3RHUA

Epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
150
structure length
141
Chain Sequence
YSIEVRTHSALHVVKGAVVKTAGSDAKWTTSTYVKGNKGVLIVKAALEPDKWGIAAIEALANEKVKENAPIKIYELPREEAEKMFGEDMYDILKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRFRKSKGLLEIHFELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational design of high-affinity epitope scaffolds by backbone grafting of a linear epitope.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags De novo protein
molecule keywords SC_1wnu
total genus 40
structure length 141
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.54.20 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 3rhuA02
3.30.980.10 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-trna Synthetase; Chain A, domain 2 3rhuA01
2ZZEA 1TKEA 1V7OA 1NYRA 2ZZFA 1WXOA 1QF6A 1WNUA 2ZTGA 3RHUA 3WQZA 1TKYA 1TKGA 1V4PA 2ZZGA 2E1BA 3RFNA 1TJEA 1NYQA 3KEWA
chains in the Genus database with same CATH superfamily
4XR0A 3ZWDA 3ZTYA 1QF6A 1WXOA 2B5LA 2B5MA 3EI1A 4AR8A 2ZZGA 1WZCA 2Y50A 4XR2A 1NYQA 2Y6IA 3I7LA 3I7OA 5FQDA 4ARFA 1V7OA 2HYEA 4A0BA 3I7NA 4AREA 4E54A 4CI1A 1WNUA 4A0AA 4A08A 4XR1A 1XVIA 3E0CA 2Y3UA 3I89A 3ZX5A 2IUTA 4CI3A 3RFNA 3I8CA 1TJEA 3ZU6A 2IUUA 4CI2A 4E5ZA 2ZZEA 2I06A 3I7PA 1NYRA 1ECRA 3RHUA 2IUSA 3ZTWA 1TKYA 3ZW7A 2EWJA 2E1BA 3I7HA 4A09A 4TZ4A 3ZUPA 3EI4A 4AR1A 2ZZFA 2ZOSA 3KEWA 3EI2A 3ZWKA 1TKEA 3I7KA 4A11A 3I8EA 2ZTGA 3WQZA 1TKGA 3ZX4A 1V4PA 3EI3A 2I05A 4XR3A 4AR9A
chains in the Genus database with same CATH topology
4XR0A 1QF6A 1WXOA 2B5LA 2B5MA 3EI1A 4AR8A 2ZZGA 2Y50A 4XR2A 1NYQA 2Y6IA 3I7LA 3I7OA 5FQDA 4ARFA 1V7OA 2HYEA 4A0BA 3I7NA 4AREA 4E54A 4CI1A 1WNUA 4A0AA 4A08A 4XR1A 3E0CA 2Y3UA 3I89A 2IUTA 4CI3A 3RFNA 3I8CA 1TJEA 4CI2A 2IUUA 4E5ZA 2ZZEA 2I06A 3I7PA 1NYRA 1ECRA 3RHUA 2IUSA 1TKYA 2EWJA 2E1BA 3I7HA 4A09A 4TZ4A 4AR1A 3EI4A 2ZZFA 3KEWA 3EI2A 1TKEA 3I7KA 4A11A 3I8EA 2ZTGA 3WQZA 1TKGA 4AR9A 1V4PA 3EI3A 2I05A 4XR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZZE A;  1TKE A;  1V7O A;  1NYR A;  2ZZF A;  1WXO A;  1QF6 A;  1WNU A;  2ZTG A;  3RHU A;  3WQZ A;  1TKY A;  1TKG A;  1V4P A;  2ZZG A;  2E1B A;  3RFN A;  1TJE A;  1NYQ A;  3KEW A; 
#chains in the Genus database with same CATH topology
 4XR0 A;  3ZWD A;  3ZTY A;  1QF6 A;  1WXO A;  2B5L A;  2B5M A;  3EI1 A;  4AR8 A;  2ZZG A;  1WZC A;  2Y50 A;  4XR2 A;  1NYQ A;  2Y6I A;  3I7L A;  3I7O A;  5FQD A;  4ARF A;  1V7O A;  2HYE A;  4A0B A;  3I7N A;  4ARE A;  4E54 A;  4CI1 A;  1WNU A;  4A0A A;  4A08 A;  4XR1 A;  1XVI A;  3E0C A;  2Y3U A;  3I89 A;  3ZX5 A;  2IUT A;  4CI3 A;  3RFN A;  3I8C A;  1TJE A;  3ZU6 A;  2IUU A;  4CI2 A;  4E5Z A;  2ZZE A;  2I06 A;  3I7P A;  1NYR A;  1ECR A;  3RHU A;  2IUS A;  3ZTW A;  1TKY A;  3ZW7 A;  2EWJ A;  2E1B A;  3I7H A;  4A09 A;  4TZ4 A;  3ZUP A;  3EI4 A;  4AR1 A;  2ZZF A;  2ZOS A;  3KEW A;  3EI2 A;  3ZWK A;  1TKE A;  3I7K A;  4A11 A;  3I8E A;  2ZTG A;  3WQZ A;  1TKG A;  3ZX4 A;  1V4P A;  3EI3 A;  2I05 A;  4XR3 A;  4AR9 A; 
#chains in the Genus database with same CATH homology
 4XR0 A;  1QF6 A;  1WXO A;  2B5L A;  2B5M A;  3EI1 A;  4AR8 A;  2ZZG A;  2Y50 A;  4XR2 A;  1NYQ A;  2Y6I A;  3I7L A;  3I7O A;  5FQD A;  4ARF A;  1V7O A;  2HYE A;  4A0B A;  3I7N A;  4ARE A;  4E54 A;  4CI1 A;  1WNU A;  4A0A A;  4A08 A;  4XR1 A;  3E0C A;  2Y3U A;  3I89 A;  2IUT A;  4CI3 A;  3RFN A;  3I8C A;  1TJE A;  4CI2 A;  2IUU A;  4E5Z A;  2ZZE A;  2I06 A;  3I7P A;  1NYR A;  1ECR A;  3RHU A;  2IUS A;  1TKY A;  2EWJ A;  2E1B A;  3I7H A;  4A09 A;  4TZ4 A;  4AR1 A;  3EI4 A;  2ZZF A;  3KEW A;  3EI2 A;  1TKE A;  3I7K A;  4A11 A;  3I8E A;  2ZTG A;  3WQZ A;  1TKG A;  4AR9 A;  1V4P A;  3EI3 A;  2I05 A;  4XR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...