1M2WA 3BMCA 2C9YA 4UTXA 1A4XA 1T5LA 2CVQA 5TJ9A 1GRNA 3ZCQA 2C92A 2Z2IA 3L4JA 1QANA 2VXCA 1AHIA 3Q3GE 1EFUA 1F2DA 1QB8A 2GK7A 3EXAA 3O0DA 4NBUA 4RABA 1LSUA 5IFLA 3UGTA 4INAA 3FHTA 1VA4A 5K3SA 1Z35A 3M0EA 2YBDA 2VYVD 4CLOB 1ZXBA 5LUAA 3VJLA 2YMQA 5HIKA 1Q7RA 3IPCA 4BV3A 3BMNA 1B74A 3WK4A 4DSNA 1QIFA 2ZUUA 1TO1E 4P98A 5CW1A 1H9AA 1MRNA 1ZL0A 4RWEA 1ZAYA 1WW3A 2EX1A 4RGQA 4Q66C 5E6SA 1FNMA 3O8OA 2E89A 2OORA 3TL3A 3ZOKA 1G0NA 2VQSA 1IBSA 3TECE 2XMCA 3LGAA 2I5PO 1NQVA 3CZ5A 3GR6A 4TKUB 5BW5A 2G0NA 4RETA 3P27A 2O6LA 4QDTA 3KOOA 2HSDA 2WR8A 2RJ3A 4K6KA 3PFWO 3OZRA 1NLUA 2VHUA 2QLNA 2WFAA 1PNVA 2OQIA 3OWHA 5IJ9B 2Z8YA 5DCYA 1N2SA 4EHKA 2JPDA 4NRDA 2XQIA 2ZU6A 1SCAA 4CFYA 1G9TA 5ALVA 2QX9A 4KQJA 2QZPA 4CMGA 2C0QA 5AXCA 1SK8A 1OU0A 4IX1A 1Z6AA 2AR0A 2G4CA 4JUFA 3UAOA 1WAMA 3FI9A 4MQBA 2ZQYA 3VH4A 2MSWA 3AINA 4AUNA 4H3KB 2EZ9A 4G26A 4WX2B 3W5SA 2D2FA 2HA3A 4JVLA 2WMOB 1AS2A 1P1CA 1RQPA 2OV2A 4M0FA 2C1ZA 1RI2A 2PLNA 1PX2A 1Z6PA 5TGTA 2GBLC 1F51E 1NM5C 1A9XA 4S24A 3QW2A 1VGVA 1T43A 2NXEA 4NQZA 4QHSA 4LHWA 4UAGA 5CGQB 2BEWA 2YIJA 2EZ8A 4UQLA 3AR2A 1U7DA 3I6ZA 1LBSA 4C4TA 4RA9B 2GHTA 4U7HA 1E60A 1T9CA 1NXTA 4Y7DA 4B8YA 3HXTA 4HQ6A 3T7JA 1SU6A 4NCIA 4EPTA 2JLBA 1FXWF 1E1LA 1YIAA 4Q3CA 5LQDA 3HY3A 4C76A 4DW8A 5GIPE 3UMYA 5A5EA 1YJXA 4HXEB 1ECPA 2CVZA 2F00A 4FR2A 5AM4A 2PZ8A 4NDNE 3VTZA 1Y4ZA 1Z0AA 4A0RA 3LSTA 3WB1A 4RIIA 4PGGA 3CIFA 1PGOA 3DVAB 4TVBA 5AKJA 5E2AA 1NQAO 2X9GA 1A4IA 1WUIS 1QYDA 2Q9UA 3BIWA 1Y9ZA 1UODA 3H4VA 5ELLA 2VNIA 1L8OA 1SHKA 1QWSA 3N7UA 4II7A 4ZC8A 1EIZA 4QDUA 3RFTA 2A88A 3HG7A 2ONKA 3FMGA 4M9CA 4U2CA 4YPFA 1MC5A 4IJUA 4P54A 4R2KA 1EYZA 3MMZA 4YBZA 1FEZA 1J09A 4EPVA 6AT1A 3IAS1 2O2JA 1GYRA 3TTUA 1SXQA 3H9BA 4GL2A 1N8TA 2HMVA 2RB4A 2ZYHA 1R5JA 5A4JA 2P2LA 1LBQA 2O3SA 1VPTA 3M33A 4BGIA 1WSDA 3NDBB 1G2IA 3BS4A 4JIMA 5IYZB 4PINA 2GTPA 5E7MA 1JKMA 3N0RA 1M34A 2VG8A 4I7EA 4MUXA 5ALPA 2E55A 2WKPA 3ZJTA 2NMVA 4DBVO 1SC9A 2BYTA 1I30A 1LNQA 4UVHA 2BTQB 4L8YA 3BQMB 3B7GA 2BFEB 2O3TA 1UBOS 3C5CA 3EZNA 3PJGA 3D3EA 4U5XA 5F3RA 2D5AA 4WTOA 5IU6A 4DJJA 3H7AA 1G3RA 1G6OA 2EBUA 2WSBA 2WYUA 3D64A 3FNQA 3KE9A 1FLAA 3L0YA 2EHDA 2R6JA 5FFMA 2E18A 3DBHA 1YRWA 2YS7A 3ZCTA 3C1UA 2Q62A 1G5QA 3B78A 4U2GA 5EZYA 1JXAA 2QR5A 3TXXA 5FBVB 5EKTA 3MUNA 2FCAA 1Q1BA 2BHRA 1IAVA 2GAFA 3FCXA 2VOJA 4G97A 4ZVRA 4EIWA 2FMFA 4L3WA 5EIAA 5IVHA 3P2EA 3H13A 5IXYA 2P0EA 4O1IA 3VPGA 4PPQA 3AHJA 1KZ1A 2B21A 4KXXA 4DCMA 3ZLJA 5JD4A 4D8WA 4G6ZA 4YUZA 3T5TA 5CDGA 1G59A 2VDRB 4AMYA 2EC5A 3I30X 4CG0A 1LVGA 4AB1A 3CRQA 4GF5A 2VYVA 5BNWA 4K2AA 2NXWA 3KC2A 5FULA 1DTSA 3D3WB 2XCRB 1JDUA 1PTKA 1U7WA 2C94A 3E8SA 5K4HA 1A8IA 4Z3KA 1A82A 2D7JA 2QTAA 3G0CA 3MZ0A 3JQRA 2XCTB 1J20A 4N41A 3I53A 3NWEA 4C0JA 3ENKA 2VUHB 1F3LA 4LZPA 1NBWB 3FWZA 4MP8A 1V16A 4N5DA 2GF9A 2JS7A 4EUFA 4JLSA 3EAFA 1RDFA 1NC3A 1TNDA 3DLTA 2JC3A 4WBNF 1QQAA 4WOPA 3EEOA 3UQYS 3BMQA 1K5GA 1ONSA 4PYLA 5T4FA 1RIFA 4ALJA 4KWCA 1NW8A 4E2WA 1JSRA 3SC3A 3VJRA 2YCBA 3QPUA 4CI0B 4X61A 3ZGYA 2MINA 1IONA 5C7LO 3UT5A 2HA5A 1HL3A 1WUTA 4FIZA 3SJZA 1R0SA 1H1LA 2SKDA 1XBTA 2V98A 4JXXA 4PSUA 4UHKA 4CBVA 3JV7A 4HVAA 5DGIA 3ROMA 3U1TA 1KZ4A 4X1YA 2RHDA 3IV6A 2VIIA 3AP1A 1JPUA 4FSXA 1S01A 3TDNA 3KPYA 2ZIXB 3T34A 4BMSA 2I2WA 3HEBA 5EZ6B 2X4IA 2XD9A 5BN5B 4GLBA 2VUIB 3F4BA 5ILGA 2PA0A 4RTRA 1PT8A 3MGKA 3FCOA 1CRLA 1ZM2A 3RBVA 1NJGA 4WVLA 1FYEA 3PNMA 1V8OA 3V55A 1FS6A 5IAOA 1HQDA 1HSZA 1ZO8A 4Y2UA 4ZT7A 2B35A 4C0LA 4CM9D 4M36A 4OI4A 4DC9A 3ICPA 3R0VA 3FTQA 3KYDB 3S0JA 4LF6B 4Q03A 3IKVA 5FCDA 1X80A 2VSNA 1T8YA 1FDOA 3I42A 2VJPA 4WN9A 1FFGA 4G81A 1OH8A 5B2ZA 4JQSA 2X3FA 2O8FB 5BVGA 3GEBA 5EAIA 1U2GC 4IW3B 4R7ZA 9ABPA 2OGWA 1FZQA 3RR2A 5CDFE 2JHAA 5DCUA 1B3RA 3WDKA 1XXHA 1KK0A 3KJFA 3PXEA 4HRYA 4QTTB 5EG5A 3G1TA 4CM4A 5K3EA 2OOSA 5B12A 4JB8A 1AK2A 2WM3A 3DAGA 3OIWA 4NHEA 4IQ4A 5IDYA 5CTJA 1FJXA 4R1TA 1YBVA 4MR8B 2JHCA 4MPDA 4R68A 4Q9LA 3T7RA 4BFLA 1QHEA 5LL6P 1GDTA 4MP6A 5H70A 2PFKA 5AHKA 4YREA 5EXEA 1FXSA 3UANA 5JSFA 3CLRD 2PO5A 2R1TB 3AR3A 3HDVA 4DIDA 3NH9A 1NN5A 4EHBA 1JYSA 2W8BB 3KZVA 5JZ9A 1TECE 1ICIA 2QUBA 3B6MA 4YRFA 5BN1A 3LUDA 4KQGA 1V7PC 2NTJA 3A4NA 4D0GA 3N2KB 3DF7A 4OXXA 1DWPA 4RX1A 3NWOA 2IGBA 1XTTA 3VZBA 3IEIA 1L8AA 2F1JA 4MOWA 1L9KA 4NE2A 1OXSC 3NCTA 1T9AA 2B1IA 3HDJA 4B7ZA 3H11A 3B52X 4MLZA 4O3FA 4RVHA 5BWBA 2OMKA 1P9WA 4A8JB 1L5ZA 1T6NA 3PR3A 3QJ5A 3R23A 1UPXA 2V9ZA 3LO8A 2QBYB 3I62A 3PF9A 4D02A 1G1MA 1ZGZA 2EU8A 1TFRA 4QOHA 3E1KA 3SDZA 3D43A 1BH6A 4JQYA 3Q40A 4REQA 3VOSA 5BPFA 4NDAA 3RRMA 4H27A 4DQDA 4ENQA 2V58A 4CR6A 4OJQA 1T35A 1GU7A 5GQSA 2PKYX 1CLEA 3L7IA 1UDRA 4K9DA 3D9QX 1BA2A 3E3OA 1PS0A 1K75A 2WWRA 5CA0B 3IJEB 1VGRA 4GPTA 4MRAA 2W48A 3HVRA 4C30A 4UHBA 4JB0A 2G0TA 3ILHA 3NBAA 3KOYA 1J70A 1DOAA 1ZRMA 3HKBA 3I6QA 3KD2A 3L46A 1RQNA 3MRSA 4LSWA 4AKSA 4KQEA 2EP5A 4DWJA 3WQSB 3IBSA 2VTDA 3PTAA 1M10A 3MB8A 2O0KA 1PNTA 5DOVA 1RPAA 5JALA 2OC9A 3K1AA 4PX3A 3A6HA 1QRAA 2QB5A 4IQGA 5ES3A 8OHMA 2QXUA 4ZOLA 3ZDFA 2VCHA 3F6CA 4LYFA 3FWHA 4ZZ1A 4FWBA 3K9QO 4A6EA 2EGGA 2FCRA 4G25A 3DL0A 2H51A 3QVSA 2IS2A 2GBIA 3IBTA 1JIQA 2R5FA 2X0JA 3M1IA 4EABA 2DFTA 2AQHA 3OCXA 6REQA 2WI8A 1PLJA 3D0QA 1JKJA 1T2VA 2P3LA 2ZSBA 4YQYA 2TMYA 1R4AA 4XW2A 4F46A 1XK7A 2RGNC 2GR9A 5I9MA 1U28A 1YZFA 4EARA 1BMFA 4YUWA 3G0DA 4Q02A 4N03A 1XDDA 2HPVA 1EZ4A 3HRKA 4GX0A 4QQRA 3O9MA 2CV0A 3HCOA 1G17A 2NGRA 2JGDB 1KVSA 2VJMA 2ZBUA 5A4KA 5AVSA 2OVBA 2ZUSA 1V25A 2FMXA 3NKFA 3K9BA 2PRJA 5HYVA 5L53A 1X38A 1B3BA 2I4NA 3HP7A 1INLA 4II2A 4RHEA 3VVBA 4B3DA 4D25A 3R9WA 4HEJA 4BO4A 4JLMA 3KWFA 3HJRA 4YJFA 5LYJA 3A7DA 5JASA 3OA0A 1RKBA 3JZAA 2WVHA 2ZIGA 3N8NA 3WISA 4ND4A 4LRTB 4HH1A 2QRMA 1DX4A 1RAIA 2KM1A 3RPEA 5BN3B 2AX4A 3SXJA 1OLSB 1KI3A 1M5UA 1ICEA 4ND7A 4UNPA 2G63A 3L0SA 4ZAYA 1P2FA 1E0SA 3NATA 3OQHA 5FBQB 3STXA 2HDHA 2XT6A 1E4YA 3QEOA 2YOFA 4K40A 4C04A 2N1MA 4DZTA 1A95A 4Q24A 3I2HA 1IL0A 2ZJ7A 3EEFA 1BNCA 5CNKA 3FUUA 4S1NA 1K9VF 2BI4A 2CZQA 1N4AA 5EHXA 4QO7A 2XEDA 3LT5A 5CA1A 1FFDA 4GKVA 4CFZA 4HDOB 1QE0A 4B31A 1Z0JA 3N6RA 4PG5A 2WF5A 2Y9PB 4FDVA 1J8DA 2ADFA 5FOWA 3LYAA 4NAVA 1F2TB 2NO0A 1EFPA 4MUYA 4MMYB 4QT4A 1GU0A 3GAMA 2PGLA 4NK5A 4XX0A 1U3GA 2IHKA 1Y8QA 5E4JA 1X7XA 2O23A 3OPVA 1IXSB 1PVDA 1VMKA 3N8IA 2IHTA 2P6MA 5L4NA 1QM5A 2WD8A 1U9IA 3MGCA 3Q12A 4MJ7A 4AD8A 3BXOA 4G1MB 4XAQA 2XDYA 1QH0A 3JVDA 4QYTA 4RYLA 5EMMA 5K3AA 4JEUA 4MEAA 3HSYA 1X1DA 1X94A 2CHFA 3GUVA 1OVGA 2UYGA 4CV0A 4LSMA 4NZPA 2XZPA 1B41A 1FSSA 4MEBA 4B40A 4EDHA 1J9ZA 1KAGA 2MOKA 5GONF 3GQBA 3D6NB 2XCQA 1VJRA 2OHFA 2WJAA 1XG5A 4WXHA 1C3EA 3NOXA 2XJ9A 1B14A 1B0UA 2OQRA 1SWVA 3OTQA 2B8NA 1G5TA 5C1IA 3THOA 4UE6A 1N6LA 5HQJA 1T26A 5BT9A 2HQOA 3UK6A 2R66A 3K32A 1AF7A 5B7PA 5LNK6 1JLHA 1MAHA 1Y7HA 3NBYC 5BSVA 3D6MA 2IUFA 3VC3A 2BFPA 3VU0A 2CF6A 3A1UA 2GJ8A 1V5EA 3VXKA 3QGMA 1XLWA 4P0QB 3QVXA 2CL7X 2PBRA 4COOA 4CJXA 5FNVF 4FJ1A 1AGYA 4U1RA 1POXA 1TIPA 3KXPA 3B13B 3PV0A 2CF5A 4X9XA 3LL4A 1PFYA 3NJRA 2GEBA 5JXWA 3VZPA 5IYZF 3KV1A 3NXKA 1N3BA 2VH1A 4QBGB 1KQFA 3KYJB 3K9FC 4DA4A 1OLUB 1OUMA 1WKVA 1ABFA 2JLYA 3OKFA 4ZI2A 4UXIA 3LCVB 1QH1B 3UK1A 4H6VA 4JEIA 4HAOA 5YASA 3ZD6A 4WNYA 3DCNA 1HTWA 3UNXA 2WY2D 3DPIA 3DWFA 1C9JA 3KT3A 1QORA 1P1IA 1VPVA 1JG3A 3WYEA 1L7NA 5AI8A 1CS0A 4DKJA 3BX1A 1L5NA 3Q2KA 1NXXA 4FHCA 4E15A 1GADO 1KR5A 2A35A 3PTLA 4WKBA 3ZI7A 3S8EA 1BW9B 1JG4A 2OBYA 4TWBA 3LW7A 3DZKA 4OJNA 3K9WA 2BHNA 2RGXA 4MV7A 3RS7A 1K89A 3JZFA 3KJHA 1FTQA 3IB3A 4I46A 3QSYA 3GNTA 4IOKA 5GM2A 1HZZC 4KTTE 5KYGA 3SF8B 3U7HB 2BFBB 4K9QA 2GASA 3WRYA 3U5TA 2VHXA 1CRQA 2OAGA 4BKUA 5HJ7A 4H7JA 3DTTA 2JIDA 1YUNA 3T3NA 3WZ2A 2G72A 1PGPA 3C8UA 3L0OA 1LSSA 3H5NA 3OTHA 2AQKA 4Z2AA 5AKXA 1FBNA 1VIAA 2KWIA 3S2EA 1OXMA 1QC5A 3O93A 4QU9A 4KYTA 5I48A 4BX3A 4UHFA 4LXQA 4QXPA 1O6GA 1EVLA 3F73A 4HPWA 4LXUA 2YWJA 4TXLA 5EI5A 5CT8A 3WWDA 2NLOA 4G56A 1TVMA 2O6HA 3REQA 1KNXA 1Z0FA 3C6BA 1TZKA 2VEOA 1S1CA 5ADVA 5A05A 5CFPA 1I2AA 2XVAA 1B76A 2HQ1A 1KEUA 3DLCA 3LWDA 3RDPA 1T1IA 4LYEA 2XRZA 3TZLA 4S2EA 4F4CA 5JCPA 5PGMA 5KOJB 1SHTX 4XLZA 1LV8A 1Z37A 1LLUA 4FQ7A 3KKQA 1X74A 2P2CA 4O63O 4GBGA 4PZYA 5C3MA 1A98A 1BFDA 1MW8X 4MI9A 3VDNB 1R8YA 3DT8A 1KOJA 1TZMA 3EDCA 2NADA 5I3ZA 3NMUF 1JTEA 2CV2A 1CUZA 4A26A 1T8WA 3A2MA 3CRW1 4FN5A 4WZBB 2OCGA 4ZOCA 3G1WA 3S2UA 1K63A 4D3YA 2I1VB 2YXLA 2COEA 5AJXA 1M5RA 5LWQA 5CIYA 4HADA 4L7VA 5F98A 2CWWA 4KO8A 1XDGA 4UEQA 1I1OA 2O1SA 2JANA 4F5EA 1XTKA 4DV3B 4FX2A 4XVQA 1XTQA 2QN7A 2RONA 1SUBA 5D51S 5DCLA 5DP1A 2P9JA 4B48A 2X0NA 4A1FA 4C7OA 4AY4A 2RHCA 3WS7A 1U3DA 3LRXA 2PL5A 4DUGD 4WE3A 1UPAA 3LXXA 4K9MA 1KYXA 1T0IA 3L4EA 4FFWA 3LC1O 3S99A 1WZCA 3TMKA 1I6LA 2QI9F 3LQFA 4Q3OA 4BCBA 4Z0NA 3I28A 5KOHB 5JQWA 1SEPA 4GBED 1ZW6A 2Q46A 3R44A 3AWDA 4JT2A 1UKVY 1F3OA 4BVKA 2NU7B 2Y1GA 3AUFA 4YDHB 4D45A 3FKSD 2CDNA 4GYJA 4X8LA 2DWCA 4OQXA 2BPOA 1XCLA 2O2CA 2C0CA 3LTEA 3P2JA 1CUFA 1P2DA 1L4HA 3DMTC 3HMQA 3UJ9A 1G38A 2CFTA 1FUIA 2P5UA 1IPFA 1X1CA 1KL7A 4OHOA 2FETA 4B8ZA 1J24A 4LJKA 1G42A 4U9HS 1D4AA 1MX3A 3CXRA 2FN3A 3EASA 1YZYA 1U9ZA 3RUHA 5K0CA 3WGYA 1HDRA 3NWPA 1ZSYA 4Q3DA 3ANSA 5LQJA 4GR9A 5G40A 4QYXA 2GZSA 1NG9A 1J0AA 1UKZA 3NV9A 1YMVA 1GGEA 4L6CA 5JWHA 1I7NA 1JEQB 1H6AA 1OZAA 2ZFUA 4BNLA 2MR6A 3EXG1 3P19A 4NONA 3WE7A 1AQNA 4MVWA 2ZT6A 4IFEA 4L08A 5MDHA 3NC4A 3HJTA 1X9HA 4WOBA 5LA6A 4N5HX 2ZT7A 3UPDA 2REQA 5FXMA 3QU9A 4HYTA 5GGXA 1Z33A 3VYUB 1QIHA 1C0PA 1D09A 2D1RA 3MAJA 1Q7TA 4DLNA 4OA5A 3C3CA 2Y92A 4YCNA 2FGKA 3A31A 4IL5A 2O7NA 5F4ZA 2B8TA 2GKSA 1SVUA 1CJKC 3IFSA 3OECA 2ATCA 2MDTA 3UHJA 1DCTA 5KYVA 4R3NA 5CXUA 3DVLA 1JI3A 1KQGA 4HEA6 2DPHA 2AFRA 1KWKA 2C3YA 5CEJA 4WXRA 1UDXA 1RI4A 1UBUS 2QL5A 5FUBA 1BMDA 4X24A 4F06A 5FBZA 5JCJD 1U8UA 1ESZA 2ZYDA 3HKEB 1CY8A 2W90A 5A2QA 4EYSA 5CLFA 4H0NA 5CA0F 4KP7A 4M8SA 2HDOA 4HGPA 4DMLA 1IU9A 1KI2A 4AX4A 5CFQA 2NPIA 4MRMA 4WKGA 1W36C 1M2OA 4A7PA 3V3TA 4YUVA 1P7CA 1T5BA 3OIGA 4UUOA 5WRFA 4LV5B 4CKYA 2VDOB 1FDTA 2EJTA 2RHTA 3K0HA 3TR0A 4ZCMA 1Q50A 1Z26A 2F3TA 1H23A 5K0BA 5DISB 3D6VA 1SGWA 5EIXA 2F7SA 3B2QA 4J6EA 4YCMA 1QYXA 3NWJA 4B3HA 4Z5XA 1ND5A 2L42A 2QY6A 2GDJA 2JGMA 1L9XA 3W3AD 3DS8A 3H1AA 1C50A 1R6VA 3OPNA 4P6VF 5EUMA 5FJJA 4AO8A 4OXKA 1I10A 1BQ4A 2PWBA 4HWRA 4MS4B 3RADC 1GL9B 3LX8A 4HVLA 1P61B 2DFPA 3F6BX 1PI3A 1ZH6A 1EVQA 3TBHA 2ZIAA 3T5BA 2QM7A 3GUYA 2AI1A 4CF4A 3NP7A 1S1MA 1P9NA 1CDOA 2HWWA 4DGSA 4NC9A 2MYTA 2IUSA 1IRXA 3EY4A 3RYFB 2GEDA 3IPLA 2JF0A 3DUWA 3JATB 1Z4JA 3KB1A 5C8YB 5CAEA 3PJRA 1E2EA 1JHVA 2UYQA 4OHBA 3R6TA 2WHPB 2Q5EA 2VXBA 2DQZA 3M9XA 4PQYA 1QUFA 2ES4A 1WXFA 2W6CX 3PD7A 3N0TA 4LXXA 3U7QB 2YW2A 3LAWA 2ZE8A 4HPXB 4NEQA 3JQCA 1E3JA 1EEHA 3IAM1 4R3UC 2GZ2A 5E1DA 1WTCA 1NN0A 4BO6A 2F43A 3G5AA 1AUVA 1THMA 3T52A 2AWOA 2H9AA 3IH5A 3QYPA 1Y5MA 1US8B 1P6XA 3FLBA 3VU1A 5I7EA 4URUR 1ZJYA 4ZOBA 2HRBA 1H8ED 5JVDB 1XNQB 2LXNA 4ERNA 3K92A 1MOZA 4U7TB 4DUGA 1O5OA 4IJWA 4IEFB 2Q45A 3GLSA 2NO7A 1F8GA 4BATA 4MHOA 4ID3A 4OL0A 4OFWA 3CF0A 1YFZA 1LQTA 3F9CA 2A92A 1SVNA 4M6WA 1RLOA 1K8YB 1WCYA 2Z3WA 1MO4A 1DG9A 2QR3A 2WF7A 4YONB 3IUBA 1ENPA 4HRVA 1Z83A 4ONEA 4HNQA 2ONZA 1Q1GA 3HHPA 2V7VA 4DV1B 4J8PA 2JFGA 1FXUA 3JRNA 1EG7A 1WUHS 1V3TA 4MKIA 3W04A 4H2DA 3ZEAA 2OO5C 4H9GA 2FWMX 4PWZA 3FKSA 5F2KA 5FWYB 4ZU6X 2ZSEA 4UDOA 4CL3A 1ONNA 4XJTA 3RTEA 4OK3A 1S3SA 3HO6A 4TLDA 3TLMA 3ZE1B 2X3YA 3DL2A 1U2DC 5IANA 5DTIA 5K0EA 3ADBA 1OWLA 1A76A 1P0CA 3FDZB 4KUHA 1LJ8A 3GVPA 3LIIA 4QVGA 1JU3A 1MFPA 4QVIA 3UPUA 2ONYA 2Q6KA 1OMOA 3N6VA 3NIDB 4TT8A 1RRPA 4K6OA 4IICA 5AHXA 2G4LA 2VT3A 4AICA 2G80A 3DKIA 5JV5A 3A6ZA 4YCAA 1LTQA 2D0PB 3RHTA 4F7DA 3D2CA 4N76A 1C4OA 1JIXA 4IGKA 2WWFA 1AKRA 2G17A 1PR0A 1V8FA 3CLSC 3OJFA 3MCZA 1QH9A 1AV6A 3AUAA 1ZUD1 2JK0A 2DCMA 1W4LA 3ESAA 1OHHA 2JLXA 3OWXA 1W59A 1V5IA 1XP8A 4F85A 5ALQA 4LK3A 3E1SA 1YBMA 5DKFA 3I5XA 4MKZA 4XWTA 5F52A 4CQJA 2NYAA 5C8ZA 4E70A 2FHSA 4J0CA 2IPMA 4C89A 2I76A 5IZCC 3B12A 4BGDA 3FR7A 3SXPA 4DANA 1G5FA 1CG6A 3AG6A 1BG6A 3UFXA 5IDVA 4J1NA 4FGUA 2RB5A 4YBRA 2Q3HA 3MG9A 3OZTA 5TEWA 5CB4A 3FN4A 3HACA 1XOIA 1SXGA 1U94A 5JCJA 2IT1A 1FFBA 4KLCA 1D04A 4HNHA 5DIFA 5L45A 3OIDA 1R64A 3N2GA 1KQNA 3T9AA 2FFHA 4DE5A 2Q2WA 2WDPA 3OH8A 3IO3A 4LE0A 3OZGA 1DXOA 2AC7A 1ACJA 1CU1A 2XUHA 4K6HA 4TWAA 3WJ2A 1UJ4A 2BFFB 4YAUA 1ZNQO 1J39A 1MQ8B 3Q3JB 1DX6A 2H4FA 2NO5A 4RCZA 1LXCA 2R6HA 1E9DA 4NTZA 3U2QA 4DC0A 1NBMA 1P4SA 4MR9B 4HDMB 1TYDE 4QHTA 4EX7A 2XUIA 1WMBA 3NRJA 2EEZA 2YMLA 5GGYA 1PUXA 5FPQA 3TNFA 2MSCB 1TVEA 3KDAA 3G0HA 3W3AA 2AI2A 4G2TA 2B1GA 2IVZA 1DLJA 3KEOA 1C8LA 4HLUA 1JXOA 2WAMA 2JAUA 5AQ1A 1HLPA 4MEJA 2QG9A 4BRUA 5K09A 4HGNA 2R7LA 1I2MA 4V1CA 4IVRA 4TV9A 4ZHQA 1ZK2A 5H3LA 1IEXA 2R6AA 3DCYA 3SQLA 3FE2A 3USES 4L4XA 3ESRA 4S1OA 4UNIA 2UVDA 2PUDA 4TXMA 1U4OA 4XCQA 2IPAB 1DAFA 1SVKA 4NE9A 4AYTA 1XZGA 4PXYA 2XB8A 4EUSA 2GVNA 1EHCA 3RSCA 2XLBA 4O2BA 4RPGA 1GFZA 3LHKA 4DOMA 3AVWA 1OYWA 3GNSA 4A6DA 1DXHA 1UT5A 3LLVA 3MXOA 3NAMA 1DJPA 3NW9A 2F3RA 3N28A 4DQUA 5FAXA 1UMCA 2C2KA 2PY6A 2PX3A 5ANRB 5KINB 13PKA 1UWCA 4FFDA 5HPYB 2FMKA 1WV0A 2CEKA 1GPBA 3CWCA 4B44A 2IOFK 4DARA 3FMOB 3WMWA 4HOYA 4JP2A 1PFQA 5JC1A 2IH2A 3I0ZA 3QA3E 4OOEA 2FUNB 2ZSFA 1P91A 4HGZA 1KEKA 1U3FA 1QTQA 1BC5A 1B2LA 4PSDA 4R2JA 2J3DA 2P3OA 2Q0XA 3P9KA 1XNHA 3KJNA 1WEHA 1WG8A 2VH5R 4HH3C 2EHJA 3TW6A 5CB6A 1X1TA 4KB5A 3KEGA 1UQUA 1X13A 4J07A 2GYVA 2VI5A 4TSKA 2OFPA 3BG5A 3OE4A 1CQIB 2V8OA 5FI3A 2XYPA 3PGMA 1I1HA 1TRHA 4QYMA 3JQBC 4UMFA 1BU5A 2XVZA 1QONA 3MTDA 4JR0A 4TYPA 4ARZA 3K71B 2ID8A 1NQOA 4MQ6A 4C7MA 1KK3A 3FVQA 4N1AA 1DAKA 1W52X 4HQNA 3C3PA 1EP9A 3DLIA 5A5FA 1H9CA 4TQ9A 1RZRD 2NYUA 3EHEA 1UP7A 3EMBA 3UTCA 4C29A 5DF1A 1RHJA 4CQNA 2VHWA 1GGMA 1KK1A 1NZJA 1PFUA 3VPAA 2PUJA 1YRQA 1LX6A 2CFRA 2G28A 3TLGA 3IMFA 2AUTA 1HL7A 2LVBA 2B8JA 3V8QA 1P3JA 4WZBE 3O73A 4GI1A 6ABPA 1T9DA 1Y7TA 4LJ5A 3GRAA 4XOUA 1E3DA 4TUYA 4ZKEA 4EB6A 3KVOA 2DYKA 1LI7A 2O8EB 3JQEA 1D03A 3ACDA 4MPJA 1RKVA 4Z7JA 4YMLA 2CVFA 3PHJA 4KMRA 2BELA 3HADA 1Z2CA 4RY9A 5ALLA 3TOVA 4DUZB 3OQNA 1OLXB 2OSVA 3ELDA 4XB6B 3VX4A 2PRIA 4TWIA 1MAWA 5BV8A 3CPJB 2Q7OE 3LKZA 5EJAA 2RGCA 4I1UA 3SKYA 1L5OA 4RK5A 5IC4A 3QLVA 4KK4A 2C4MA 4KL8S 1BX0A 3SIXA 1T3LA 1W5FA 3JY6A 1EE2A 3QUSA 4GE0A 3ZDRA 4DZRA 3LYUA 2P6NA 1FYDA 3W1EA 1VL0A 3PEVA 1TFUA 3C6MA 1I5EA 3PGLA 4OBXA 4ARCA 1A8QA 4UUMA 4R2XA 1XWIA 2PX4A 2YWCA 4QXOA 3K0FB 2GRUA 3QLTA 1OB5A 2MJLA 3SNKA 4PLPA 3GJ5A 5T3UA 4BIMA 2P65A 2HL6A 4N7JA 5K3FB 3HVUA 2K6GA 3WHLA 3BFVA 3U4QB 3IIKA 2J3QA 2ZI4A 2R8YA 1B8VA 3GFBA 4HDAA 2VCYA 1P2TA 4I55B 4R2LA 1UBGA 3KRTA 4S3MA 4LE2A 3ZY2A 1JAZA 2O8NA 3PEFA 3HXMA 3IV7A 3C6ZA 5B4VA 2XCLA 4GPAA 1IZ0A 3A32A 3A6GA 1EBUA 1GARA 1MQ9A 1O6CA 3FMIA 5DJ5A 3WNBA 1WU8A 1C0LA 4X93A 2ZS7A 2IY9A 3AU8A 5HCNA 4BAUA 1NQWA 4CLRA 5HFJA 4YUYA 4JITA 2OORC 1O96B 3AJ9A 1SC3A 3EC7A 3CX6A 1XQ9A 3ASVA 2REBA 4MVJF 3CVOA 3CSUA 5KYWB 1W19A 3NU1A 3H9GA 3KHUA 3OE1A 3S2YA 4E31A 2JFUA 4RK7A 3TFOA 5K8TA 1RE1A 2PL9A 5K0ZA 4JKOA 1SIBE 3LC7O 5JZSA 2QRNA 3CNBA 4KE8A 2K5UA 5BXQC 4L9RA 4PLFA 4KUGA 5HMMA 4BGVA 1RHUA 1GOTA 3H1PA 2IZOA 1FB5A 2ODBA 3GLGA 2P4EA 3FSEA 2YRXA 1AB5A 2XUOA 2FWRA 1KPIA 2HNBA 4OATA 4W5QA 3F5MA 4QOJA 1ZK0A 3F71A 3OTIA 1IXKA 4QUGA 5LBTA 2ZUTA 3SQDA 3UJAA 4CUJA 1WABA 3G2KA 1UFQA 5ALTA 1JEYA 1QDLB 5JYEA 1VKNA 1EWRA 1W9MA 1NNI1 2OR3A 4ISBA 2V7TA 1A2KC 5CX1A 3FYUA 4JYCA 1DQNA 2ETXA 2O3UA 3C3EA 4FEYA 2PRYA 2A67A 4WN3A 4YJ2B 5J2TF 1WQ3A 4EF6A 4FMDF 4O4IA 2ZREA 1NBAA 3B89A 3LKVA 4PSVA 1L5QA 2DETA 1LDYA 4ZO7A 1TAQA 4DCOA 2I4IA 1NLYA 4MVJE 2ZE5A 3DNPA 3OCZA 2UZ3A 1F8FA 3D7SA 1VKZA 1VTKA 1K2WA 4P83A 2D3WA 1O97C 3VGJA 2GD6A 3RTAA 3E84A 2QA5A 2R8ZA 4YWJA 3PRKE 4QLAA 1HTTA 3RBXA 3M2TA 1KXJA 2NUTB 2JDID 5I7SA 5KYUB 1L5VA 2YFYA 2O8BA 1N2JA 2EKPA 4P53A 3R75A 4D9BA 4EI9A 5FBRB 5JVDF 5LR6A 2XBUA 3DTVB 4M0MA 4RQUA 4UXHA 1KMNA 4YRNA 1TYEB 5M7EA 2WIKA 2UYCA 4J94A 2IXGA 1NMYA 3KOWA 3UC9A 3UG7A 3ZNOA 4UAUA 1T1JA 3D7NA 2KE5A 2UAGA 4HEHA 3TQTA 1DDOA 2NUPA 3JQFA 1XDWA 2G76A 3WXBA 2I0FA 1FTSA 4PN3A 1NR1A 5EP2A 5KS2A 5CITA 4QWMA 3IHTA 5EL0A 2Y68A 1VSQA 3WK8A 1RZRA 3TGPA 3EFEA 1KY3A 1YZTA 3IUJA 5DHAA 3C6KA 6Q21A 5J2TA 1JUDA 1OX5A 1QLHA 3FVTA 5AJWA 3EA0A 3SKXA 4X3CA 1UDAA 2Z1DA 3RSGA 2CK3A 2H1HA 1VFPA 4Q7JB 1I6WA 3V4RA 1H93A 3QQ5A 1I36A 2ZRLA 5C4GB 1Z13A 4PC2A 1RXEA 4JCCA 1ECCA 4XWGA 4JWTA 1DAOA 3WLPA 5KYTA 2O2ZA 1FSGA 2CCKA 2I2CA 4DLXA 4NG4A 3E2MA 4DLSA 3RRNA 2PMWB 4LX8A 3CN9A 3SP1A 3L9XA 2H1FA 3X1XA 4XM1A 3FJYA 4IHJA 1SMKA 4C4YA 4KTVE 2IOYA 1IM5A 3SF0A 3L8DA 5K0NA 4EHLA 1GEGA 2O5VA 3O84A 1Z28A 3F7OA 3T7KA 4EFNA 5ECWA 3WMXA 1K98A 2PRSA 3M4ZA 1G20A 1T6BY 1V35A 2WC1A 4GL4A 1KZ7B 4AJLA 5T6MA 4EG0A 2J9RA 2W9XA 2AHOA 4IIGA 1RM4A 4DDWA 3LY5A 2Y66A 8ABPA 5FDFA 2LE0A 2ESRA 2GEVA 3V1KA 2PZKA 9LDBA 4MHTA 1GDHA 2JJMA 4DCJA 4RTNA 3WQBA 1FE8A 2J9ZB 4Y2QA 4GSLA 4LYGA 3RJZA 5CT4A 3O8CA 3BE8A 1D1PA 1GSOA 1L4YA 4P7KA 2FEXA 5LZ7A 3EOAI 1NTOA 1NX9A 1WWKA 1Q1QA 4DIEA 1CZOA 3SXUB 3CG4A 4P0TA 1ADBA 1GPMA 4Q9IA 1M0WA 2PN1A 4HH4A 3LL7A 4HNAA 2NZUG 4YMSA 3RU3A 1Z4KA 3BFPA 3T3MB 2MU1A 5BVHB 4HDRA 4K9OA 5E2IA 2NU9B 3EVBA 3MEQA 3MWKA 3WFJA 4BASA 3MT7A 3GJ8A 1L5LA 1F14A 2C2ZA 2K2WA 2YWFA 1CZKA 1FYVA 1KJJA 3ENQA 4TLLB 3QTTA 1YTLA 2B4YA 3HUEA 2M6LA 2JCSA 1M5TA 1EFVA 4B6RA 1L7DA 3OFVA 2OBNA 1YL7A 3WMFA 2JVKA 1QF7A 1WW2A 4LXIA 1Z73A 4R2IA 5BMVA 1XTIA 2FWBA 2H11A 2DZDA 2WHYA 1BVRA 3D8TA 3UCEA 1RI1A 3FTDA 1ZD9A 3DKVA 5D3MA 4NI5A 2CUTA 1Z4IA 4YCJA 1AGRA 2YFHA 4GU5A 2O59A 1MQSA 3CNEA 5IUKC 3W2IA 4BO8A 5B6IA 3K30A 3LT1A 3TW4A 1ZOOA 2BC9A 1LTHR 1NW3A 3NHPA 1ESCA 1Z3CA 2R7AA 4Q05A 3IILA 3AKZA 4YAOA 3ITKA 1WLSA 3QPVA 4LHXA 2C58A 4J3NA 1RLIA 4CKBB 5BRNA 5JJBA 2CXSA 1TVKA 3HCRA 3ZU6A 4U0JA 1PWZA 2LRHA 5C81A 5EZSA 1R0ZA 5B55A 3DNFA 1GCUA 4CDGA 2EXXA 1KKLA 2C7GA 2NXNA 2OB1A 3N2IA 5EWMA 3EGOA 3OQ1A 1FDSA 2IIPA 2Q28A 2WMYA 3TE6A 2IH4A 2HMTA 4R1MA 3UV3A 4BO2A 3T9CA 1KMQA 5ERGB 4HDSA 3TTTA 1R0WA 2AIRA 5I6DA 3O8RA 1IIBA 4B3IA 2VWPA 1VCIA 3FPLA 2BF4A 4O2LA 3R7SA 2DTEA 4RDXA 2E1RA 3O4GA 2IZZA 1XZ8A 1E2GA 3NETA 4LBYA 2OQ2A 3MOIA 4UDXX 2BWJA 4JA2A 1JHOA 3PNOA 1NATA 2O3QA 5HEKA 4PHFA 5H4GA 4RKFA 3DZIA 3FRJA 1DBVO 4CMIA 5JD5A 5FFNA 4Y6SA 2C07A 2LDBA 3BBPA 2PH7A 4YRJA 1FNCA 4XVUA 4B9EA 1I33A 2RHGB 3UJBA 1OYOA 4Y1FA 2O3RA 3FVVA 4IDPA 4MIOA 1H5UA 2ZU0C 4F3RA 1TJYA 5ECDA 4ZYWA 4IGIA 3Q3EA 4UPVA 1YAJA 4PLVA 1FMCA 3PNQA 1NRJB 1ZLYA 2GAJA 2BKEA 1PQYA 2W70A 5C1PA 3I12A 3QFSA 1KEEA 3BL6A 4NFLA 4JSRA 5ELXA 3LE8A 1HMYA 5DK4A 1BCSB 1DQSA 2TMKA 3WRWA 4M7RA 4G0PA 5JU6A 2HCBA 2Y1CA 1J8QA 4W63A 2JG3A 1AKUA 4UBOA 2FQQA 4JROA 3V1UA 1NNUA 2JW5A 5AVVA 3LBYA 1DLIA 3KU1A 1A97A 2JFYA 1EI9A 1GPDG 4Q1AA 1JDZA 1A1VA 3GVCA 4DIMA 5F35A 1G9SA 3LMKA 2B0JA 4DIBA 1CUGA 1E79D 1RXUA 2ZYUX 3DMYA 1QGED 2PO7A 4N18A 3S81A 2H63A 2QL7A 3KSZO 1GIAA 2WLTA 3L7AA 2COKA 2VP9A 3C8HA 1TQ4A 3LF1A 3V7NA 4YMVA 5EE1A 2BE7A 3DEYX 1VL8A 1B1AA 1A7UA 1RP7A 4DJFC 2VWHA 1Z88A 4Q1FA 4RD6A 1RHMA 2JEZA 1YSCA 1YTUA 4W8OA 3VPHA 1I5OA 1ZMXA 2IEBA 3FROA 1XZEA 2CXXA 1YS9A 2JGLA 4OHKA 4XWAA 4Y6GB 5SICE 2E6KA 3VR5D 4CG3A 4DBLE 2PKQP 4MV1A 3ULKA 4J0GA 5LU8A 4PHCA 1OA1A 4PNZA 2HF8A 3UJCA 3P26A 1XA3A 4MDHA 3I3SR 1NU6A 1UDWA 2WSIA 3RM3A 5K3BA 4ZZ0A 1HE2A 1UADA 2OVFA 2QOEA 4NJEB 4ZQIA 2PGXA 4YDQA 3I9OA 3UBTA 2YFKA 1F8UA 4MRPA 1LV7A 4BYMA 1CJBA 2F1HA 4IP0A 3R7BA 3WFZA 4DMHA 1L7MA 1KDZA 2WIBA 2ZI3A 3INNA 5AKGA 2WYIA 2W4QA 4CEJB 1U5BB 3MVEA 4Z8YA 4NNOA 3W5JA 1ZG3A 2EZUA 4QLBA 1LI4A 3L8GA 5IK2D 4JASB 5T41A 3A9UA 3RJ5A 3QE4A 4E5KA 4XIJA 4I55F 1V45E 4FSDA 4D9EA 4DMGA 5LP6A 2Q0HA 4QYIA 5AI5A 3GFGA 1S4QA 2BMWA 4UTNA 2HF2A 3QBVA 4WXEA 4F9FA 1I3NA 1VC2A 3TG8A 3SLRA 1J1UA 2JD1A 1NHWA 3ELBA 1FPQA 2Y67A 2VDWA 2GO7A 3K2BA 4K05A 4NCXA 3CLHA 4RMHA 3TS1A 1WQ1R 4JBGA 2EJVA 3AG5A 1P1RA 4RLHA 4RJLA 3RYHA 4NJOA 2DLCX 4FOPA 1C3LA 2NO4A 1NJ6A 1T36B 1HETA 2A0WA 2FAXA 2Q41A 4HMOA 4FZVA 5ALRA 5C31A 1G8HA 2G25A 2IY8A 4IOMA 1JA9A 4G41A 3KTFA 3CGGA 1FXWA 4BFVA 1XCJA 3QVTA 1Y3AA 1F4VA 2F90A 3K1YA 6CHYA 2E3JA 1OIXA 2ZUWA 3W0LB 1XRLA 1BHJA 4DG8A 5AKYA 1XGKA 2H3EA 2GM9A 4YRAA 2FSIA 4Z1OA 1GG9A 1MNQA 3DMFA 3OWOA 3QFCA 2HJWA 4UHEA 1GRQA 1NI5A 1A50B 2Z09A 1ZS9A 4FYYA 1HQCA 4NZNA 4FD3A 5JG7A 2R4QA 3DMRA 3HLKA 4DCPA 5CNIA 1Z06A 3JS5A 4PQGA 3FYDA 4IEIA 2C7PA 2CCJA 3I5UA 1A5SB 2N3ZA 2NTEA 1Z6ZA 3EWIA 5HTOA 3WXMA 3MJHA 1XELA 3VTFA 2JCYA 4YJ2F 1ARZA 3OX3A 2P1RA 1YD7A 1NY5A 4RA6B 3R9XB 1T9GS 1EZZA 2W6OA 1JKFA 2FP4A 2VJLA 3ENNA 1UKAA 3EEYA 2IXTA 3W5AA 4BQSA 1CUDA 1VG1A 5IVIA 2VP4A 4WQMA 2P9ZA 1NVBA 2C7BA 1DG3A 4MVJP 1J23A 2ZRPA 1MTZA 1RMYA 2AE2A 3WWZA 3EF1A 4UDYX 1D2MA 2ECQA 2XBLA 4M1ZA 4B83A 4BNGA 3D7KA 1OH6A 2WTEA 2QORA 1K97A 1KAQA 3KQPA 4ZALA 3M6FA 4F5ZA 4Q3EA 5L3VA 1GZ4A 1XO1A 4BCCA 2QD2A 3CLRC 1GUFA 3ZR4B 4BX0A 2VSOA 1E18A 1Y4DE 1ZISA 1ULZA 2G5GX 3IS3A 3KELA 4NU8X 4DV0B 3UGJA 1ECJA 2W2MA 2C4VA 1ODTC 3PIRA 2IVFA 4I66A 3GXBA 1PL6A 1R5OA 5ETJA 4Q9JA 1N1GA 1PKXA 1SCDA 3TBKA 1GAWA 2OE2A 2X5XA 2HXGA 3LM8A 2QLBA 1IOZA 1KY5A 1S9HA 4JNKA 4NYIQ 5I9LA 4UUBA 4FOTA 5A7HA 1OB2A 4BFZA 4OMCA 3R76A 3AMVA 5SYAA 4HMQA 2VAPA 3X1MA 4CTNA 4LK2A 2X6TA 1L0BA 1UMDA 5ERXA 3COWA 1TGVA 3ASZA 4EKYA 5ED4A 4KEAA 1QZTA 3C8DA 1U81A 1ZD4A 3PZRA 4J43A 3RVRA 1V5FA 2MYUA 4HRXA 4EKEA 4UD2A 4BKMA 3OZAA 3EPLA 4CKWA 4EA6A 1FFCA 5IS2A 3H2SA 3HSKA 4ODIA 2AS0A 4DNXA 4FE3A 5ESXA 2RG7A 4HG2A 1NQ5A 3CSDA 2A7XA 4PLZA 3B9PA 4Q3LA 3GRZA 3ITNA 4WCVA 2J7KA 1JXQA 1W8DA 3REGA 5KI6A 4ZI7F 1PFGA 1KNQA 2DQYA 4WBNA 3H8WA 4F11A 2Q4EA 3NORA 1E1MA 1CC1S 4OMFG 1X9GA 4A0FA 5A3QA 2QZZA 4XEHA 2EG5A 4WHMA 3LCUA 3ET5A 1V9SA 3OPXA 3O8QB 4PLTA 2P1DA 1Q0SA 3KOUA 5HFAA 4CIXA 4BP3A 5A3RA 3KBBA 1LGYA 5D1NA 3QBEA 5C7OO 4BO7A 1C3OA 1Q11A 2GN8A 3PUKA 4UEKA 5G02A 2GCGA 3L18A 4B87A 1JHUA 4YMIA 2GZAA 4AZTA 1M2HA 3UHAA 2H7CA 1KMIY 1Y89A 4PHHA 3EYAA 2BP7B 3LXRA 4D8XA 3AI2A 1VHDA 5IK2A 4E5SA 3C8ZA 5DBOA 3N76A 1E7SA 2HPHA 4TKVB 3FPSA 3A1VA 3VNRA 4AS3A 5BSGA 1EUYA 1N2GA 1VE5A 2IXDA 4OAQA 1C9MA 2CFOA 3R7LA 5KPJA 1E1NA 2Z95A 4AJ9A 3KNZA 4WT7A 4CEHA 3ZLBA 2DBYA 3WMEA 2OLEA 2R5WA 5G0UA 2O19A 3AVQA 5DSXA 2ADOA 1VYTA 4IIJB 3GJXC 4HGRA 4UHJA 1XTUA 2B99A 3V4FA 3NBQA 3IOYA 1A8HA 3TQSA 1IJBA 3NYQA 1JJ7A 1SCBA 2QY9A 4DQXA 4EJ6A 2C9CA 5KVCA 5J47A 5JAZA 1TZCA 2P9HA 5LD2C 3HKDA 3DEHA 4TROA 5KYNA 5CEEA 3EQ6A 3PQ8A 4RGBA 5A0FA 4CDRA 1YMUA 5CXQA 4LJ6A 1O8BA 2YOGA 3OIUA 4V02A 1IWBB 2HPAA 1OZGA 1TCCA 2A1UA 3PXXA 4XUCA 3VX3A 4BNDA 4CTMA 1ZIXA 1KPGA 3ZCUA 5HK8A 2VP5A 5EXPA 3VSBA 5KMGA 3I64A 2QD3A 1JMVA 1VLLA 3Q8KA 4MPTA 3FXAA 3RGGA 4DPKA 1LBEA 4YT5A 1GTSA 3LIPA 3BCRA 4XVRA 1EXMA 1T1RA 1XZIA 2DTDA 3B7WA 1NJSA 4JDPA 4R71A 3K9HA 4GPZA 5A9TA 4IFIA 4R8LA 2EIXA 5E38A 2CLOB 1JA1A 2JGRA 3F2IA 3G7UA 3NXSA 4MYDA 4FKMA 1UEXC 4X1KB 2JFPA 3K9CA 3SU8A 3KKEA 5G1OA 4DLAA 1V1JA 1Y1LA 3CNNA 4I0WB 5FI5A 5JTTA 3MRVA 5F9HA 4Y0AA 1F2UA 5H3HA 1VQ1A 2FPMA 4D3ZA 1NBIA 1FLNA 2G7ZA 2JBWA 3ZW7A 3W77A 4F5YA 1G8SA 1L5HB 3BJZA 5B1IA 1DKOA 1IULA 2EFDB 3SDSA 5JZVA 3IUPA 4EJSC 2QL6A 3RVSA 4DR6B 3I4LA 2XB6A 3PWSA 4Y9TA 1RC8A 2XYVA 5ITZB 1R5BA 4R7TA 3DOJA 3LDFA 4GEKA 3SQNA 5FLXA 3V2HA 2W2LD 3TZKA 2WJIA 4QLOA 2R47A 1DELA 3OLCX 2RBGA 3B85A 3WLKX 3CHYA 5EXTA 3BKXA 3OZDA 4RH1A 1U11A 1UZNA 4ZTUB 2QVZX 4ZGBA 3SZOA 2FW6A 4H1WA 1LFAA 2I1LA 4ZYXA 1QAQA 3ZXUB 1N2XA 3RC2A 1D5WA 1E2KA 2YXNA 2HIMA 3ZHUA 3L8FA 3QSGA 2IC5A 1UWLA 4BRWA 4BNMA 2LGJA 3BL5A 3DHYA 1U8ZA 4YP7A 5FL3A 1SKMA 1JFFB 2HGZA 3KZCA 3PXGA 4URFA 3ZLTA 4B17A 3EJWA 4MWGA 3T4PA 2XQVA 4LJRA 3R7WA 1Y5RA 4BQRA 5KJCA 2B7LA 1SQ0A 3CRNA 4U6NA 3MWEA 1ZXLA 1Q1AA 1TU0A 2HHJA 4JI5B 3ZXIA 5I7RA 4P3KA 4GZMA 4L2IB 4WDRA 2OCXA 4BX9A 3L4BC 2HTFA 3WK5A 3PBKA 2Y0EA 4QULA 4TT3D 3O7MA 4YO8A 1WCXA 3ZHZA 1SUIA 3L0BA 3RBZA 2OWEA 2AGVA 5COAA 3QF4A 3RH0A 4EM6A 2R4TA 1HGXA 4L6AA 4HAXA 3SBOA 2QP4A 1GQQA 4BO0A 2V5UA 3AFOA 4OK5A 1MG0A 4YLEA 5F78A 3HB7A 2QVGA 3EIUA 1FX0B 2DKOA 1M33A 1MIOA 4D7AA 4D8TA 1ZHOA 5EUQB 3RRXA 5E6RB 4G5QA 3S1AB 2VTVA 4L9SA 4AYWA 2WFLB 5C2JB 5KX5F 3CR7A 3F4KA 4ATNA 2WZBA 1YULA 3G13A 1FJ2A 1GQRA 2OGUA 3IJRA 1O1YA 4BZWA 4Q1VA 6YASA 1TF7A 2H5IA 1S96A 4BP9A 4EMTA 3THWB 2Z6VA 1R1DA 3OUZA 4RFVA 4ITRC 3P0IA 3EIHA 4OHUA 3LPDA 1CB0A 3KE8A 2WLSA 5G53C 1XZNA 4M0UA 1FFAA 4FINA 3RV4A 3R7AA 5ICMA 1TMGE 2WU8A 1EE9A 4EUHA 2I34A 4PCAA 2WM9B 3WB0A 3CPHA 3ZKWA 2P6UA 5K51A 4HFJA 4JX9A 3CR3C 3LYLA 3AETB 1DOHA 4R1SA 2HGSA 3W79A 4WCFC 2ZCJA 2I9KA 1NNSA 3PI6A 4DRZA 1BEUB 4J29A 2HIHA 7REQB 1RCFA 1WHTA 1U3CA 4NCKA 1YCGA 1ULBA 1R16A 2FW0A 1DQZA 2RK3A 3DXXA 5FUQA 3EIWA 4KR9A 4Z7QB 3F3MA 5BNTA 2QYTA 1ISPA 2NUBA 1UXOA 2VHJA 1OWOA 3NVKI 2DBRA 5LMCA 1OV6A 2BLLA 2B9EA 4A5SA 4ZVNA 3K6SB 1Z4MA 4RA9A 3EUFA 2HX1A 1MB9A 1Y1RA 2WJWA 5HNKA 2GPNA 1G18A 1JQDA 3KLBA 2F8MA 1QRUA 2CE7A 4Q82A 1O3YA 3KDPA 2JA1A 4Z4FA 5GONA 1HY3A 1KHTA 4WLNA 4MZDA 5J1TB 3WGMA 3IBCA 4LZZA 1G19A 1M2EA 5DDIP 1KSFX 3FSGD 1Z0KA 3R3HA 1NMSA 4RIFA 2QN3A 2ZI9A 3MTJA 2L17A 4IF6A 4L73A 5H82A 5BWNA 4HEQA 3BHIA 1T8SA 3PGVA 1U2ZA 2Q3FA 1Q0ZA 4HC4A 3UKOA 1WP9A 4DYVA 1ZN9A 2ZETA 3DBRB 4YJ3B 4CGYA 5JSZB 1NVVQ 1CE8A 1FNSA 2VPYA 5DT2A 3NQ41 4Q4CA 5AFSA 2H4XA 5HZKA 1QVRA 2EQAA 2WJZB 3FZYA 4BZPA 2PUVA 1I1QB 5FNVA 1BJTA 1JJVA 3BZWA 5LZ2A 4YRZA 1ZJ5A 1T4DA 4DMRA 2ZJFA 1H2WA 2NNLD 2W4MA 4YALA 3TVDA 4UFNA 1RPTA 1IBRA 4JUAA 4UUAA 2H2DA 5JPIA 1G8AA 3QKRB 1GNTA 1KARA 4TS9A 2NSDA 3AIOA 2VT7A 3P2MA 1EK1A 4OQQA 3T7DA 2JLRA 1D7OA 3Q1LA 2W2LA 1XZKA 4AG3A 5JZBA 2R7MA 1I5RA 4AW9A 2X41A 3I9MA 5KCMA 2BTEA 4TYWA 4PYQA 1BWSA 4CL0A 5LQAA 2FVYA 1ZGCA 4XASA 4R5MA 1MX5A 4HAUA 3TCKA 1DCMA 3HCCA 1G5PA 4I4CA 3RFUA 5FI0B 2QGFA 2P6PA 5LLTA 3TRIA 4G8CA 4E7OA 2IYEA 1K8QA 2HW8A 1ODLA 5BWCA 1ID8A 3MW8A 2QAGA 3DMPA 3L8CA 3UWKA 1GZ7A 4B81A 3UZUA 4L0DA 3PHGA 1TZ2A 3CNHA 2QX6A 3CZPA 2GPTA 5IAGA 1O5TA 3IMKA 3B53X 4JJIA 1C7RA 3A2NA 2FEMA 4WXYB 1PR4A 3ZLUA 1IY1A 4MH0R 3SX2A 3L1VA 2FH5B 4QJIA 3LXUX 2C2GA 1UC8A 3PHHA 4ZODA 2XUDA 4GPD1 4TT3A 3TXAA 3EPKA 1ZVKA 1OU4A 5FTWA 1XRSB 3W4KA 1YKFA 2HIGA 3PLRA 2GHIA 4HVTA 2J0UB 2XMGA 4XWWA 2BFOA 4HSGA 3DXYA 5JSUA 1FY2A 1AKVA 2VT6A 2F9MA 4DCNA 2N0SA 4ZQGA 1NVAA 1GAJA 5AI6A 4MGIR 5K05A 5CBPB 3L84A 3VUFA 1NUAA 4I14A 4W5WA 1YL5A 2VP0A 3H2YA 5JCZA 4IOLA 2XQGA 5AD1A 1SVSA 4KQMA 3BE4A 1BA3A 4R2MA 2DWOA 2WMNB 1PSZA 4N9WA 1OGYA 2ZWIA 3DOCA 4HGOA 4JN6B 2X5KO 3GLQA 1XPUA 4J3FA 1K0UA 1SUWA 3CVJA 2L18A 3IHKA 4TMFA 5AXAA 3UUGA 3HA5A 4CV3A 5KNDD 1U0OC 3KHKA 3LUGA 2CXQA 4UZFA 4U2BA 3VMFA 4US2R 5AK5A 4CT5A 5HVNA 1H0HA 2OLJA 1OFVA 3ETGA 4M9RA 4ALMA 1KQ3A 1PJBA 4EJFA 3H6KA 5IN4A 1MB3A 4WECA 3P2YA 3N07A 1IM8A 4EB6B 2WK1A 3S2FA 3W5DA 3AUYA 3FPHA 1WXDA 4QQNA 5JQGB 4GYKA 4QTYA 4KCGA 4BFYA 4EEZA 1LC0A 1PDWA 4YHHB 5FTKA 3KWMA 2QX7A 2WICA 1VMIA 1WRBA 2W2KB 4QFBA 5L3RA 2FUG1 2XQKA 1NP7A 3STUA 4QRIA 4ACAA 1WTAA 3QFRA 3ILYA 1E2PA 4L78A 1UCFA 2PAAA 2QRHA 1W5TA 4NDZA 2GYYA 1SOUA 4KHPB 2FK8A 2CXHA 1JAXA 3UQZA 5JRDS 2K2QB 3V6LA 1UIMA 3W3AH 1K68A 1MIHA 4RJ2A 2PBLA 3PDJA 3BE6A 5K0GA 3WLLA 4ZN6A 5A4IS 4X97A 3A25A 1KJ8A 4PRLA 1AHPA 1GZ6A 1ESEA 3E7WA 3IDSA 2R97A 1JIIA 1C7JA 2B4RO 3FTNA 3K0AA 4GGOA 2EKLA 4L5IA 1A7KA 4P92A 4OPMA 2CLDX 4QXRA 3CEMA 4F3KA 1EWVA 1WKBA 3ORQA 3OUUA 1ODKA 1P0IA 1RQ2A 4QSHA 3QFHA 4MVCA 4ZO6A 3WQHA 3EG9B 4RSGA 3D4NA 1OFUA 2BUBA 3VAAA 1GZ3A 3QV1A 2XQJA 3RAGA 1GPAA 2Z9DA 3F5FA 4CXMA 5DE3A 1VPDA 2VBFA 4MW6A 3TMAA 2E87A 1NXQA 1AO0A 4YMTA 3MTGA 1G4UR 4I3FA 4L74A 5D3ZA 2SECE 1ZICA 2EFGA 1Y6FA 2HR1A 4HS4A 4ZRDA 4M8KA 1R4MA 3D6TB 3RT7A 1TJ5A 2IPLA 3ORRA 3R0QA 4L5CA 2A0FA 4IV5A 1WSBA 4QXMA 5DH9A 3BXGA 3K4PA 3MJDA 2J3KA 1EGAA 2B98A 2ODEA 3GCXA 4LVNA 4QO8A 2XH8A 2MYPA 1HYQA 2IYUA 2PXHA 3AERA 1NJ8A 5EY5B 3CWZA 1NASA 3QKWA 3T8YA 3D4BA 3WHKA 3GLIB 2OWDA 1CQJB 3GT3A 4NPAA 4MVJG 5AVRA 1U9CA 3FOWA 3LP5A 3F2VA 5EWJB 1PVVA 4EG6A 2OV8A 4TTRA 4HQOA 4TMWA 4RF5A 5DLPA 1QFSA 2J7PD 3COSA 4JLWA 4Q6WA 4QPPA 1EWKA 1F9EA 4OQPA 2BBWA 4RCYA 1JXMA 3CF4G 1IEVA 3GA5A 3INTA 4FHZA 2J46A 4KNWA 1PSWA 1RR6A 2LNDA 3DR3A 1IUPA 3A8TA 3F8TA 3PC7A 1RPNA 1CW2B 2YIVX 5ILQA 5JZMA 2D3TA 1IXYA 4FDLA 5T57A 4AJPA 1EMDA 4B3SB 2DX7A 4QNRA 4PZLA 3E61A 4OLBA 2C29D 4JD5A 1B4DA 1E8DA 3ZBUA 1R00A 2NSHA 3JRXA 4QOFA 3BMCB 3KOMA 2VNAA 4U6SA 2FN4A 3WNZA 1Z0ZA 3E82A 1U5CA 1OILA 1ESMA 5EP3A 1TYBE 3IIJA 4H35A 1J0DA 2F59A 2TRSB 1EP1B 3TTYA 5C8XA 4TMTA 2JGAA 1H4SA 1MB4A 1YCDA 3ETEA 5CLIA 2ZB4A 5CURA 5IUJC 1DKPA 4YX9A 4C2UA 1ORWA 3BMNB 3GD7A 1TM1E 4ZT3A 2C2BA 1HV8A 4BLUA 1XMIA 4TGLA 3DDNA 4OSOA 4HWPA 4YECA 2PJUA 3IQZA 3HO1A 2QPOA 2YY7A 3GFPA 3R6DA 4YRDA 3OQMA 3WIUA 1F20A 1FUUA 1XZMA 2ODPA 1SD5A 2QYHA 2VUUA 2GEKA 2XGGA 3O8OB 4LQCA 1MBZA 5E6SB 3V1TC 1ONBA 4F6LA 4ZAZA 1GRCA 4N0EA 2P78A 3QY9A 1AO3A 3ENWA 5EJ2A 4GLOA 3K2QA 3OMLA 3OCUA 4PO3X 3GN1A 1Z38A 5EKDA 1XLTA 2JJ8A 3R3UA 2GZMA 1ZIDA 2X0EA 3TLCA 4AP6A 2DFVA 5BYBA 3OFND 4KAXA 4YR9A 3NI2A 4MRVA 4REMA 1PL7A 3GHYA 1JILA 3GT4A 2XYQA 5B3JA 3T7AA 4C20A 1RWBA 1AN0A 1NX6A 3QKTA 2Q6VA 2Z2ZA 1M1UA 3C3AA 4TXHA 1AZSC 1YS7A 3AR6A 2ZSJA 3KVYA 4W8HA 3ICQB 3A6EA 4FMCF 2UU9B 2J4FA 3NT5A 2D0DA 1Z5ZA 3RIYA 4RXTA 4DIOA 2XUPA 2PX0A 3IUEA 1XMQB 2I2BA 3TSCA 1JLLB 2HFJA 3IT2A 3PDUA 2ZSAA 3E4DA 4IXMA 5DASA 2I7VA 4BO5A 3ROTA 4G84A 4B3RB 1WDTA 5FTMA 3U56A 1YU6A 2IK8A 3LQRA 1YQXA 3JD1A 4KN9S 1GXSA 3N9IA 3W5CA 1A9XB 3A9VA 3QELA 4KMOA 4D74A 1BDBA 2Q49A 3CEAA 1KAEA 3CTMA 3T5CA 1NRIA 4LYDA 2BEWB 1S2NA 3WIVA 3H6GA 2YWRA 1WZIA 2ZWPA 3ODPA 1JKIA 5LFAA 4JBWA 4OHZA 3VM6A 1UL1X 2Q2OA 3I05A 1DKLA 3QP9A 2P1ZA 2YDYA 4CF3A 2POQX 4CVNA 4DA9A 3TOZA 3MRXA 2JATA 2V0GA 3IAUA 2B7BA 3H9CA 1F4LA 1CJVC 2VWGA 4PEVA 1KS9A 1NAHA 3WYBA 1EPUA 4LRYA 4QARA 1N3IA 4MUNA 2VHVA 1YE5A 4E46A 1CBUA 1EP2B 5AKKA 2RMKA 4IS2A 3RVPA 4HVCA 5AW0A 2FMUA 2JIOA 3NHAA 1GZHB 2FPIA 3INRA 4TMKA 1K66A 4URVR 4G09A 4BU0A 4UMDA 3S3TA 3T1TA 4W9NA 1JX6A 2DPXA 3FNRA 5FKJA 4H7FA 4KI0A 3P9CA 4U00A 1U9JA 2XA1A 4RM2A 3VPXA 1BJKA 1AV7A 4W5JA 2FFJA 5ESWA 1WB4A 4YJ3F 3RC7A 5LBIA 1DKMA 4LJYA 2LV8A 1C8BA 1U1GA 2CNBA 2GPBA 5IABA 1D8AA 3CF6R 5CJPA 4MUKA 5HF5A 3AV0B 3OD1A 4ISCA 3C41J 1M34B 3F7NA 2H4ZA 4B46A 1UBFA 2E21A 4P0PB 3SICE 1E3LA 2PBZA 4EUEA 4FXOA 2A9PA 1BKYA 2ST1A 4WK4B 3W2GA 5K9ZA 1F9AA 2BN4A 2G1JA 5H5JA 2FSUA 1M2VA 5KVAA 4RTOA 1N1DA 1LWOA 4X6UA 4EG8A 2W43A 2J7PA 1ISHA 2PBFA 3NEYA 4R16A 2GBCA 3UHOA 4AZWA 4DLPA 3O4JA 1KI8A 4OFBA 3NUZA 1KBOA 4PO9A 2J0EA 3VBEA 4B8WA 4L75A 2R1VA 1CZRA 1QE5A 1XALA 4JT4A 5FPKA 5L3QA 2X5OA 3MK31 3DBHB 2AN5A 2V7QD 3FAZA 2XKKA 1XEXA 3GEPA 3OF3A 2PGJA 1YFKA 4F8YA 3ROQA 2WUDA 4HWSA 4ZC1A 3O91A 1JECA 1Y3HA 2ISCA 4LY6A 1R3UA 3K7EA 1AE1A 1XMPA 4HB2A 1FMTA 3RU9A 5EHIA 4BE7B 4LYHA 6LDHA 1LH0A 1R66A 4K8RB 4OFXA 2QRJA 3LZCA 3T3EA 2QPLA 1D6JA 1UFRA 2R2GA 4LJ4A 5I9IA 2VTKA 1OFIA 2ZPUA 5EQFA 4DCTA 4YROA 4ZU1X 1KY2A 4OXNA 2IYXA 2V0CA 5KKAA 2XT9A 1JALA 1GFSA 1WDWB 2QTZA 1ZJWA 4GKKB 1Z4OA 5F21A 4AY2A 3SFTA 1KJWA 4FZ5A 1RFLA 1XWWA 1KEPA 2GB4A 3C1OA 2KW5A 3WLMA 3IEMA 4P4TA 4BUZA 1XQYA 3KTAA 5IJZA 1JDPA 2DHQA 3V8RA 3AHGA 2I62A 2IGTA 4IV0A 3KJEA 1V16B 2WHRA 1PNQA 2JIPA 2ZJ8A 2ZPTX 1KZHA 3PNYA 3B1ZA 2YKGA 4D99A 2FZKA 3PHLA 5DN6D 1IN1A 2Q3MA 3RK4A 1PX0A 3OFNA 5KOJA 2E49A 2IEYA 2MINB 1U63A 3UT5B 3A6JA 4U39A 5DHSA 2IUTA 4M1EA 3SMQA 3TOSA 3VAZA 4UBJA 5DMXA 1ZZEA 3I6YA 3ZGXA 1H1LB 2Y6UA 1G63A 1IFXA 1Y1PA 2XTJA 3HL4A 4NAUA 3K6KA 4TRJA 4TZTA 4H60A 2OL4A 4X1YB 5GADl 4OI1A 4B71A 3WLEA 3ENVA 4UHDA 3NKLA 1G5RA 1GKKA 3DFFA 4XWOA 4OF4A 5LQCA 4DR7B 4GYYA 1SCNE 4IFBA 4R0MA 221PA 4PSKA 4A9AA 1OXXK 1SFRA 2I8LA 3U7JA 4NH0A 5J4HA 1QZ3A 5CXSA 5AHRA 1QIGA 4GLFA 1HFEL 2BFCA 3HY4A 2PCLA 2BE9A 1A27A 2OLKA 3EXFA 3P7MA 3QJGA 4OO3A 3H9UA 4QUEA 1UEJA 3ZV4A 4F4JA 4N3AA 1N2OA 1PE0A 2EWMA 3L1HA 3P1JA 4UVEA 3GLRA 4TN1A 3VYTB 1D1SA 3PQ5A 4JP5A 1X80B 4WN9B 2OBXA 1G3IA 3DC2A 3I4CA 3OLXA 3GDWA 5EUCA 4FCCA 2DH6A 4KU4A 5BVGB 5JTUA 3KZKA 1BXKA 4BLWA 4FEEA 1JPVA 2E0IA 3PUYA 3ADCA 2R6FA 3AIMA 4D9FA 5CYOA 4FDAA 3O8LA 4JLUA 3UB2A 4MS3A 4KKVA 1XXHB 4NBVA 3HWX1 3AB7A 4PF1A 1R6AA 3RVLA 2EGUA 4CM4B 5A06A 3GPLA 2A6PA 2GX6A 1XRJA 4DEXA 2QLFA 3Q2IA 4G9BA 1ETHA 4EY4A 1XQWA 4JJ6A 5KQPA 4DHWA 1T8UA 4ZCLA 2UZ4A 3U5ZB 4QDKA 4ZV9A 1AMOA 3AY6A 3UA4A 3ZHYA 3FVWA 3ICCA 3OLVA 4K6MA 3II6X 2XOKD 3H4IA 2OCLA 4WOKA 1R6DA 1W8IA 4X20A 3BGIA 4IYJA 1HKHA 1T24A 5JH7B 1TK9A 2PWPA 4YN3A 3VR6D 3SEFA 3BJEA 1Y3DE 3Q3HA 4F2WA 4RO0A 1ZSNA 1BDIA 2JFFA 4K1LA 1PDVA 1TGYA 2H0QA 1IN6A 2WWWA 3O1IC 3IV9A 2YQ5A 3B5JA 3H11B 2HRQA 3HU2A 1CVRA 4NEGA 2FRVA 2XCOA 4RW0A 4DHEA 2VLIA 3M1LA 4YB8A 4PYRA 5AM1A 1L6RA 2WQ7A 2LP4Y 2HKIA 3DAHA 3OPQA 1G6HA 1E6UA 1PLKA 1MA0A 3IAXA 1XNJA 1T2DA 4G37A 4REQB 4I4IA 2X9QA 1SZDA 4I36A 3H8VA 4PG8A 1M9NA 5JJCA 4FD2A 2VYQA 3Q0TA 2DBZA 1G5HA 1XRMA 1HRKA 1YS1X 1K4MA 5K5EA 3HCFA 3ZVMA 3LRPA 2UZ1A 3WICA 2ANBA 2XOXA 3T3HA 1MJ5A 2J3IA 3WWEA 3HKBB 3U0BA 1E2FA 4X7BA 1VE1A 5ICSA 3SYRA 1LK5A 1UJCA 4YFVA 3IXMA 1V1MA 4ZAXA 1QVZA 4Z9YA 1QCZA 1VZ3A 3FYCA 2LZ0A 5E3JA 3K1AB 3HUDA 3FNBA 3QI2A 5CW2A 1UMKA 2SNIE 2HWYA 4ZOLB 3WDSA 2XODA 3DW1X 1TKCA 5HKAA 1KOFA 1R10A 2DFNA 2ON6A 2P62A 4UOZA 2QVYX 4DSTA 1QU3A 3AVVA 2ZRHA 3RC9A 3GJYA 3WK6A 1PFKA 5EMLA 1L4EA 6REQB 1SNYA 2H2AA 3KUCA 1E77A 1JKJB 1UZAA 3A7EA 4N8EA 2CDRA 3STTA 1RFGE 1W0CA 4KIJA 1IQPA 1PJ4A 4GNRA 3CW8X 4P38A 1CNFA 1WXIA 2B6NA 3QI7A 4OM7A 4U8GA 3GLIE 1V4BA 2WZDA 3M34A 1X7ZA 2CL5A 3EWNA 3PNVA 4W7IA 1VI6A 3C98A 5AVKA 1KO8A 2VJMB 3RRZA 2Q1SA 3OC6A 3V2GA 4IDFA 4FN4A 5CH5A 1GTVA 2O2HA 2OV1A 2BI7A 3AFGA 3EWAA 1ZM3A 4IMIB 5DN6A 5E1MA 3CVVA 1VL5A 3G0GA 4YJFB 2NV6A 1G8JA 1J2UA 1J8VA 2R79A 1Q7EA 3C87A 3CKLA 4Q4HA 3RYFA 5LYJB 1AHNA 3BKWA 2ZWVA 2JA2A 3LNCA 1OJ7A 3L07A 5C1DA 1OTHA 3UMRA 5H7XA 4L5AA 4Q7LA 3O21A 1W0KD 3SQWA 3H1EA 2H2IA 4Q7MB 5SY6A 5L7WA 3KZOA 4EPYA 2GYUA 2V7UA 5NLLA 1NUQA 1TU4A 2EKBA 1I4EB 3LLSA 4MW5A 3KFXA 3SQXA 3WNDA 3FTFA 2A9KA 2VR1A 2J1LA 1YQDA 4WA7A 2DF8A 2HV9A 4Z9BA 3WAJA 3E70C 3PG5A 1RP1A 3GLFA 1RHRA 2RI0A 1P0PA 3DAPA 3TFWA 1NQXA 3HZHA 5AK3A 4JUBA 3DCIA 5CA1B 5HJEA 4WGFA 3QF7A 3L43A 2G9QA 3NGXA 4HLCA 1E3MA 3BTOA 5E0OA 2H2HA 1E5DA 2J9XB 3HN6A 5KTPA 2HU5A 1EFPB 2G40A 4XX0B 1TU3A 1QZUA 1OFHA 2OV3A 4Y1RA 3ZXYA 3O03A 2BSAA 1DIBA 2BL4A 3G7SA 3DP9A 2WUGA 3DOEA 3KL2A 3I01M 3NJ8A 4BMVA 3DJYA 4ER5A 3O8DA 1P4GA 4JSYA 1ZWKA 4FHDA 1H2ZA 2D1QA 1JW9B 2DR2A 3OOEA 4P7BA 3CXUA 4X8MA 3VO9A 1I0ZA 4FJ2A 3GYBA 1YS6A 5ECYA 3H5LA 3GQBB 4HXFB 1W93A 4BDSA 1JTVA 1XZBA 4M8NE 4BP1A 2FMTA 4M22A 4CNBA 5DM4A 4MTCA 3IPXA 1ZGJA 1IG3A 4IDAA 2IW3A 4IDHA 4XWKA 4N3GA 1P4AA 4IDEA 2PTHA 1BU8A 1C9DB 5IAJA 1AQ6A 1XEFA 3FD8A 4KBGA 5GIOE 3HDYA 3G9XA 2XECA 1P74A 1X86B 1TXGA 3F0TA 4Y9RA 3TAHA 3IELA 4GS5A 2AHRA 2PKRA 4TQUS 4OI0A 4XGKA 5ALUA 1Q6YA 3RTDA 2CMGA 4QFMA 1I9GA 1KP3A 5AW5A 2JJ2A 3LCJA 4JDUA 2O48X 1H6DA 1E2QA 4QATA 5EPEA 4RKRA 2V7XA 4AC9A 5HUHA 3KSDO 3WQQA 5JYBA 5LZ9A 3R8FA 1VPWA 4KIUA 4GPBA 4CMKA 5I4BA 4TQAA 3CT6A 2E1PA 2J0VA 5FX2A 2ZIEA 4BNYA 3IUYA 2OMEA 2ZUVA 4FP9A 2P0YA 2V97A 3AF0A 2QTCA 3L1KA 3U4HA 4F96A 5AVUA 2A33A 1JHMA 3L41A 4GUDA 4MV5A 4Q1EA 4R7GA 3I39X 3JSXA 3QEAZ 4N0MA 4U63A 1I7PA 1O89A 4MV8A 1E92A 2IDKA 4C3VA 1ODSA 2I29A 2PGAA 1XU7A 2TMDA 2ZZKA 3DWEX 3CKMA 4FQ8A 3P96A 3RTBA 3H05A 3TFQA 2PIDA 1CS0B 3N8DA 1KZYC 4LE1A 4RE5A 2ETVA 4L0QA 4WPGA 1DIHA 4AN1A 4EPWA 2NPOA 3MT0A 4QDOA 3Q11A 5JCXA 5LVAA 1YU9A 2ZXFA 4QU8A 2XE4A 2XWQA 4U2DA 3T4UA 2A5DA 3WX0A 5CVVA 3HS3A 2W6ZA 4E13A 4MNTA 1CV2A 4B3JA 2FY8A 5EVJA 1S3IA 1PNRA 2GERA 3QUTA 1XI2A 4QOSA 3HB5X 2QVBA 4NMXB 1NRWA 3WYGA 2FFQA 3ZX4A 5GTDA 1AA9A 3UHFA 3RF7A 4EWLA 1DCFA 1N4DA 3ZCPA 2ERXA 3COYA 2DHRA 4HB0A 1KJZA 1M6NA 1P44A 2XF2A 3DFKA 5K0LA 5TR9A 2II6A 2UXCB 1O6ZA 4D8UA 1M34E 1WMFA 4R1QA 3QKSA 3J80A 1HDIA 5A3SA 3K72B 2BGWA 1F4PA 4KHZA 4MRNA 2GZ1A 5H9VA 5C32A 3PC4A 4D6XA 3KPVA 4L4RA 2M6SA 3REQB 1T3TA 2AG1A 2B25A 3I9NA 3T15A 3WDMA 4BAGA 3GP8A 1TZJA 5IT0A 4FT4A 1KYZA 4MVYA 3LZDA 4IIFA 4YAWA 1MEOA 7AT1A 3D4LA 1LFDB 1YVPA 3SQOA 4NECA 4IINA 5LZ8A 1RXIA 4D42A 2RGDA 2IZ7A 1SD1A 2YYSA 2HJHA 1E62A 2IIBA 3IVGA 3IURA 4S12A 1A7JA 1W0KA 1A5BB 2WUEA 1VCNA 1J5PA 2DJ5A 4NYJR 2WTNA 2IXBA 121PA 1D4FA 2YVLA 3GJZA 4OB8A 1D4ZA 2GWRA 4YASA 3K94A 2G04A 5CJ2A 5ALKA 2O5RA 4LQ4A 3S2GA 1ZU4A 4LBZA 1DRUA 2WTMA 1BS1A 5DSTA 2F1IA 3SX4A 1WLYA 3NIFB 3MUEA 3R5FA 4P9NA 3D1LA 5TIIA 1XTPA 5IC6A 2SKEA 4CRWB 4F4DA 5ARCA 2X8WA 2XB2A 4LA4A 4GW3A 3R1IA 1BE6A 2GPYA 1JNYA 4RZ3A 2I6FA 5K3OA 1XDZA 3TTXA 2AZ4A 5IM4A 4C7OB 2P7IA 2NAPA 2PUGA 3TZBA 1XL0A 1Z2PX 3PTZA 2XF8A 4LY9A 1UC9A 3C4QA 5JY6A 3T1NA 1CFJA 3CNLA 4AKGA 2J5QA 4PGMA 4YFYA 1IUOA 3EVZA 3IAFA 3ZNQA 3B8EA 1VLMA 3VH1A 4YCSA 5FQNA 4EB8A 1RLJA 2I7XA 2F1RA 3AHHA 4OYHA