3RHWF

C. elegans glutamate-gated chloride channel (glucl) in complex with fab and ivermectin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
221
structure length
191
Chain Sequence
b'EVQLQQSGPELVRPGASMKISCKASGYSFTGYTMNWVKQSHGKNLEWIGLINPYNGGTSYNQKFKGKATLTVDKSSSTAYMELLSLTSEDSAVYYCARDGDYYRYGRYFDYWGQGTTLTVSSAKTTPPSVYPLCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSTCNVAHPASSTKVDKKIVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Avermectin-sensitive glutamate-gated chloride channel GluCl
publication title Principles of activation and permeation in an anion-selective Cys-loop receptor.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Transport protein/immune system
total genus 33
structure length 191
sequence length 221
chains with identical sequence G, H, I, J
ec nomenclature
pdb deposition date 2011-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rhwF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rhwF02
1MWAH 2RAMA 5FUOL 5K9JL 1YYML 5LAXB 4X4ME 5DUBA 3D2UD 2BSRB 4JY6A 2X4PB 5IB1A 4KVNL 3O81A 3WBDA 4G8GD 4DVRL 5F7DB 4CMMB 1N7MH 3BDYH 1I8LC 4GW1B 2VKWA 1S9XA 5HYFA 1GL4B 1DN0B 1NKRA 4S1SL 4X4ZA 3T1FA 4XNQA 4C57C 2NW2B 2XA8L 4L8SB 1FFQA 3SPVB 4EI5D 2ZSVA 3UBXA 4M7KH 5FKAB 2RBLA 4KKCC 5JNYB 3RPIA 1E27A 4X98B 4N8CL 4WEBH 3T0WA 3PF2A 5HVHB 4BSWB 2OJEA 5E6IA 2VLRA 5DTFB 2C4FU 4M7ZC 4UQ3A 4G6AC 3HFML 1NGZB 2H6PB 1JPSH 2FO4B 3U7YH 5I15H 1J8HD 3C08L 1AE6L 2WINA 5IGXL 1H8OA 1KXQE 1SBBA 1PY4A 1CGUA 3CFCL 4U1SB 4LLMA 1YMHA 1OLLA 4Q2ZA 4RMUA 1FLRL 2FCBA 5DJDB 1Z5LA 5JW5B 1T80A 3IKKA 4Y88A 5FCUL 3RVWD 5B3NA 3V7MA 3HAEG 1R3IL 4OCYL 4PRIE 5ETUB 4A2LA 2HKHL 1HYSC 4QXUH 2G9HB 5DHYA 5T33L 4D9LH 1ZV5A 4PJFF 2Y5EA 1YDPB 4LQ1A 5GS1A 5HYEA 3OAZH 4GMSL 3ZE1F 5IR1B 4HXBL 3RWEB 5DVLA 3MLZL 3S35X 4POZD 2O5XL 2D7QA 1NUNB 2QSTA 3DMMD 1J86A 1CDHA 1FH5H 2W9DH 3NVQA 2R0ZL 1N0XL 4JQIL 2CJUL 3V4UH 4U1LA 2FJGB 5JUEH 1F4HA 5IVZB 3ZYIA 4F58H 5EU6D 1H0DB 2HLFD 3S98A 2WUCH 1A1OB 3HS0B 2XTJB 5HYIA 4PB0L 4ELKA 3V6BR 3JWNC 4IRZL 1HCFX 4UB0L 3IU4H 1XR8B 4NRXA 1E0OB 2CO6B 2AJUL 4MA1B 1G7PB 4X6CE 4X99A 1OOAA 4JPVL 3ULVC 3H3PL 5CJQH 3M1BB 3RIAF 5HHNA 5I16B 4PJAF 3HPLA 5DFVD 3DVIA 4U1GB 4PG9A 1SY6H 5E99H 3JTSA 1JZ7A 3UYRH 1JN6B 1X5XA 2WUBL 5EPMB 3SQOL 3OR7A 4LCCA 5F9DC 1A6AA 1JGLH 1H5BB 4JM4H 4QTIH 4J3TA 1A4KB 4U4BA 1F11B 1C08A 1QRND 1T03L 2NXYD 3WMSA 3N50A 3S88L 4M8VA 4YGAB 3QUZB 1IM3B 3BGMA 3FMGL 3TFKD 2P8LA 1DANT 4H5SA 3FFCE 5DJ2B 4HMDA 5C0GB 1MFDL 3VXSD 3HRZB 1S8DB 3TA3C 1NANH 5DFTA 3O4OC 4MQSB 4OZHB 4PJEE 3BAEL 3BHBB 2IJ0C 3GBNH 5IK3B 1DL7L 2H1PL 3QWQB 2DOCA 3N1FC 1JF1A 5I2IA 5KANI 4ZMAT 3BP4A 4KUCF 3DBXB 1TZGH 4V1DB 4KV5F 1OTUC 3VD4A 3FOMB 1S7TB 2B0SH 4KU1A 5FM5M 4K71B 3ARBA 4JN2A 1WIPA 1G7HB 4XCNB 1N2RB 1S5IL 2H2SC 3FB5A 1BQHB 5JMRA 1MIEH 4HGWB 3RWDA 4LK4A 1RHHA 5DJ6A 1K8IA 3EGSA 3MREA 1HQ4A 5E9DE 5F21B 4MNHA 3TO4C 4EUPA 5FFLA 2AVGA 2HT4D 4CL7A 5IBUG 3NH7L 2UZYB 3LKNB 3HG1A 2Y6SD 3CD4A 3K46A 4L8BB 4MNGA 4UT7L 4OQTH 3MYJB 3QQ9C 4E41A 2H8PB 4KROC 4WO4B 3C60B 1SMAA 4WVRA 3QWOB 5IW1B 3R8BB 1DBKH 3CZFA 1MVUB 5I1GL 2AQ1A 3V79C 4QRTB 3Q5OA 3N85L 4JFHD 1U2CA 2BVYA 3BPNC 3NA9L 4G9FA 4XCEB 1H3XA 4CVZB 4OCWH 5FYLH 1U8PA 4ZS7H 4PGBB 2X1OA 1K4DB 1MEXL 3WHE0 3C5JB 1A9EA 5I74C 4PJFB 4O5LH 5ABDE 1NFKA 4OD3H 1J5OL 5ALCH 3LHPH 4GS7C 5HYJE 4BM7A 1GZQA 1YEDB 4WUUA 4N0YH 5T1LD 3BUYB 1BQUA 4OD2B 5AG8A 1RZJH 3VE0B 3WCYA 3H9HA 4LDOB 1NC2B 3D0VA 4JFXA 1RUMH 5MERA 4X0KB 4TUJA 5GS2D 2X4TB 3S34L 3EBAA 2JIXB 2CD0A 3MCKA 4GMTH 1I1YA 3HI1A 4MJIE 2VDPL 1N8ZB 3K3QA 4XRCA 5IMOB 2OMNA 1MFEH 1WZMA 3D39D 4JPKH 3BVNA 4WU7A 1RZIB 4Y89A 5CBAA 3P4NA 4LSPL 4BELD 2I27N 3D6GA 4KH2A 4M61A 4PJAB 3CDGA 4ZSOA 1J0JA 1XGQB 2QL1A 1ADQA 2O5YH 3MACL 2LAAA 4PREB 4I77H 4LP5A 4ZAKA 5GZOD 1MF2H 3D85D 2MCG1 5D96B 4GLRH 3DXAA 3OB8A 5CMAB 1G84A 1JHKH 1CL7L 1MSPA 1OVZA 4PJ9A 4R97B 3WLWC 3BQUB 1JHTB 5L9DL 2W0KA 4XP6L 2H32B 1V8HA 3X11B 2N7BA 1X5ZA 4HD9A 2HG5A 3O3BB 3MGTA 1VADB 5IIEA 2WP3O 4S11A 1KCVL 3EIFA 4OT1L 2J6EA 7CGTA 1N6QH 4K7FB 4L4VB 3TYFA 4YDIH 3HMWL 1HN1A 4PLOB 4D2NA 1WV7T 1ZOXA 1CQKA 1N6VA 2GIYA 3E2HB 3O3AB 3NFNB 1CDCA 1MRCH 5FDWA 4ETYA 3MRRB 5FV2A 2H9GB 4G5ZH 1UVQA 2GUOA 4ENEC 1BREA 4LPUA 4W68A 5FHAL 3FT3A 2VWEE 5DRNA 4RGMB 2BHUA 2PXYB 5KN5B 4M6NL 4QHLB 3THML 3L5IA 4ZUTA 3I6KB 3TBSB 3KPOB 5ELIA 1LNUA 4OKVB 2EC8A 4QTHB 5DJAA 2RIKA 3D9AL 1QSFE 4G7YH 1N5AA 3O8XD 3H3BC 3QXWA 3OXSB 2ZSWB 1I4FB 3B2VL 4GKOA 4PJIE 3NOIA 4TPRL 5I1LB 3OKOA 3QHFH 4LAQL 5DRZA 5HHMB 4KRNA 1X5JA 3QI9D 3NMEA 3RGVA 4OIAA 3UXFA 3RWGB 1QHPA 4Z7QF 5IVOA 1LE9A 5IEKA 3TZVA 4WUKH 3QJFB 3PV6B 1RUKL 4W4OA 2M1KA 4YPJA 5EU4B 2VSDA 3TIDA 1JPFA 3FQUA 1BJ1J 2A6JA 2ERJB 1A7PH 5SWSA 3UBXG 2ICEB 3MJ9H 4NO3A 4ZUWA 1ZVYA 5CD3A 3FB8B 3CSPA 3MRMB 3MBEA 4JB9H 1UKTA 3OKEB 1UJ3A 3SGEI 4PJ8C 5F1NA 3LB6D 4IRJB 4QRPE 4V2BA 4TTDD 5SX4I 4PJGE 4M1GL 3EZ8A 4LLYA 2YUZA 2C1OB 5MENE 5BRZA 2DM3A 3B9EA 3MNVB 3VMPA 4OGXH 1BIIB 5D6CB 5B38G 2FEEL 1C16B 4J6RH 5KAQF 1MIMH 1JGEA 4JY5L 1NFIB 3MV9B 4ODVH 1RULH 3REWA 3A6BL 1BLNB 5DA0B 3X3GH 1NCUA 1XH3A 3MJ7B 3RBGA 5IESH 1D5BA 2GT9B 4NBYB 5EUOA 4XP5H 5EO1B 4PJCA 4WFHD 5JW4Q 1R5VB 3GSQB 4LL9A 5ESVB 4Y1AB 4WCYL 1A6TA 1EUTA 3EYVA 2YBRB 1NGWA 3FFDA 4G8GE 4K2UL 4LCUA 3LQZB 4GRLB 5J0BA 4DN4H 3MUHL 3GIVA 3OHXB 3OMZA 2O26U 3VXQB 1BGXH 5E8NA 1CT8A 1T7XA 2QEJA 4ORGB 1TVBB 5KSUB 2AK4A 4IOIA 3SDDB 1U8QB 5C6WH 3ROLB 4DZBB 3S35H 5F7YC 2NYYC 3MJ6A 3NA4A 1L7TL 1CFVL 2MJWA 3JWOC 3DHMA 2VZ3A 3MV8D 1KOAA 5IFAL 1YZZA 4OF3A 5IFHL 1G0YR 1EFXA 1QSED 1J8HE 4L1DA 4P4KC 3T0BA 4NN5B 5D1XB 3WFBH 2HFEB 1Z3GH 4JG1H 4Y16B 3V5KA 4M7LH 4PJXA 1CLYL 2VSCA 4XHQA 3MLYH 1M1SA 4LLVA 5A2IH 1QTYT 1F2QA 5IROC 4IS6B 1MHEA 1V3MA 5EC2A 4Y5XC 3UC0L 3JV4A 3TYGL 1RJYB 2EDRA 4DOHB 3T1WA 5T1MB 3VG0H 1T20A 4GXUM 4HIHA 1RIVH 5JXAL 2F8XC 5DUPH 1JIBA 4YK4B 5BZDA 4BQBA 1ZHLA 1F3JB 3GMPB 2PTUA 2H41A 1QOKA 1YN7B 2XZQH 4R90H 4MA8H 1CFQA 4BFGA 5T3XL 2QQLL 1FSKB 4I5BA 1NBZB 1RAMA 2X1QA 4IMKC 1YNLL 3U46B 3S4SA 4PGJA 1RJZA 5A2KH 5C08B 2VB5A 4NO2B 2HVKB 4U6VL 5EU6E 3ARDC 3BP6A 3TBWB 5BZWA 3B43A 4AY0A 5JHDD 2CQVA 2BP3A 1J0YA 3O41A 4ZUVB 3S5LA 3TN0D 4ZOCA 3OJ2C 2RQ8A 2V2TA 1EEQA 4RAVA 3HN3A 4CJ1A 1NAMH 3U36A 3U83A 1MAJA 1MLCB 2NY1D 1OAQH 1KPRA 2D7PA 5C8JB 3V6ZA 4FTVA 2FL5B 4XVUD 2VAAB 2VH5H 4QHMA 5GS2H 3D2UB 2VXQL 4NNXB 3MRHA 4LSUH 3KPNB 3A6OA 1I8IA 5JQHC 3SJVB 1UB5A 2HH0H 4M6MH 1TXKA 5I74B 4JEGB 2DIBA 1DQMH 1CVSC 2HTKD 4PUBH 1QRNE 1EBAA 4MD4A 2HFFB 4JQXC 1U93A 2GHWB 3HB3D 3ZE0F 2J7LA 1ZT1A 4MJ6A 5E2VH 3H6JA 2CIIA 4LSVH 4HUWB 1M71B 2YOCA 2I26N 3TVMB 1QO3A 3R1GH 4XH2B 3V7AG 3VXSE 4OLYH 1RJLB 1SYSB 3VFTB 4LHUB 2M26A 4NC2B 3BD4A 4P0DA 3L3KB 3VWJB 5F44A 4EDWL 1D5MA 2E7HA 3RVVD 3CK0H 4YH6A 4NQCB 4ODXB 4YFLF 1KELL 4CMHC 1WBZB 2AXHA 2ITCA 2C1PB 4F2MA 5CSGA 5F96L 4GG6B 3TPUA 2MHAA 1FYTB 4HKXB 5I1KL 3RZCB 4PTUA 4OIIL 2P4AB 4OLVH 3O6LH 2EDTA 4KJWC 4NKOB 4K8RC 4F7MA 5JR1H 3BE1H 2HAZA 4X6FA 4PG2A 5EBMB 1S9YA 2AABL 4OLXL 4N9OB 2Q8BL 4R4ND 2CLZB 3FQRA 4YR6B 3PWLB 2XRAH 2IEPA 2YR3A 1MCWM 4LCWA 4UT6H 4YBLB 1KEGL 4OSUL 1DLHB 2B20A 4P5KA 4X6CA 4NO5A 2ATPB 3JXAA 3IFLH 2BX5A 1IEAB 1RPQA 2ADFH 3FRPA 4FFZH 1JWUA 3BZFA 4KK5C 3EO9L 2E5EA 3LIZL 1WEJH 4MA7H 1R24A 3UPAA 5IM7B 1QVOB 4X5WB 3MV7A 5DS8A 4KKLD 4KPHL 5L2JB 4JFHE 3P0YH 1F42A 4I2XE 1TNNA 5IB3A 1X3DA 5DR5H 1MJ8H 5TQ0L 4AEHL 4HULB 5K9KA 1II4E 4NHCH 2CKBH 5SX5K 1YEEL 3MRLA 4XPGL 1UM5L 3SKOA 5C6TL 1Z2KA 1YY8B 2ESVB 1ERNA 2NY3D 3E0GA 5HDOA 1F6AB 4JZJA 3WL9B 1TZIA 2YWYA 4OCRH 3T0EC 4LVNC 5HXMA 1F2XK 3HNVL 4NKDB 3E6FA 4U6TA 5JO5B 3QCTH 1KPUA 3BKML 4L29A 5DD1H 1IEBA 1TVHA 5CEXA 2IQ9H 3HZVB 1CGTA 1QBML 2P8PA 4W6WB 2VTFA 3IDXH 1NLDL 3PHSA 4WV1C 1AD0A 4XT1C 4OZGF 3IXAB 3L3HA 4OLZL 1CD1A 2IFFL 3I6GB 5A16A 3O6FB 2ATKB 5KSVA 1MQKL 4I18A 4NQEA 3RWCA 3ULSB 1K4CA 4YWGH 1FL6B 3WS6A 3H3KA 3V95A 3FJTA 5I66A 1T5XA 1F4XL 3D39E 5BS0A 2BMKB 5TDPA 1G7JB 1PVHA 5E4EB 3L1OL 1U2HA 3L7EA 1FBIL 2E8YA 4BFBD 3P4MB 3D5OF 5EC1A 3RUGB 5GGQH 1UENA 4Q97A 1B0RB 1N26A 1C5CH 3VGDA 4Z95L 2B2XL 4HXAL 4BZ2H 3U0TB 2CLRB 3NIDE 5I1HL 2VYRE 4Y4FC 1X4YA 2E9WA 4RIRA 1T5WA 1R5IB 2XG4A 3VDAA 5IBLC 5ANMA 3VWKD 1JGDA 4JZNB 3IYLW 1LO0H 2DICA 2VDOL 3V4VH 3L3DB 3HE7C 3MFFA 1LO4L 1LK2B 2ZCLL 1DN2A 4WFED 5GZNC 1U8NB 4XZUB 1S7SA 1IGTB 4WTZG 1GPOH 4ONFL 2IMNA 4OZGE 1MOEA 5AZEL 25C8H 4IMLA 1FO0H 3TT1H 4F15C 5I18L 4YDJA 1ES0B 4UDTA 4PJBF 1B0GA 4G7VL 1RK0A 3O3UN 3SGJC 1A5FH 4HF5H 4KDTA 1YNTA 1UB6B 1G9ML 4D94A 2IMMA 5HVWA 4BK4A 3MLPA 4R7NA 3L7FB 4I1NB 3PWUA 3NBNA 4MJ5A 1ZHNA 5D7LA 4D3CL 1GGBL 2VZSA 3QDGB 2IPTH 5CD5C 2BNUB 2XZCL 3JWDL 3UJJH 2MSPA 1IQWH 2DMCA 2Q86B 5F9OL 4N9GB 5L88H 1FGNL 1SY6A 3G6AA 3CUPA 5FYKD 4LIQH 4WRLA 1GOFA 1TCRB 1A3LH 1ODAA 1N59B 5CILL 4UIMB 4P9HH 4HGMA 5DD3H 2YZ8A 1NCDH 1P84J 4JG0H 5C0BD 3DRQA 3S7GA 3KDMB 5DWUH 1CGXA 4DKAA 1Q9LB 3DO3A 2D3VA 3FTGA 3TBYB 2EIZB 3L5XL 4CKVX 3SGKA 1AGBA 1ZVSA 3PWNB 5F1SA 3SGEH 3G5YA 4JRWA 2ADJA 5LGJA 3KG5A 2AGJH 3SKJL 1D9KC 4F7CB 2NZ9D 4HKBB 3EYOB 4X6DF 3O4LB 2AJYL 2YZ1A 5ENWA 1YN6A 2NCMA 3ZTJH 4RGOL 5KSBE 4MX7B 4HEPG 4HMEA 5KZCD 4LU5H 1I3GL 1VDGA 5L2KD 5E00B 5HGBB 4Z5RB 2XN9A 1I9JH 5CJOL 3GRWH 3CNKA 4YPGB 2YXFA 2GCYB 2NZIA 6CGTA 1AGEB 1AHWB 4L9LC 4XNMB 1EXUB 1OGAD 2HKFH 1Q9WB 3D18A 3MXWH 1R0AL 1AGCB 2J88L 4OFYA 3VI3F 5IFJB 3TBVB 3C8DA 3CLEL 3R0MA 4F7PA 4X80H 1U8HB 5DK2B 5JORB 2YPLB 1JNNH 1FP5A 1INDL 1S7XA 3QEQD 1C8PA 4WWKB 4FFYH 3QIWD 3B9KB 3DROA 1JUFB 5GGUB 5D2LF 4KKCD 5BV7L 1OAXH 3MXVL 1CZ8L 3U9PH 3PGCA 4P9ML 2YN3A 4O58L 4WFHE 3WXWH 4I9WD 2RCSL 5J1SC 1X9QA 4MS8C 1QRKA 4X6DE 1RFDH 5JIIA 2Z0BA 3SDAB 3H7BA 1RK1B 4M5YL 2A6DB 3WFDH 2YD9A 3U4BL 1JTOA 1KCUL 1KNOB 4FQCH 4MAYB 3WIFA 4BFIA 3I75A 5HDLA 4PJIA 2IAMB 2X05A 5K9OB 4N0CC 4F57L 4CNIB 5DEGA 2P5EB 5T1DH 1V3JA 4YHIB 3DX6B 2WWKO 4X7TA 4W6YB 1LMKA 1X4ZA 3QIBB 5T5FH 3U4EA 5ID0B 4AENA 5HJ3A 1KFAH 1ND0B 3QT2A 1HYSD 4Q6YA 3QUYC 3GJFB 3VI3E 3MV8E 4NO0B 2Q3ZA 4X4YB 2V7NA 3GMQB 1PLGL 1QSEE 3BW9A 3F7YA 4PRPA 3ARZA 4G42A 3FO1A 1R3KA 2RB8A 5J6GA 4PV9A 2JCCB 1I75A 3TNNB 1Q0XH 2X4SA 1MREL 1FN4B 4PJBB 3TBTA 5EZOL 1A7OL 3F7VA 5F1KC 5I1AB 2L4OA 2IADB 1ZLSL 3LPWA 1DQDH 4OLWH 3GSXB 4X8XA 3WHXA 3J7HA 4EXPX 5IMLB 3C5ZB 3QEGH 1AGDA 2E6PA 3FCTA 3K1DA 2YEZB 1A1NA 5EOCJ 3SKNA 3QYCA 3ZTNH 5MEOB 4WHDA 3ULVD 3CVHB 3PP4L 1NJ9A 2CR3A 1BBJB 1DVFB 4FQXD 4KTEH 4F3FB 2Z91A 2E9JA 1Q9OA 3GI8L 3F12A 3CU1A 1D6VL 1UKQA 1AR2A 3GHEL 1UQSA 3MCLL 1A0QL 1TZHB 3QHZH 3WIIH 4JRXB 1U58B 3L3IA 3QH3B 1U8KB 5JHDE 5GGSA 1G6RB 3VXMA 1Y18A 4L5FH 1U95B 2I60H 5ILTH 4FZEH 2MFNA 3U0PB 3QNZB 1QD0A 4GQ9H 4OUOA 2X6MA 4JVWA 2V5TA 3GO1L 1CICB 4Z0XA 1JZ2A 1JV5B 4U1KA 4X6DB 1A47A 4KJPC 3LEVL 2HYMA 4IRSA 5FO9B 1N4XH 3TJHC 5ADOL 3FRPG 5BXFA 1T0MA 3MBXL 5AUMB 1W0WB 3WKNA 4HUUB 1QSVA 1OTUD 3I2CH 4GKNB 1G7QB 4TNWK 4XP4L 1J8HA 4PRNB 1VENA 3KPSB 2Y7QB 3GMNB 2H2SD 1TITA 1J7VR 1XGYL 4UUJA 2WQ8A 3HC4L 2R8SL 4WV1B 2PW1B 1JPTL 1MCLA 3ARVA 3Q3GB 3VU2A 3TO4D 4WI3A 3QB7C 4NZUL 4QRRD 4JDTH 3G5VB 4P2OA 2VE6A 3FO2A 3FT4A 2V2WA 5D2LB 3UPRA 1P4LA 1UH3A 1QA9B 4YIQA 5E2UL 5CAYB 3VFNA 3MNWB 5CP3H 5TJWK 1P7QD 3T2NL 4PRBB 1IFHH 1F6FB 2AJ3A 5I8CA 4KROD 1EO8H 5DGRA 2AQ3A 3Q5YA 4QOKB 5DJYA 3PQYB 5GJTH 2BZDA 4HPOH 2HJFB 4JHBA 4Z77B 4NKMB 4LFHD 4JFPA 3BJLA 3EYSH 1P84K 3MLRH 3UYPA 4OZIE 3UX9B 5KBNC 4UNVA 1NCWH 1D5XB 2CR6A 3MRQB 4FP8H 4RFOL 2PYFB 3ARBC 3V9FA 2VQ1A 3MJ9A 2E7LC 5DI8A 3CFEB 2X4QA 4GAJH 1I7TA 3W0WB 1IC5H 3O3EB 2DJSA 4DKFL 1W72B 1WGOA 5GRYA 2UZIL 2VLJB 1ZTXH 3UTZB 2UYLB 3BEWA 2GSGB 1F97A 1QR1A 5F3HA 5FYKH 3DO7A 1QKZH 1DBAL 1ZS8A 3RX8A 3VXRD 1TJGL 3UDWA 1ZHBB 5FGCB 1SVCP 3EDFA 1IJ9A 5ICYA 1BQSA 3GJEB 5J8OA 3WUWA 4NN6B 1WAAF 1NPUA 1PFCA 2AEWA 1UM4H 4CW1B 2WBJA 5FOJA 3OKDA 1TJHH 1KLGB 2NMSA 5I8KL 3VH8A 1IQDA 1OW0C 2UY7A 4MHHG 3QQ4A 2H32H 2QKIB 3KR3H 2YKLL 4IIQC 1NMBH 2VLLB 4E5XB 4OB5H 2D7TL 3T4YB 4RQQA 1S7QA 4TULH 3RWFB 2FSEB 4RBPH 1MRDH 3H9SD 1CE1L 1FZKA 4OGAC 4XNUH 1OM3H 1MHPL 2MKLC 4ZQKB 5IW6A 4U1MB 1S7WB 2HJLA 1ZGLM 1IGYA 5D5MB 3ALWA 4KK8D 4Y5VA 1PKQA 2EYRA 3C2SA 4MA3B 4EVNB 5LCVL 3WLWD 1NFDF 2EIBA 3FKUS 3KYKL 2R0KH 2XV6B 1QFWM 5EZIL 1D9KB 5DUML 2UWEA 1WAAE 2VZ1A 4WHTB 1KJVA 1K5NB 4NSKB 3T8XA 5MEQB 1KXTB 5LJYH 5TE6H 4YJZL 3EOBB 1NUFA 1DUZB 4NQTA 2PNDA 5FA3A 1AQDA 4PRDA 4NT6B 1XMWA 3NTCH 3BEVA 2W0LA 3ARWA 3MLSL 1KJ2L 4L9LB 4QRQA 1JRHL 1FNEA 2PR4L 5E2WL 2DAVA 4ZAKC 2MQCA 4L4JA 3BN3B 4WFEE 3WN5B 4XMKL 2QSVA 4I2XA 1YUHB 4DAGH 1ZA3B 5GS0D 4B53A 4EBQH 2GITB 1VERA 1IAOA 5I71B 1P5UA 4XPAH 1YEHH 3ZO0A 5KOVC 5LWYL 1EUUA 3QUXA 4XNXH 4HWBH 1GYAA 4TUKL 3IXTA 4XCFH 3IDJB 5IB5B 4A6YL 1U0QA 4QNPE 2HRLA 1I9IH 3W9DA 1VPOL 3BYTA 5KVFH 3LD8C 1M4KA 3EO0A 3S36L 1LEIB 3PWPD 5FA4B 3WS3B 2NPLX 3LKPA 3UZEA 1CFBA 2J4WH 4N90D 1TCMA 4HC1A 5T5NG 4KQ4L 2BVUA 1S7RA 4RBPK 3PJSA 3EJZC 5A2JH 5GJSL 1FNHA 5FYKE 3MRFB 3WUZA 4PJHA 3DPBA 2NLJB 4XVSL 5CEZL 3OZ9H 1WJ3A 4F33B 1MLBA 1GIGH 1WCQA 5I1IH 3ULVH 4ZO9A 5C0BE 2YD1A 5IF0A 1Q8MA 3O6KL 4YXLH 3KPMA 1EAPA 2FRGP 4PJ8D 2DM2A 1GOHA 3SCMB 3RY5A 2JB5H 4TSBH 1LP9A 4X6EB 3BMVA 3LN5B 1NDGB 2BNQD 2JB6B 1BMGA 4BZ1H 5SWQB 3BT2H 1G7MB 1SYVA 4DGVL 5IMMB 3BKJH 4IBLT 3O2VH 5DDHA 3FONA 5IVXE 3RGVC 5L0QC 1KULA 4ZDHB 5I17B 5L2KE 3ZT6A 3C09C 2VQTA 4W4OC 1A6PA 2K3TA 1OAKH 1BX2A 5DEFB 4ZYKB 5B38B 1B4JH 1ZA6B 1NCCH 2YWZA 4Q9QL 1PY9A 1A14H 3RDTA 5J6HB 3DGCR 1A02N 3VXUA 5FV1L 4D9RD 1ZT4B 2RFXB 5CEYA 3CFBB 1OGAE 1YEGL 2F53D 2BSTB 2DBJA 1M7XA 1R3JA 2BXZA 3DUUB 2XWJB 3U0WH 2JJSC 3DSFH 2V7HA 3WJJA 2EKJA 1P9MA 2OL3L 3QEQE 4ODTL 3IJSA 5E08L 2FX7L 4CN6A 3LZFL 5JA9A 1XR9A 1QBLL 4QKXB 3U9UA 1E6OH 2X44D 2YPKA 1NFDB 2F54A 5I0ZA 1CTOA 4I9WE 1RZKL 4CN1A 1UT9A 4JFDB 5EOQH 3GMLA 1OARH 1IGMH 4PR5A 2DWEB 4CAGA 3G6DH 5AYQA 4P4KD 5E8DH 2OQJA 4JFEB 1XGRB 3ULVF 4U1JB 1OP5H 4M9PA 3VFWB 5C0EA 3QNXB 4MWFA 5GGTH 2EC9U 2CKBA 5C1MB 1K8DA 3VXOB 2ADGB 1DTUA 3GSWB 4ZUUB 4M1DL 8FABA 4AG4H 1CK0H 1RVFH 5C0CA 1O7VA 4NQSA 2A6KA 5ACMA 1BIHA 5C0BB 5AAMA 3NCJL 1A6UH 2EDLA 4WI6A 5DJ0A 4HIXL 4LAJH 1AQKL 3V2AR 5C9JA 4JKKA 4YDLB 5EB9A 3OF6A 4HH9A 1T1WA 3EFFA 5MP6L 5AEAA 5HDQH 3BO8B 4UIKH 3ARFC 4NJAL 3MRKA 1UM6L 4YDKH 4YEFA 4BH8A 3ARDD 4PYGA 3O2WL 1EO5A 2ORBH 1MH5A 2GTZB 1IT9L 4UU9B 4PJ5A 3PL6B 2D7OA 1OAYL 5JXED 4MSWB 5AWNH 4U1NA 3MRCA 4OLUL 2Q7YB 4W6XB 3ULVE 5DYOA 3CCHA 2J2ZA 1I8KB 3F8UB 2B4CL 3TV3L 1WIUA 3DX7B 4GT7A 2C3XA 2VRAA 4GW5B 4XP9L 3B9DA 4LLQA 1HSBA 1GC1L 4HWZB 4L8DA 4HLJA 4NN7C 3TT3L 3NN8B 2PYED 1VACB 2GFBA 3ILPA 4JFQA 2A1WH 2AXFA 2BERA 5IKCB 1U3HC 2V17L 3T2OA 5DGQA 4OAWA 5C07D 3B4NA 3UTSD 1MCPH 1T4KA 5F89B 5KS9A 1DQJA 4JM2C 4NQDD 3VJ6A 3VW3H 2V2XB 4U3XA 4ZUSA 5E2JA 3AREA 1WFOA 2WANA 3Q6GH 4MNQB 2PTVA 1CXEA 3EJYC 4P2CG 4ONHA 1KJ3H 4MD0A 1WICA 3WDJA 4GSDL 1BQLH 4WJ5B 2R2EB 3C5SA 5CZVL 1R3LA 1INQA 5HBBA 1TTFA 2DQJH 5FGSA 2OI9B 1QFUH 5TPWH 3IF1B 2M2DA 1T22B 2Y07L 3RWIB 5DHXB 4IIQB 4ZFFB 4N0UB 1UCTA 3S96B 5F7HA 4NQUA 1LWRA 5DLMH 1KLUA 4O9HH 3GMRA 2YA2A 4P5MA 1YNKH 3ZKXC 1OF2A 3X14A 1UXSB 2COQA 3QIUA 1BWMA 5FYJL 1FJ1B 1PZ5B 3FB7B 4KJWD 4I8DA 1AFVL 4K8RD 4JJ5B 5GSRB 1X5YA 4R3SA 3VH8G 1MCWW 5MEPB 2H26B 2DLIA 4QRRE 3OKKB 1CLOL 3ORJA 5HHPB 2XWTA 4DGYL 2CDGB 2XZAH 2YD2A 3B8SA 5F72S 4OBSA 3AXLB 2FX8H 3H42H 3MLTB 4ZTOL 2AS5M 5TDOB 1S3KH 1BFVL 2FR4A 5LAXA 3GKZA 2BSRA 1WBXA 1EMTH 1P1ZB 2X4PA 3A0OA 4KK5D 5JDJA 4UT9H 3L3GA 5GQBA 5F7DA 4OF8A 2OS7A 3HRPA 5AZ2H 4GW1A 1EERB 2OTUB 1B2WL 1DN0A 4FQLL 5BW7A 2NW2A 3KLDA 2C7UB 3TN0A 3KPQB 4HV8B 3SPVA 1X5GA 2G60H 2GK0B 5FKAA 5LQBH 5JNYA 3OKMB 2VC2L 2YA0A 2D4DA 4O4YL 3QR2A 1LO3L 4X98A 4CJ0A 4Z8FH 1G9MC 4BSWA 2ED9A 5DTFA 4MXWH 4Q9RL 3QDHA 4YHLL 3VI4F 4JPIB 3UYOD 1M7IB 3C6LB 4KHXL 5E2TH 5INDB 1NGZA 2H6PA 2FO4A 4G6ML 1PQZB 3VXRE 1R5WB 4XMLH 1MVFA 3A67L 1FAIH 3IDYC 3IAPA 5H35B 2BC4B 4KKBC 4U1SA 2VQUA 2XXMB 4M03A 4LEOB 3LRGA 3JWDC 1MCOL 4P59H 1PEWA 1C1EH 4OM1L 5CZKA 2F8OA 3PNWB 5ETUA 2G9HA 3AM8A 3E8UH 1CS6A 1YDPA 1EGJA 1AP2B 2OX5A 4APQB 5E7BA 4J4PC 4JANB 3RWEA 5IR1A 3RHWF 3KPRB 4HUNB 5ISZD 3KHQA 3SDXF 3M8OH 5SWZB 3UTQB 2WP3T 1PYWA 4HS6B 4RFEA 4C56D 4DGIH 1X5KA 4I0PC 3H9SE 4D8PA 1J1XL 2QLVB 2FJGA 5HHOB 3OL2A 1H0DA 3K4DA 2AK1L 4U2ZA 3G6JF 2OBGA 3T77B 1T1YB 4G6KL 3MLUH 4QT5B 3EYQC 1PZUB 2ZUTA 1CDJA 2HT2C 3HS0A 4Y4FD 1SBSL 4K3HA 4WEMB 1VGKB 2BRRL 2WIMA 2AJXL 1S7UB 1XR8A 3HE7D 1YEFL 4E9LA 4OZIA 4Y8DC 1G7PA 2X89A 1A4JB 5GZND 1YPZE 4LGRB 4CU6A 4H88L 3M1BA 5I16A 5E0QA 1KIQB 3PP3H 1PW3A 4HG4J 2P5WD 1JI2A 3FN3A 2AEIT 4I18C 1JN6A 5EPMA 1OLZA 2VLKB 3JWOH 1QEWB 1IBGH 2FB4L 4LRNH 4DZ8B 4WY7H 5JTWA 1H5BA 3LEYH 2DTMH 4H0GA 1A4KA 3RU8H 1F11A 4W81A 2KUTA 2W9EH 3T0VA 4NBZB 1IM3A 5C7XL 4MAUL 4P2QB 4YC2C 3LQAL 1A6VL 5DJ2A 5CD5D 4P49A 1NBVH 5ESAB 3MRPB 3EAKA 4K7PL 4OZHA 3LN9A 3NCMA 4JO1L 3BHBA 4JKPL 1JHLH 5IK3A 1SJXA 3UO1H 4J12A 1BWWA 3UP1A 3MYZA 3UBXI 4DW2H 4WHYG 3U30C 3GIZH 3FOMA 3QDMB 4LKCB 3QZWB 1G7HA 4XCNA 1N2RA 3LS4H 5C0FA 5C0NC 1U6AL 4OBRA 4HCRH 1BQHA 4UAOB 3PWPE 4OJFL 4XNYL 3FQNB 4N90E 5LVEA 2R0LH 2DLTA 5LXGL 1GAFH 4TVSa 3I9GL 2CUMA 2OCFD 1UA6L 2D2OA 5CSZB 2GJZB 3RAJL 1DBML 5CJ8A 4XC3H 1NMCB 1FDLL 4LPVA 3BISA 4Y4HB 3QJHB 5DD0L 3P73B 4FQIL 3LKNA 5B4MD 4AT6B 5MI0C 5HHXH 1O7SA 3MC0A 1JK8B 4EXKA 3DX9B 3MYJA 1CE6B 3U2SB 5K33A 3IDNB 4EQ2A 4RMWA 4WO4A 3C60A 4P2RD 5T3ZH 3GGWB 3ARFB 5IW1A 3VFOB 5DURD 1PSKL 1IEHA 5D93B 2BNQE 5ACLA 2FATL 1F13A 1HZHL 1MVUA 1EGJL 3PP3K 4NWUH 3SKMA 4QRTA 4FG6C 4XCEA 4Z7VE 2IGFH 7FABL 2VITB 2I9LB 4PGBA 4R2GC 1K4DA 2QHLA 5KSAB 3QXAA 5CINL 2A9ML 3C5JA 2IG2L 4M1CC 4PJFA 1G0XA 5IW3A 5HGAB 4YXHH 3CFDA 3V0VB 1L6ZA 2LE9A 4MS8D 3GSRB 2Z8WC 4D9RE 3SDXB 2F53E 3FO0L 3HAEH 3PWVB 3S97C 4Q0XH 1X6NA 1EHLH 3BUYA 5CUSH 3WFEH 1IGCL 4XVTL 3FN0H 4OD2A 3ZYZA 3VE0A 5IB2B 4NCDA 4N0CD 4KXZI 3WO4B 3G6JB 4NZJA 1NC2A 2YD6A 2APVA 3QG6B 4PGZA 1AO7D 5D2NE 5D71L 1FIGL 2IWGA 2X4TA 1KCRL 2JIXA 2WAHA 2FEDC 2QJDA 4Y4KB 1HINH 4K8RH 4OM0L 3QUYD 1CQYA 5EBGA 4H1LB 3P9WB 4LARH 3NABL 3DVNB 1ULVA 1RZIA 2WNGA 2Q76B 5D7KD 4LEXH 1XGQA 1CL7I 4HWUA 5F7EH 3ARGB 2A77L 1FG2B 3Q6FB 4XB8A 5JA8B 4JKWA 5EFIB 4PREA 5DXWA 4WI8A 5IQ7L 5JIKA 2OP4L 4ERSH 5E6ID 2VLRD 5CMAA 5FO7A 3U79A 3DWTA 1KC5L 2F19H 2JJWA 1XF4A 2E27H 4UTBH 5DJ8B 4OFDA 3BQUA 1JHTA 2FBOJ 2X4RB 3L95B 1GGIH 2H32A 4BH7B 3PGFH 2XACC 3OX8B 3X11A 3ZYOA 3O3BA 5IV2A 2NTFB 1VADA 3GSNB 3VFRB 2BSSB 4KRPC 4XCCL 4L4VA 1KTRL 4JJHA 3WFCL 2DQIL 3QFDB 3RL2B 5D7IF 5FM4A 2BJML 1VEMA 6FABH 1AJ7L 3O3AA 1V7NL 2H9GA 5DT1H 3QXTA 4GBXB 3QEHB 1VGEL 4GOSA 1GZPB 1Q0YL 2A2QT 1SEQH 3T65A 5GGRB 1OAZL 2PXYA 4HS8L 4QHLA 5KN5A 3OB0K 1RD6A 3I6KA 3TBSA 1ZWIB 3KPOA 1A6WL 1NGQL 3O0RH 4OKVA 5EULV 4QTHA 2AV7B 5JQ6H 4U6YB 3ILQC 2QSQA 1LK3H 1U91B 2PYEE 4Z7WE 1LVEA 3OXSA 1I4FA 4J8RB 2GI7A 4XPBL 4PP2A 3TJHD 5C07E 3UTSE 3HNTL 2A0LC 3GEWB 1G7LB 1BZ9B 4NQDE 1OCWH 3IJHB 1HSAB 4HG4K 3AS3A 4BYHA 1Z9OA 5JMOC 2ZP0T 4S1QL 3ZL4H 5EZJB 3N1MC 2VABB 3QJFA 1MFAL 5CHNB 5EU4A 1WLHA 4N5EC 2O61B 4LSQL 4XBPB 1XF5B 1M7DB 5J1TC 4OTXH 5D1ZB 2Y5TB 5E56A 3FB8A 4R4FH 3MRMA 3QAZB 4Z9KB 5CJ5A 1C5DB 5F8QC 2NY0B 2VZOA 3MTRA 3DV6B 4X9HA 3HUJE 3OKEA 4RMTA 4KAQL 5K9JH 4S1DC 1NGYB 5ERWA 2WV3A 4IRJA 2FEEI 4Y5YC 1E4WH 1CFNB 4KVNH 1B0WA 3MA9L 2Q6WB 3MUY1 2X4UB 4TQEL 2CDFB 2C1OA 1LEKB 4NQVB 3QISA 2XA8H 4F37F 1C16A 3O3DB 5A3IC 1NFIA 5JHLH 3IFPB 3MV9A 3OKLB 4YZFE 3ARBD 1BLNA 5CJXA 2VDQL 4WU5B 5F7LB 4XWOD 3D3VB 4N8CH 3FOLB 3L5JA 5EO1A 1R5VA 1A7NH 2GTWA 3WD5H 3GSQA 1WWAX 5ESVA 5I76B 1SJVA 2FX9L 3HFMH 3K2MC 5EOCL 1J1PL 2YBRA 1F8TL 4UNUA 1AE6H 5IGXH 2N7AA 3CJJA 4P2OC 3LQZA 4K3DL 3OHXA 4DQOL 1FLRH 3HG1D 1K85A 4BSJA 5E5UB 2W91A 3BDXA 4L3AA 4ORGA 1TVBA 5KSUA 1ZLUK 1DQQA 4JR9H 3U7WL 3WEXB 4N8VG 3SDDA 1YC8A 3LKRB 4E41D 1R3IH 4WI7A 4OCYH 4J3UA 3ROLA 4DZBA 5E95B 3IGAB 5BV7B 3AGVA 4RISH 1L9MA 4YC2B 4GMSH 4PIRF 3MLZH 1KV3A 1TQBC 2O5XH 5TH2B 3LDBB 3TA3A 4G9FD 3KGRA 3CC5A 4UOW0 3QP3A 4JQIH 2CJUH 4YO0B 5L7XL 5D1XA 3BN9C 5BJTA 3U30B 2HFEA 4HPYL 1NH6A 2W9DL 4Y16A 4MVBD 5D7IB 1B4RA 4OGAD 5JUEL 4MZ3A 5CLTA 4IS6A 3BESR 2J12B 1RJYA 4UB0H 4WUUD 4OLEA 5T1MA 1KB5H 2AJUH 3UDWC 3LKSB 4JPVH 3MFGB 3VFUB 3H3PH 5CKAA 3CFKB 2Z4QB 1NBQA 3GMPA 3TO4A 1YN7A 5ISZE 4QRSB 3EO1B 2WBJC 4RGNB 4OUUB 1F5WA 2WUBH 1NBZA 4C56E 1RUAH 3U46A 1H8SA 4TRPL 2EEDA 1Q38A 1JFQH 2FDBP 4M93C 3SDCB 1HXYB 5C08A 2R0WL 5MI0B 4NO2A 5L8LB 4MDIB 5ALBL 5F70A 1T03H 2MOVA 3TBWA 1PG7X 3HNSL 3MROB 3S88H 1JGLL 1I7UB 4QTIL 1IKFH 3O11B 4MQ7A 1HE7A 1AY1L 3BKCH 3FMGH 1RIHL 4ZAKD 1HHGB 4JFFB 4CU7A 1MLCA 1OPGH 2X9YA 3W2DH 2JJUA 2FL5A 5IMKA 1MCEA 1L6XA 4YDVB 4LPXA 3BAEH 4Y5VC 5C0RL 5HTSA 1J9CT 2P5WE 3HZKB 3DARA 4NNXA 1DL7H 2H1PH 3KPNA 2C4XA 3QRGH 3SJVA 5F9WB 2NNAA 2BOBB 3KJ4B 3MGAA 2NY2B 2J5LB 4NZTL 2AEPL 1AGFB 1CXLA 5E7FA 1S5IH 1TZGL 1AC0A 5E5MB 1IL1A 2AKRB 2HFFA 2F74B 4WIQA 2B0SL 3JTTA 2H3NB 3BGAA 1MY7A 3VRLF 4HUWA 1M71A 5I1DB 1MIEL 3TVMA 4PLNC 1AKJB 4XH2A 4WW2B 5FM5O 1RJLA 1C7TA 3VFTA 3VWJA 2X7LA 3EJZD 3L3KA 3VD9A 2LTQB 3EDKA 3MUJA 3OR6B 4JHZA 4K23L 4UT7H 4AM0B 4NQCA 4D0CB 1C5BL 4ODXA 4M02A 4W70A 3MO1B 3RZWA 3V5DB 1WBZA 2ICWB 2UY6A 3U48A 3ZKQD 1YQVL 4OQTL 4MQXC 4GG6A 3H9SA 1FYTA 4CBPA 4HKXA 5DC9B 3N85H 1DUYB 3NA9H 5F7FA 2H2PC 3QUMB 4NKOA 4IJ3B 5FM8A 4PY7B 2J8UF 2R4SL 5EBMA 2CLZA 3H9YA 3BI9X 4PJDB 4YR6A 3PWLA 3RGVD 4OZFB 4JAMB 1MEXH 1LQSR 1DLHA 2ATPA 5F1IB 3VRLE 1TETL 1IEAA 1HHHB 3AMLA 3TZVD 1H8NA 2W0FB 3IFNL 2JJVA 1U3ZA 4D0BA 4KRPB 5EG6C 2EDNA 1YEIL 5J56B 5SWSD 4O5LL 4OD3L 4P2RE 3LHPL 2PW2B 5IM7A 4X5WA 4R26L 3MBED 4FHBD 2GJ6B 2FHBA 1FZMB 5L2JA 3BPLC 3DETC 4X7FC 1S7VA 4Z7NE 3BH8B 1VFOA 1GC1C 2PO6B 4PRHB 4ZNEA 1YY8A 2ESVA 3CLFH 5SV4A 4H25B 2VDPH 4CVWA 4EJ1C 1XCTB 2BY2A 1F6AA 5BRZD 3WL9A 1I1AB 4X8JA 4JRYB 1RIUL 4QGTA 2A6IB 2YUVA 4LSPH 3DGGB 5DJCB 4NKDA 3IS0X 3EFDH 2J8UE 1GVIA 5D7JB 1TTUA 1I1FB 5D6DA 5JO5A 3VGFA 4PJ7F 3P9LA 1MCSA 3O9WB 2OR7A 1MF2L 4YQXH 1Z9SA 3IXAA 2CPCA 1AO7E 4GKZB 3RDTC 4Y19B 2Z31B 3I6GA 1F6LL 2ATKA 4DUVA 1FL6A 2R29H 5DMGC 4HZLB 1WVZA 2EDFA 1KCVH 1G7JA 4R4BB 4OT1H 5D7KE 2AK4D 3HMWH 3P4MA 2YPVL 3RUGA 3VFGH 2IBZX 1B0RA 4KI5D 4ZD3L 3EOTL 1CDIA 5FXCH 5I6XB 1NC4B 1CXFA 2VLRE 2X4OB 3U0TA 5FHAH 2CLRA 4YAQB 1R5IA 1AD9B 2OZ4A 5FYJU 3MJGX 4G5ZL 1NKOA 1EFXD 3MUZ1 5GGVL 1TENA 3M17B 3TM6A 4M6NH 2QR0B 2HVJA 3LRSB 3WIHA 3THMH 3MRIA 1I8MB 1LK2A 2MWCA 3GK8H 1U8NA 4Z7VA 1IGTA 3D9AH 2VN4A 3EOAB 3AROA 2DDQH 4NC1C 3B2VH 5C0AB 4KFZC 1WC7B 4TPRH 2XOTA 2R1YA 1UB6A 2HLAB 4LAQH 5EBWB 4YHML 1KJ2B 4JM2D 1ORSB 1GGCH 3QHFL 1YEKL 2GAZB 5GS3A 3HR5B 4P3CH 4LVOC 3NGBC 3MRNB 4F9LC 3QDGA 4FMKA 4JGJA 1WQVT 2BNUA 5C0DB 1CIDA 1RZ7H 5I73B 4N9GA 2Z92B 5KTEL 1JZ6A 1N59A 4UIMA 4OF7A 1GGUA 3KDMA 4YBHA 4A6YB 4OCXL 5F6HJ 4R7DB 2BOCB 3IS1X 4FTVD 1Q9LA 5DMKB 5AYUH 3ARYA 3TBYA 2EIZA 5EWIH 5DUBB 4JY6B 5INCB 3HMXA 2VNCA 4ZO6A 1MFCL 2IBBA 3RY6A 1NMAL 4F7CA 4HKBA 3A6BH 3EYOA 3T1FB 1JZ5A 3O4LA 4J6RL 1CLZL 1MIML 3AREC 3AB0B 4MX7A 4KVCH 3ZDZE 5I1JL 1CFTA 5E00A 5HGBA 2ZPKH 4Z5RA 5J4MA 5IESL 4WCYH 4PBXA 2OJEB 4YPGA 1TIUA 3CAFA 2GCYA 4KKNA 1ZEAL 4K2UH 3I02B 5DMIL 2FZ3A 2D31B 4RMVA 4XNMA 1EXUA 2FECL 1Q9WA 2DN7A 5F7KC 2WINB 2EDBA 5TF0A 2XG5A 1AGCA 4M5ZH 3MRJB 4DN4L 1UH2A 4PJ7B 3TBVA 1HILB 5I0DA 5DK2A 2KPNA 1LEGA 1BGXL 2VISB 2GK2A 5JDSB 2YPLA 4PGDB 1WWWX 4YEEA 2VZVA 3RPKA 4WWKA 1GXEA 1L7TH 1XF2B 1CFVH 4U7SA 5GGUA 4ZXBB 4Z18A 4EI6B 2A74B 3RJQB 4FN0A 3QIUC 3OG4B 3QBTB 5IFAH 1CGVA 3W9EA 3OPZH 3KPTA 4MHHI 3ULUD 3UTPD 3H7LA 3VRJB 2OZ4L 1RK1A 2A6DA 2E6QA 4XNZC 2XWBB 1IM9B 3WIHL 1KNOA 3QG7H 4MAYA 4LCWD 1CLYH 4Y2DC 3MLVH 4YX2L 2IAMA 3HG1E 5C3TA 3MSPA 3EDJA 3MV01 4KKBD 4MNGE 5GRUL 3UTSA 3WFBL 5J13B 5K9OA 5LGHL 2OL3B 3T0DA 1Z3GL 3C87A 3CDCA 4JG1L 4CNIA 1A7RH 2L7JA 3QQ3B 2P5EA 3UC0H 3TYGH 4YHIA 4E41E 3DX6A 4XGZB 3MZTA 4U0RB 5DK3A 2OM5A 1XFPA 1JTPA 3QIBA 5ID0A 5M94B 3RKDC 4KQ3H 3WNMA 3MV11 1BD2B 1ND0A 3MV7D 4NRXB 4NO0A 5BW7C 3UTTA 4X4YA 4JY4B 4G9FE 2Y9RT 4L8SC 5EIVA 1XZ0B 3ARPA 2ZUQB 3GMQA 1YNLH 4R90L 2XZQL 3V7AE 1PG7H 2NR6C 4MA8L 2JCCA 3BIKB 4HIIB 1FNLA 1MI5B 3OR7B 1ED3B 3HUJA 4PJBA 1ZLVH 1XEDA 1SHMA 5HVHC 5I1AA 5FOBB 2IADA 3MJ8B 3STZB 1NGPH 4FNLH 3CPLB 3EYQD 1C08B 3GSXA 2HT2D 4OCLC 4WUUE 1CFSB 2DL9A 5IMLA 1CR9L 3C5ZA 3V0AC 2YEZA 4UDUB 1T66C 2GEEA 5KAQG 3CH8A 1MJ7H 3CVHA 1NAML 1BBJA 4LHUG 2XT1B 2VXQH 5JW4N 1OAQL 4JHWL 4PY8I 4KJQD 5C09B 1OD9A 2VH5L 3JBG7 4NQED 1HEZB 4LSUL 1F3DJ 4OKDA 1TZHA 4JRXA 1U58A 4HS3B 3QH3A 5BS0D 4K07A 1U8KA 1DQML 1G6RA 1J87A 1U95A 1P6FA 1VKXA 4ZSOE 5F88A 3PIQB 4YHPB 4YHYB 3U0PA 3OTTA 1BM3H 4DEPB 3QNZA 4RNRB 4U2YA 2PCPB 4XP1L 3RL1A 4LSVL 5E1AB 3EGSB 1IGJA 1HQ4B 1CICA 4V2CB 1JV5A 4D0DB 2W60B 3R1GL 4HLZG 4KK9C 4EDWH 2XTJC 3DYMA 2WLZA 4OLYL 4OF5A 4MB4A 3RIFF 3JSSA 3JUYA 5FO9A 3F6IA 3DYOA 4MA1C 3T0EA 5AUMA 1KELH 1W0WA 3SE9L 1W2KT 4HUUA 4I3GA 2X2YA 4GKNA 1G7QA 3RVUC 5F96H 4U1GC 5J57B 2KZ1B 4MXVE 3KPSA 4M7JH 2Y7QA 3GMNA 2X1WL 3HC0B 5C0ND 1BAFL 2AP2A 4JFZL 4JCMA 4OIIH 4AMKH 5J11C 3RVXC 5C0JB 1H5BC 1UWGH 4WV1A 2PW1A 2AABH 3D25A 3Q3GA 2Q8BH 2W65B 3MRBA 4LPWA 4PB9L 1ZLVK 3MZGB 4OSUH 3G5VA 1OY3B 3QUZC 3P9MB 5D2LA 1ZMYA 5D7LD 5C70A 1OGTA 3TESA 4UT6L 1FZJB 1QA9A 4HJ0D 4RMRA 3IFLL 2GJJA 2P49B 4UBDD 4MCYB 3MNWA 1MCKA 4PRBA 3RVTC 4OF0A 2DQUL 4QOKA 5GRWA 3PQYA 2HJFA 1FQ9C 3BX7C 4NKMA 4Z77A 5I19L 1O5DT 3HI5L 4K94L 4KRMB 2FH8A 4PBWD 1WEJL 4PPTA 5TQ0H 4AEHH 1D5XA 4H26A 3MRQA 3S37L 2PYFA 4K71C 4XPGH 5C6TH 1UM5H 3D0VB 5A1AA 2X4NB 5DR5L 1SJHA 5MERB 1VFMA 3OBAA 1J0IA 3O3EA 4G6FD 1W72A 5K59E 4R2GD 3NPZB 1ZK9A 1WITA 1I1YB 4J7RA 3UTZA 2UYLA 1FLTX 4M1CD 2ZJSL 2GSGA 3NCEB 1NGXB 3BVNB 5SWSE 1OD7A 5CBAB 3P4NB 1XGUB 3BKMH 12E8H 1ZHBA 2Q7NA 3HCVB 3GJEA 1NLDH 3QCTL 4I4WA 2Z93B 5TF1L 1EIBA 1MCQA 3CVHL 2XN9D 4Z0BH 5JW4R 3DXAB 3NIFE 5DD6B 4CW1A 1XAUA 3K7UA 3C60C 4PJ9B 4WO4C 1KLGA 4KI5F 2Z8VC 2DYPD 5BOZG 5BRZE 1F4XH 2FEDD 1EJOH 2K7PA 1MCHA 2QKIA 2NXZC 4OFYD 4YWGL 1IAIM 2I9TB 4GAGL 2HG5B 1PBYA 4YXKH 3MGTB 2VLLA 4E5XA 1FBIH 1HXMB 1G6RL 3KS0H 5GRZA 4XAWL 3GMMB 1KGCD 3GMOB 3RWFA 2FSEA 4LCIL 1OQOA 4Z95H 2B2XH 1VFBA 4HXAH 4KGLA 5DVMA 3KPLB 5EUOE 5GGQL 4AIZB 4PJCE 4ZQKA 3HI6L 5I1HH 4U1MA 3V6OC 1S7WA 3MODL 5FDWB 3U1SH 1UZ8A 4LLDB 1C5CL 5D5MA 1E6JH 3LV3B 3ROOB 5CP7B 2VDOH 2VXUH 3P77B 4EVNA 3FT3B 4KTDH 5B8CB 2YRLA 2XKSA 2EDOA 1EX0A 1D9KA 4ONFH 4RA0C 4HUMB 2AK4E 5I18H 1XIWC 5DJAB 3QFJB 1K5NA 4WTXA 5MEQA 3F5WB 3A6CL 5IJKA 5FYLD 2CRMA 4P46B 4G7VH 1VFUA 3DTXB 4KI5E 1JRHI 3EOBA 1T6VN 4U05A 3TCLB 3ULUH 1KIUA 4NT6A 4HH8A 2KKQA 1ZSDA 1HHJB 3CH1B 2DQFB 1JNJA 3MQIA 4L9LA 2WWMC 3WKMH 5DJZB 4PRPD 1T1XA 2P7TB 1GGBH 4MCZB 3WN5A 1LE9B 4PJXE 3TZVB 1YJDH 5D96C 1YUHA 2C3WA 4X6BB 3V6FB 4PS4L 2IPTL 1FGNH 2GITA 1IGIL 3ILQD 3UJJL 1UEMA 4CGTA 5CILH 3BQUC 3ZKMC 3L3JA 2JJTA 5L88L 4DVBA 1T1ZB 3IDJA 5DD3L 4JG0L 5J1AB 2A0LD 1NBYB 3L5XH 2BNRB 2GYSA 4C4KT 3KPPB 4K3EL 2VN7A 5DWUL 4BZYA 4U1HB 2MNUA 4GRMA 1LEIA 2ZUSA 3WS3A 4PY8J 1P4BH 2AEQH 3D1MC 3E2HC 1W72L 3SKJH 1FL3B 1F58H 2NX5B 2C3VB 1N64L 3GSUB 4N5ED 1AO7A 2AGJL 3IKCB 1FNSH 3VXMD 4RGOH 3BKYL 2B8OT 3QHTC 3MRFA 4RGMC 1XH3B 4FFWC 2NLJA 2NY6B 4F33A 2PXYC 3QUYA 5FUCC 4KK6D 2EIEA 3P30H 3QA3B 3VGEA 4E0RB 4FTVE 3QCUL 3IB4A 4S1DD 5CIPH 3GRWL 4LP4A 1QNZH 3BXNB 3SCMA 4JPWL 1BEYL 5IT2H 5JOFB 1CGSL 5FO8B 1QFWL 1R0AH 4LCUB 4X6EA 1YY9C 4IRSD 1URLA 2ICWJ 3C8KB 3LN5A 2VLMD 1NDGA 5A2LH 2JB6A 5SWQA 1U42A 1G7MA 3LS5L 3ULUF 1INDH 4FS0A 5IMMA 1LD9B 5A3ID 2I5YL 1JNNL 1CZ8H 1RZFH 3B6SB 4K3GA 1FORL 4P9MH 4X6CF 4O58H 4ZDHA 3EHBC 5I17A 5L6YH 4FFYL 2L7UA 2HT3C 3AY4A 2RCSH 1EEYB 4IOFD 5IB4B 3U9PL 2NY4C 2Y25A 4Y7MA 4NDMB 3SKUD 5DEFA 1EAJA 2ERJC 4ZYKA 5CGYC 4G6JH 1PEZA 1ZA6A 4M5YH 5B38A 3U4BH 3TH3T 3NIGE 2V9QA 1WCBA 1KCUH 2QHRL 5J6HA 4N0FB 1ZT4A 2RFXA 3CFBA 3K80A 2DIJA 2GQHA 4P2OD 5TQ2L 3WFDL 4F57H 1KTLB 3DUUA 4F7TB 4MLIA 4FQCL 5CJBA 3PWJA 5GXBB 4IRJC 3WFHB 3CSYB 4NKQB 4L3EB 2CXGA 1NCBH 3IAQA 1S9VB 2EDHA 2EYSB 4L4TB 1NFDA 1L0XA 2AV1B 4ELMB 5T5FL 1CGYA 4P3DB 1KFAL 2B7DT 3QEUA 4JFDA 3DECA 3TWCL 3KLSA 3ULUE 3UTPE 4PJEF 4P4RB 2DWEA 4N8VB 5CJXC 1I3RA 2VDMH 4P23C 4LCWE 4NM8L 2F5BL 1MREH 3S4SB 1K3IA 3BN9D 5EZOH 3FQWB 1U8OB 2DLGA 4R6UA 3HZYB 4JFEA 1XGRA 1ZLSH 4U1JA 3E6HA 4QLRA 3NCFB 4K9EL 5IWLC 4JE4B 3VFWA 3QNXA 4O51B 5BZWB 3DRTB 5DHVB 4HKJB 4L3CA 5M95B 1QSZA 2VWEC 3VXOA 1EBPA 1ITBB 3IDMA 4GRLC 5J11B 2ADGA 5E94A 1OTSD 3C9NA 3MV7E 5CEZD 3QEGL 3PP4H 3N9GH 4G9DB 2XQYG 4RZCB 4U0QB 4MLSA 5I8OL 3H9ZA 4NNPL 1QPXA 4N5UA 3SDDC 3ME0A 2WBJD 2HWZL 2DJ4A 3GHEH 4KTEL 3BO8A 3MCLH 2HTLC 4LQFL 1QACA 4KHTH 1J0HA 5JIHA 4JO4H 1JNLL 3QNYA 1MUJB 2GTZA 3VFVB 3QHZL 5K9QI 3WIIL 3BP5B 3RQ3A 3PL6A 1ONQA 1CD9B 4U3CA 1WZKA 1FVCA 4MSWA 2MKWA 4WGVB 4NN5C 5D1XC 4L5FL 3UROR 3CIQA 4AIOA 4Y16C 3OSKA 5AAWA 2BCKA 4GQ9L 5JPMB 1I8KA 2E7LA 3DX7A 3KXFD 3PDOB 4WFFD 4EOWL 4HWZA 3LEVH 3NN8A 4PRIB 3B9VA 5IKCA 4NQEE 5ADOH 3BIAX 2F5AL 3L6FB 3OGOE 4YK4C 4OFIA 5FCSH 2Y4SA 4PRAB 5BS0E 1TFHA 2HFTA 5F89A 2N56A 5SV3A 1FSKC 2V2XA 1YQ2A 3CSBA 3QDJA 1A64A 2D7NA 3B5GA 4MNQA 1FNAA 3HE6B 2R8SH 1JPTH 5EOTB 1IAKB 4KGJA 1FNGA 3G5XB 5DK0B 3GI9L 4NZUH 3ECBB 2CK0L 2XFXA 1HHIB 4WJ5A 4X6FB 2R2EA 4JDZA 1X6LA 1JWSA 1S9YB 2CIKA 5ANME 1OW0A 4ZFZB 4XI5C 3SQBA 3K8LA 2P8MB 3IF1A 2NXZB 4JDTL 1T22A 4X6CB 4X83A 3RWIA 4IIQA 4ZFFA 4N0UA 3S96A 3SE8L 4RWHA 1MJJA 3T2NH 5HI5D 4QY8B 2DKSA 2AJSH 3BPCA 1JWUB 1TPXB 4KI1A 1QP1A 3I3EA 2QQNL 5B21A 4MQXD 5KVDL 5ACZB 3RNKA 2BFVL 1UXSA 1NDMA 2DL2A 3QUXD 5DS8B 1U8IB 4HT1L 1FJ1A 1PZ5A 1NLBL 1BVLA 3EYSL 3MLRL 2H2PD 5GSRA 4JJ5A 4GKSA 5MEPA 4HFUL 2HA1A 3OKKA 5K9KB 3GSOA 2CDGA 4JFOB 3DVGB 1FCCA 3TH4T 3AXLA 2D0HA 5D7LE 3MLTA 1EFQA 1I9RH 4JZJB 5FK9B 5TDOA 3TVMC 4OI7A 1TZIB 3FFCB 3L3OB 1QPPA 2D0FA 5CWSB 1EO7A 3MRGB 1XIWB 3TIEB 3RX7A 1MWAB 1DBAH 1BOGA 4XHJC 3FZUC 4PJEB 5J7CC 3VWJC 2IC2A 4ZNCD 5IQ9B 5FYKL 2GSIA 1JPGB 4BA8A 4HIEB 3UEZA 4UILH 4NHUB 2OTUA 5TE7L 3QPXH 4OZ4B 1TVHB 5CEXB 2EXWD 4W4NA 3NFPB 2P8PB 1G9NH 3IVKB 1HNFA 2RJMA 2C7UA 1F00I 3KPQA 5KOMC 3RVWC 1JWMB 1K2DB 2GK0A 4Q58C 3OKMA 3RZCC 5CBEB 4RX4A 1TJHL 2YKLH 1K4CB 4FXLA 4UV7L 1EHNA 5E9DB 1JGVH 4XBGB 1G6VK 5ICZB 4POZC 5I9QB 4JPIA 3CMOL 1M7IA 2VDLL 5IBTH 4JZOB 5INDA 3TEUA 3INUL 1PQZA 4OB5L 1R5WA 1CE1H 4YBLC 3IFOA 5H35A 2BC4A 2F15A 4C58B 1RU9H 2P43B 4PJIF 5IVNA 3X12A 2XN9E 4LEOA 3SO5A 3CVIL 3DJ9A 2HLFC 4RIRB 3RDTD 1HKLL 3VXUD 3BPOB 3KYKH 3PNWA 4ZFOB 3U82B 4JKLA 4XPHL 5DUMH 1JZ3A 4APQA 1BJMA 1AP2A 5DMGD 5C92A 1KXVC 1LE5B 2R0KL 3KPRA 3H0TA 5DFVC 2R23B 1EA9C 1L7IL 1KGCE 2VDNH 5SWZA 3UTQA 2FIRT 4HS6A 4Q6IC 5FIEA 3T0AA 4NOFA 2LU3A 5HHOA 2FIKB 3BZEA 4KKAC 2F54D 3T77A 1T1YA 1NCNA 5FYJD 4QT5A 4EN3B 1JE6A 2VERN 3X13B 4PJGF 5HYJB 3MLSH 4LSDA 1JRHH 3BIBX 2PR4H 5E2WH 5D6DC 1VGKA 4WEUD 4MJ5B 4XMKH 1S7UA 4O2FB 4LSRL 3TFKC 1ZHNB 2JK5B 3OJDB 5HD8D 1T04B 1A4JA 4AEFA 3HLAB 2BVQB 4C54A 1KIQA 2FJHB 3O6FC 4NZDA 5FYLE 4EBQL 5LWYH 2ED8A 4QXGL 5DD5L 1DBBH 2VLKA 2DQEL 4TUKH 4MJIB 1QEWA 4XPAL 5I1CL 5C0CD 4DZ8A 2NY4B 3BSZL 5IJVB 4AK1A 2ZOKB 1VPOH 3FB6A 4HX1A 2W38A 4XNXL 4HWBL 1UCBL 4WTZA 5E4EC 3UAJC 2G2RB 4PRPE 2QADD 3OF6D 2Y36L 5KVFL 1BZ7A 1ZVSB 2IH3B 2JJSA 4P2QA 1KT2B 4KQ4H 5CCKL 5FGRA 5E5RB 3TP4A 2J4WL 4JQVC 5LGJB 1AIFB 5ADPL 1IC7L 5GJSH 2WLYA 5ESAA 3MRPA 4PJ5D 2DMBA 5TGBB 1ZLWH 5CEZH 3NACH 1YN6B 3DLQR 5JLZB 4K7PX 1W0VB 4YHNB 5GIRB 3OZ9L 3ULVL 2XN9B 2O5ZL 3QDMA 4LKCA 3QZWA 1A7QL 4NYLB 4P23B 2EDXA 4P5TB 3GNML 5T1KB 3FQNA 3I84A 4G8IB 4KZDL 43C9B 1D5IH 2DQDL 1OQXA 1QFPA 5DSCB 2J8OA 4F7PB 5CSZA 2GJZA 3BT2L 3VXME 4U6XB 3P11H 3VFSB 4Y4HA 1DE4A 3QJHA 5D1QB 3ARED 1D7FA 4Y2OA 1FPTL 4DJMA 3P73A 3ARXA 4YUEL 3C2AL 2AI0L 2XYCA 4AT6A 2IALB 1HDMB 1T83C 1JK8A 2DBLH 5DQDL 3DX9A 5HI4C 5LBSH 1CE6A 1Q9KB 3U2SA 1QSFB 3IDNA 2YXMA 4QHUB 3H7BB 1NCCL 1IGFL 3ARFA 3VFOA 3RTQB 4CUCA 4X9FA 3BZ4B 2VLME 3I85A 4PJIB 1RMFH 2OK0L 3SO3B 1MHCB 4S2SB 2FX7H 1IILE 1RZGB 3LZFH 5DEGB 1LGVA 3W11D 4AEIH 3O6ML 2VR4A 4ODWA 2VITA 4UTAH 1QBLH 3P4OB 5H94B 5FKPA 4X7TB 2I9LA 4QCIA 5KSAA 1KJMB 3U4EB 3QO0B 4AENB 2ENSA 3RY6C 3QIUD 4K7PY 5IEHB 5HGAA 1E6OL 4BQ9A 3V0VA 1Q72H 2QV2A 1Q1JL 3VXTA 1KSRA 3GSRA 1OARL 3SDXA 4LLWB 1LO2H 1U3HA 4H8WH 3PWVA 4U6HA 4RAUB 2DLEA 1I1CA 1KLFA 5IB2A 1ZLWK 4JM2A 3G6JA 3ABZA 4QHNB 4QRPB 2B1HH 2B39A 1AHWC 2C3GA 3QG6A 4PJGB 3WHXB 1ROWA 5F7NC 5MENB 4HSQA 5GGTL 5LKNA 1QZ1A 1DQLL 2ZG1A 4Y4KA 3RKDD 4GRWH 4HIXH 1AQKH 4H1LA 3DVNA 2Q76A 5DJXA 4KRLB 5A40E 2FYYB 1BJ1H 4WWKC 5LG1A 4NJAH 3B9KC 3ARGA 1FG2A 2NR6D 2OTWB 1UM6H 4HC1H 5EFIA 2YD8A 3O2WH 1MNUL 1IT9H 3MR9B 2ZKHL 1NUGA 4AQOA 3NCYS 1OAYH 5GGSB 1NCTA 2CMRH 2ORBL 3SDAC 4G8GB 5DJ8A 1FHGA 4MAYC 2EDEA 5D9SB 5EIIA 5SX5H 1KPVA 5CEZE 2X4RA 3L95A 1T66D 2IAMC 4BH7A 2RHEA 5AWNL 3OX8A 2UWEF 3TV3H 2NTFA 2ZUVA 4XP9H 3VFRA 4DK6A 2BSSA 3MMEB 4ZODA 1GC1H 32C2B 4Z0XB 3TT3H 5TFSL 1UKSA 3JUZA 4EI5B 2X9XA 3O8XC 3QFDA 3QIBC 3RL2A 3GBLA 4K94C 3WLBB 3GBMH 1RJCA 3WJLA 2IPUG 2EEAA 3AVEA 4GBXA 3QEHA 3GSVB 1FRGL 2LVCA 1J8HB 1JJUA 4NUJB 1GZPA 4IDJL 4LDLB 4TNVK 3VW3L 3VDBA 2X09A 2P1YA 4XMPH 5GGRA 4WHYH 1Q94B 2PTTB 1ZWIA 4P48A 4EDXB 5HYQA 5CZVH 4KY1L 3KXFE 2AV7A 4WFFE 3E3QC 1T7YA 4U6YA 4LMQI 4R8WL 1PKQE 2KH2B 3REVB 4TVPD 1U91A 4KK9D 3Q1SH 4LPCA 3C5ZC 5HYSG 4U33A 1KTKE 1CD0A 3D87B 1T21A 4Z78B 1RURL 2ZG3A 4J8RA 5TPWL 1H3VA 1J05B 2X89D 2UWEE 4GRWF 3UZQA 1DVFC 1G7LA 2DWDA 1BZ9A 4JHAH 3CXDL 1HSAA 3VFNB 3DMMB 5KVMC 4DKDC 1T0NB 4GXVH 3VXNB 4HK0A 4KMTL 5EZJA 3RVXD 4JFPB 5EU6B 5FYJH 2VABA 4X5XB 1AFVH 1UZ6E 2O61A 3P4LA 3HHRB 2ICCA 1XF5A 1M7DA 3S9DB 1EHAA 4DGYH 1A3RL 2Y5TA 2EO9A 4I48B 3IAGC 4K3JH 4ZTOH 1C5DA 4BKLB 2KL6A 3WXVL 3FN9A 3DV6A 4J4PA 3S6CA 1BF2A 2P24B 1CICC 1NGYA 4B5EA 5GS0L 3KLHD 1QLRB 1J1OH 1CFNA 1S3KL 5EA0L 1KB9J 1CG9B 4Q6IB 2Q6WA 3RVTD 4I0PA 2X4UA 1LP9F 2CDFA 1B2WH 1EMTL 4XXCA 1A21A 1JF5A 2WQRA 1LEKA 5HGHB 3LOWA 4UT9L 5HGDA 5ICYB 4FQLH 5AZ2L 1CXKA 3NIDF 3P3YA 1QRNB 4GRWE 2NXYB 2A73B 2OXGA 3IFPA 5JOPD 3K1KC 1PD6A 2E8ZA 3TLRA 3WSQH 3M45A 2VC2H 4WU5A 4JFYB 4O4YH 5I30L 1LO3H 1REIA 3D3VA 2G5BA 3FOLA 4FQ1H 4MYWB 3QQ4B 3F58L 1WBYB 1OAUL 2JF1A 4LCYB 1DCLA 4G8EA 2XKNB 3CMGA 3VXSB 3DIFA 1AXSA 4XVJL 1YYLH 1HI6B 3CFJB 2BY1A 5CIPA 5B3JE 4MXWL 2EE9A 3A67H 4ODSL 5ECJE 1KIRA 4PJHE 2EDYA 3PGDB 5E2TL 2OLDA 2DQGH 4I3RH 2A9NL 5I8EB 2YK1L 1ZKAA 3EOYG 1MCOH 3ZT7A 4AYFA 3GSNL 5FAAA 1J12A 1FGVH 3WEXA 4OM1H 2ADIB 4KTYA 5CZXC 2DF3A 4WO4D 3C60D 1WFUA 3IGAA 4J2XA 1LP9E 5H2BB 1FL5B 2R2HA 5KW9L 2EXYC 4X4XB 1AR1D 2D9CA 5TH2A 3K2UH 2DD8L 1HHKA 1KJVB 4LFHG 3T8XB 1KCKA 4OGYH 1J1XH 4YO0A 3WO3B 4AZ8A 3J8F7 1N6UA 3LSOA 3M8OL 4KMLB 4EIZC 2AK1H 5D7IA 1E4XL 1T89A 1KEML 3TF7C 4G6KH 1FZOA 1AQDB 2E9IA 3QULA 4PRDB 3NPSB 3DUSB 5I1EH 1I9EA 1SBSH 3RI5K 2BRRH 2SEBB 2AJXH 3VXUE 4QRQB 1YEFH 3RNQB 1FFNB 1K3ZA 1P4IL 2VXVL 3LKSA 4EEEA 4RDQG 3VFUA 4E42B 4LNRB 4NN6C 4I2XB 4UMGA 1D6EB 1NC2D 4QRSA 1QLFB 4HFWB 4YGVB 2HRPH 2R4RL 5KSBF 4OUUA 4I3SL 2FBJL 4IDLA 4NRYB 3WFZA 2FB4H 2JIXD 3SDCA 1F02I 1EEZB 4FQPA 4YE4L 4MDIA 2F54E 4GAYB 2NTSP 2ID5A 5FYJE 3QZWG 4R9HA 1IBGL 2FGWH 3MROA 4WY7L 1I7UA 4WDIB 3LEYL 1JPST 1GGTA 2HMIC 3O11A 2VXSL 5C7XH 5FUZL 2WWMD 5T1LB 4CRPA 1BBDH 1ZT7B 5KVGL 1F90H 5J12B 4JFFA 1A6VH 1DZBA 1NAMB 3KYNA 4POYA 5DO2C 4K7PH 4ZFGH 4KZEL 4YDVA 4JO1H 4JKPH 3HZKA 2CUHA 3G5ZB 3X3FL 2XY1A 4NC1E 5F1OB 4MB5A 4PD4J 3BQUD 3ZKMD 3ES6B 5FF6B 2BOBA 5C0CE 5SX4H 1JHLL 2PKDA 3BD5A 3ALXA 1NL0H 3D39B 5HHQB 2C5DC 5IF0B 4Y0GA 3OWEA 3KPMB 5HPMB 1EAPB 1AGFA 3GIZL 5E5MA 2AKRA 1P7KB 1U6AH 2Z35B 3QQNA 4OJFH 2F74A 4KMQA 4XNYH 5E1HB 1MJUL 4NNYB 3W39B 5IJKC 4L4VD 2H3NA 5LXGH 1PG7W 3I9GH 5F3BA 3D85B 1IKNA 5I1DA 4HW6A 1UA6H 2R9HC 1AKJA 2R0LL 4KUCD 3RAJH 5F9JB 1GAFL 1SYVB 4WW2A 3BH9A 4PJ5E 2FHFA 3RJDA 4MDJB 4R4NC 5DDHB 1LO5B 4DFHA 2DYPA 5ITFB 3AS2A 4RRPG 1HOCB 3U4AA 4XC3L 4FFWD 3RBSA 3WN5C 2Y72A 3EYUH 2PXYD 4O00A 4AM0A 4D0CA 4UV4L 1TLKA 4K9EC 3MO1A 3V5DA 5HHXL 4D9QD 2P45B 2ICWA 1Z6JT 4OZGB 5I71C 1FV1A 2ZCHH 3K4ZA 2OSLB 3Q5TA 1U8JB 5D72L 4UQ2B 1EDQA 3LKOB 2FLBT 2ZOLB 5CEYB 2JJTC 1EGJH 1R3JB 1S9KC 1YY9D 1BZQK 1DUYA 4ORZC 2EE3A 5IG7B 3OXRB 3LCYA 3QCVH 7FABH 5KS9E 3VGHA 4NWUL 4PY7A 4G6AD 4JO3L 3O2DL 5HHVL 3IJSB 1E28B 4R96B 5HHMD 4PJDA 3ET9F 1HH9B 1CF8H 4JAMA 4OZFA 1KTDA 5CINH 2A9MH 4YHKL 2IG2H 4HQQH 5F1IA 3EHBD 4H1LG 1HHHA 1KCSH 2HT3D 2W0FA 2F54B 1ACYL 1CGWA 2VL5B 2APWA 4KJYA 4TVPH 3T04D 5CGYD 1UWXK 1M6OB 3EJJX 3TJEL 2E3VA 3O8XB 2MCPH 1MRFL 3G04A 2I07B 4LSSL 1IGCH 4LVHC 4XVTH 4J3XA 3VMNA 2CLVA 2PW2A 1CIUA 4UI2A 2GJ6A 1FZMA 3DOSA 1EHLL 2ARWA 3WFEL 3K74B 5DHVH 3FN0L 3NAAL 2EZ0C 4HUVB 4MWFB 4IRJD 3BH8A 1KB9K 2DIAA 2PO6A 3QI9B 4PRHA 3SCMC 1KCRH 4LASL 3OAUL 3ZZ1A 1K8DB 3NZHH 4X7EC 2YD4A 4OFVA 5D8JL 2R69H 4OM0H 1HH6B 4JRYA 4NQSB 2IH1B 2X70A 2A6IA 4YHOL 2AJVL 2OTPA 3DGGA 5DJCA 3ELAT 4K8RL 3MOBH 3MV9D 5D7JA 4LARL 3GB7A 4GLRI 4HH9B 1I1FA 5KSBB 4LIQE 5EO9B 4LEXL 2OYPA 1Z0MA 3AY4C 4PGEB 2OP4H 1OT2A 3C8HA 2AAVA 4MXQC 2FLRT 1KC5H 3BGFB 3O9WA 4Y1AD 4GKZA 4Y19A 2Z31A 5IHUL 1CBVL 3TO2B 1JF6A 4GRLD 2E27L 4C55A 2BVOB 4HZLA 4R4BA 3CCHB 3SDDD 3WFCH 4QXTA 4L8DB 2BJMH 2BK8A 1V7NH 4JFQB 2AXFB 2HTLD 2QSCL 2JELH 2AQ2A 2Z9TA 1NC4A 6FABL 3EUUA 2K9UA 4Y5YA 3TA3D 1OB1A 4YAQA 1JYWA 1Q0YH 1AD9A 3LQMA 4ONGL 5DT1L 4ZUSB 4HS8H 2XA3A 5KG9B 2QR0A 3LRSA 2IANA 4TNWF 5D1XD 1I8MA 4OZIF 2VXTL 2YA1A 4Y16D 1WIOA 1NGQH 4WTWA 1MCDA 3HZMB 1F4WH 3EOAA 4MB3A 3VFMA 3MUGB 5JQ6L 1FO0B 1INQB 5C0AA 2DI7A 4H0IA 4XPBH 1UJTA 4PFEA 4MMZC 1WC7A 3HNTH 3MV8B 5GSVB 2HLAA 2YRPA 3QUML 5EBWA 2KQMA 1FVEB 4QHKJ 1QSEB 1KJ2A 4YDLC 1ORSA 1FE8H 1GH7A 1KLUB 3I6LD 4GW4B 2GAZA 4X9IA 3HR5A 1MFAH 4M6OH 5C08D 1K9TA 3MRNA 4LSQH 4M62L 3LMJL 1AXTL 2YC1B 1T2QL 2LU4A 1CDYA 5C0DA 3QQ9D 1WT5C 2ICES 4R3SB 3PL6C 4TVPE 2Z92A 4XI5D 5D70L 3LH2H 4KAQH 3CDFA 5J9PB 4A6YA 3FO9B 5DF0A 1JVKA 2BOCA 2FR4B 5DMKA 3MA9H 1RUPL 4UINH 3KWWB 4TSAL 2MQ3A 4TQEH 1WBXB 3JV6B 4PLKC 1E4WL 5I75B 4PD4K 2EKSB 5INCA 3L3GB 1JYVA 3SJVD 1SJEB 5JHDB 5GGVY 4GAFB 2OR9L 4HMCA 2VDQH 3TN0B 5JHLL 4LVEA 2VKXA 3QIWC 3W81A 2APBA 1GGYA 5DC4B 1ZGLB 3UZVB 2NY1B 3D69B 2FECI 3B5HA 3P2TA 2FX9H 3TVMD 5EOCH 5DZOA 1J1PH 1F8TH 1U9KA 4NCC2 1A7NL 3WD5L 3PHOB 3I02A 4R0LB 4OZHE 4XHJD 3FZUD 2D31A 4K3DH 4LHUD 3VWJD 4C83B 3EDEA 3U7AA 4DQOH 2OI9C 5BQ7B 3UJIL 1DEEB 3V8CA 3MRJA 2EH8L 2HFGL 2E6JA 4IHOB 4PJ7A 4V1DE 4NQCD 3U7WH 1HILA 3QO1B 3VA6A 4WI4A 5JOPE 2VISA 4F80A 5JDSA 4PGDA 3ALPA 1DR9A 2H45A 4NPYB 2A38A 4JR9L 4LF3B 3UJTH 2R56H 1J18A 1XF2A 3V0WL 2FJFB 4ZXBA 1FYTD 1N3NB 4EI6A 2A74A 1L0QA 3RZCD 4RISL 3N1PC 3KXFA 1OP3K 2ENYA 2YMXL 4XPFH 2DQHH 3VRJA 5L7XH 5ESQB 4U1IB 1DFBL 2XWBA 1IM9A 1PYWB 4HPYH 5F6IB 5HY9B 2ITDB 4RFEB 3SDYH 4D8PB 4TSCL 4QNPF 2OL3A 5E8OA 4Z76B 3QQ3A 4GUPB 4YFLI 4XGZA 4OV5B 5IHLB 1OWRM 4GG8B 1YMMA 1PAMA 1HIML 2VOTA 3IDIB 1BD2A 2HN7A 2ZUUA 4OZIB 3OGCB 2RGSA 1KB5L 2WK2A 3QDAA 4AJ0A 4DUWA 4LMQE 4JY4A 4FQXC 5BOPA 5FB8B 4ENED 1XZ0A 3MLXL 2WM0A 4TRPH 4M4RA 1ORQA 2OR8A 3RIAK 2R0WH 2ESVD 2XQBL 3BIKA 1B6UA 4HIIA 1MI5A 1QLEL 5ALBH 1RUAL 1ED3A 5FDYA 3HNSH 1JFQL 4PJFE 2HJKB 4KKAD 4PTTB 3V6OE 5FOBA 3MJ8A 3ZE1E 3STZA 5JW4M 3CPLA 1AY1H 2W07A 4G8FB 3C6LC 1MCFA 4NFCA 1CFSA 2QTEA 1RIHH 1IKFL 3BOVA 2FD6L 1WF5A 4UDUA 5EUKB 3BKCL 1JYXA 3T4AB 2DLFL 3MRDB 5KJRL 4S1RH 1BHGA 3DURA 5C0RH 1IZKA 1P69B 3C6SB 1OPGL 1AI1L 3W2DL 5IVXF 2VJXA 1UYWH 5C09A 5B39B 3B2UC 3QWRA 2NY3B 3O6FD 3PV7A 3GZKA 1HEZA 3B3IA 5E6YA 2FO1A 3QRGL 4APQC 4NZTH 2AEPH 2LV4A 1AXIB 4HS3A 3LEXB 4LKXA 2NQCA 3MCG1 4ZOEA 3BWAB 3UAJD 4PJAE 1BVKA 4YHZL 3PIQA 4LVHB 5C0FB 4YHPA 5GISL 4OV6F 3OAZK 5EO0B 4M7LT 4JO2L 3R8QA 4RNRA 1BFOB 4UZGA 2PCPA 5E1AA 3HA0A 1FG9C 3I50L 4D0DA 2W60A 4OZFG 3DUHA 4N1HB 3R06B 4K23H 2EYTB 1UWEL 5EU7E 5BMFH 2F58L 1DDHB 5MHSD 1C5BH 5D7SH 1OSPL 3VGGA 1QYGH 1YQVH 1S9WB 3AS0A 4HWEL 4WW1B 3EW3B 3Q48A 4FOMA 2YHGA 2N1KA 3AAZB 4L4VE 3OJVC 3HC0A 1KBGL 2XNAB 4NM4L 4FQJH 2DJUA 1GHFH 3DVFA 4BUGA 5C0JA 2NW3B 4WI9A 2C26A 2VDKH 4M43L 2VZTA 4OCSH 3SKMB 3L5WB 2HP4A 2R4SH 4KV5E 5H37G 2W65A 1A6ZA 3VWKB 1R3HA 1U8LB 1ZE3C 4PBVC 1H3PH 4NIKB 1TETH 3P9MA 4Z7UA 4L1HA 3IFNH 3T08A 5FUCE 5GHWL 3QXAB 1FZJA 1D5ZB 1YEIH 3QDGD 3P0VL 4ISVB 4NCC1 4D9QE 3CFDB 4MCYA 4XPTH 5HI4D 4O02H 3V4PL 1RUQL 2NYYD 4R26H 1KN4H 1P2CB 3KYMA 1H15A 1HQRB 1C7SA 4RCAA 1SM3L 3VCLB 2VR9A 2X4NA 5HHME 4UAOC 5C9KA 5ITBH 2D0GA 3PDDA 3S37X 4L9DA 1XGTA 1RIUH 2E7BA 5TE4L 3CLFL 4RFNB 3VD7A 1BVZA 1A2YB 1NGXA 3F62A 1RQ5A 4J3SA 3O4LD 1NMCC 1XGUA 3NZ8A 4Y4HC 3FT2A 3EFDL 1XGPA 3HCVA 1N5YL 2NY5L 5DFWH 4ZS6C 1TNMA 2Z93A 5DQJB 1SEBB 3BYYA 2P47B 1W8OA 3DV4B 2GY7B 5DD6A 5FO7B 4KK8C 2AXJA 1F4AA 2BVEA 3CDYA 5BVPL 1XF4B 4YQXL 2DS4A 2BVTA 1RZ8B 2G75B 3DX8A 1MQ8A 1YECL 5D93C 4F9LA 2EE2A 1H3GA 3S3SA 3VA2C 2I9TA 3VFPB 5IV2B 2R29L 1HXMA 3MV9E 2YPVH 1VEOA 2YPLD 3SGDI 5IVXB 3GMMA 4WWKD 5KZCB 3GMOA 4ZD3H 3EOTH 3B9KD 5L2KB 5KSAC 3TGXA 4HBCL 3STLA 3KPLA 4HK3J 3VFGL 4AIZA 1A3QA 1KENL 4QO1A 5GRVL 4LLDA 1J0KA 4Y1AE 1OP9A 3LV3A 5EN2B 5GGVH 3G08B 3ROOA 5CP7A 3P77A 3SDAD 1QBBA 1OGAB 5B8CA 5T3ZD 3T65B 4TYUA 4MAYD 1S78C 2IAMD 1V05A 3GK8L 3WO4C 4FMFA 5GS0C 3QEQB 2P5ED 3QFJA 3QIWB 3F5WA 3S3JA 4DTGH 1I85A 3QSKB 1VB9A 1XF3B 1U8MB 4P46A 2DMKA 3DTXA 3QIBD 2DDQL 4YNYB 4Y4KC 1S5HB 3TCLA 4PP2B 4YHMH 4NO0D 4M7ZB 1HHJA 3CH1A 2DQFA 3UTTD 3OQ3B 1YEKH 3R0NA 4HLZH 5C0IA 1QHOA 5DJZA 3ARGC 5JPNB 2P7TA 2WIIB 1DSFH 3QXDA 4JDVA 4MCZA 1GGCL 2CXKA 3TH2T 3GKWL 4P3CL 1KACB 4X6BA 3V6FA 4HJJL 4LSTL 5KTEH 8CGTA 1JNHB 3D0LB 4HIJB 1RZ7L 4DOHE 1WSST 3C5ZD 1EVTC 4OFKA 3DHJA 4OCXH 2WMPA 3MOQA 4RWYH 1T1ZA 5J1AA 3W5MA 1DVFD 1NBYA 1X4XA 5ERWB 2BNRA 3KPPA 4HZAA 3I6LE 4U1HA 3ZKNC 5AYUL 3IJYB 5HYSB 5EWIL 1MFCH 4Y2DA 4CDHA 4ODHH 1IAIL 2IQAA 5C08E 3WJLC 1NMAH 1CTNA 1FL3A 1ZANL 2NX5A 4JRXD 2C3VA 4FQ2L 3GSUA 1CLZH 2GW5A 4GBXC 1NCAL 4RMQA 3IKCA 5EU3B 4HJGB 3SBWA 4CMMA 3VXPB 1U92B 5I1JH 1DLFL 4NWTL 4O2CB