3RHWF

C. elegans glutamate-gated chloride channel (glucl) in complex with fab and ivermectin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
221
structure length
191
Chain Sequence
EVQLQQSGPELVRPGASMKISCKASGYSFTGYTMNWVKQSHGKNLEWIGLINPYNGGTSYNQKFKGKATLTVDKSSSTAYMELLSLTSEDSAVYYCARDGDYYRYGRYFDYWGQGTTLTVSSAKTTPPSVYPLCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Avermectin-sensitive glutamate-gated chloride channel GluCl
publication title Principles of activation and permeation in an anion-selective Cys-loop receptor.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Transport protein/immune system
total genus 33
structure length 191
sequence length 221
chains with identical sequence G, H, I, J
ec nomenclature
pdb deposition date 2011-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rhwF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rhwF02
1W0VB 1MFCL 1UWGL 5LAXB 3UYRH 4LOUD 3UCRA 4WNQB 2HKFL 2H41A 1AQDA 3MRFA 4PJXB 1KJMA 1QFWM 1FJ1B 5ITFA 1HNGA 1XR9B 2BXYA 1OTSC 5DRWB 4M8QA 1NMCC 2AI0H 2GITA 3ARGA 1K5NA 5D9SB 1X5GA 4P57A 4QRRB 4PV9B 4JQXA 3QXWA 2BSRA 3IJYB 4O2FA 3QUXA 3TZVC 5SWSA 3BX7C 5EC1A 2R1WA 4DK6A 2R0KL 3O2DL 4KQ4H 1H5BC 1GZPB 3AUVA 1OAXH 1IQDA 5DYOB 5T1KD 4UNUA 3L3OB 4HJ0C 3NABL 1D9KD 4BM7A 2GJ6E 4LKCA 2R2HB 4TTDC 1KCUH 4HUMB 1WZ1L 2YC1A 5EFIB 3NFPA 5HJ3A 3SOBH 1NCUA 2VLKB 5F72S 3UTZB 4XH2B 1CDCA 1ED3A 3MRJB 4YPGB 4IHOA 3D3VA 3FQRB 5FYKE 2F53A 3L5XH 2CRMA 3BKMH 1KIQA 5K59F 4KRPD 3CSGA 1MELA 1LP9E 4PJCB 4X5XB 3DTXB 3RGVC 2APVA 3WJJC 4K8RC 3ARFC 5EIIA 4X0KB 3B2UD 4LSRH 3I50H 5DFTA 4GXVL 3U46B 3MV9B 1V3MA 4YEEA 2XN9E 3O8XA 4K23H 3FQNB 4MD0A 3ZSSA 1QFPA 3TT3H 3CXDH 1BQUA 4HWBL 4YDJA 5FOBB 2KL6A 4WIQA 1BQHB 5C1MB 3ZL4L 4LCWB 5I75B 2X4OB 3TT1L 4Q2ZA 3V4PL 4GLRI 4K3HA 1FVEB 3C5ZC 2YRZA 1MLBB 5IVNA 1S7XB 1R3KB 1UT9A 2W59A 4GSDL 3T65B 3TIDB 1T1WA 3MO1B 3R1GH 1IARB 1PLGL 3HUJB 3HMWH 1MHCB 4PJ7B 5HVHC 1I4FA 4GRLB 4GG6E 3BKJL 1IAKA 1FYTA 1G9ML 1U9KA 3QH3A 1HDMA 1KJ2H 4YHNA 2AK1H 1I7TA 2CLRB 4YX2H 2ED9A 2PW1A 2AAVA 1MFNA 3ARQA 5KAQG 5JOPE 1J1XH 3MV11 4YGVB 3AC0A 1PQZA 2AK4B 1I7ZB 1A2YB 2BVPA 5AAMA 5KZCB 1CXEA 2ERJB 1MF2H 4CVUA 4YQXH 1JGEB 3V52L 3V6ZA 5F7MC 2PCPA 4KJYB 2K3TA 2UZIH 4G43B 4J1UB 1G1YA 1MHPH 2CUIA 2J12B 5IJVB 1CDBA 3ARGD 2ADJA 1ADQA 5C7XH 1ZMYA 4I3GA 4XXCA 4Z0XA 5IHUL 1QP1A 3PGFL 4HCRH 1YNTA 3GRWA 1FO0A 1EIBA 2DLGA 4HIHA 3B9DA 3QXAB 4XCCL 3QUXD 4ZO9A 5SWSD 3P4NA 4OLWH 1MCWW 1U8MA 1DBBH 2NY6B 4ZUTB 5EZIL 1CXHA 5CFHA 3PP3H 2L7UA 1A8JH 4JHBA 1QPXA 4X4ZA 1V3KA 5E99H 1P5UA 4YDKH 4P2RB 2W91A 3NIFE 3KS0H 1AGFA 1G9NL 4ZFOA 5D7IE 4GRWF 1JZ5A 3VFRA 5FCUL 3OGCA 1BFVL 1IGFL 1RZFL 2JJVA 2W1NA 4WFFE 4XWOC 1OD7A 1F13A 4LARH 1DVFB 2DWDB 1ZVSB 4LEOB 4DN3H 2Q7YB 2YPLD 2IAMB 4G7VH 4JPWL 2JJSC 3D3VD 1KIRA 3QI9C 1JRHI 4NRXB 2F53D 4BZ1H 2QADB 1IFHL 3DRQB 3G6DL 2B8OT 4W68A 2F8VA 3SO5A 43C9A 3DOSA 4M1DL 4DGIH 4N0UA 4LLMB 2A2QT 2NY2C 3O6MH 1EJOH 5FGBC 4MA3A 4XHQA 4JO2L 1C08B 1N4XL 4PS4H 3EJJX 4U1LB 1PSKL 5LGKA 1FFQA 3RWDB 1RFDH 4WUUA 4J3WA 4KUZL 4UT7H 3VXUE 2DS4A 4M6ML 1YY8A 4H1LB 3T0EC 5DHVH 4BA8A 1FL5A 4G80B 2DAVA 3N85H 1ZLUK 2BX5A 3TO2A 5KSAA 1WZKA 3JV6B 8FABA 3WUWB 2A73B 1R3LB 3HI6L 2J5LC 1AXSB 1P7KA 2R29H 5SX5K 5IESL 1B0RB 1IKFH 1KLFA 2R69H 5IB5B 5DJZB 2NQCA 4Q6IB 5LCVL 4IS6B 4PGDA 1U0QA 3IETA 2G5RA 2YD4A 2YA1A 3N0PB 4LLDA 2Q7NA 1BVKA 4U1NB 1KIPB 4DW2H 1NL0H 1NCWL 1R5IB 2VMFA 4OGAC 3BDBA 3E2HC 3F7VA 4ZS6C 1WVZA 4HBCH 4Z6AT 4UT9H 5HHVH 1LO5B 3GKZA 3TESA 4UILH 1DL7L 1B0WA 3V6OA 1NGWA 4LPVA 1ZGLP 3LCYA 4D0DB 3V4UL 3EUUA 2JK5A 5JIHA 1CGTA 1KBGH 2RGSA 5J7CC 4UV7H 1IAOA 2J1KA 3D18A 3B8SA 2EE3A 3RTQC 4LBEB 3MLYH 4GKSA 1EHXA 4QNPE 4MJ4A 3CFDA 1I85C 2ICWA 2V5SA 4YHYC 3HN3A 3VFWB 4V1DD 5IP4A 5KSBA 4P4KB 4J4PA 5GS0C 3MLZH 4P23D 5BMFH 3LQAC 4CRPA 2M26A 3TC9A 1FFPB 5F7DB 1MFEH 1JPGB 5FKPA 1FIEA 2CR3A 1UACL 1B88A 3U7AA 3DV6A 3BVNA 4WI2A 2X4PA 4C83B 4JDVB 4ZSOA 2P8LA 1SJHB 3TN0A 2I60H 3PABB 2VLMD 5E8OB 1JF6A 4HBQA 2G60L 2H32A 1DLFL 2Z31B 3GI8H 4KGLA 3QIUB 2BNQA 1RZJC 5IQ9B 1DQQA 3U7YL 2DF3A 3VWJC 2AV7B 1EAJA 3MNWB 5FB8B 3CFEB 1J05A 4WEMB 3NA9L 4JO4L 5H35A 2YPKA 4HXBH 1M05B 4JRYB 2H9GA 2ZSVA 1CBVL 4D9RE 4AENA 4S0SD 2D7QA 5CD3A 4MLSA 1RVFL 2AXGB 3PIQA 4RIRA 4EQ2A 4CVZB 3QP3A 4CVXB 2Z8WC 1MFAH 3QULB 5ERWA 2WUCL 4M1CC 3BPCB 3N50A 4KDTA 4CU7A 1MRFH 5C0BB 4PJEA 1YECH 4HS6B 4N90D 2VISB 5KOVC 4LCYA 3UBXI 2CIKB 1OGTB 1I1AD 1N8ZB 3RHWF 3ZO0A 3GZKA 1WSST 4OIIL 4GKZB 5DK2B 5GS3A 4LCIH 2LAAA 4OGYL 4Z76A 5IMMB 4NZUH 4OSUH 4KUCF 1X5YA 5BRZB 2LVCA 2Y7QA 2DIJA 3DVGB 5I1HH 2DL2A 3UPRB 1YPZE 3U0PA 2VQTA 4K55A 4R97C 5DK0A 1LK3H 4A6YA 1NFIB 2D2OA 4RMTA 3WEXB 3F6LA 4IOIB 1C12B 1LK2A 3MGTB 3BMVA 1H3TA 2QHLA 1U8NB 5MEPB 5GRXG 1FZMB 2FD6L 1NQBA 1WF5A 5IFAL 1I8IA 5GGSB 4CW1B 1WBXA 3KYOA 2YD2A 2X4TA 4LPYA 4H25B 4KK8C 1FN4A 4WO4B 1A6WL 1ZGLM 1M7DA 4PV8A 5DMYA 1NSNL 5BZWA 3AAZB 5DJAB 1V8HA 3PL6D 4OFPA 1RUPH 4X5LA 3RNQB 1EHNA 4ZDHB 3LRHA 1H9VA 4LVNC 4JM4H 4Y4KC 1P1ZB 5ENWB 5TE6L 5J89A 2D03H 4IIQB 1NC2A 2OK0H 4NDMA 3G5VA 4ENED 3TCXA 2NLJB 5TDPA 4RISL 5I8EA 2LAGB 1YEIL 1W72L 4J4PD 1KPVA 5HI5C 1BQLH 1BD2E 5D1QB 5IBTL 1XF4A 2AJVH 3SDDB 5J8OA 3D25B 5I1LA 3LB6D 3BGAA 3HI5H 3V5HA 4JY5L 3U4EA 5HGBA 1FVCA 3C2SA 3P0VL 4Z7NE 3MLUH 1ZT4B 1JPTL 4IMLA 4XAWL 5TDOB 3FO1B 3MROB 2N7BA 4F9LC 5DTFB 4PUBL 3IKKA 4R96B 4NQTA 3L95B 4AQ1B 1GPOL 5EH1A 3TV3L 2DQTL 5EO0A 3NAAH 5LXGH 4FXKA 2BNQD 1R5WA 2BNRA 1JPSL 4XTRC 3FO9A 4B7IA 5DDHA 4HEPG 3OJDB 4HW6A 2H1PH 2GSIB 4O58L 1OCWL 5D7KD 4ZD3H 2G75B 1C16B 3O2VL 4NJ9L 3SPVB 1PBYA 1CDJA 5FGCE 5EA0L 3TGXA 4X6CB 4NM4L 4AEIL 4KKNA 5I0DA 2BFVH 5D93B 2AJYH 2OBGA 1AI1L 2WBJA 1FE8L 4NKIH 1CFVH 2NXYC 2VLRE 1AO7B 3ARDC 4G8GE 2BCKA 2MCPL 1J8HB 1JV5B 1BFOB 1JNLH 4XNZB 4P59H 3V0AC 4BZ2H 1BWWA 1P9MC 2X1QA 4YZFE 2DN7A 3W39A 2F5AH 3QHZL 2X4UB 1T1ZB 4JZOA 1XR8A 4YHPA 4M43H 2DTML 3S37H 3BP4A 3HE7B 4U6YB 4GAFB 1IM9A 4GJTB 1MCCA 4OLYH 1YZZA 2A83A 2AJ3A 2CUHA 4UINL 1QLRB 3VMPA 1IMHC 1LO0L 1YEJL 3MV7B 1RZKH 4NKOA 2JF1A 2VNCA 3NACH 4PB9H 1F4XH 4HIXL 1U91A 4NQEB 3S36H 1BF2A 4HFUL 2YWYA 4PIRF 4D8PA 3TYGL 3KPSE 4QXGL 4P3CL 1ADQH 2YD8A 4MJIB 3UO1L 4YWGL 4FZ8H 2R1YB 4K7PH 4ZUWA 5CBEA 3VDBA 2FATL 2YA0A 1ZXQA 1CD1A 3GRWH 1FO0H 1ZLSL 4XI5D 3I6GA 3FZUC 1DUYB 1KELL 3MUY1 1XGRB 3EYQC 3MFGB 1CLYH 3EOTL 3SCMC 1EEZA 1E6JH 1LILA 2HKHH 4JGUA 4XP1H 1WTGT 4LSVH 1XFPA 2CGRL 2NNAB 2Z8SA 4HUXB 1IL1A 1AKJA 2G9HA 4LQFH 3C8DA 4WEBL 3MRBB 2X7LB 1MHHB 4RGMC 5F7EH 5JUEH 3B9KD 3B5HA 1WEJH 1QFHA 3NCEB 1CD9B 1N59B 3HR5B 5HSFA 4E41E 1P53A 4HIEB 3RU8H 3SE4A 4MS8D 5EBMB 3RQ3A 3LKPB 4DKAA 3HG1A 4BFGA 4NYLB 3QO0B 4U1JA 1DEEA 1DSFH 2A74A 3CC5A 2YXFA 3LIZH 1RZIA 1ZT7B 2XQYG 4O5LL 4LP4A 5IEKB 5ADOH 3V0VB 1DTUA 3OV6A 3BEWA 5H37H 1FSKC 5E2WL 4NN5C 1A6ZA 3UTTE 3ZDXE 3IFOB 5CSZA 4XNMB 2F54E 5D71H 4QYOA 3OHXA 2JB5H 5EUKB 5KVGH 5I17A 4KMQA 5E6ZA 4FNLL 3GSNL 5JA8B 4JFYB 4IRJB 5GHWH 4MQXD 4NO0A 3CZFB 5SWQA 4DOHE 5HYJE 4O9HL 3W0WA 3EJYD 2OTWA 1MI5A 3DI2B 4YHKL 3FMGH 4JFFB 1N0XL 3MR9B 4P2CG 5I1GL 4HDIB 3DRTB 3RA7H 5C0DB 2Z8RA 4C4KT 1XF1A 3RWGB 2P48B 3QWOB 1VFOA 5D2LE 3IGAB 4WFGD 5EIVA 5E9DA 4L29A 2MJWA 1OTTC 4K3JL 5CEYB 5C71A 5F7NC 1JK8A 2GI7A 3Q2CA 4F7PA 2WBJD 3KXFB 5CJXC 4ZNEE 2VH5L 2XRAL 1Q94B 3D1MC 1KB5L 4L3EE 4OCXL 3RFZC 3NIDF 4TSBH 1NAMB 4PLOB 1ZEAL 4NNXB 4E42B 3MRCB 3G08A 1BEYH 1IM9D 1U95B 2HTLC 3O9WD 1NDMA 3WHE1 1UJ3A 3GSXB 5FO8B 1MREL 3PGCB 2RFXA 1CT8A 4P5MB 1FNSL 4FQQA 3UTSA 4AH2B 4AEHL 3MA7A 4KRNA 2ICCA 1DBMH 3QIBC 4FQIL 1NFDF 4UIMA 2B5IB 4NO3B 5DD3H 1CFQB 1TITA 4PG9B 1NGZB 4WTXA 2FEDC 4OZGB 2CJUL 4FQLH 1AP2B 3SY0A 1T4KB 1ZLVH 2N56A 4N0YL 1C7SA 4R4ND 4KGJA 1GGCH 1UH4A 5T1LB 4QTHB 4R8WH 3ALPA 1TZHA 4I3RH 3QXUA 3BZEB 5L6YL 3PWPA 1QVOA 4TRPH 1UVQB 4DJMA 3SO3C 3DX7B 4PRDA 2I5YL 3Q1SH 4JPVH 3WFCL 4KV5F 3LN4A 3GSWA 4Z9KB 2P45B 1MIML 4N9GA 5FYJU 1ZVYA 2AVGA 1AKJD 5K9KB 1AD9B 4MNQB 3DBXA 2E6QA 1EXUA 4M7LL 2FX8H 1F00I 3ZE0E 4HJGA 5I8CA 1U8IB 4PGEB 4RRPG 3GMNB 4P9HL 1KXTB 2G5BB 4DWHA 3MJ7A 4PJXF 5LWYH 3HG1D 5T3XH 3HZYA 5AUMB 5J6GA 5HHMB 2H26A 5F70A 4JHWH 4OI9A 1IKNC 5D72H 4PRHE 2CDEA 5F1KC 3OTTA 3MCKB 3MRHB 3FTGB 3QQ3A 4P49A 32C2B 3KYKH 4ETQA 2ORBL 3VI3E 4KQ3H 2JCCB 1KCVL 2IH1B 5EU6A 4ONGH 2OR9H 2E9WA 1GRWA 1H3WM 3F5WB 4HAFA 1T20B 1GZQB 4IDJH 5E4EC 2ENSA 1SEQL 1MFBL 1A7PL 2LFGA 1T1XB 1RIUL 3VWKB 5E03A 2FX9L 2XZCH 2Z8VC 3CU7A 4QTIL 1AFVL 3CNKA 1DANU 4X6DB 3KPNA 4PJGB 4A6YH 3GJEA 4NO0D 3GI9H 3TBYB 1IM3B 5E8PA 5GGRA 2F19H 1QSEA 1CFTA 1MI5D 2P5WA 1BPVA 4CUCA 3JZ7A 5LBSH 1MCIA 3NGBC 1RUQL 3U1SH 3FQUA 1FGNH 2HVKB 7FABL 2EDKA 1F90H 1U8JB 2HFFA 2O5YH 5E9DD 5J11C 2BK8A 4L3ED 5BVJB 5LQBL 2CLZB 4MHHI 3QEQA 4NQDA 5IW1B 4PRPA 5IIEB 1A1NA 4NOBA 4PJCF 4GBXB 1I1FA 2XKNA 4M3JA 4OZHB 3H7BA 4HLZH 3VXQB 1K8DA 1YEKL 2OZ4A 4NQCB 2R56L 1S3KL 3FT2B 4IRSC 3PHQB 4Y2DC 2X09A 2EDXA 4ZFFA 3NPZB 4QRTB 4PJIB 1YN7B 3F6IA 5I1CL 3GSRA 3MA9H 5ALBH 1WFTA 3UEZA 2P42B 3BZ4B 3PJSA 3E6FA 1JWMB 1N2RA 3CLEH 4HXAH 3RL1B 5CZVL 4UB0H 5JHLL 2B1AL 1L7TL 4OAWB 5MI0C 3GIVB 4DKDC 1JPST 1TJHH 1ZAGA 4JKMA 1QR1A 3NBNA 3UROR 4APQC 5EOCH 4XPGH 3MXWH 2CDFA 1S9VA 2DB8A 4GAGH 4BH7A 2VE6B 4LVOB 3HUJF 1X4XA 5SWSE 1GGYA 3MUZ1 4GT7A 4LSSH 1UEYA 4PJ7F 5IROC 4JZJC 4N9OB 3RVVD 5A3IC 3F62A 4NO5A 4M6AA 5FA4B 1JNJA 2LABA 1UWXK 1BP3B 4C55A 1X5LA 1C5BL 4CJ0A 4D9QD 2I9LA 2O93L 3WL9A 3K1KC 5F3BA 3H0TB 4EXKA 2D31A 2JELL 4MNHA 3V7AE 1EFXB 2ICES 1PYWA 2NY5L 1A7RH 1T7WA 3LEYL 3Q5OA 1KGCD 4HH9B 1VFAA 5E2TH 5FCSH 1U92A 3HZMB 2AJUH 2EKSA 2YPLE 3VE0A 1NUDA 1JNNL 4F37K 3D3VE 4DK3A 2EC8A 3JWDH 4TULH 5DWUH 2F53E 4G8EA 4ZTPL 3SKNA 1N64H 2DTSA 1JUFA 4P4RA 1I1AC 2KQMA 3UZQA 4YR6A 1J12A 3I6KA 3IFLH 1JGLH 1ZE3C 1A6TA 4PGCA 2GUOB 3THML 4I77H 5EU6D 3L7EB 1N5AA 5JIIA 4UNTA 5DEGA 2JIXB 5AZEH 5HHOB 1MIEL 3VFVA 4Z7UF 2AABH 3GO1L 2EYRB 4OF8A 3RWEB 2H2SD 2BSTB 3H9YA 3RWHB 1CVRA 4JANA 1A7NL 3U9UB 2EDNA 5FV2A 2E7LC 1D5XA 1GJIA 4HWEH 4X98B 3C60B 3PDOA 4XVSL 3CUPB 3SGJA 1FLRL 3CFBB 4FQJH 3ULVC 4JREC 4PY7A 4YXHH 1G7MA 5EUOB 3A67H 4G8FA 1WWCA 4ZUSB 1DBKL 5DZOA 5CJOH 3RIAK 4LLYB 4LLWA 5JDJA 1MQKH 3UYRL 1FYTE 5IW6B 1Q8MA 5L2KD 1CE1H 4NZJA 5JW4R 1GGUA 3OF6A 1CQKA 2GT9A 4KY1H 1RAMA 1RIVL 3Q5TA 2CD0A 4C56B 2AV1B 4PP2A 2AI0L 4NUJB 5F89B 3O41B 5HGAB 2AJSH 2JLLA 5IKCB 3CZJA 3J8F7 4M1GH 1KG0B 4KDWA 5CEZD 4V1DE 4B53A 1JHKH 5C0FA 3NZ8A 5EU7E 3T77A 2UYLB 4U31A 5D1XC 4OB5H 5ICZA 3Q3GA 4LLQB 1MNUL 5IUSA 3ZKMD 1LO2H 4FQ2H 4QO1A 2Y25A 4RBPH 2AQ2A 3HLAB 3K3QA 3U0WH 5E94A 5DJXA 4KQ4L 4PREA 1OAXL 4S1SH 3IKCA 4F2MB 2QTEA 1MCOH 1NMCB 3ULUF 4QHKI 5KVMC 2HG5B 1R0AH 2D7NA 3CPLA 4WW1A 1KCUL 3VGEA 3SKOA 2AJXH 3VXSB 5IMOB 1P6FA 3SOBL 3U83A 3VCLB 5I30H 5JPMB 5HD8D 1NCBH 2DM2A 4NKQB 5HYEA 5ID0A 4NGHH 3L5XL 1ZHBA 3CVIH 4X7TA 4JQVA 4OKVA 1NMAH 1G6RB 4Y5VA 3TZVB 3DO7B 4WU7A 2C7UA 3C8KA 3MLXH 4Y5YC 3VRJB 2FCBA 4Y1AB 1X6NA 4OFKA 1S8DA 4LSRL 3I50L 4BYHA 4J3SA 4AIXA 5JQHC 3WKMH 1H5BB 2UY6A 1NBZB 4KAQH 1F3DH 2Y5TA 1LVEA 2EDEA 4JAMA 3MMEB 4L4TB 4K23L 4N90E 2R2CA 5KW9H 3TT3L 3LEVH 4N0UE 5D6CB 3CXDL 1FGVL 1ORSB 2HTKC 4GXUM 4XNXH 4WUKH 3D0VB 4PJXA 4JDTH 1FJ1A 5DT1H 2HMID 5I66A 2VR4A 3O3EA 3WHXB 3OWEA 1BAFH 2APTA 5DRWA 2DIBA 2JB6B 4PJ9C 2R0ZH 4G6FB 3CSYB 3R1GL 4CNIB 1OP3H 3ARFB 3U0TB 3HMWL 4UOW0 1TVHB 1CGWA 4PV9A 3KPLA 2C1OA 4KJPD 4XNQB 4KK5C 1T6WA 3M45A 2VKXA 1KJ2L 2ZWLT 2AK1L 2VTFA 4WW2C 5SV3A 4YX2L 1T0MB 3SGKC 4M7LT 1AGCA 1TVBB 2FJGA 5E08H 1J1XL 3U9PH 1DCLA 5KSVB 1F2XK 5CILL 1RU9H 3GGWB 5DYOA 3QYCA 3F12B 4PGBB 3C5ZB 4PG2A 3CH1B 3WS6A 3H42H 1BLNB 4YE4H 3V6OE 3DV4B 1MF2L 2UVEA 4G8IB 3SKJH 3RX7A 2VLKA 4HK3N 5IV2B 4XH2A 3DGGB 3MRJA 2UZIL 1MHPL 2RBLA 3FQRA 5E00A 4PJ5B 4MDIB 5C7XL 5HHPB 5FF6A 4R90H 3RL2B 4NHUB 4X8JB 5EU5B 4XMLH 4PJCA 4GAYB 3DTXA 4HCRL 2NTFB 2FL5A 3DXAB 4U3HA 4EXPX 5BXFB 4XVUD 3EW3B 3GMLA 4U7SA 4OLWL 5IB4B 3D0LA 1DBBL 2P4AB 1JMZA 3CFJB 3DX9A 5IFJB 2LVEA 5F9OH 2J8OA 5GISH 1ZGLB 3ILQD 5JXAH 4P9HC 5E99L 4M62H 4ZSOE 4YDKL 5IEHA 4ELMB 2VXVH 3WYRA 1CZ8H 3HC3H 4GQ9H 4H20H 3FN0H 2BNQE 3QUZC 3VGHA 4Y4HC 1FVEA 4LARL 3EO1A 1R3KA 4KK6C 3T65A 3VXRD 2Q3ZA 1PEWA 5EPMA 2UUDK 4DN3L 1CGUA 1HSBB 4WTZA 1EK3A 2NX5B 4G7VL 2D7TH 3HUJA 3PG2A 3D5OF 4J3XA 4BZ1L 4ZPVB 3O3AB 4JM2D 1INEH 1YDPA 4LFHD 4DGIL 5HDQH 1EJOL 1X9QA 4PJFB 4J3TA 3RGHA 4DZ8B 2V9RA 1TNNA 3LN9A 1RZ8B 3EFDH 5T3XE 1N6VA 2O5XH 4PS4L 5JZ7C 1RFDL 2VO5A 1A2YA 3RDTD 4KROD 4UT7L 2OZ4H 1BOYA 4FZEH 3N85L 5KAQF 3UJTH 1LEIB 4H8WC 2R0WH 4MD4B 5DFVC 1JGEA 4F7CA 3FRUB 1EA9C 3S6CA 5K59E 3BRGC 3QI9B 4KJYA 3I2CH 3OKKB 3FONA 4G43A 3DWTA 4F58H 1AE6H 4P0DA 5C9JB 3DVIA 2FO4B 2R69L 1HQ4A 2QQNH 2YD3A 2NY2B 4WI8A 5GJSH 5B8CC 2DBJA 4YO0B 4QRRD 5J3HC 4DW2L 4K94H 5HYSG 4HBCL 2VYRE 4NOFA 3KJ4C 1NCAH 3QXAA 4UT9L 1S7VB 5HHVL 4Z7UA 3UAJD 4X6CF 2XI9A 4UILL 4ZYKA 1NUGA 4L8DB 3T0EB 3M17B 2LU4A 3GMMB 3BT2H 3P73A 1AIFB 1KBGL 3KS0J 1B4RA 2DQGH 4UV7L 1SMAA 4JFEA 1RZ7H 5DHYB 1JN6B 4P2RA 2X9YA 3MLYL 2VWEE 2QR0A 4LU5H 2B39A 3WLWC 1LEKB 4ALAH 1AGDB 1AQKH 5IJKC 3MLZL 4M02A 4JJHA 2VLKD 3AGVA 5BMFL 1FZJB 1ZVSA 4Y16C 1OARH 2Q7YA 3MRNA 4HUKB 1MFEL 1HHIB 3OR7A 4LCUB 3ECBB 4NWUH 4IOFD 3QXTA 4UMGA 5FM5O 3IDNB 1E28A 1YC8A 4JN2A 3RWCB 2DQFB 1AR1C 1SJVA 3ZHKA 2YK1H 2NY1D 4HG4J 2I60L 5A43C 1EO7A 4MXVF 3QXDB 3GI8L 4R2GC 1ZA3B 3MV9D 1C08A 3RTQB 2NY5C 2ZKHH 3RIFK 1JF1B 3RWDA 1VEMA 1GC1H 4JFHD 1Q9WB 3Q6GH 4YHYB 4E9LA 2HLAB 4F7EB 4HXBL 3VI4F 3VXNA 3E3QC 5EZOH 1IGMH 3MRPA 5HGHA 4NN6C 3RX8A 1EEYB 5KTEH 2DQIH 3WUWA 2ARJQ 2A73A 5F3HB 1R3LA 2DI9A 2BNRE 1AXSA 4EI5C 1OPGH 1JWUB 2OX5A 4IS6A 1CFBA 1MRFL 5D7LA 5AG9A 3OAZH 2B2XH 2YEZB 4WFGE 2FDBP 4LNRA 1YECL 1KENH 1R5IA 4GRLD 4LKXA 3VWJB 1P4IH 1SBSH 1I8LA 4LHJB 4D0DA 5BQ7A 2VITB 3IRZA 4LCIL 5C09B 4DGVH 4NZUL 4OSUL 3KWWA 5C0ND 1EBAA 2AK4D 5I1HL 4ZXBC 4LBEA 4PY8I 3CCHB 5KZCD 3JWNC 3QT2A 1LK3L 4KJQC 4Q9RH 1TZIA 1DFBH 3C5JA 4X6BB 3GMOB 4N5EC 4KZDH 2BMKB 2FSEB 1K85A 4PR5A 1NEZB 5LKNA 1FFPA 1ZV5A 3ROOB 1BBDH 3BN9D 4X7SH 1RJZA 2QEJA 2RJMA 3TBTA 1F6AA 1NLBH 4QHUA 4ZOAA 5JO5B 4DGYH 4C83A 4MQ7B 1SJHA 2ZCHH 1GH7A 2EIDA 4HAGA 1MCHA 3W11D 5D7JC 2BVOB 3T4YB 1KFAH 2C1PA 3OR6B 3PP3K 3GIZH 2IC2A 4NQXB 2IPKB 3BD5A 1RUPL 5IQ9A 3FOMB 2NY6D 3B2VH 4CADA 3MRGB 1FFNB 4R97B 4JM4L 5CZXC 2D03L 4HUVA 4JRYA 1M05A 2HJFA 2Y23A 4FTVB 4LDLB 3G5YA 2DLTA 4JFED 2CRIA 4RA0C 4MA8H 2E7HA 4P2RD 2YSSA 1JWSB 4X80H 1M6OA 1YUHA 3NZHH 5GGTA 3AXLB 5IWLA 1U8KB 3QEUA 4L3AA 2BVUA 1VEOA 2AXGA 5JW5A 1BQLL 1OW0C 1LE9B 2AJVL 1YQ2A 2F8XC 1DVFD 4JN1H 2F74A 3HI5L 3QULA 3LV3A 1ZTXH 2IAMD 3BPCA 3OX8A 5JW4M 3HG1E 4R0LC 5C0BA 3WFHB 1NJ9B 2QADD 3MLUL 3V8CA 4HS6A 5EO9B 2VISA 4XCNB 3QNXB 1OAZH 1OGTA 2H8PA 2A6JA 4F9PC 1R3HB 3QWRA 4HG4K 1N8ZA 4LVNB 4FQXC 1TENA 3T0XA 4P3DA 4OZGF 5E24E 4Y4KB 5F7UA 4GKZA 3NAAL 3BUTA 1IGTA 3AU1B 5LXGL 4OZ4A 4KU1A 4ORZC 1INQA 5B38G 5BV7C 2G2RB 1UH2A 3MYZA 5D2NC 2H1PL 4ZD3L 4QOKB 1WWWX 5KANI 1JFQH 4U1SB 2WINB 4XX1G 4ODHH 2CUMA 4Y8DC 3DROB 5EO1B 2XNAB 2A77H 2BFVL 3PQYA 5A2KH 4IOIA 3QUKB 1QFWI 2AJYL 3W0WE 3EBAA 1MI5E 1SYVA 1U8NA 3D85A 1XAUA 1KTDB 3E1F1 4NKIL 5CD5C 2NY0C 5ESAA 1U58B 1JNLL 1U3YA 4P59L 4BZ2L 2F5AL 1KT2B 3ULUD 4H25A 4WO4A 2AGJH 3V5DB 4M43L 5E9DE 3BPNC 1F8TH 1F4AA 4WCYH 4F3FB 2KZ1B 2X4SA 1F5WA 4OLYL 5DJAA 3HAEB 2UWEB 3MLWH 3T04D 3RNQA 1VADB 2CDGB 5E1HB 1D5ZB 3NACL 4PB9L 1F4XL 1YA5A 5ENWA 3S36L 4M7JH 1DBJH 4IIQA 4UU9B 2JCCF 2WUBH 5MP6L 5HHQA 2NLJA 3B43A 1KC5H 1ADQL 3QEGH 1SYSB 2P7TB 4XBGB 4K7PL 2NXYB 3ARDB 3X14B 5B3NA 2IFGA 4P4KD 5MENB 2WWKT 3FB8A 4KKAD 3GRWL 3CDFA 1FO0L 3SDDA 3WO4C 3D25A 3U4AA 4PJBB 4QRPA 3KHQA 4X6DF 4PJGF 3T0VA 3GM8A 1CLYL 4J6RH 1BREA 5HDBF 1E6JL 2XWTA 2HKHL 3AM8A 1PDKA 3QFJB 1NMBH 3WIHA 4XP1L 3CD4A 4JJ5B 4K2UH 4XB8A 3LS4H 4LSVL 5DTFA 2KQNA 3HNSH 4R96A 4Y88A 3GHBH 2NYYD 1G7QA 4LQFL 3FB6A 5F7EL 4MXQD 5JUEL 4XCFH 2Z31D 3BP6A 5K33A 4ZFOL 1WEJL 2XQBL 3OJVC 5SWZB 1YY9C 2GSIA 3PWPE 3RU8L 1C16A 4D9QE 3LPFA 4JRYD 2CLVA 3LZFH 3C6SB 1ZANH 4OZHF 1DSFL 3LIZL 5CMAA 1KGCE 5DVMA 2DMCA 4MB3A 2WLZA 3SCMB 5HYSB 4HX1B 4R26H 2FH8A 1S78D 3SGDH 5ADOL 3OKMB 1SJXA 2PF6A 1AO7A 2PW2A 3DO3A 4PBVC 1OSZA 4PTTB 4PJIF 1BFOA 4BQCA 3X3FH 2D0HA 4J23A 4JHZA 3QZWB 5D71L 5C0BD 2HYMA 2JB5L 5TJWK 5KVGL 3Q0HA 4U6YA 3TH4T 4W70A 4XP6H 3QWRD 1KLUA 3HNVH 5DD1H 2IF7A 5B39G 3GBNH 2VIRA 5GHWL 1U8LA 4G6JH 5EU6E 1UQSA 1MH5B 1QRKA 3MV7A 2Q8BH 1WGOA 1EFQA 4PJAB 5GSRA 2W0FB 4NQEA 3TJEH 3I3BA 1JZ3A 3CDCA 4KDVA 2FZ3A 4LGSB 4G3YH 1UADC 4GQPH 3RA7L 3JVGA 4OF0A 4L3CB 1I8MA 3H9ZA 1TZGH 5HVGB 1FSKB 5TF0A 4NN5B 3PQYD 2FJHA 2PTUA 1E4XI 1T21A 3D85D 4R7DA 1DUYA 2P5WE 1FAIH 1VESA 1XGRA 3QPXH 3RZCA 1UM4H 4LCCB 3IVKA 2P44B 3U36A 2IEPA 3KLHC 3ZLQC 2PXYA 4WO4D 2KKQA 1I1YB 1BVLA 4TSBL 1HHHB 1U3HB 4MJ2A 4HUXA 3OKYA 4XNYH 2WNGA 3MRBA 1BEYL 4GS7C 3QEQE 3QO1B 4NQDE 4TNWK 4PRPE 4AG4H 3HB3C 4HGWB 3UTOA 4XC3H 3QRFM 4JDZA 3M8OH 3MBEA 2Z4QB 4HIEA 3PWJB 3TJHD 3IDMA 1DBML 2YWZA 3LKPA 4OFDA 5DD3L 4LSTH 4NYLA 1P2CB 5TQ0H 5C3TA 1R24B 3TH3T 4FQLL 4P48A 2GJZA 1NBVH 5CGYD 4G6AD 3DVNB 4Q97A 2H45A 3AY4A 2ITDA 1XZ0A 1GGCL 3QDMB 5IBUB 1PKQB 5IEKA 1R3JB 3V0VA 4YDLB 5D1QD 4JFDB 3GSOB 3SDDD 2AEQH 5BW7C 4R8WL 4YHOL 1PY9A 4CDGC 1MQ8A 3IFOA 4OLXH 4XNMA 4I3RL 5F7WC 5JIPA 4P2OA 5EUKA 4Y5XA 1FNEB 4TRPL 2BRQA 4MAYA 4OUOA 3Q1SL 4JPVL 4NWTH 3VFPA 5DJ8A 1RI8A 1KJVB 5EUOF 3VA6A 5BJTB 4JFYA 3ARTA 1HH9A 4IRJA 4ZODA 4FXGB 3T8XB 3QIBB 2EXYC 2MQ3A 3PGDB 4L4VB 2FX8L 5I0ZA 5D6DC 2ZUTA 4F80A 2EC9T 4JFFA 5GRUH 4GMSH 5GSVB 3L3JA 3OJMB 5M95B 3NH7H 5C0DA 1E4JA 3K4AA 5LWYL 2XFXB 5T3XL 2GFBB 3ULUH 4JM2C 4JHWL 3IGAA 2EECA 5D72L 1RMFH 3QDGB 1ES0A 4RX4D 3DPBA 4X99B 4JFXA 5IBLD 2XXCB 3KYKL 3KXFA 4KQ3L 3IXTA 5T33H 3HRZB 1AO7D 4ONGL 4K7PY 4LPUA 5IT2H 2OR9L 5DI8A 2ZSWA 3WNOA 4CU8A 4IDJL 6CGTA 3MOQA 1IQWH 4LMQE 1QQDB 2ICWJ 3OSKA 3HE7D 2XZCL 1FL6B 1U95A 3OL2A 2CKNA 2HRPH 4W4OC 4AM0B 2D4FA 3MGAA 1NC4B 5C0GB 4A6YL 1OOAA 3GDBA 3SJVB 1D5MA 3GI9L 3IXAB 3GSXA 3MV7D 5FO8A 3PGCA 2F19L 4NQED 4AH2A 3TVMA 5LBSL 4NO3A 4OZGA 1I3VA 4L4JA 4MJID 3U1SL 1FGNL 1T4KA 3OKOA 1F90L 1EZVY 3VRIB 1LEGA 5C0EB 2O5YL 3JV5A 2VZVA 2BY2A 1P69B 1R6VA 4JE4B 4QTHA 5E4EB 3FT3A 3DYOA 3VXPB 1OP5H 3RZCD 3S34H 5E8DL 1UVQA 5I73C 3PXHA 2PXYD 2C26A 3RUGF 3KPPA 4XBEH 1AD9A 3JUZA 1YEEH 5E8NB 1QHPA 5ALBL 1ND0A 5GGTH 4LHUG 1V3JA 1U8IA 1KYOJ 4EUPG 1QZ1A 1YN6B 3CLEL 4HXAL 2JJWA 4UB0L 1DUZB 3OZ9H 5IMKA 1TJHL 5KOMC 5EOCL 4XPGL 2Y6SD 4O4YH 4LLUB 4JZNB 4RGNC 4GAGL 1HI6B 4Q9CA 3NIDE 4P5KB 1JTTA 2X4RB 2IH1A 5D1ZA 4IRSB 4LSSL 4Y2DB 2BRRL 3DSFH 3F5WA 5DMGD 1GZQA 3O4LB 3TBSB 1K4CA 1VFBA 1OTUC 1WT5C 5GRWA 4N0FB 2WLYA 5JLZB 3MV8A 1FH5H 1SBBA 5BCAA 1NFDE 4X6DA 3ESUF 4IRJD 5I75C 3TBYA 2YN5A 5MI0B 3O8XC 4TUOB 3TP4A 5E2TL 1Z6JT 1XCQB 1AXTH 4JFFD 2D9CA 4APQB 2FB4H 2AJUL 3JWDL 4TULL 1K8IB 3GSVA 4PJHB 5DWUL 1YEHH 3VFOB 5E2UH 1ROWA 3KNBB 1N64L 1U8JA 2J3SA 4TVPH 1T7VA 1E6OH 3EOBB 5ABDE 2NPLX 3ALWA 4JZJB 4HUWB 5DMIH 3IFLL 4P9ML 1DLHB 1W72B 1T66C 4YFEA 3S96B 4KV5E 4CAGA 4MNGA 1I3RA 3KXFD 3RY4A 1UB5B 2Z35A 4GBXA 4I77L 3ZKQD 5DSCA 1WIOA 4OZHA 3WIFB 3VXQA 4NQCA 5AZEL 1F58H 4J8RA 2AABL 3FT2A 2XG5A 1A9BB 5I16B 2ERJC 3VG9C 5BS0B 4QRTA 5F88A 1TTGA 4UTAH 4PJIA 4I5BA 4PJXE 1Y0LB 4HWEL 4UBDD 1U8QB 2MHAA 5HHXH 4ELMF 1EDQA 4FQJL 2VABB 5EOCJ 4Z7WB 1ETZB 4YXHL 1ZLVK 3TVMD 3WUZA 3GIVA 3KVQA 1P4LB 3A67L 1HXYB 1NDGB 4WJ5A 5FYJD 4QRRE 4JFPB 3WIHH 5FM5M 3L3DA 5CJOL 2NY4C 3HE6A 3ZDZF 2VE6A 1MQKL 5GZND 1SY6A 2ADFH 3EYFA 1CE1L 4ACPA 5B39B 3ZYJA 1UEMA 3UPCA 3WSQH 1S9WB 1QFUH 4Z95H 1ORQB 4KY1L 4KKBD 2FEEI 3E8UH 5FA4A 4HGKC 3FQTB 5IHZA 4Y4FC 1IC1A 1EHLH 2AJSL 4JVUA 2YUWA 3H9HB 4OLEA 4M1GL 2EZ0C 3K8LA 1FG9C 4WI4A 3TO4A 1JHKL 2CXKA 4NO2A 5EBWB 2VLKE 4OB5L 2I27N 4NZDA 2OI9C 5FAAA 1MCDA 1D6VH 4NN7C 3UPAA 3DIFB 1LO2L 2IJ0C 2M8XA 4FQ2L 2FO1A 4PJDA 3HNTL 4GXUN 4OM0H 5CINH 5HHMD 3U0WL 5KS9B 1DDHB 2QBWA 4PJCE 2R0LH 4BQ8A 1CDYA 5DEFB 4LDEB 3JTSB 4S1SL 2P1YA 5ID1A 5T5FH 5EULV 1FNGA 1MCOL 4S1DC 4S1RH 3FO0H 4CVWA 2WQ8A 1J7VR 3KPQB 1FLTX 1R0AL 4X9IA 2BVQB 5D1ZD 2AJXL 3L7EA 4FQCH 3MX0A 4EN3A 4C57C 2GJ6B 1MCKA 2DQCH 2JIXA 1IE5A 2R1XB 1J18A 2QV2A 5I30L 2Q76A 3RWEA 2DKUA 1NCBL 2F15A 4JPKH 4S1QH 1D3CA 3L3GB 2BSTA 4NGHL 3VWKD 4HLJA 2L0DA 5D1XB 3CVIL 4ZFZA 1NMAL 1WTLA 4M93C 1CVSC 1VFMA 3MLXL 3C5SB 1GOHA 5TH2B 4ELKB 2HRLA 4K3DH 3WKML 4Q6IC 4KAQL 3GMPB 2V7NA 3HUJE 5EU3B 4ZUSA 5KSAC 3WFDH 1X7QA 3TBWA 3HTLX 3FN9A 1VERA 2V2XB 2BVYA 2FIKB 4LLYA 2PO6C 4G9FA 2XN9B 5KW9L 5IW6A 4KVNH 3LEVL 5CHNB 4N0CD 1HHKB 1YMMA 2FJFA 1RJCA 4XNXL 5I1AB 4WUKL 1G7LA 4JDTL 3AS3A 3WS3B 5DT1L 1JZ6A 3GSQA 1UM6H 5CIPB 4GBXD 2BXZA 2VDOH 4C56A 2KZWA 3DVFA 4Y8AA 4NQCD 5HGAA 5J1TC 2R0ZL 1PVHA 1FG2B 4Y5YB 1X4ZA 5DD0L 5IKCA 3VFMB 4ZOEA 3V6OC 5IOPB 4PRIA 3IDJA 4RMVA 15C8H 4NQVA 3HPLB 3S97C 3UBXG 3A6OA 2J8UB 4GG6B 1V05A 3LPWA 1F97A 4LRIC 4RNRB 1BJ1H 5E08L 3HLAA 1IGJB 3U9PL 1ZT1B 3WFEH 3SDAA 3U82B 1E27B 4E5XA 1K2DB 3F7PC 4Z7UE 1Q72H 1T80A 5ICXB 2HG5A 3QIUC 4PJ9B 1ZSDB 3H42L 2AW2A 3D2UA 4YE4L 3VXSA 1YJDH 3LMJH 2IWGA 3SKJL 4P3WA 3VCLA 2A9NH 4HT1H 4JFEE 1KB5B 3TN0C 1DP0A 2Z0BA 4P2RE 3I3DA 1KTLB 4KKLD 4R90L 3TZVA 4UUJA 5IM7B 4XMLL 1EFXD 3VRJA 3TO4D 4WW2B 4MJ5A 5DRZB 4Y1AA 4OI8A 3U4BH 1F3DJ 4OKDA 2LV4A 1NGQH 1WAAF 3AVEA 3WXVL 3ARSA 2HT3C 1DE4B 2ATPB 1H5BA 1HILB 1NBZA 3RUGA 3NMEA 4R6UA 1MLCB 4PB0H 3CDGA 3W5MA 3IFPA 3B3IA 5F9OL 4JO1H 4LRNH 1CLZH 5GISL 1T7ZA 3H3KA 2QKIB 5JXAL 4M62L 1G7PB 1HYSD 4QXTB 2VXVL 3IS1X 1CZ8L 4GQ9L 4H20L 4XP4H 3FN0L 3JV0A 4KDTC 3WHXA 4LHUB 4YIQA 5TDNB 4AZ8A 4QRUB 2JB6A 4RZCA 2NW3A 4MLIA 4RRPA 2JIXD 4EUPB 1WBZB 5HHOD 3RGVA 3QQ4B 2DM3A 2ICEB 2C3HA 2D7TL 1TVHA 4AEFA 4PJ8C 4Z7VB 1QA9B 1N3NB 5FYJH 3RZWA 4N68A 5IG7B 1INEL 4XNQA 2E7CA 1Z9LA 4HWUA 3C60D 5E6IA 1HXMA 2YD9A 2EXWC 2MTPA 5ADPH 2UV3A 5HDQL 1UA6H 5DJCA 1Q9KB 5FHAH 1D7FA 2MPAH 3EFDL 1TVBA 3O2WH 3DMMB 4XAKD 2O5XL 3WFBH 3ULUE 5I9QC 5D7LE 3GGWA 4LPWA 5DS8A 1CICC 5F8QC 2OZ4L 4FZEL 3QUZB 4I3SH 5GGVH 4PGBA 4Y4HB 3CH1A 5IFHH 1BLNA 3VXUB 4Y7MA 2R0WL 5DUPH 5FDWB 2OL3A 1NCTA 1SMOA 4PP1D 3O3BA 3I2CL 3P0YH 4I2XA 12E8H 4C56D 4F58L 1AE6L 2BOCB 5ISZA 2VWEC 4PJ5A 5KVEH 3DNKA 2QQNL 5GJSL 5JA9A 5HI4C 4OBSA 1XGYH 3H9SB 4GAYA 1BBJB 1O0VA 3DXAA 1OQXA 4K94L 1NCAL 4M48H 1T2XA 4RBPK 4Z77B 4R4BB 5CBAA 1HHGB 3ZDYF 4CMMB 5C6TH 4RGOL 4KTYA 2J88H 2V7HB 3BT2L 1HEZB 3MNZA 5IFJA 2DQGL 1C5CH 3QJFB 1MCLA 1RZ7L 4ELMA 3MRMB 3ZYZA 4YHLH 1OTSD 4JFQB 4LU5L 4N8VB 4ALAL 3D2UD 1AQKL 3K2UH 3VXSD 4QKXB 4R4FL 3QDHA 4EI6B 4HMDA 3QB7C 1X44A 1OARL 5C6WH 3UJIL 2XA8H 3IDIB 1HSBA 1B6UA 2UWEF 4JRYE 2XWJA 4NWUL 3KJ4B 3DYMA 1U6AH 3BO8A 3BUYA 4QXWA 5GGUA 3TZVD 5TQ2H 3BP5B 2KUTA 4XCEB 1U8OA 5DRNB 5SX4H 2WP3T 3SGEH 3QUYC 4DAGH 2YK1L 4Y1AD 4OGZA 2P8PA 3CFKA 1RZ8A 5SV4A 2DYPB 2OQJB 3EJZC 4IEFB 2WMPA 3K4ZA 5CWSA 5J9PA 4WFHD 3BJLA 3P9MB 4JY4A 3RVXC 2ZKHL 2ARJB 4HJ0D 5C0BE 3LQZB 4L4TD 3Q6GL 3O3DB 3KHOA 4TTDD 1BX2A 3HE7C 4PJBF 4AMKH 5EZOL 3ELAT 1Y18B 5CGTA 3JWDC 2LTQC 5IMLB 1Q9LB 3LKNB 4MD4A 4Y16B 1A14H 2Y5EA 5KTEL 3FRUA 4HC1A 2DQIL 2JJSA 3QI9A 2EIZB 3SDCA 1OP3K 1OPGL 5C9JA 1FFRA 3RHWK 1KPRB 3LS5L 4QRQA 1RD6A 1CXFA 1U8HB 4G6FD 43CAB 4M4PA 1J1OH 3RGVD 3OXSB 2ZPKH 4OD2B 4K8RD 3D39B 3ARFD 2CQVA 1OWRM 4YO0A 2B2XL 4D2NA 4R2GB 3E6HB 3PQYE 1KENL 3KLAA 1E4KA 4I18A 3EOYG 1RUMH 1S7VA 1P4IL 3VJ6B 4DTGH 1SBSL 3DURB 5L7XL 1CGSH 3HZKA 3LVEA 4QGTA 2X42A 3GMMA 4UDUB 4DGVL 4TVPE 5INCB 2C3WA 4OLZH 4HWZB 2EDOA 1ITBB 2H6PB 2HFGH 1JN6A 5DHYA 1CDHA 4O2EB 2HN7A 4JHAH 4EI5B 3C5ZD 4Q9RL 1R3IH 4YK4C 1DFBL 1AGDA 3ZYIA 5JW4N 4NPYA 4KZDL 1CDUA 5AYUH 1GGTA 4L8BB 1FZJA 5K9OB 3ARVA 3VGAC 1UZ8A 3VFSB 3ECBA 1BBDL 4PJ5D 4QWWC 4X7SL 4PJAF 3IDNA 1NLBL 3P4MA 3S37X 4NQSB 3MRKA 3T08A 5KG9B 1PZ5B 4DGYL 5GGRY 2DQFA 2BHZA 2EO9A 2ZCHL 3DXAD 4U3CA 1S9YB 1O7VA 4JKKA 4FS0A 1F3JB 3GIZL 4QRPE 3ZKNC 5IB1B 3WCYA 1Z5LA 3RTQA 5EDXA 3CFCH 3KDMB 3B2VL 5HHNA 1BHGA 1Q9WA 1I85A 4HK3J 5I8KH 1I9IH 3C2AH 3QA3B 2HLAA 5FXCH 4F7EA 1H8OA 1DBAH 2OSLA 1NEUA 4KHXH 4MA8L 3NZHL 5JXEA 2EDTA 5I15H 1QO3B 5F3HA 3VD7A 4NBZB 4WGWB 2FIRT 1UXWB 1JWUA 4OCWH 5ETUB 2NY7H 5CEXA 4YFDB 4JN1L 3SE3C 2XWBA 3CX2A 4OFYD 1ZTXL 5DVNA 4BKLB 2NX5D 3BDYL 5D7JB 4HF5H 4KTEH 3MRQA 2ADIA 1WISA 3EHBC 1CK0H 3R8QA 1OAZL 2A0LC 3VWJA 1X4YA 4TNVK 5T5NG 2GSGB 1YEFH 1AO7E 3DX6A 1U41A 4JKWA 1T1YB 2VITA 4GO6B 1WC7A 4RDQG 4Z18A 4F7TA 1KEGH 1EZVX 5FA3B 2FR4A 1Q1JH 3MXVH 1A6AB 2CO7B 2YD5A 1RPQA 2BC4A 1WAAA 2C4XA 4GG8B 3CCHA 2EICA 4ODHL 4XWOD 3VFUB 3G6AB 1AY1H 2P24A 2ZCKH 3ES6B 4LL9A 4G8GA 2A77L 3GMOA 4X6BA 3PWVB 4HK0A 3MV7E 1ONQA 2D0FA 2FBJH 1CN4A 3QI9D 4NQEE 1QRNB 2V9QA 4XCYA 2R23B 3ROOA 5EC2A 3PWUB 5J1AA 5KVFL 4D0BB 1B9ZA 1RZGB 4MJIE 4MXVE 4BQ9A 2NY2D 4FQXB 2NY3C 35C8H 2QSCH 1DQJB 3S35X 5JO5A 2AGJL 3BH9B 5L0QC 5DJDB 3BWUC 4WCYL 1F8TL 3MRDB 2VQUA 5C9KA 3L1OH 5BV7B 3K81A 3OR6A 1I7RA 3X13B 3OKNA 5D2NB 4NQXA 2IPKA 2BSSA 5AWNH 3VI4E 4ODTH 4K3EH 4KKBC 1FP5A 2B4CC 2IG2H 3P9WB 3T0ED 2A9MH 2HFEB 4UDTA 5GJTH 1DEDA 5C3LD 3OG6B 4WDIB 1DBJL 3FQXB 4I8DA 4U0RC 2WUBL 1KC5L 3K46A 3FB7B 5ICYB 3BEVA 3AXLA 3KPSB 5JDSB 1U8KA 2NY0B 5A1AA 1E4WH 4K7FB 4PYGA 3V7AG 3KPOB 2CXGA 1LE9A 1CLCA 3H2WA 1UB6B 1Y6NR 3FO2B 4Z78B 4MHHG 3BPNB 1VENA 4OGAD 5ALCL 4J6RL 3IJSA 3IDUA 4ZS6D 3WFHA 1NJ9A 3PV6B 1NMBL 3VFNB 5EO9A 2YKLH 2BNUB 3QNXA 4PD4J 1KCRH 4K2UL 3LS4L 1R3HA 3HNSL 2E5EA 3WV0A 3EO0B 4OF3A 5L2JA 3GHBL 5DC0A 3ARXA 4Y4KA 3GSUB 1MUJA 4XCFL 3AU1A 1KJ2B 3RTQD 1HN1A 2B20A 3BZFB 5FIEA 2G2RA 5DJ6B 2A6KB 2VAAB 3PUCA 3QAZC 4TQEH 1H15B 1RK0B 4MA7H 4Q9BA 5DLMH 5GS0D 4JLRB 4K8RH 1CF8H 1VGEH 2GQHA 2K7QA 5A16A 2XNAA 3WO4B 1ZANL 4AIZA 3R0MA 1BFSA 1KN4H 3WKNA 1BZ9A 1ZHNB 1P84J 4FFZH 4WU5B 3GUTB 4R26L 4Z5RB 4D3CH 1T3FA 3CJJA 4JFFE 1KTDA 1RSFA 1U3JA 3OAZK 2CKBA 1RJYA 4F9LA 2EYTB 3DARA 5E2JA 3X3FL 4PLNC 4F8TA 1J9CT 1ZWIB 2C3VB 4GW4A 1IRAY 1HH6A 3NN8B 1FORH 4ONHA 1AH1A 2EIBA 3H6JA 4MZ2A 3VWJD 2AQ3A 4GW5B 4XP6L 5DD1L 1NCCH 3HNVL 5DQ9B 3ZHLA 2W9DH 3KXFE 2OS7A 1MJ8H 1DQMH 5DJ2B 3GBNL 4PBXA 5E1AB 4G6JL 5JNYA 2CDGA 1J87A 4YBHA 4KK9C 1AGEB 2Y1VA 1WICA 1A1MB 2OL3H 5C09D 2NW2B 5DD6B 3TJEL 5D2LA 4F7MB 4DOHB 5HYJB 2I07B 5GS1A 1OGAB 3KYNA 2CSPA 1AGBB 3LN5A 4G3YL 4AJ0A 1BFTA 2FX7H 3S9DB 3IFNH 1SYSA 2P7TA 4XBGA 1UXSB 1TZGL 3ARDA 5TE7H 4ZNEA 2VQ1B 4GMTH 1P9MA 2D7MA 4TUJB 1VSCA 4M1CD 1CYGA 2XA3A 1UGNA 2IADA 3OPZH 4DEPC 3P77A 5DQDH 2VL5A 3QPXL 1UM4L 3OQ3B 4XPFL 4OZGE 5FYJE 2A6IB 2IFFL 1XT5A 4JJ5A 2Q20A 4LVOC 2GTWB 3BE1H 3SDXF 4XNYL 4PJHF 4I4WB 2RB8A 5DHVA 4POZC 1F2QA 1RHHA 4RFNB 4XC3L 2EH7H 3BYYA 1IAIH 3REWB 1S7WB 5SWZA 2E8YA 4K94C 1NKOA 2BOBB 2V2TA 4FTVD 3KPMA 4LSTL 5B21A 5HPMA 3W5NA 5TQ0L 4FA8A 5DXWA 5HGGS 1FFOB 1NH6A 2ZZUT 1NBVL 1MJJB 2R2EB 4HX1A 2EKJA 3OKMA 1N6QH 1MAMH 4PRAA 5T1KA 1I1CA 2AEQL 4KK8D 2EDBA 1OM3H 3F65A 3BGMA 3LEXA 1FVDB 4OLXL 1D9KA 4LGPB 5HHME 3ARWA 4CN6A 5I2IB 4KI5C 5JHDB 3VXMB 2X2YA 4PD4K 3L7FA 4YDIH 4NWTL 4Z7WF 4YHIA 4Q0XH 3TNMA 4NT6A 1G7JB 4Y4KD 1MH5A 4H1LG 4UNVA 3KJ6H 4NRZB 4PJAA 4HC1H 5DA0B 4XZUB 5CUSH 2GIYA 1FZOB 5CJQH 5GRUL 3U2SA 3RWJA 1DQDL 4QOKD 5MEQB 4QHMA 3RNKA 3NH7L 4L3CA 5IK3B 3TPKA 2W0KA 1A4JB 3MV8E 2FWOB 4X6DE 3ULUL 2EEAA 3MFFA 4HPOH 1TQBB 2P5EB 5HDBE 1RMFL 4KRPB 3EYVA 1P84K 3QEHA 5KVDH 3X12B 7CGTA 3T3MF 3VXOA 4PRHB 1G7HA 1QLFB 3ULVF 1UCBH 2DQEH 5IT2L 1A5FH 4MDJB 4X7DC 2VDRL 2FGWH 1IQWL 3RKDC 4XTRD 2HRPL 3QO1A 4FMFA 4MNGE 5IVXB 1GXEA 2IANB 5KS9F 3GB7B 3O6KH 4OZHE 3OKLB 4YC2C 1QSVA 2IQAA 2Z4QA 1HQRB 4NQCE 4ODVH 5H94A 2ZUUA 3TH2T 1P2CA 2AJZB 2HJLB 4PJIE 4XMPH 4M9OA 3TIEB 1ZHKA 5CJXA 2NXYD 3ARDD 1XF2A 4PLKC 4EDXA 5JQ6H 3MRLB 5MEND 1R3JA 2QL1A 3GSOA 4AL8H 3G04B 3FCTB 4JRWA 1CE6B 4BSVB 3MRRB 3S34L 2VXUH 4JY6B 4ODWA 1CG9A 2YN3A 4KMLB 3BJ91 1G9EA 2XYCA 3QFJD 1LNUB 3BI9X 3HCVA 3TNNA 3BP7B 4MAUH 4AYFA 1KJVA 1JZ7A 4LDOB 5GS0H 3T3PE 1EEQA 3LQAH 4XBEL 3QIBA 1YEEL 5FO9A 5KN5A 3PGDA 5GGTL 5F7FA 4TN9A 4DQOH 1AQDB 1TCRA 3U6RA 3MRFB 5SWZD 2OTUB 5ITFB 4JO3H 3OZ9L 4M8QB 2PYFB 2GITB 4FHBD 1TCMA 2GFBA 1CL7I 4U3XA 5DO2C 1K5NB 5DRXB 3FZUD 5FKAB 3G5XB 3QDGA 3EYQD 4X99A 4O4YL 1S7SB 5IHLB 1RZJH 1WIUA 1C5DA 5F21B 5MERB 3SCMD 4HKBB 1FNFA 5F93C 5I73B 2J7LA 2MFNA 2BSRB 2EC9U 2W9EH 3PXJA 3QUXB 3DSFL 4PJDE 3BKCH 5SWSB 1CDGA 1H8NA 2ID5A 2J8UF 4GG6F 5EC1B 3KPRB 2R1WB 1JGUH 4ZUUA 5E8EB 3JWOC 1FL6A 5LG1A 4EIGB 4AM0A 4LSQH 1ZHLB 1CIDA 1PGRB 1FH5L 2YPLA 1CGYA 1Q9OA 3Q5YA 3IXAA 1XGUB 5JPNA 3FN3A 4LKCB 5HHOE 3BXNA 1AXTL 1IKNA 3MUHL 2FB4L 2YC1B 5KSUB 3HZVA 3NFPB 5HJ3B 4XBPA 4RGNB 1ED3B 1YEHL 3DUSA 5E2UL 3D3VB 3IRPX 4TVPL 5L8LB 1E6OL 4NNYA 3BPLC 1KIQB 4RAHA 3SBWC 4YJZL 2X89A 3LKRA 5DMIL 3VXPA 2Y72A 4XAKE 5EIIB 5EUOE 4WW2F 5B38A 4S0TD 4UAOC 3PHOA 4MZ3A 1XF3B 2VRAA 1F58L 3IF1A 5TF1H 4G9FE 3GJFB 1IC4H 1U3HD 1H0DA 3AREC 3O8XB 1YMME 1TIUA 4UTAL 1BOGB 3DSNA 5E8NA 1HINH 5I1IH 1WCBB 1OD9A 3O6FC 2DDQH 4YDJB 4YEFA 4C56E 5HHXL 3LPGA 2ZUQC 3HI1A 4Q58C 1DUZA 2DQJH 1IEAB 1X5KA 4Q2ZB 1YNKH 1RUKH 4HUUB 3WXWH 1OTTD 3RIAF 3P9LA 4PRIE 3WIHL 1LMKA 1S9KC 1BGXH 4LLUA 4JZNA 3QDMD 5K93A 1ZKAA 4P5KA 1QBML 3BKYH 4U7KA 4DVBB 4JRXA 2ADFL 2XIDA 5I19H 1TQCC 4QXUL 4TYUA 2ARWA 4Z7VF 3WSQL 1BM3H 4IRSA 1FYTB 4P2QA 3QH3B 3NTCH 3VG9B 1HDMB 5HVWA 3E8UL 3O4LA 3TBSA 4YHNB 1I7TB 4V1DA 2HTLD 2R9HC 3H3BC 1EHLL 4P23A 2PTTB 1F42A 3GMQB 1WK0A 3WN5C 4ODSH 5T3ZD 2XTJE 1A7QL 4RMUA 5IVZA 5HY9A 5DMKA 2Q6WA 3QIBD 3VXSE 1ULVA 1OAQH 2JJTA 4L4VD 3O4OC 2FEDD 1XCQA 4APQA 1V5JA 3V6ZB 1A7OH 3SDXA 4ZAKC 1D6VL 1MHEB 2NY4B 4J12A 2PCPB 2CKBH 4OM0L 1K6QH 1U42A 4JGMA 1M7XA 4QLRA 3KNBA 5CINL 4P5TC 2ADJB 4KXZH 4LAQH 1K4DB 3F8UB 2R0LL 5IROA 3QDGD 4JZJA 4Y1AE 1A6VH 5ESVA 4Z0XB 5T5FL 1DLHA 3J7HA 4S1RL 4Y4FB 3IAQA 1FO0B 1XEDA 3RUGE 1I7UA 4WFHE 3BESR 4FQCL 2DQCL 3EFFA 5I16A 1U8MB 2FBOJ 2J6EA 4JPKL 1RHFA 1QHOA 2F5BH 4XRCA 3R8BB 2OI9B 1NC4D 9CGTA 4NN7B 5IW3A 1Y0LA 3SJVD 4OZIB 1AGFB 4ZFOB 4YFLI 1CQYA 1QNZH 2VABA 3OGCB 2NCMA 4Z7WA 1I1AA 2Y36H 4K3DL 1H8SA 1I9JH 3TA3C 3WFDL 2UZXB 1BIIB 1KIRB 4BSWB 1FV1A 2QQQA 1OP5K 1PG7W 1F6LL 3VFTB 2YR3A 4KVNL 1MAJA 3SDYL 5C8JB 5LGJA 2X89D 5B39A 2ESVB 5H2BA 2RR3A 1UM6L 3RVTC 1KJ3L 4MA3B 4L9DA 2VDOL 3FQTA 3EDKA 3QJHB 4HZLA 3DLQR 4M93B 2E7LA 1SVCP 4R3SA 4QF1B 4WUUB 1L6XA 1IC5H 1YY8B 3MLRL 3ARPA 15C8L 5E5MB 4N1HB 3TO2B 2ADGB 5KSAB 4U05A 4I2XE 4MCZB 5B4MC 8FABB 1U2HA 5GRJH 2PO6B 5ISZE 4PJ5E 3WJLC 4LAJH 3VH8G 3PL6A 2IMMA 3BQUC 1DDHA 5KS9A 2NR6C 1GAFH 3EYUH 3HC0A 4TSAH 4PGDB 3DXAE 3IETB 3PHSA 3JTSA 5JOFA 4LLDB 1Q72L 3HKFA 3DI3B 3IB4A 1JMXA 4JRXD 3F7VB 1YJDL 4IRSD 4Y2DD 3LMJL 4P2QD 4U2ZA 4I9WD 2R1XA 2Z91A 2A9NL 3O4LD 3EYSH 5CSBA 4HT1L 4WHCA 1L7IH 2W9LA 3G9AB 4ELME 4HS8H 5C0AB 3QQ9C 1EERB 2YBRA 2VSCA 3D18B 1JE6A 4DFIA 4GRMA 4GKSB 4TTGA 3WDHA 3MJGX 1Q38A 2FLBT 2WM0A 4FXLA 5TH2A 3U4BL 2W92A 2ICWB 1NGQL 1QG3A 5KSBB 1TVDA 3O11A 4APQD 1RZFH 2ZOKB 3OMZA 3GMPA 2NX5E 3EDJA 1DN0A 5EU3A 5EBLB 4PB0L 4XPBH 1GIGH 5CCKH 3VGFA 2RCSH 4FFWD 4JO1L 4K71C 1CLZL 4LPXA 4LRNL 4OCLC 1TLKA 5A3ID 1HHKA 2F8OA 3BVNB 2AERT 4U6TA 4XP4L 3WS3A 4J2XA 2P8LB 4JVPA 3TN0B 5FGSA 1MWAB 1JCKA 4JFOA 3BWAB 2H32B 1DJSA 1NANI 1XGPA 3REVA 1PEZA 3VGBA 3VFMA 1SVZA 5BS0D 1J05B 3L5JA 5IOPA 1SJEA 5FYJL 2YPKB 1JHLH 4OCNC 3ZT6A 2H9GB 2X6MA 3F58H 2PN5A 1PX3A 4G9DA 3JBG7 5D7SH 3P4OB 5ADPL 2J8UA 1BJ1J 1UA6L 1CU4L 5FHAL 2MPAL 2YUVA 2HLFC 4RIRB 3O2WL 3CGTA 3WFBL 3V95A 3RY5A 2CIIA 4HGMA 3CU1A 4I3SL 5KANG 2R15A 5GGVL 1CS6A 4PJEB 3L6FB 5EN2B 5ICXA 4PJ9A 5IFHL 5T3ZH 1QBLH 3RVWC 2WBKA 3IU4H 4POYA 4LCYB 1D6EA 3X11B 4P99A 5A2LH 4L9LA 2X1OA 4PJ8B 12E8L 2JE8A 1CTNA 1KN2H 1NUNB 1KTLA 5CKAA 4GFTB 5KVEL 1H3XA 4WW2A 1XGYL 3ULVD 2GTZB 3PE9A 3U0PB 3SGKA 2DKSA 5DK0B 2CRZA 3W9EB 2PYEB 2N1KA 5I9QB 1EO8H 4BK5A 4M48L 2BZDA 2E9BA 1T22A 1CICB 4OZFG 1LK2B 3UC0H 5C6TL 3UMTA 1U8PA 4U6HA 3B9KA 3NFNB 1I8IB 1C5CL 1WBXB 2QKIA 3IDGA 1UACH 3KYOB 2YXMA 1A9EA 4YHLL 5DD5H 3DGCR 1FN4B 2MCG1 3WD5H 1F45A 1RIHH 1WQVT 4OJFH 4RWYH 1M7DB 4LHUA 5TDNA 3K2UL 3EO9H 4PV8B 4HIIA 5BZWB 4QRUA 5K9QI 2PTVA 2GJ6D 4I48A 4EUPA 1WBZA 5GXBB 2P49B 4ZPTB 2XA8L 3B6SA 1ACZA 2PKDA 2DD8H 4Z7VA 1U6AL 5D1XD 3QSKB 5TQ2L 3QIWC 1NC2B 5IG7A 4NDMB 3G5VB 2IBBA 5TDPB 4DAGL 5I8EB 3RPIB 3JV4B 5FEBA 4DN4H 2KPNA 4DCQA 2IALA 1Q9KA 3CK0L 1KPVB 3O45A 4U2YA 3C87A 1HOCB 3QHFH 3V5HB 2OJZH 3U4EB 3PDGA 3ZHDA 4UV4H 5ANMA 2Q3AA 3C08H 4O2CA 1VACA 4IMLB 1A14L 5HPOA 5FDWA 3BN3B 4LVHC 1RURH 4OF6A 2HT4C 3RWIB 5EO0B 2BOCA 5J4MA 4FXKB 1R5WB 2BNRB 1WAAE 3FO9B 1J1OL 3QUYB 1JPFA 5DDHB 4FQHA 2FYYB 2BHUA 4GOSA 4HFWA 1BBJA 4MVBC 3F7YA 4KH2A 2Q1EA 1RUML 3WHE0 2GW5A 3T2OA 4DTGL 4R4BA 4XT1C 1CGSL 1SY6L 3T0BA 1FNAA 2V7HA 1TJIH 5B3JE 3PNWA 4EVNA 1TJGH 2FD6H 2WBJB 3O9WA 3D9AH 2YA2A 1HEZA 2HTKD 2LTQB 4OLZL 3W39B 2O61B 2HFGL 5JOPD 4RFOH 2VAJA 4M6OH 5FUOH 1XR8B 1G9MC 4JHAL 4YHPB 3BIKB 5DJYA 5AD0B 4PJ9D 1R3IL 3BP4B 4WGVB 1NSNH 3RJQB 3U7WH 3DYPA 5ACZA 3IDXH 5B8CA 5AYUL 2A83B 4EI6A 1W0WA 2KBGA 3EYOA 3MRIB 3BRFA 1A47A 3I3EA 3NFSH 3L5WB 4NKOB 1QFOA 1U91B 4KK5D 4JG1H 3QUMB 4YGAB 4D8PB 4CN1A 1LO4H 3UYPA 1BJ8A 5DRNA 1XH3A 5CBEB 3MJ9A 5IF0A 2OJEB 1A3QA 1TTUA 1CD1B 3DUUA 3BOVA 2ARJA 3CFCL 3I6GB 2Z93A 4S11A 4XXDA 4LSPH 4XPAH 5I8KL 2V9TA 1I9IL 4YK4B 3C2AL 3V9FA 2YD1A 3B8YA 5IR1B 1EEZB 4FABH 5IJKA 3MQIA 4X4XA 2VXSH 4Z7OF 1DBAL 1JPTH 1Y18A 2J6EH 3LKNA 4Y16A 1N0LA 5CJ5A 3VGAB 1IBGH 3WE6B 4JCMA 5I15L 1EAPB 1XGQB 5AEAA 3LKSB 5L88H 2MSPA 3B9VA 3KR3H 4LHUD 4GAJH 1AKJB 5FUZH 5ILTH 1A0QH 1IGIH 1U93A 4OCWL 5CJBA 2NY7L 4QOKE 5GGVY 3G5ZB 2DM7A 1U8HA 3ZTNH 3D39A 3QNZA 3VH8B 3DX8B 3ZDYE 4HF5L 1G9NC 4DUXA 1A6UL 4KTEL 4XC1L 1CK0L 1DEEB 3QNYA 2W0PA 1B4JH 1CL7L 2ITCB 1YEFL 3BAEH 1RZIB 1CD0A 3S35H 4LCCC 5FK9B 1KEGL 1XCTB 5HGDA 3DMMD 4OI7A 1Q1JL 3MXVL 2VB5A 5INCA 3BEWB 5GZOC 4HWZA 1A6ZB 1LO3H 2H6PA 1U3HC 4D9LH 3QUZD 1TETH 2RIKA 4QYOB 4WTWA 4BFEA 4Y4HD 3S5LG 2DTMH 1AY1L 1UFUA 3EOAA 2ZCKL 2EE9A 4KK6D 3VXUD 3ULVH 4X4MA 4NCC1 2FBJL 4OF7A 1OAKH 5IVOA 1C8PA 1CFSB 4QT5A 5SWQB 3VFSA 2GHWB 3W0WB 5HDOA 2OTWB 3PF2A 3TCLB 1NCDH 3N1GC 35C8L 2QSCL 3R0NA 3H9SD 4L1HA 2GK2A 3MBEC 3ZE0F 1S9YA 4YDLC 4M5YH 1CIUA 4OQ1A 1F3JA 3HS0A 4PJBE 5JZ7D 2B0SH 4HKJB 5IB1A 5AWNL 4L29B 4ODTL 4ZXBA 1NGYA 4K3EL 4MX7A 2EDDA 1JK8B 1T0PB 2A9ML 3IJHA 3QFJE 4NBXB 5GJTL 1CFNA 4F7PB 3NCMA 4HKXB 3N1MC 4HHAA 4IJ3C 1OT1A 2GCYA 3AY4C 4U0QB 1A3LH 5DFVD 4Y19A 3TM6A 3FQWA 8CGTA 4L8SA 4QCIA 4TSCH 3D6GA 3I75A 4KMTH 5L9DH 3G08B 3UBXA 1E4WL 4P2OC 1UXWA 4Y5XC 1XF5B 5SWZE 1NDMB 4MAYC 4N0RA 1UJ3B 2NY3B 1UC6A 2V5RA 4N8PA 1MPAH 2W65A 4OCSH 5L0QB 5IVXF 5J3HD 2RFXB 4BFBD 1CT8B 1J5OH 5D7JA 4FQQB 3UTSB 3MA7B 3MLPA 3FHAA 2YKLL 4UIMB 5INDA 4JM2F 1KCRL 3UYOD 2GSGA 3SY0B 1MRCH 1T1YA 4CL7A 4P46C 3OBAA 4U0RB 2DYPD 4NJAH 3K74B 2R4RH 5E2WH 5T5NF 4QHNA 1S5HB 3WLWD 3CVHA 1TZHB 2W0LA 1T7YA 4TQEL 4S2SB 5BZDA 1J0ZA 4HUNB 4MA7L 4RDQF 5DLML 3PWPB 5C0CB 4K8RL 4QY8A 1VGEL 3ROLA 3ES6A 2NZ9C 2RQ8A 4IBLT 4PRDB 1RJLA 4Y16D 3LN4B 5F71A 3MLSH 1KN4L 5BVPH 1KULA 4PJAE 4R0LA 3K1DA 3V6FA 2X44D 4N9GB 1KPUA 1QRNA 5DK3A 4WV1C 4D3CL 4DKEH 1WLHA 2R23A 1OB1B 4OZFB 2EYSB 4HJGB 5I8CB 4D0BA 4F9PA 1AR1D 3D39D 1KXQE 4R2GD 1T2QH 1FORL 1JYXA 4O51A 4F33B 5J6GB 4RMSA 1RQ5A 5ELIA 1NCCL 2CDEB 3C8HA 2W9DL 4JKPL 1MJ8L 1NUFA 1DQML 5DGRA 3QQ3B 3QAZB 4ETQB 4RFEA 4WDIA 2OL3L 4PGZA 3MZGB 2VZ3A 2DQUH 1JYWA 3VD5A 5F6HJ 2FX7L 4KC3B 3IFNL 1T6VN 4EI5D 5JDSA 2I9TB 3EGSA 3OJ2C 4GMTL 4K7FA 1T0NA 1GHFH 2WV3A 3KPOA 3S3SA 4X6EB 1UB6A 4IM8A 5DUMH 3WLBA 3OPZL 3KPNB 3FO2A 3GJEB 5DQDL 4Z78A 3BHBA 4FQ1H 4ZOCA 1D5BB 5L2KA 3P11H 5GGRB 1FNSH 1QSEB 2DLFH 3GBMH 3S88H 1CFTB 3Q6FA 5EZLA 2NXZC 2P5WB 3VFNA 1EPFA 4EDWH 2BNUA 5MEOB 4JCLA 4GLRH 2AXHA 3QDME 4TNWF 2R2BB 3BE1L 2XTLA 2XG4A 2V2WB 4ZXBD 2EH7L 2DJ4A 2HJKB 1IAIL 3QEQB 4NQDB 4PRPB 1A1NB 3MACH 4KJQD 1ZS8B 5D70H 4EUPH 1LWRA 1I1FB 1C7TA 2XKNB 1EVUA 5J6HA 1YEDA 4N5ED 4UQ3B 3CAFA 4Y19D 5DVLA 5BO1H 5T3ZE 1N26A 2XQYK 4XHJC 2ZCLH 4DEPB 1JGDB 4GKNA 2GEEA 1ZHNA 3V5KB 4ZFFB 3VXTB 2Z92B 3GUTA 4NBYB 4NKDB 4Z5RA 2XZAH 1N6QL 1MAML 4PGJA 2Q87A 3PJSB 1OM3L 3E6FB 1N2RB 5TE4H 2X4NA 5D7JD 1WV7T 4FFWC 1ZWIA 4XPHL 1T04A 2C3VA 3QDGE 1X6LA 4YDIL 2SEBA 1QR1B 4GW5A 5DQ9A 3OG4B 2CDFB 1S9VB 3C9NA 4Q0XL 5CZXD 5E1AA 2EDWA 1AGEA 4LEXH 4BH7B 3KJ6L 1O5DT 4HC1L 4XMKH 4RMWA 5DD6A 5CUSL 2ZUXA 5IGXL 3WNKA 4YAQA 5EORH 2I07A 1G0DA 1OGAA 5FO7A 1AGBA 4BQBA 4ZG1A 1VKXB 2NZIA 4M5ZH 1MFBH 2FGZA 2I9LB 3F7QA 3WL9B 4HPOL 1XIWC 4WEUD 3BPOC 5DURD 2D31B 4MNHB 5FECA 4LSUH 3UDWC 1S7RA 1PYWB 1QRND 5IB3A 2GK0A 3ABZA 4GRWH 1EHAA 5BOPA 1UCBL 2DQEL 4Z0BL 4OLUL 2GJJA 3ZZ1A 1A5FL 2A6IA 3O0RH 4K07A 1U92B 4YNYB 3T2NH 2EKSB 4FQXD 2FGWL 4H8WH 2VLJB 1FPTH 2GTWA 4GW1A 4RA3A 4BUHA 3SKNB 4O02H 4I4WA 2X70B 5E0QA 1JUFB 4P4RB 3X17A 3B5TA 1JRHH 3PWLA 2KDGA 3I6KB 3O6KL 3C6LC 5CAYB 1S7WA 4M3KB 3L3IB 4PGCB 1JVKA 3BZDA 4ODVL 3HE6C 4K9EH 4RSVA 3LRGA 1N5AB 4XX1E 1MCJA 5DEGB 2MOVA 4OUUA 1EGJA 4YHML 3VFVB 4XMPL 3RPKA 5KJRH 3KPSD 5CD5D 3FAWA 2NY0D 3BSZL 3AS0A 5C0JA 5JQ6L 1A3RL 3P4LA 5DUBB 5I1CH 25C8H 4AL8L 1D5XB 3MJ9H 1LDSA 3PDOB 1FVDA 2FECL 2VXUL 4OD3H 4OZIF 4PY7B 5I2IA 1TNMA 1Q0YH 1G7MB 3VXMA 5JHDA 2BY3A 3LH2H 2L4OA 4MAUL 3LRSA 3WNNA 1KXVC 4M9PA 4YC2B 3HR6A 3S5LB 5GS0L 4JRXE 1G7JA 1JTOA 3LQAL 1HKLH 1HIMH 1ZVHA 4P2QE 3VW3H 3O3UN 4DQOL 4B50A 3O4LE 4LK4A 4GUPA 3RVUD 1X5AA 1S7TB 4JO3L 5IB2B 5IK3A 4PP2B 4C58B 5DQJB 1P7QB 2FWOA 5C0IA 3BIAX 3FFDA 2P5EA 4EN3C 2JELH 4ZQKA 2HT2D 1RZJL 5GIRA 2NY5H 5C0FB 4ERSH 1QLFA 3S7GA 2W9EL 3SDXE 3T77B 4MJ6A 4MWFA 3NIGF 5T1MA 2VLME 4MDJA 2W38A 5GRYA 3BKCL 5DR5H 1NFDA 4HH8A 4MSWB 1ACYH 3Q3GB 1LE5A 1JGUL 1OLZA 1RV6X 3VXRA 3PV7A 4ISVA 5D5MB 1FC2D 5IVXA 1YY9D 2IANA 3GB7A 4ZO8A 4HULB 1P4BH 2BHYA 3X3GH 3BKML 4QEGA 3JUYA 1HQRA 4XNUH 3CPLB 4JM2A 3PWNB 3LKQB 3SKOB 3D87B 1OGAD 5BS0E 2AJZA 2R4SH 1NEZG 1RK1A 2HJLA 2APFA 3T4AA 3MZTA 5ID0B 3N9GH 4YBQC 1KCLA 4RAVA 5J56B 4X7TB 4OKVB 1EJ6A 3MUGA 4WU7B 2BERA 3RDTA 2C7UB 3C8KB 3L3HA 1UKQA 3FCTA 1CE6A 4BSVA 4Z7WE 1W0VA 2J2ZA 2ICWI 5LAXA 1UYWH 4JY6A 1S8DB 1QPPA 4WNQA 1LNUA 4W4OA 3QPQC 1XR9A 4JKLA 4NZRH 5KSBF 2F58H 2Y5TB 5TF1L 1IC4L 3B4NA 5TFSH 4U1HB 4KROB 3WNPA 2VDMH 5D9SA 1HINL 5I1IL 1QSFB 3WFZA 4WI3A 1MVFA 2DDQL 2IH3B 4QRRA 3SDAC 2OTUA 2OR8A 2DQJL 3GM0A 2D7OA 5I66B 3IJYA 3O3EB 1RIVH 1YNKL 3BPLB 3T3ME 2XTJC 1RUKL 2PYFA 3QRGH 2RAMA 3WXWL 5DRXA 4I0PC 3MJ8B 3ULVE 5FKAA 3G5XA 3WNLA 4Q9QH 4FFVC 1BGXL 1S7SA 4P2YA 2M2DA 5MERA 3KPLB 3BKYL 4HKBA 2C1OB 4UAOB 4AK1A 2WW8A 1GZPA 5I19L 5HI3C 5F7HA 3KLHD 1BM3L 3L3OA 3MYJB 1KUMA 3AREB 3NTCL 1QOKA 2R2HA 1MNUH 5KS9E 1MVUB 3KPRA 4YQXL 5EFIA 4DKFH 5JHDD 3VXMD 1AGCB 2FJGB 3O6FB 3CVHH 3HB3D 1W0YT 4JR9H 5E8EA 3UTZA 4EZMA 3QISA 1NPUA 4YPGA 3ARUA 1ZHLA 3KYAA 4ODSL 2ZUQB 1X5XA 1XGUA 4M7KH 4KHTH 3ILPB 1OAQL 2APWA 4PJEF 1EUTA 5C92A 4X5XA 5KSUA 3S3JA 2MQCA 1A7OL 1VDGA 2MNUA 4X0KA 4MA1C 1AC0A 4KVCH 5H8DA 5CS7A 2CKBL 3U46A 4NC1E 1YYLH 1K6QL 4AQOA 3GK8H 3MV9A 1CLOH 3FRPA 1TQCB 3MC0A 3MODH 4HJJH 4LAQL 1CGXA 4WVRA 5E00B 2IGFH 2P5ED 4IMKC 5FF6B 5KBNC 1A6VL 3FQNA 3E0GA 5BV7H 1Z9OA 4PRHD 3IYLW 2FL5B 3ARZA 2NY1B 2WQRA 5ESQB 3DMMC 1IGYB 1WT5A 5FOBA 1B3JA 3WN5B 1FHGA 3HAEG 1BQHA 3GMLB 3D0LB 1XF3A 1F4YH 4HKZB 4LCWA 2X4OA 4H0IA 3GJFA 5E6IC 1R5VB 2EXYD 3G9VA 3CX5J 1MLBA 1S7XA 3DX9B 3O4OB 5D7KE 3TIDA 2F5BL 1BOGA 4ESKA 4OM1H 3MO1A 1WCBA 1FGVH 4ZAKB 2IAND 3AFLA 5IEHB 5I1EH 3K7UA 5F9DC 1QTYT 1T5XB 1MHCA 5EOQH 4PRBB 4PJ7A 3DETC 4GRLA 1IEAA 4P5TB 1QNZL 4HQQH 5F1NB 2Y36L 4X9FA 1U3ZA 2IPTH 4HUUA 1V3LA 3EO1B 1I9JL 3O6ML 5EPMB 2CLRA 3EAKA 2UVFA 4J3UA 4FG6C 1MJ7H 4YGVA 2VDKH 1GCFA 4DVBA 2J8UE 2AK4A 4N1CA 1I7ZA 2DMBA 1CD8A 1YDPB 4OBRA 2H2PC 5JW4Q 1PZUB 3C09C 2EDLA 1JGVH 5CEZH 2WZPD 2PTTA 3GMQA 3U30C 5CILH 2R29L 4J1UA 5IJVA 4V2CB 1IKFL 1K9TA 1IC5L 4H5SB 3WDIA 3TA3B 4F7CB 1CR9H 1MHEA 1NL0L 5GRJL 1ZA6B 4ZS7H 3FONB 1HCFX 3P2TA 1K4DA 3EYUL 1GAFL 4KFZC 1OWWA 1HQ4B 4TSAL 4ZUTA 4C54A 3QZWG 1FBIH 4Y4FA 1WBYB 4Z7UB 2QQKH 4ZYKB 1IT9H 2EDFA 3EYSL 4OGXH 3ZT5A 3KPRD 4KKCC 3TFKC 3P73B 1L7IL 4HS8L 1DVFA 2DWDA 4LEOA 4JFEB 2IAMA 4POUB 1KIUA 4NRXA 2QR0B 4OZIA 3T09A 5I8OH 1X5FA 3DRQA 5D8JH 2BY0A 1RUAH 3BQUB 3BDXA 4KJWC 4LLMA 1NGPH 5F6IC 4RGND 4X7CC 4Z7VE 4XPBL 3MRNB 2AEWA 4LF3B 1GIGL 3OR7B 1BIIA 5CCKL 4KZEH 4BSWA 2RCSL 3A6CH 3SDCC 4U1LA 3VFTA 5C8JA 5LGHH 1E28B 1QLEH 4JN2B 2ESVA 4XWGH 5EU4B 1X5ZA 4H1LA 1CWVA 4G80A 1OTUD 2OMNA 3QJHA 3NCYS 3JV6A 1E4KC 2IMNA 4I18C 4LCWD 4EBQH 4QF1A 4KPHH 3CX5K 5ANME 1IAMA 2EH8H 1B0RA 3IU3B 3O8XD 2VZOA 5IB5A 1EGJH 4UTBH 5DJZA 4Q6IA 1MFAL 1JZ8A 1JHLL 3VXNB 4OIBA 3ZTJG 5E5MA 3F58L 5JMRA 3KPTA 3MRPB 2ADGA 5HGHB 4PLJC 5D7SL 1L0YA 4MCZA 1I8KB 2VDQH 4U1NA 1KIPA 1MJUH 4NP4H 4K71B 2PO6A 5I18H 1LO5A 5IBUG 1JIBA 4YBLC 4XP9H 1JZ2A 1QKZH 3H9SE 1T66D 3UTPD 4F15C 2FH6A 1EMTH 1C1EH 4JB9H 1MSPA 5F8RC 5D7LB 4GRWE 3V2AR 2DBLH 4LNRB 5T3ZL 1QBLL 3IU4L 1MCPH 1AC6A 4LKXB 1MCWM 1FYTD 2OM5A 4OQTH 4X9GA 3VFWA 5BQ7B 1HNFA 3IAGC 4P4KA 2IBZX 4UT6H 1KN2L 2VXTH 3KWWB 5C0AA 3S98A 5F7DA 4OT1H 3JXAA 1JPGA 4LRIA 3QDJB 1T2JA 1TZIB 1EO8L 3C5JB 3O81A 5IQ7H 2D0GA 2ZOKA 4JDVA 5EBLA 2NY4D 3UC0L 3PABA 1MY7A 1OQOA 4PR5B 5E8OA 4X6FB 2DKMA 2Z31A 5JXEC 3QIUA 4HZAA 4JEGB 2AV7A 3MNWA 1RJZB 3TBTB 1F6AB 5FB8A 4QHUB 3MGOB 2XACC 3CFEA 2O5ZH 2BSED 2FNBA 5DD5L 2WIMA 3WD5L 4Y4FD 1RIHL 4DUVA 4OJFL 2OK0L 4RWYL 1MWAA 1MOEA 3EO9L 2C1PB 3BWAA 3ZE2F 1A1OB 5K9JH 2EZ0D 1KOAA 2XY1A 4NZTH 4CADB 4CVZA 2DD8L 2LE9A 3ALXA 3T0WA 2ZUYA 4CVXA 4C4KO 5IHBA 4HUVB 4M61B 2HJFB 5A40E 3G5YB 2YSSB 3P4OA 1ODAA 1M6OB 1YUHB 1BZ7B 1J0HA 4DN4L 2CIKA 3QEUB 5JW5B 4NRYB 3D39E 5I74B 3ARBC 2AXFB 2F74B 3LV3B 4S1DD 5DK2A 3HHRB 3QHFL 2OJZL 4MGXA 3OX8B 5IMMA 4LPTA 3V79C 5BRZA 2H3NB 4UV4L 3L6FA 3BH8B 5EN2A 3C08L 3D69B 3DVGA 1KSRA 3UPRA 5E2VH 1LGVA 2ESVD 1VGKB 5I1JH 3G6JB