3RI5F

C. elegans glutamate-gated chloride channel (glucl) in complex with fab, ivermectin and picrotoxin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
218
structure length
188
Chain Sequence
EVQLQQSGPELVRPGASMKISCKASGYSFTGYTMNWVKQSHGKNLEWIGLINPYNGGTSYNQKFKGKATLTVDKSSSTAYMELLSLTSEDSAVYYCARDGDYYRYGRYFDYWGQGTTLTVSSAKTTPPSVYPLCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSTCNVAHPASSTKVDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Avermectin-sensitive glutamate-gated chloride channel GluCl
publication title Principles of activation and permeation in an anion-selective Cys-loop receptor.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Transport protein/immune system
total genus 35
structure length 188
sequence length 218
chains with identical sequence G, H, I, J
ec nomenclature
pdb deposition date 2011-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ri5F01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ri5F02
3BESR 3T8XB 5HGAA 3TNNA 4JFDE 1QRND 4N8CH 3LIZH 3PL6A 2VZ3A 1FAIL 1IM3A 3OJDB 2E7LA 3TO2A 4NC0B 2ZUQB 4NCC1 5F70A 4O51B 1A5FL 2F5AH 1L7TL 2FATL 3TH2T 2W60A 2EC9U 1GYAA 5DRZA 5E6ZA 2DMKA 5ESQB 4AG4L 4DK3A 1N5AB 3V79C 1KBGH 2NY2D 2PYEA 4WW2B 2XN9B 2YHGA 4LAJH 3QXDB 4N9GA 3U1SH 5DO2C 2GYSA 4IMLA 1FZOB 3MACH 4K3DH 5FKAA 5AEAA 2BNUB 2XACC 1NUGA 2DIJA 3RVVD 1T1YA 2VAAA 1NGQL 3FO1A 3KJ4B 3O8XA 5HI4C 5JHDD 3WN5B 4OLXL 3HC0A 4FXKB 2D2OA 1NQBA 4OGZA 4NP4L 3NN8A 2NW2B 4NRXB 3RI5F 5ILTH 1X5ZA 4PYGA 3TBVB 5D2NA 1WITA 4WI5A 1JRHI 5HY9A 3LHPH 2ERJC 2FZ3B 4PRIA 4U1SA 3TIEA 2AABH 3EYSL 5D2NE 3MO1B 4ZXBB 5F96L 1XFPA 3BO8A 4NQDB 1P84J 2C1PB 4LNRB 4QLRA 4PRIE 4HBCL 3BIKA 3D0VA 2R23A 4A6YH 2IAMD 4BUHA 3ARQA 1YN6B 5IB4A 4I18C 4HMDA 4X7SL 5IW1A 1QACA 3OKKB 1JHKL 2X7LA 4PY7B 3EOYG 1MAML 2GSGA 1YMMA 3WMSA 1OY3B 1XF4A 1OAZH 1L0YA 1U95B 4PRAB 4R4ND 3VXOA 5BJTB 1I1YB 1QBLL 3VRIA 4TNWF 3OQ3B 1DBBL 2W9EL 1A1MB 3DHMA 1RZKH 1KUMA 1E6OH 4HJ0C 4QHMA 3SKMA 4WWKB 4MCYA 1U8PA 3ARBD 4CAGA 2DLFL 5DRWA 1VHPA 2UUDK 4YBLB 4K94H 2EDXA 2VSDA 5H37G 1KPRA 1D5XB 3W2DL 5INDA 4LP5A 1FLRH 4CW1A 1A02N 4NKMA 12E8L 4RMRA 5F3BA 3R8QA 1QFWH 4TTDD 1GRWA 2AK1L 3U9UA 3AGVA 2MMXA 4AL8L 5GJSH 3WXVH 1QPPA 3MRDB 4L3CB 4IHOB 5EZIL 1MCPH 4U6HB 2QBWA 1G6RB 5D7LA 4KUCF 2X09A 2WMPA 2YPLA 1QSFD 3UAJD 5D7LE 2K7QA 3F5WA 4M7LH 4MNQB 2ZUUA 4XVJL 2YPLE 3FZUD 2X4SA 4QF1B 4QT5B 1VDGA 4Z7VA 2IH1B 1XF2A 4PJIB 1FFRA 3GMQB 3NFPB 4DKEH 3QI9D 1L9MA 5C0NC 4RIRA 1A6WL 4GQ9L 4Z95L 3Q0HA 4NO0B 3FQTB 1UH4A 2H26B 3VJ6A 3KS0J 2YWZA 1MLBB 2R1XB 1V7NH 4YH6A 4OF7A 3S34L 3DUUB 2XWBB 2CSPA 3ZKNC 1SHMA 4MQ7A 5E70A 1NMCC 4RBPH 1H3PH 2P5WB 4PGBA 5SWZB 3O0RH 1Y0LA 4XP6L 4R97B 1EPFA 3B2VL 2VXVH 3OAUH 3MV9B 5JO5B 1AR1C 3T4AA 3ARDC 3RQ3A 5JQHC 4FRWA 5FECB 5FA3A 1YUHA 3VXQB 3IF1A 2WBJC 4PB9H 2ED9A 3ZKMC 2J4WH 2QKIA 1LDPH 43CAB 5IOPA 4N1CA 5FB8A 1SBSH 4JDTH 4XXDB 1LHZA 1XF5A 4MAYB 4AEEA 1CK0H 1MNUH 4LGSB 5CZVH 4RRPA 3ZE0E 5D96C 1FYTA 4MYWB 3DV6A 5FKPA 2XQBH 1A7NH 4GW4B 1L6XA 3IS0X 4PJ7E 1FCCA 3P30L 3WLBA 1I8LC 2YA1A 3QIUA 5ETUA 5DJDB 4PLJC 5I66B 5EB9A 3QP3A 3I75B 5SX4H 2ICEB 4ZFOB 2XPGB 1HHHA 2QSTA 5DVMA 5SV4A 5F9AC 5LXGH 4KI5F 5CJOH 2LTQC 2O5ZL 3QA3B 3RWFA 3KYAA 1HH9A 4XBEL 3O45A 2DI8A 1MCSA 4BUGA 2XWJB 1KT2A 1RZ8B 2M2DA 3A67L 4KK8C 4JFDB 2R0ZH 5IUSA 2CR6A 5HGAB 3TNNB 2AGJL 1S8DA 3E0GA 5IROC 4H0IA 4DZ8B 5AG8A 1AO7D 4NQCD 3PL6B 2GIYA 3P9WB 1CD1B 1F2QA 1V7ML 3NIDF 5E6IB 2HTKD 3TO2B 2R2CA 1OM3H 3BHBB 2P43B 4YXKL 5K59F 2FO1A 3IJSB 2MPAL 4JFEA 4JR9L 1DFBH 3JV4A 1MCBA 5E2WH 2VN4A 4U31A 4JO4L 4LKCB 4EUPH 4JFEE 8CGTA 2HJLA 3MBEB 4HK0A 4CDHA 2HT4D 4IMLB 4YDJB 4JQXC 4R8WH 2FIKA 1OWWA 2GK2A 1WQVT 4FQHA 5DD6A 2GTWA 2ED7A 3JTSA 3Q48A 2MNUA 5KVFH 4XP4H 3GMRB 3TBTB 3VDBA 3GIZH 1IGIL 2ZUYA 3O8XB 3UDWA 4G6AD 4U05A 3ARGA 3T0WA 4KVNL 3O4LA 1H5BC 3NN8B 3QIWA 3RU8H 1WAAA 4HS8H 1A21A 1UH2A 5D2NB 5GPRA 5JUEL 5HY9B 5CGTA 4BK5A 4X9BA 2EE2A 1KJMA 4PRIB 2HKHL 1OTSD 3BJ91 4FNLH 2Z31D 3BO8B 2ITDA 3D0VB 5E8OB 3GB7B 3PUCA 3X11A 2ZUWA 2ADIA 3CC5A 2DYPD 4KJWD 4EN3C 4GAJL 5IW1B 4ZUSA 1YECL 5AWNL 3S88L 4R96A 5AZ2L 4R7NA 5E6YA 4P59L 5MI0B 3SDYL 5JXAH 2NR6D 5DFVC 4XB7A 2QJDA 4OD3L 2JB5H 3VRIB 5D1XD 4RX4D 3OKMB 2AKRA 4HFUH 2GHWB 5SWSA 3SDCC 4QHMB 1TVHA 3SKMB 2AJSH 1ETZB 1U8PB 2EIBA 2F53A 4UTBL 1YEHH 1YC7A 4WW2C 2YS4A 5DRWB 2H2PC 2OQJA 3EDFA 3NA9L 4GRLA 4P23B 2IPUG 4J4PD 4KUZH 2HA1A 4M6MH 3SGJC 4D9LL 5DHXB 5I15L 4YXLL 2V2WB 1IKFH 5INDB 4CW1B 3QUYC 2A74A 4HHAA 4K8RC 2K9UA 5F3BB 4MNGA 3DX9A 1KFAH 5DJZA 1U6AH 3RIFK 5CEXA 1F02I 3REWA 3PWPD 5C0JA 1RZIB 4MNGE 1EGJH 2O61A 1CDIA 2P8MB 3P77A 1S78C 5TFSH 4ZS6C 4ZNEA 2DJSA 2A83A 5D1ZD 4GXVH 4LCCA 3RPIA 2I5YL 3KYMA 3MOBL 3SKJL 4R2GD 5D7LB 2BNRA 5CILL 1ZVSA 4DAGH 1LE9A 3MRPB 3OHXB 2YPLB 1FJ1A 1EHAA 2VXUL 4ZXBC 3E2HB 2BNRE 4P9HC 4BZ2H 2FBJH 1IC5H 3TO4D 3V6OC 5FM4A 3VXUE 3WL9A 4PTUB 2X9YA 3OG6B 2OBGA 2FO4B 2WWMD 3SY0B 3O6LH 3GI9L 3FT3B 1ZXQA 3PP4L 1XF2B 5JW4M 2W38A 4TRPH 4RIRB 3T0EE 3HZMA 3KPSA 4RMTA 2GFBB 1T6VN 1KENH 1AKJD 3QYCA 3PF2A 1B0GA 2DWEA 3MLTA 3KPSE 1JNHA 3U48A 1U3ZA 4Q9CA 1TTFA 4FFZH 1ZVYA 4J3WA 3NVQA 4WHYG 5HYJA 1MCRA 4Y2DD 1UADC 1T4KA 4K9EC 4I77L 4R0LA 3GNML 1XT5A 3BH9B 4JN1H 2NXZC 2VDKH 4IOIA 5GGVL 1Y0LB 4Z5RA 4FZEL 2R1WA 2I07B 2FHBA 2ITCB 4YBLC 1JPSL 3DHJA 3T0AA 3C08L 3K46A 3KXFD 3NZHH 2IBZY 5EBGA 2H3NB 4G8FA 3K1KC 1FVCB 3MLRH 3QXTA 3IF1B 4NZUH 4YHIA 1S7WA 5IJKA 3RWCA 4DKFH 1ZEAL 4U2ZA 2QKIB 4AJ0A 4D8PA 4NHCH 1QYGL 3D2UD 2QHLA 4XX1G 5T5FL 4EDXA 1ZKAA 1MEXH 2XKSA 3AY4C 3L95A 1EFXB 1GZQA 2YPVH 4FTVE 3LN9A 4JPVL 4PJ7B 1SYVB 1AJ7L 1R3LA 1C12A 1S3KL 1TNMA 5D5MB 1CF8H 2UWEE 5I74B 2RR3A 4PTTB 1S7XB 4K3HA 4U2YA 4YHOH 1FH5H 2HFTA 3IDUA 4G42A 3CXDL 3BP6A 5F89B 1HHHB 1AI1L 1I8IA 5I1AB 3MCLH 4N0UA 3LKSA 5KAQF 3HMXH 1U8NA 1NFIA 3STBA 1HH9B 5F7NC 3O45B 5EO1B 4XCYA 1UKQA 1KXQE 1KT2B 3E8UH 4PBWD 3RGVD 1MVUA 1T1XA 4FQ2H 3RVXC 1KIRA 4P4KB 2Q7NA 1MREL 1DBJH 1J5OL 1FFNB 4LEXL 5EH1A 1G7HB 4HWEH 3MV7A 3JWNC 1JN6B 2NY5L 4RA3A 5I9QB 1SEQL 3AS2A 4CMHB 1OB1A 3MV7E 4PPTA 1VFAA 3LPFA 5F7EL 4EOWL 5EOCL 3U4AA 1A1OA 1KV3A 3JV4B 1KOAA 2A9ML 1A0QH 4OD1H 3V4PL 3LEYH 1A7RH 1RIUL 4P9ML 1A9EA 3PWNA 2FIKB 2NXYB 4GG6A 4FQHB 2VTFA 3TJHD 3MRJA 3JTSB 2CUMA 1AXIB 2D7OA 2G60H 1UFUA 3EDDA 2CIIB 5GGRA 1A64A 1RZFH 3WXWH 3QDGD 3KAAA 4U1NA 3LEXA 5HHVL 2DLTA 4PRHE 4LLQB 3HC3H 3QIWB 3TPKA 1INEH 2W1NA 1U8HB 3B8SA 4KTEL 4KK9C 1KJMB 2Z8SA 3D9AH 2P1YA 1MFBL 2V17H 3SDXB 1OVZA 1R3JB 2P44B 1PZ5B 2VDQL 3DRQA 1T21A 2YK1H 5IVNA 3FO2B 3CK0L 5JW5A 4K7FA 2OTPA 1NGYA 4NPYA 4HG4K 4GUPA 4YFLF 2DQFB 2CDEA 4ZNCD 5GGUA 4R96B 3D85D 4LVOB 4JDVA 3VFMB 4K55A 5D7KE 4BJLA 1DP0A 1K8IA 4WU5A 1KXVC 4MAUH 1IM9D 4ZS7H 4Z78A 2E7LC 3F12B 1HWGB 1MCDA 3L3KA 4H0HB 4JB9L 3ZYOA 4ERSL 2QQKH 1IT9H 3ULVL 1AHWA 5CBEA 1UYWL 1CBVH 4GRLB 1BZQK 2VDOL 1VEPA 2J5LB 3ROOA 2AJUH 5CCKL 4TUOA 2JCCA 2A74B 1JYXA 2B0SH 4MNGB 2CKBH 4PUBL 3BDYH 3AUVA 3IJYB 5FUOL 4AEHH 5DJZB 3QO1A 4RNRA 4Y19B 3L1OL 4JFFA 5DEFA 4XNUH 1WZ1H 3OX8A 3UTSD 1D9KD 1M6OA 1W72H 4NQXA 5FO9B 1CXFA 3P77B 2GQHA 3QFJD 4JFFE 3P11H 3L3OB 4LSUL 2A83B 3JUZA 4LCCB 3WJJA 5F72S 5D2NC 1LK3L 4CN1A 4ZFGL 4IEFB 3AM8A 3PNWB 4O9HH 2BNRB 1ZVSB 1MIMH 5C0RL 4XAKD 3MOQA 4OT1H 1KB5B 3QEGH 4XVUD 2HKFH 3VXUB 4EUPA 2DF3A 4XPBH 5HYSG 1UEYA 2AEIT 3O3AA 3QUZD 2IBGA 5JIHA 3N85L 4MJ4A 3I02A 5IBUG 4YHZL 3T0EB 1N6VA 1MI5D 3CLFH 5HI5D 1QFUH 2F9BT 4XX1E 5F7LB 5BO1L 5FYKH 1KIPA 4J1UB 3HZMB 5JMOC 3SDAB 2LVEA 2X5PA 5MI0C 4XXCA 3MBXH 5DQJA 1B0GB 1Y18B 3MLTB 1JNHB 4JO1H 3QQNA 2NY0D 2HLAA 3CSPA 4KZDL 5IFHH 4PJGF 1E4WH 5I30L 1U92B 3LB6D 3ZL4L 1T4KB 2A2QT 3B9KB 3DI2B 4MD4A 1FDLH 3SN6N 1TJIL 4TULL 5HDBE 4OKVA 3T2NL 1RMFL 1MFAL 3NFNB 5ITBH 1ZA3A 1U2CA 5CJBA 3BN9D 1SEBB 2P48B 1J10A 4A6YB 1KCUL 4FP8H 4HC1L 1K4CA 4QXWA 2DDQL 2DKMA 2X4UB 5GSRB 1O7SA 2P46B 4G8FB 5ALCH 4M43H 4D3CH 3QHZH 4R4FL 1HEZA 1MCIA 4FXGA 5BMFL 3RWCB 1YEFH 4DVRH 4MB5A 1CGXA 5DJXB 1EMTL 3BRFA 3ARZA 4LKXA 3SHSA 1XGTA 2GK0A 3QULA 4QKXB 4LRIA 3UCRA 4D8PB 1Z5LB 4FTVB 4OIIL 4KROC 5KVGL 4F7MA 4I3GA 3L95B 4JGUA 1WFNA 5KTEL 1GZQB 1I9JH 4QWWD 1N6QH 1XZ0A 2OR7A 4S1DC 2UWEB 2V2TB 1C12B 3LY6A 2ATPA 5GRUL 2PW2B 4O02H 1LK2B 1BZ7B 4XH2A 3REVB 4KHTH 1B4RA 1I1CA 1NCDH 3BP6B 4U1JB 4RGND 1I8IB 5E08H 3K0WA 2F54D 1UJ3C 3DETD 3MFFA 4JM2C 5LCVL 5BS0D 1U8NB 1NFIB 3QCTL 4TSAH 5DVOA 2F58H 3MRLA 1JL8A 5HVHB 2YBRA 4UDTB 1EGJA 5TF0A 1GGCH 1MVUB 4UNUA 1NAKH 2VC2L 3L3DA 2PXYD 5EZOH 1CDJA 2OP4L 1KPUA 4ELMF 4JQIL 3J7HA 1JZ3A 1H8OA 1LMKA 3MV7B 3DVFA 2X05A 4AQOA 5L2JA 3AS1A 4HUMB 1JPTL 3A6BL 3TZVB 2AI0L 1AD0A 1TXKA 5DD1L 3AU1B 3SJVA 1DJSA 5KZCB 1A1OB 5F7YC 4KJPD 5J56B 3MZTA 1YC8A 1NUNB 3CFJB 3CCHB 1CGYA 4UOW1 5DJYB 1HYSD 4ZUVB 4U1KB 5IMKA 3MRJB 1J05A 4U6YA 1K5NB 4ZUTA 1K9TA 4KVCH 4ODVH 2EDOA 2EXWC 3O6MH 5GGRB 4PRHB 3PGFH 2WLZA 1JCKA 4UDUA 5IW6B 3RGHA 4CADA 4XI5C 3LEXB 1CG9A 5BXFA 3NGBB 5EO0A 5CINH 5FV1L 1Q0XH 4EZMA 1F4YH 3QIUC 4EQ3A 1TJGL 1YEGL 2R29L 1G9NH 4TPRL 1FGVH 5MEOB 1LO0H 1GOGA 4NGHH 3MODH 3O2WL 3QIBA 4QOKE 3QNZB 1T21B 3P0YL 2IGFL 4G6FD 4ODSH 2EEDA 5JW5B 1EA9C 3IDGA 3QT2A 4NPYB 2Z93A 1KXTB 5T33H 4DUWA 5DHVH 2CDEB 2N56A 4ODXB 5CEZL 2VDLH 3RIFF 3D3VB 4PJDE 3BPCA 4GAYA 4UT9H 1FN4A 2CDFA 3RAJH 1UXSB 4U3HA 3L3JB 4I13B 4WU5B 1K8IB 4EXKA 1Q0YL 1LP9A 2GUOA 3I3DA 2X2YA 3HNSL 2IQAA 3B9DA 3GSNB 5CEZD 5DZOA 1LILA 4YUEH 3M07A 1PG7X 4FQIL 2VDMH 4POZD 5E99L 5DUBA 1JWUA 2BMKA 3T3PF 1G7MA 1J1PH 4JG1H 4P57A 1NBZB 1P6AB 3MCKA 3ABZA 3ROOB 4X0KA 4OM0H 3IKKA 4OZGF 1AQKH 5KN5A 4APQB 3HI1B 2E6PA 3H7BB 4MLIA 4YPJA 3SGDI 2I9LA 1OTTC 2BOCB 4PJXE 2GSIB 4JFFB 3H42L 3GKWH 3UDWC 3MMEA 3ARGC 3HAEH 1R3IL 2HFEA 1M6OB 1SJXA 4NQXB 1CLZH 1UCBL 3MRQA 5F3HA 4EQ2A 3BDXA 2Q76A 3EO0A 4DN4L 3QIWC 2C3GA 4Y2OA 4JHAH 3DGGB 1IGCH 1DEEB 1S7VB 4KRLB 1B0WA 5HJ3B 4Z7OE 4X99B 4YBHA 5I18H 1IFHH 3IDIA 1VEOA 3WIIH 2ARJA 4HMEA 1WIOA 1MCHA 4XCFL 4GSDL 1EAPB 4AIXA 4EUPB 5CAYB 1PLGH 4JLRA 4MXVF 3VG0H 1KCKA 4UT6H 4WUUD 4IRZH 4NQVB 2VLJA 2BNQD 1KEGL 5J7CC 1G7LB 1NJ9B 1KCSL 4P99A 3MRHA 2D31A 1C08A 5SX5H 3K80A 6CGTA 5DA0B 2XG5A 4G6KH 4IRJB 1C7SA 1IEBA 5DQJB 4X6DF 3UYRL 5JNYA 5I8KL 3UC0H 3BI9X 5DGQA 1QPXA 2A6KA 1ZLUH 4YHNB 1RJYA 2HLAB 1R3HA 3X3FH 2FSEB 3DMMA 1PBYA 3PWVA 3VD3A 1IARB 3CFCH 5EBLA 4GKZB 2BSRA 2P8LA 1XR9A 4GRLC 3BWUC 4PB0L 4RFNB 1A5FH 4BSJA 4Y4HA 2FATH 4WEMB 2FEEI 4NJAH 1DN0A 5IR1B 4AG4H 1ED3A 1UJTA 3VD9A 4OFKA 4KAQH 1HEZB 4FXGB 1OF2A 3FMGL 4PJAF 4LKXB 1UACL 4N5UA 1C16A 2GK0B 3QULB 3U4EA 5DK0B 4DFIA 1NGQH 4PYHA 5GRJH 4LCCC 1ITCA 5F97E 1P2CA 4OLXH 5KG9B 3VFTA 3OKDA 1XZ0B 4XP5L 2R0LH 3DO3A 1J1OL 1T3FA 3KDMA 4NP4H 2ATPB 3NCYP 4RAUB 2EIZB 4Z7UF 1NCNA 1AR1D 4HJGA 3SOBL 4GLRI 2APXA 3D69A 4HIXL 4KC3B 5B8CB 3EYSH 1JE6A 3MLSL 5F96H 3DSNA 3MFFB 4HBCH 2CKBA 2WBJD 3I3BA 1YYLL 3MRLB 1LO5A 3D0LB 3O3BA 3MNVA 1UB6A 3IDMA 4X7SH 1NC4B 2E6QA 1JHKH 2BRQA 2L4OA 3L3DB 4PJ8D 1S7QB 1HHKA 1KPUB 1MAMH 2C4FT 4WWID 4DUVA 2FX7H 1K3ZA 4MXWL 4BH7A 2R8SL 3VWJC 3K4DA 3N1QC 4R0LC 2J12B 2N4IA 2JK5A 5L2JB 1T20B 1QBLH 1J86A 1AD0B 2AXGA 3E6HB 4NRYA 1DBBH 5DMKB 2W9EH 4QYOA 3GO1L 3MUHL 3VA2C 2EYTA 1Q94A 5K9KA 1CDUA 3FB5A 3PHQB 4QRRD 4DN3L 5KSUB 2DLFH 2HJKA 5IJKC 1LO4L 3ELAT 4XCNB 4Z7NE 5IMKB 2VZVA 4U6YB 3W2DH 5FYKE 4KK8D 2Y5EA 3GJFK 1X4ZA 4XMPL 5E0QA 4ZUTB 12E8H 1P69B 4PG2A 1T2QL 2AK1H 3UBXA 4AL8H 4FFVC 1NLDL 4JZNA 1ZK9A 4CUCA 3VGBA 1U3YA 5B3JE 1M7DB 4AM0A 4HUWB 4E0RA 5BXFB 1TVDA 4ELKA 5JHLL 3SGEI 4LF3B 5EZIH 3HAEG 5EO0B 2Z9TA 4WGWB 2UYLA 3X3GL 2P45B 1KJ2L 2EYRA 2YEZA 4Z8FH 2I60L 3CZFA 4QOKB 5C0AA 4RQQB 3FO9A 4P2OA 3MLUL 3D48R 3STLA 5GZOD 4X8JA 1WF5A 2R2BA 4RMUA 2C3VA 1F8TL 4XVJH 4XGZB 1KLUA 5BW7A 1DDHA 4PJDB 2Z93B 3GSUA 5F1OB 2GJ6D 3BKCL 2KL6A 2ZUSA 3BPCB 1BD2A 1A6WH 2IH3A 4MD5A 4NWUL 4Z95H 2RIKA 1BD2E 5HYSB 5HHNA 2R9HC 2GUOB 1T1WA 3EHBC 4NQEA 2BY1A 3HR6A 1EDQA 3BUYB 2IQAB 3NIFF 4HFWB 4LK4A 5IBUB 3TC9A 3VFUA 3S34H 3MGOA 3LKPB 1MWAL 4NQEE 3MV8B 1XAUA 3K4AA 4HGWA 4F7CA 3F7VB 4NN6B 3JBG7 2BMKB 5DUBB 3UZQA 3GJEA 3O2DL 4OLWL 3W11C 3E1F1 4XP6H 2VIRA 3KPRD 4S1RL 2P5ED 1IGJA 3C5ZD 3MCKB 2W9LA 3B2VH 1CFTA 4MA7L 4TOYL 2G75B 2X4RA 5KN5B 2GEEA 4PJXB 1ONQA 5HGHB 4HKZA 3IFOA 5CZXC 5FO7A 3UPCA 3NCEB 2HFEB 4CRPA 5DFVD 3DTXA 5LBSL 2HRPL 3DYPA 2APBA 2WW8A 4X4XA 3K4ZA 4K8RL 1FVEA 1OLLA 2PO6A 2X4NA 4XT1C 9CGTA 2A73B 2B39A 3FQNA 1UXWB 1XF3A 3BVNA 4GKNA 5I1EH 3AB0B 3MRFA 4OUUA 2XN9D 3BDBA 4JLRB 2ADGA 1AFVL 3P30H 3PP3H 5IB1A 1FZJA 3EJYD 4KV5F 3EYUH 3O3EB 2ZSVA 4K8RD 1WBZA 1YYML 5I1CL 3P4LA 4OFVA 4XP1H 4OV5A 3MRHB 1BM3L 4P9HL 4L4TE 5C70A 4L8CA 3FRUA 4XBEH 2J1KA 3S4SA 1S78D 5JNYB 4ZS6D 5DMYA 1EZVX 3QCVL 1VCAA 3A67H 1T83A 3FFCA 1R3HB 1UZ6E 1K4DA 2GY5A 4FA8A 1OCWH 3V5KB 3DMMB 3FFCE 2AGJH 4X6CA 3PWVB 4V1DA 4ZXBD 1GZPA 4PREA 1LGVA 5EBLB 3I6GA 1MCEA 1GC1C 5I8CB 3QUKA 1HCVA 1AHWC 4X6CE 3ZTJG 1KN4L 1XR9B 3DX8A 3G6AB 5D8JL 4J3TA 4YXKH 5J06A 1DN0B 2MPAH 3G6JE 4DW2L 5IMMA 4JR9H 1U36A 1ED3B 4K9EL 4WY7L 5DI8B 4JO4H 3QJFB 2D3VA 2EDNA 5C0IA 1C16B 5E94B 2IMNA 4Q97A 5D9SA 5DK2A 4LVNB 3TV3L 5HVFB 3ARSA 3GSQA 4JQVC 1RJZB 4HJJL 1VA9A 3WJJC 1IGIH 1MLCA 2B2XL 3OKDB 3AM8C 1F90L 5MERB 2NXZD 1DZBA 1P1ZA 4WWKD 2B1HH 2E7CA 5DLML 1T3FB 3KDMB 3MLWL 4I4WB 1QRKA 2VQ1A 1T22A 3L5IA 3IYLW 4RWHA 1XCQA 3I85A 5C07E 5JUEH 4GH7B 4HJGB 5IHUL 3U0PB 3V7MA 2HKHH 2DKUA 3SKOB 4XNYL 2RBLA 3LKQA 2EXYD 3JWOC 2CKBB 4OBSA 3CJJA 4IM8A 1T80A 5LAXA 3WEXB 5GS2H 1LVEA 4XXCC 1W72B 1UB6B 5F9WC 4GAJH 1YECH 3BPLB 3OSKA 2DAVA 4IDLA 3S88H 4GMTL 5L7XL 2ILLA 1OT1A 3B5GA 2XTLA 4UB0L 4P59H 5D70L 5GRXG 1GL4B 4XNQB 4BH7B 2E9JA 2VITB 3SDYH 1C5DB 4BQ9A 2VLLA 5AYUL 2EDBA 2W59A 5I17A 2AXGB 4X83A 1EEYA 4NRYB 2UVEA 3RBSA 1NC2B 1BQSA 1LDSA 1RSFA 3MLZL 1QP1A 1OL0A 3D18B 4UQ3A 2RHEA 1BPVA 1Q94B 1I7TB 3FB5B 4ONGH 5K9KB 4I3RL 4X9GA 1CICB 2HJKB 3NA9H 1AQDB 1UWEL 4NO0D 1CGTA 5TDNA 1H9VA 1H0DA 4MCZA 3DROB 4D9LH 4N0FA 5I15H 5CEYA 4YXLH 1HSBA 2WWKO 4LRIC 1YA5A 3MLVL 3OF6A 3P3YA 4KQ3H 4P48A 3RVXD 4ZFFA 4PLNC 2X4PA 4QRQA 5IVOA 5GS1A 4KKAD 2XXMB 4XNZB 4L4VD 4Y5XA 5TH2B 4Q9BA 2P5WD 3DSFL 4W68A 5SWZD 4R7DA 1PSKL 2KBGA 4F33A 3W9DA 2UYLB 1QUNA 3MV9D 2I5YH 2DQCL 3SKJH 3LRGA 3FO9B 3D87B 3U46A 1PDKA 1GIGL 4RDQG 3V95A 1HQ4B 2CLRA 3WE6B 5HTSA 2C3VB 1RK0B 5E2JA 4M7JL 4X9IA 1KLUB 4PP2A 3KYKH 3OJVC 4OZIA 2P49B 1BIIB 1L7IL 4NKDB 4PP1D 3GSUB 4OZFH 4EI6A 3IAGC 3HB3C 4OZIE 4YX2L 3GI9H 4ENED 3PP4H 4LSVH 4HUKB 1HH6B 4MAYD 1ZLVK 4MD5B 2ATKA 1MCWW 4XHJC 5GGTL 1GAFH 1AD9B 3OAYH 4YR6B 4DTGL 5FK9A 5HHNB 4PBVC 4C83A 1T1WB 4NQEB 3MROB 1ERNA 2VH5H 4OF3A 3MGOB 4S10A 3S3SA 3L5HA 1ES0B 4AT6A 1OSZA 1A9BB 5E24E 4NQSB 4I77H 3GNMH 2NW3A 3Q5OA 5GGVH 1I7RB 1U8KB 4FZEH 3HA0A 1D6EA 4QXTA 1F4AA 4ALAL 3LV3B 4N0YL 1JPSH 3KS0H 2Q8AL 5A2FA 5IHZB 3C08H 4FZ8H 1CFSA 4ZPVB 4JFDD 4ZYKA 3RTQB 5FO7B 1AIFA 2ZJSL 1ZEAH 3PL6D 3VMOA 3TN0A 5F8QC 5E6ID 1EFQA 2HFFA 4X4XB 5C9KA 1QYGH 3BPNB 3WYRA 2X4NB 4M48L 43C9A 3FCTB 2FLBT 2SEBA 2JLLA 2APTA 3OR6A 4GKNB 3HC4L 3MRFB 4OUUB 1AJ7H 4IIQC 4JZOA 2D03L 4KXZI 1NEUA 5KS9F 1S3KH 3RJDA 3QIBC 5J13C 2OSLA 1T7YA 3MBED 5DMGC 1BIHA 2DI9A 4NNPL 4JY4B 1FZJB 4WFEE 3CXDH 1JUFA 2ZSVB 4PJEE 5F1SA 15C8L 1DR9A 1AI1H 4L4TB 3GSVA 5IWLA 1HKLH 3O8XD 4D0CA 3V5DB 1P6FA 4HH9B 4L8CB 2GJJA 3H3PL 4LQFH 3S4SB 1RK1A 2DQIL 3MV01 4LARH 3BKJL 3FFCB 1MCCA 3GMNB 1NKRA 4YXHL 2IG2L 5IEKB 4PRID 4PJCE 5CMAA 1MREH 4X6CB 2KQNA 3GMMB 4YDLC 3I6GB 3V6BR 3PXJA 3QUKB 4JM4L 2JE8A 3CFDA 3TBYB 1SEQH 4P5KB 3G6JB 2FX8H 2DWDB 5F7EH 4EOWH 3EDKA 1E4XH 1RZJH 4F9PA 5DHVB 1S7UA 3TNMB 2A9MH 1DVFA 1WCBA 5HYQB 4FFYL 1ZLSL 1FPTL 1HI6B 3ZMRA 1YMMD 1JHTB 1RIUH 4P9MH 3R4DA 5I75B 2A6IA 3V6ZA 4LHUA 1CVSC 2G5RA 4YC2B 5DK2B 5F1KC 4OKDA 4FN0A 3GSQB 4JO2L 3N0PB 3BPOB 1KJ3L 2XZCL 4LHQB 1MH5A 2EC9T 5C07B 3PGCA 3AB0C 5HHVH 1T22B 2FJGA 3PHOA 5IW3A 1XIWB 3LD8B 4P23D 4KTEH 3S37H 1UZ8A 3QPQC 2DM4A 3VGDA 1MFBH 1JF5A 3K8MA 4XRCA 4OIBA 5LAXB 4LCIL 3ILQC 3P4NB 5B39A 3CK0H 1X5YA 3HAEB 3OB0K 3BKML 2V7NA 4KROD 2ICWA 1YEJL 4OZFG 3S8WA 4RFEA 1QLFA 5D7LD 4S1DD 5DJ8A 1EHNA 2V6HA 5JOEA 3MUGA 5CWSA 3WLWD 2YPLD 2VLLB 3PWUB 4CNIA 1WK0A 1ACYL 3ZKQD 4X5XB 5I1KL 1P7QA 1EEYB 3THML 5C0FA 3QISA 1YY8B 2O5YL 4Y4HC 3OKNB 4NOBA 2R39A 5IHLB 3IAQA 4ERSH 5KBNC 1WISA 2GAZA 3ZDYF 3ULVH 3VGGA 3L5XH 2WINA 1UYWH 5A2KH 1IBGL 2PTUA 3KLHC 1ZA6A 4P2QA 1H0DB 3BAEH 3GZKA 2CK0L 1HSBB 5CCKH 1RUKL 4P2QE 3T77A 4L9LB 1CFQA 1MFEH 5GS1B 1JGLH 1J0IA 2NY2B 4PJFE 4L1DA 5ICYA 4BZ1L 1BVKA 5IQ9A 4F33B 1CL7I 1FE8L 4WI3A 3T09A 1CCZA 1I9RL 1NGWA 3MYZA 4LSUH 3VG9B 3W9DB 4BA8A 4U6VL 2BERA 3TT1L 4ZFGH 2P47B 2VABB 3FN0L 2YUZA 5C0RH 1TTUA 4M7KL 4NQUA 5F9DC 1ROWA 1MELA 2CLRB 3HG1E 1V3KA 3BYTA 3VE0A 4JAMA 5DURB 3BIBX 4OZIB 1FL5A 1Q9OA 2IANA 5IF0A 5IEHB 2BVUA 4Z7QE 1MHEA 4YO0A 5DYOA 4ZDHA 1CI5A 5D71L 2Y06H 3QBTB 2I25N 2EXWD 4P5MB 1MJUL 3GIVA 1EFXD 4KMQA 5IK3B 2ATKB 1RAMA 1F3RB 2IJ0C 5KSVA 1XGUA 1E4KA 1FYTD 1VB9A 5FK9B 3BZEA 1A8JH 3CFBA 1G1YA 2ARWA 3W39A 2HT2D 4KZDH 3L3HA 3QRFM 1KTLA 4RFOL 1OSZB 4R90L 1TJIH 4TULH 3N1MC 5FHBL 4I5BB 3H8NA 3T2NH 1RMFH 4QXUL 1PY9A 4G7VL 1MFAH 1KIQA 3CMGA 1QEWB 3FOMA 4HC1H 4YHML 1C8PA 1ZANH 4JG0L 3U6RA 3RVTC 2AJVL 2Z35B 4R4FH 2HMID 4PG2C 3P4MA 3UPRA 3T0DA 4X5WB 5BMFH 2BCKA 1M71A 1ZGLA 1EMTH 4KPHH 4NZTL 3EFDL 5C08A 2HFFB 4JRYA 1IAIL 1JK8B 3SGDH 4OF0A 5KVGH 5B4MC 4F7EA 5KTEH 4Y16A 2QTEA 4ZOAA 1K8DA 1FZMA 4JRYE 1PFCA 1YEIL 4ZUWA 3TVMA 4JFED 5IMOB 4P2OC 1M7XA 2DQHL 4JZOB 4D0BA 1I8KA 2OSLB 5GRUH 4PJEB 5EPMB 5EBWB 3F7RA 1BJ8A 2NXYD 5BW7C 1DBML 3GRWL 1CT8A 3C09B 1D3CA 5ID1A 2R2EA 3SQOH 3JSSA 4MHHI 5LCVH 1OTTD 1FLTX 3QCUL 4F2MB 2AK4A 3ARGD 3QCTH 3VI3E 1TIUA 3ZDZE 5I1LA 2AK4E 1NEZG 3QIWD 4PJCB 4F7PA 4OQ1A 4L3AA 1MRFL 2VC2H 1GJIA 3ESVF 2EYSB 1I7UA 1KTRL 2OP4H 2MJWA 3KPOB 1J9CT 3VXRA 1YN7B 3DX7B 3EYFB 4NNXB 3WS3A 1D5IL 3CFDB 2FL5A 3VXRE 3BQUA 1S9VA 1JPTH 3WUWA 4YGVA 4CVWA 4DVBB 2Z92B 1QSEA 5DD1H 3KPTA 1JGDA 2BY2A 5HGDB 1BQHA 3SCMB 1HXYB 3CH8A 1DVFB 1WCBB 3VXNA 3MZGB 4Z7WA 3HE6A 5DQDL 5C8JB 2YN3A 5F6IC 1OOAA 1ZT4B 1DSFL 5GRWA 4YHKL 1EJ6A 4Z7WE 2LU4A 3GSRA 3RY5A 1Z9SA 3BPNC 3W0WA 1NBYB 2PO6C 5IVXF 4ZAKA 1PW3A 1AXSA 3PGCB 5ADPH 3OAZK 2AQ2A 3O6FB 5EDXA 2FJGB 2BC4A 2JIXA 3PHOB 1R3KA 3OMZA 1KN2H 4GRLD 4N5ED 2CJUL 1BVLA 1UZ8B 2H32H 5E8EA 3G5VA 2X41A 4QHLB 5ENWA 1TJGH 1YEGH 3CFEA 2R29H 4TPRH 2EDLA 4RAHA 1SJEB 1SJHB 3O2WH 3TWCL 1O5DT 4XRCB 1IZKA 1N4XH 2J8UF 4JREC 3P0YH 2IGFH 1KBGL 3T65B 3SE9H 3HZYA 4LPVA 5D4QA 1CLOL 5HHQB 2OXGA 3MACL 4Q2ZA 4NOFA 4J3OC 4DQOL 1AGCA 5JORA 4YDVA 3IDXH 5DJ8B 2BNRD 3VGAB 3DVNB 1BJMA 2GCYA 1V3MA 3PWJA 1G9NC 3JWDC 3VXUD 4GG8A 4JGJA 3HNSH 5E9DE 4K3JL 1WJ3A 3MUZ1 3ISWA 2DTMH 3BN3B 3T0ED 4Q6YA 5DMJB 1U8QA 4FQIH 4UNTA 3IGAA 2WINB 4NQCB 2V5YA 3KPSD 3SDAD 1ZA6B 5I19L 4P2QB 1RUAL 4YHPB 4OZHF 2YC1A 3V0WL 4NN7C 2YPKB 3UEZA 3WBDA 5AD0B 1PX4A 1CFQB 5E4IA 1NMAL 2BVYA 4PJFB 1IAII 3K2MC 1YJDL 1IE5A 3B9KD 4N8VG 3ME0A 3H42H 5D72L 4F3FB 1J0KA 2WIMA 1R3IH 4JZJA 4NUGH 5ICYB 4PRPA 2YXFA 5IQ9B 4MQTB 4DN4H 3RKDC 1S9YB 4XPTL 3LD8C 4PRPE 5EUKA 4LIQH 3HG1B 2BZDA 5J9PA 3G5ZB 4B7IA 3VFNB 1A14L 4LSQL 4F7TA 5CBAA 3SGEH 4XCFH 4KMTL 4GSDH 1KSRA 2ZUVA 3VE0B 4JAMB 4XVTL 3RFZC 1IAMA 5IF0B 4LRNL 1MHEB 2AXJA 1I7ZA 4FTVD 4YO0B 5TDOB 3CFKB 3RWGA 1KEGH 3JTTA 4PGEA 1KCSH 3T2OA 4FFVD 4ZFZB 4LSTL 2X42A 5D7IE 4U7MA 3IRZA 5KSVB 3S5LG 4ESKA 2BSED 1WWWX 2VO5A 5GJSL 3BZEB 3GM8A 5AYQA 3WFZA 3CFBB 1T7XA 2AJXL 2DYPB 3W39B 3QUXB 1VKXA 1RV6X 1S7TA 3GHEL 1P5UA 2GITA 3HE7A 1GXEA 1JIBA 6FABL 2YMXH 4C58B 3WJLC 3DO7B 5CD3A 5IKCB 4Z6AT 3MFGB 2LAAA 2IMMA 1DL7L 4M7LL 3NCCB 4PB0H 4PJGA 2FJHA 3VA6A 5DZLA 3MUY1 1KEML 3U6RB 4PJGE 3MOAH 3P4MB 3UPRB 4HKBA 5GS1C 3VDAA 3N50A 4WNQA 1M71B 1ZGLB 3RNKB 5J6HA 4BH8B 3FMGH 4Y5XC 1UACH 3MV7D 4FQLL 2R9HD 1C5CL 1AE6H 2K3TA 4ZPTB 2Z4QA 3S35H 3EHBD 4JRYB 4F15B 2XFXA 4A2LA 5EC2A 4PGDB 3VG9C 1FG2A 1PD6A 4UIMB 1W0VA 4Y16B 2FGWL 1F3JB 3TVMB 1FC2D 7FABL 5KZCD 2X4TB 2NY4C 2H2SC 2VJXA 1I8KB 3STZA 2X9XA 1E28A 2JF1A 4QY8B 1G7IA 3ULVE 1UWXH 5D1ZB 4HIXH 2VXVL 4R9HA 5J6GB 3TPUB 3MLSH 3NZ8A 4CL7A 1RULL 3MV11 1WC7B 1REIA 2AK4B 3RWDB 4PRHD 4XPHL 4JFYB 1D5BB 2DIAA 1YYLH 4CKVX 5I1LB 3MRKA 2DICA 4NQTA 3T3MF 1RU9H 2WUCL 4DKDC 1G7PA 4F7PB 2R2HB 1EBAA 3GK8L 1LDPL 1SBSL 2HVJA 3CDFA 1MQ8A 5F7UA 4MXWH 2RGSA 3VXRB 5ID0B 5J8OA 2R8SH 3NCFB 1MNUL 5DF0A 4GJTB 2A6DA 2FL5B 3BQUB 3MXVL 5EO9A 1AKJB 2XQBL 3OJ2C 3F7QA 2YXMA 5E8PB 1CLCA 4MJ6A 4OZFB 4Y4KA 5EU7C 4MVBC 1BQHB 3S98A 4ELMA 4Z7WB 1WVZA 4CMMB 2M26A 1GC1L 4DN3H 3LRHA 1UB5B 1LO4H 4X7DC 1BX2B 3LSOA 2VZTA 1NAMH 3GSRB 3P4OA 4NBZB 3OKLA 3TN0C 4R26L 1ZWIA 1J0JA 2XI9A 5JDSA 3HZKA 3T1WA 1T2QH 2R4SL 3FB8A 1OP5H 1YDPA 4ZAKB 3BP5A 1NLDH 1T5WB 3MJ9H 3O3UN 1RIVL 4MS8C 2JIXB 2BC4B 5IGXH 5JHLH 5CKGA 5I71C 4PJ9B 3X3GH 4HC1A 2I60H 5E8EB 1U93A 3G5VB 5JLZA 3MNWA 1EX0A 5ENWB 3CFEB 3MLUH 4O4YH 3C09C 1QOKA 5IWLC 2ORBL 5E2WL 1F8TH 4JFFD 2FBOJ 3VCLA 2DKSA 5HHXL 3HZYB 4YDIL 3BXNA 1QFWI 2CLVA 2YD4A 3BKCH 4Q2ZB 3IDJA 1AGCB 5JORB 3JWOL 3LN4A 5EOQL 3VFWA 2GCYB 4KI5C 3UTTA 5E9DB 3PWJB 4HX1A 4W6WB 5FAAA 1QQDB 2O5XH 3OKYA 3B2UC 3QNYA 4GG8B 3DVIA 5BS0E 1URLA 3CVIL 3IJHA 2CUHA 1MWAH 4GRMA 2PR4L 4F9PC 4Z18A 2BSSB 1DVFC 3O2DH 3IGAB 4OLWH 1KTDA 3QH3A 1ZT1B 1UG9A 2GY7B 4TOYH 2W0FA 1IAKA 2ZCHH 5T1DL 2XKNA 1FZKB 4ETQA 5I6XC 5IM7A 2BVOA 4JZJB 1D5ZB 1CDGA 2HRPH 4N68A 5JXAL 4AY0A 4OFYA 4OZGA 3BGFC 2YD7A 4TSBL 3F8UB 2V5SA 4FQXA 3VD7A 4OUOA 5T5NF 3HCVA 4YZFF 5F71A 1LE5A 1AFVH 2DD8L 4UQ2B 5DWUL 5DS8A 5D7IB 3CXHK 5I1CH 3JTTB 1AGEA 4PGEB 4U1HA 4ZO9A 3TIDB 3VXTA 2VSCA 5DQ9A 1RHHA 4N8PA 3PQYA 2OL3A 4ODWB 1JVKA 2PCPA 1I9EA 1VKXB 3QCVH 3PQYE 4H26A 5TFSL 2FB4L 4PJ5A 3D85B 5C7XL 2FR4A 3O4OB 1R24A 1W2KT 4DAGL 1NDGB 1WWBX 4X6DA 5SX4I 1NEZB 3RWIB 2CIKB 4IS6A 5D8JH 2VLKA 3TFKC 1TVBA 5TF1L 3IFLL 4PJGB 1IM9B 4X6DE 1BZ9A 4WTWA 3HB3D 5AAWA 1U3HB 4DW2H 2VLKE 4NM4L 3O6LL 4PJHF 3NFSL 3QHTC 3W9EB 4WNQB 4XHJD 1RZGA 4PJBE 4P4RA 3VFPA 3FN9A 1TFHA 2FJFA 5C0GB 2Z4QB 5EOTB 4JFQB 5EU5A 3EOBA 1A4JA 5C3TA 3TV3H 5H35A 1FG2B 4NZRL 3AFLA 3UO1L 1FSKB 2NX5A 4H88L 3SE8L 2B2XH 5EORL 2E9BA 1EXUA 2BDNH 2QHRL 1F90H 2VNCA 2NTFB 4YE4L 4PJAA 1I8MA 5DLMH 3MLWH 5CLWA 3L9RB 3QZWG 1D9KB 1VFOA 1G7IB 4HXAL 4WO4A 2VDKL 3EUUA 3E3QE 5JOFB 2ZOKA 5IHUH 5FYKU 1IGTA 4NBXB 4BFIA 2AEQL 4KXZH 3NZ8B 1H3TA 4XNYH 2WV3A 4MSWA 2B4CC 2AV1A 4WU7A 5F7MC 3ZZ1A 2VXQL 3VWKA 1KG0A 4WI9A 4WRLA 4Z7UA 1E4KC 2APFA 2R69L 1G7PB 4HZLA 1U8IA 3QUZB 4JANA 4FG6C 4XAWL 1EHXA 1BLNA 5L7XH 2ICCA 4P2RA 4UB0H 4QOKD 1MEXL 2XT1B 4NIKB 3HS0B 3GUTA 4LIQE 3QIBD 2BNQE 5DMGD 4LDLB 1DUZA 1N2RB 4I1NB 4HS6B 2JJUA 1P7KA 4MJ6B 3KVQA 3QQ9C 3QDJA 1EK3A 1F3DH 2G5BB 1BREA 2J8OA 3QDJE 5BVJB 1WIPA 2N1KA 5DEGA 4Y89A 1UWEH 1WTLA 3WUZA 4P3DB 5CLTA 3P4OB 3OKLB 4FQQA 1ZWIB 3MLVH 1B0RB 3QWRD 1JI1A 4K2UL 1MRDL 3BP5B 3IXTB 2PN5A 1QO3A 4LASL 2RAMA 3QQ4A 4JGMA 2OTUB 2Q6WA 1FGNL 2CPCA 3DSFH 1G9EA 1PSKH 1VFUA 2H45A 5FHAL 2E8YA 1NGPL 4HWEL 5DUPL 2ZZUT 3MUJA 1YPZE 4NNYA 5DA4A 5HDQL 1RJLB 5EWIL 4LVHB 5JLZB 1XGPA 2A38A 5MEQB 1GIGH 4G8GA 4N8VB 1X3DA 1Z9OA 3GM0A 3ZKXC 2LV4A 5FO8B 1A0QL 1MCNA 3VCLB 3MR9A 4M7JH 3LEYL 3P40A 4G8GE 3U0TA 1HE7A 5TQ2L 1L7IH 4DGVL 1IC7L 3B43A 3KPQA 4NFDA 4U6XB 1MHHB 1RHFA 2CLVB 4GBXA 4Y7MA 1CU4H 4BKLA 4S0TD 4YX2H 1CQYA 3K74B 1UKSA 1S9XB 5JZ7D 3M45A 5DR5L 1EERB 1W8NA 2MKWA 3LN4B 1N8ZA 1A4KA 5TQ0H 4NC2B 3SBWA 2DLGA 5GGTH 1Z9MA 5BS0B 3HUJE 4DTGH 1IGYA 2Y36L 3UROR 4W6YB 2Q3AA 3QNYB 3IDYB 3K1DA 3BQUC 4WW2F 3Q3GA 3LCYA 4LSRH 3HC3L 1VACA 3AS0A 4XZUA 3VH8A 2VLJD 4NHUA 3VGHA 3S5LB 3D9AL 3HE6C 3ILQD 3MPCA 3UMTA 3QH3B 4MQXC 4NYLA 1ND0A 3O41A 4HUVA 2YK1L 4N0YH 1IAKB 3CU1A 2IALA 3HLAB 4NM8L 2Q8AH 2ICES 5CJXC 1Q1JL 2Y4SA 3QHFL 3OJMB 3PDOA 4O58L 4MXQC 2ZJSH 3DMMD 4OLVH 1TETL 3OL2A 2NY3B 3CLEH 1BBJA 4U1GB 3AREA 2XQYG 2AJ3A 4B5EA 4YPGA 4GRWB 2QL1A 4M48H 2NLJA 4MAUL 1CE1H 4Y4HD 4ZS7L 3K8KA 4HS3A 1A6ZB 1JTTA 3WFCL 3HC4H 1KJVA 5SV3A 2D03H 2YZ1A 1QRNA 3HCVB 4I3SL 2Y25A 4CVXA 4RGMC 3BD4A 1CBVL 3BH8A 4KY1L 5DS8B 1NAMA 2IPTL 15C8H 1U8JA 2ZP0T 4MNHA 1HILA 2AJUL 3FT2B 1AGEB 4U1HB 3P73A 2YRPA 1OP3H 2VISB 3X12B 4X9HA 3VXTB 1ZOXA 3MJ9A 2QADC 1RHHB 3F7YA 3H3PH 5F9JA 3PQYB 3EYOA 3C6LA 4G6FB 4GAGL 4OGAC 2DQIH 2PCPB 4M5ZL 5IFAH 3F58L 4F57H 4YXHH 2IG2H 1J0ZA 2H32B 2FR4B 4V2CB 4NKIL 2CR3A 4UUJA 3INUH 2YR3A 2VE6A 2X70B 3FONA 4OT1L 3WDJA 4JM4H 3QEGL 4QNPF 2HG5A 2VLKB 3O2VH 3QXUA 3VFOB 1BZ9B 2X9WA 4PJBB 2P42B 1HN1A 1F97A 4FFYH 4J3UA 1ZLSH 1CIUA 1SQ2N 3WFHA 4BQCA 2OTWA 1GGUA 1RZGB 2DMCA 3VFPB 1QFUL 2J6EH 1WCQA 7CGTA 1F6FB 4JZJC 4D0DA 4Z77A 3RIAK 4POYA 3P9MB 1UQSA 4I18B 3MBXL 4EN3A 4JO2H 2XZCH 3F65A 1MWAA 3KPMA 1E4WL 1RZJC 3DRTA 3HZVA 1I8MB 3FOLA 4M5YH 3ETBF 4KFZC 4PJIF 1XGRA 4NN5C 4OB5H 4WO4B 4YAQB 1YY9C 2OJEB 4KRNA 1IQDA 4P0DA 2ZOKB 1IGTB 2BOBA 3P9LA 5CP7B 3RVTD 1Q9LA 1A6UL 1E27A 1R5IB 5E1AA 2FIRT 2ED8A 2HYMA 3RL1A 5J0BA 4QRPA 4U4BA 4M43L 2FDBP 3ARBA 3UYPA 1KG0B 1DLHA 5E00A 4E9LA 1OTUC 5ISZA 3RHWK 4DVRL 5CD5C 1FL3A 4K23L 3H0TB 5EN2A 1G9ML 1YEJH 3QUYA 5ISZE 1H8SA 4ZD3L 3RL2B 3U0WL 2BNQB 4JN2B 4P2OD 3HE7C 2ZOLB 4U7SA 3O4OC 3FTGA 1SYSA 2A9NL 1DUZB 3KJ6L 5I1KH 4HK3N 1K2DA 1ORSB 1OGTB 5JQ6L 3FO0L 2O5YH 3QDJB 3TYFB 2DQGH 2EDJA 1T03L 1WWAX 1R0AH 2XTJE 1NCDL 1BD2D 3EO1A 3QG6A 3C2SA 4M6NL 5DEGB 5K9JL 1V5JA 2J3SA 4Z9KB 4NDMA 4BZYA 4EIGB 2CK0H 1RUKH 4NQED 4R3SA 4KU1A 3GMLA 3LKOB 3DURB 4MJIA 3V6OE 3EYQC 1QO3B 1VERA 3Q2CA 4ZUUB 3MGTB 2Y6SC 3QQ4B 1U8LA 1YPZB 2Q6WB 4MJIE 4JFPA 1FNGB 2XKUA 4N0CD 4M1CD 1FE8H 1I9RH 1W0WA 3QO0A 4U6VH 3TT1H 4WW1B 5BZDA 4FABL 4AQ1B 1B90A 1GGIL 3BZ4A 4MMXC 2OM5A 1NMCB 3OXSB 1FCGA 3RTQD 4XB8A 3MR9B 1HXMA 4MA3A 3KPQB 3BP4A 4UV4L 5H8DA 5HYIA 4M4PA 3GFUA 5D71H 3ARDB 2PO6D 2V5TA 3NPSB 4EI5A 3HUJB 5CZKA 1MJ7L 4L3EA 4ODVL 3L3IA 3O6ML 5EIIB 2WBJB 2ZNWA 5TPWL 4C54A 2JKXA 3FQRA 4L3EE 1OT2A 1NKOA 1UWGH 1VACB 3CD4A 3VH8B 4M1GL 5DJ2A 4R90H 1Q0XL 3AY4A 4Y4KC 5M95B 1FNHA 4OCRL 4L4TD 1EVUA 4PD4K 4G7VH 5D2LB 5D96B 1F6AB 1G9NL 1LO0L 3JWDL 5JPNB 4NGHL 3RUGF 1ND0B 3O41B 1HQRA 2LVCA 2IALB 3OXRA 4JG0H 4LU5L 3EAKA 2E27L 5DJ0B 2CK2A 2AJVH 3FFCD 3PE9A 1N0LA 1FBIL 4W4OA 2VDLL 4G43B 3U36B 3WIFA 1NL0H 2LTQB 4FQJL 4LBEA 3I2CL 4NZTH 3EFDH 1IAOA 4KI1A 4KRPC 1BBJB 2PTTB 4MQSB 2X4QA 3TBWA 4YPGB 5IJVA 2ENSA 2P24A 2L7UA 4WTZA 1SVCP 4HS3B 1VSCA 1YEIH 5BRZA 4LVHC 3B5TA 4ISVB 3HPLA 2PNDA 2DQHH 3BZFB 1I3RA 1S5HA 4YUEL 3FQXA 4DOHE 5BRZE 1FNAA 3MLXH 1AO7A 1T5XB 2VDML 1EEZA 4JG1L 4L4VE 1DBMH 4HEME 2A6JA 3GRWH 2CXKA 2GT9A 2V7HB 5DSCA 1ZGLP 3NCJH 1NCBH 4RBPK 3UZEA 3QDMA 5MENA 2DJ4A 4OCWL 2AERT 3QCUH 2VLRA 5KS9A 1DQML 1N6UA 1FO0L 1W0YT 4AENA 1MCFA 1NGZA 5C07D 1CE6A 2DBLL 1HOCB 4TQEL 3GKWL 3C6LB 4G8EA 2F19L 5DFWH 1HDMA 2QQNH 1G84A 1XIWD 1MRFH 4NO2A 1N26A 5T3ZL 1KJ2B 3R06B 4KRMB 4MHHG 1KF9B 1IGCL 5ESAA 2EDFA 3NTCL 1J8HA 4UUJB 5I18L 1G1CA 2VE6B 5HSFA 4E42B 5ANMA 5JOPE 1D5IH 5AZEL 2I24N 5CUSH 4J23A 3QWOB 4AIZA 5FXCH 3VG0L 3T2PA 3GHBL 4KKCC 3V7AG 1T66C 4IRZL 4E41A 4H1LH 5IQ7L 2F5BL 4ETYA 3MX0A 3VRJB 1DSFH 4E41E 3SE4A 5GGTA 3ZSSA 4OGYL 2DL2A 3LS4L 4J3VA 4EN3B 1PYWA 5I0DA 1MCWM 4Y8AA 3T04D 2KZWA 3EDJA 1MWAB 4NRZA 1ZHLA 2MCPH 5JPMA 3HZVB 4FQXC 3BWAB 5ACMA 5A1AA 1FHGA 2YD5A 1NANI 2MQ3A 3PV6A 4EEEA 3LQZB 1XGRB 3C9NA 2WQ8A 3CFCL 4W4NA 4WDIB 1IQDB 3PXHA 2CJUH 3P9LB 5D1XA 2YOCA 3CFIC 4QHKI 4RX4A 3TCXA 3OF6D 1MQKL 3SDCB 5DRXB 2OMNA 1E27B 2WP3O 4NJAL 4WHDA 4U33A 5C09A 1KGCE 1T0MA 2AEPL 3KPNB 3TWCH 3VFRB 5B38A 4PR5B 4AH2B 2V2XB 1CLYL 1BOGB 4KAQL 5C09E 4RRPG 1X5KA 5E00B 5ISZB 4NFBA 1CLOH 3IKCA 2PYEE 4PGZA 4RGOL 5EN2B 2HP4A 3QUYB 3G5YA 4QRSB 3GMOA 1DBAL 3BGMA 4DQOH 3OKOA 1RURL 1NDMB 2NY4D 1J8KA 2KUTA 5GRJL 1UM6L 1R6VA 3VFVA 5ERWA 1XR8B 3FTGB 3PWPA 2XV6B 1YNTA 2R0LL 1HZHH 5DURD 4K3JH 2XTJB 4J6RL 2CH8A 5DRNA 5ACZA 1MUJA 2PYFB 5HHPA 1I4FB 3QG6B 3ZE0F 4D2NA 3I6KA 4X6BB 5I19H 1RUAH 1TQCC 4PJ7F 3V0WH 3QJHB 3TO4A 4Y5VA 4JKLA 5D5MF 1NMAH 4HWNA 4KGLA 3VDCA 1YJDH 4MJIB 1RIHL 5D72H 3U79A 1U8LB 5HDOA 5HGBA 2FX7L 2CRIA 4PRDA 3FRPA 4PV9B 2HFGL 2DQDH 3E3QC 3G9AB 1Z6JT 2R0WL 4XPTH 1YMME 4OD2A 4WO4C 4BQ6A 4IDJL 3FQWA 4DGIL 4UIKL 5BZDB 1IMHC 4MVBD 5DDHA 1UEMA 3QAZB 3BYYA 4Y2DA 1A14H 3BZ4B 4LSQH 3X14B 5JTWA 2X10A 4KMTH 3ILPA 2NXZB 4L8SA 1HXMB 1ZSDA 2V9RA 3LKNA 4H5SA 2AQ1A 4XVTH 2J6EA 4MA3B 3VWKC 4DZBA 4LRNH 2OK0H 5K9OB 2X1WL 5C6TH 4YBQC 1L0QA 3CNKA 4EI5B 3WD5H 4XWOD 3IVKA 1A2YB 4LSTH 2NY7L 4L3EB 2MSPA 3L3IB 1QNZH 1MJ8L 1PQZA 5DHYA 5GGSA 4PFEA 4WFED 4DJMA 2AJXH 1MHPL 3ES6A 3GHEH 2XWTA 2BVQA 5DJ2B 1N64L 1QTYT 1JV5A 3OB0H 4Z8FL 1JPGA 4PRNA 6FABH 1ODAA 3QR2A 4L8BA 4LEOB 4JDZB 1JNNL 4R6UA 1WZKA 1UENA 4HF5L 1DL7H 4JPIB 3ZO0A 4FMFA 3OXRB 1JTOA 3QPXL 1LEIB 1KEMH 5GHWL 3X17A 1JYWA 1QA9A 4Y1AA 1FL6B 4OF6A 1UJ3A 2WK2A 4JM2A 5KJRL 1S9WB 1KYOJ 2DQTL 3V6FA 1U8OB 3WIFB 5HD8C 4Y1AE 4LBEB 4Z7VE 4FQLH 1C5CH 3QEHA 3SDXF 2X4QB 1RI8A 2E9WA 3G6DL 4HPOL 3SEPA 3TBWB 5IJVB 1GOHA 2H6PB 1HHJA 2P24B 1NCCL 3RGVA 3L7FA 2FGWH 3LQAC 1JP5A 4DOHB 5BRZB 7FABH 5CIPH 1NFKA 3K3QA 1F4HA 3SCMD 3V7AE 1JZ2A 1DVFD 1QD0A 1ZTXL 1I3RB 1I1FA 2DIBA 3KLAA 4GS7B 4L4VB 3EDEA 4WJ5B 5HGGS 5F7WC 1EEZB 5EIVA 2XA3A 1XF1A 4OBRA 2NY6C 1H3WM 3RNQB 2A6JB 4KTDL 5T1LA 4P46A 2VDRL 4GBXC 1CYGA 3PWLA 1B2WL 1VGEL 3C5SB 1RULH 3GSOA 2AJYL 5FOBB 3NPSC 4XPHH 5JIPA 1CFBA 3SBWC 1NGZB 5E5MA 3RIAF 5EULV 3O6FD 4JKPL 2WUCH 2DL9A 3C5JA 1BWWA 3GK8H 1FAKT 5EU6A 2FEDD 3EBAA 1AC0A 1LO3L 1Y6MR 5A16A 5EU6E 1DQJB 3Q6FA 3TCLA 2C7UB 5TGBA 3DXAA 4U1LA 1VGKA 2COQA 3C60A 5I1EL 3QDGA 1E0OB 2NYYC 3MXVH 5J1SC 5I2IA 4GXUN 3DXAE 4JY5H 4O2EB 4P2YA 1FYTE 4ODBD 5FUCC 3T0XA 1AGBA 2W9DL 4GFTB 3VI4E 4E41B 3EYUL 5FM5O 1ZVHA 4V2BA 1GC1H 1AXTH 3BP7B 1JF1A 4I48A 4TYUA 4XP1L 4D9RE 3RHWF 4HKXA 1VPOL 4X7TA 1WFUA 4DCQA 1OAQL 5GIRB 3C8KA 8FABA 1NUDA 4R26H 3AREC 2VR9A 1CDYA 1P7QD 4BQ8A 2ZWLT 5I1IL 2R4SH 4Q58C 3MRIA 4R4BA 3CMOL 2Y5TA 3KLDA 5E1HB 5JPMB 5C0BA 2BRRH 2ZUXA 1OCWL 4CJ0A 1RIVH 3MRBA 3C9NB 1WBYA 5C0BE 3JV5A 5GXBB 3TFKD 1TDQA 3OPZL 4P2QD 1IM3B 4LP4A 4H25A 4LSSH 5D7JA 2Q20A 2W92A 5IVXA 2W60B 25C8H 1T0MB 5DRZB 5H94A 2ORBH 3RBGA 5IVXE 1RUMH 2PYEB 5HHXH 4YDIH 4N9GB 5FOJA 2Y1VA 3C6LC 2WBWB 5FKAB 2NZ9D 4XMKH 2I9TA 2B4CL 3JWOH 3HG1D 3OKOB 4Q6IA 4QXGL 2PF6A 1T1YB 2VAAB 5EOQH 3LPGA 3MREA 3RVVC 5GS0C 2J8UA 3VFVB 3FO1B 1UM5H 3HC0B 3CDCA 1BEYH 1YNTB 1BFOA 2B1HL 4NUJA 3UX9B 2F15A 3HRZA 4ZSOA 3QFJA 3CVIH 3O4LE 2PR4H 4ZSOE 2MQ0A 2NQCA 3GRWA 5HHPB 4U1SB 3TIEB 1WAAE 4OCLC 3AS3A 3BIKB 2R15A 2R23B 2OI9C 5B21A 2UWEF 1WEJL 2VZSA 5T1DH 4Y5VB 5IB4B 3A6OA 3DIFA 3QUXD 5L8KB 4FG6D 5FA4A 5AG9A 3MNZA 2X7LB 4QHNA 4RMQA 2D7TL 2GSGB 5HGBB 1BFSA 1YMMB 5MHSE 1FFPA 4PG9A 2NNAA 3HRPA 1L6ZA 1XF4B 4KHXL 3WHXA 3VXOB 4P5TA 4R4NC 5GS2D 3BEWA 4TSBH 3QQ9D 5DDHB 2HJFA 4QO1A 5T3XL 3QWQB 4LCWA 3SPVA 4CVUA 2YSSA 1FFQA 1LNUA 2X1XR 1FVDA 1KNOA 3Q6GH 4H1LA 2UZIL 4LCWE 3LKNB 4MCYB 1NCTA 5SWSE 4ONGL 3ARBC 2DD8H 4DZBB 3KG5A 5DWUH 5E95B 4JRYD 2F53E 3N1FC 1CIDA 4MB4A 5EZLA 1KPRB 4X5LA 5T3XD 3S96A 4KQ3L 4Y16D 4NKMB 3VGEA 3TVMD 2ICWI 2IPKA 4Y8DC 4TTDC 3U9UB 3FB6A 4NZJA 1Q9WA 5GGSB 2DS4A 3WFBH 2IC2A 3ARXA 3CU7A 3WKNA 2BVQB 2FB4H 2DQJH 4KROB 2XTJC 4J7RA 1JV5B 5C7XH 4MJ5A 4KK5C 1TCRA 4XPGL 4ZNEE 5DD3L 1MF2L 2R1YA 2AK4D 2FX9L 3UAJC 4OCSL 1BJ1H 3F5WB 5TF1H 3IFLH 4YQXH 3KYKL 2X4SB 1FNEA 3FZUC 5JXED 2DM3A 1N3NA 1QA9B 4J3XA 4NM4H 4Y1AB 4Z7VB 1DUYA 1UJ3B 3NFSH 1DQLL 4JM2B 4LSVL 4MX7A 5IESL 3V6FB 4K7PY 3VXRD 3RVUD 3TH3T 2VUYA 2R4RL 3QEHB 1GAFL 3QNXA 3CH1A 3BQUD 1WICA 3O3DA 1HHJB 4J3SA 4NZRH 3UO1H 3VJ6B 3MRNA 3J8F7 1X6LA 4H88H 3SE8H 5EORH 2QHRH 2VH5L 4WGVB 5IIEA 2YN5A 5LGJA 4YE4H 2ZG1A 3QAZC 5GGRY 1EHLL 3KLAB 4MQ7B 3VXPA 3HE6D 3VWJA 5HYJE 3NCMA 1X5XA 4PGBB 4HXAH 2R56H 5SWQA 3BOVA 3V0VA 4U1MA 3NMEA 2EDRA 2AEQH 4OJFL 2B5IB 3T4AB 2RFXA 3W0WD 1WZLA 4MXQD 4FZ8L 4EI5C 4X80L 5FA3B 4ZAKD 1YUHB 2D7MA 2VXQH 2BY3A 2VL5A 3VFGL 2JIXD 2JB6A 2R69H 4Z0BL 5M94B 4EUPG 4PJ9D 4XAWH 5IOPB 5EU6B 5FB8B 4U1IA 4C55A 3QUMA 2HWZL 3E6FA 1Z0NA 1XF5B 3BUTA 3TCLB 5TGBB 3DXAB 1QHOA 4L8DA 1FYTB 3DV6B 5FKPB 4AIOA 4NJ9L 2EIEA 4HBQA 2X40A 4L9DA 3WLBB 3GGWA 3QIUB 1S5IL 5ETUB 1CGSL 5K33A 1MHCA 4Q9QL 1OAUL 4PV8A 1H15A 1WBXA 1TZHA 4W4OC 4I48B 1CDHA 1HKLL 2QADD 1U41A 3CX2A 5EU4A 4DCQB 5E9DD 4J12A 4OGAD 1CQKA 8FABB 3RWFB 5DT1L 4N0UE 4OCMC 4LQFL 3RWHA 2Y9RT 4IOSD 3ZSTA 4LARL 1D6VL 4M6AA 3D39A 4K2UH 5JIKA 1MRDH 1YEDA 2VB5A 4LASH 5C0BB 3V4VL 4F9LA 1DQTA 3MRBB 1FGNH 3CX5K 1S8DB 4GS7C 5FHAH 1WBYB 4POUB 1NGPH 5DUPH 3LN5A 1R5VA 4HEPG 3S3JA 5JW3L 1JGVH 4H25B 5HDQH 2EKSA 2HTKC 1A3RL 2FX8L 2IADA 5D6CA 5D7JB 5EWIH 4BFGA 1UM4L 3G08A 4X8XA 4YK4C 3SKNA 1E4XL 1RZJL 4JFEB 3OZ9L 5H94B 5HDBF 5L8JB 3S37X 3GMPA 5TQ2H 2HJLB 4ORGA 4PRPD 4DGVH 1IC7H 3C6SA 4HK0B 2AXFA 1UA6H 5DD6B 2GTWB 1TPXB 1XGYH 1F42A 2X4OA 2I9TB 2FD6L 3CVHL 5DR5H 4GG6E 4J8RA 1MSPA 3LAFA 1GGBL 5CIPA 2OR8A 4L5FH 3ARGB 4B41A 4G6AC 2Y36H 4HUXA 1BFOB 3O4LB 3OB8A 5GRVK 4LLVA 4EVNA 1YY9D 2AV7A 4ZSOB 5FCSH 2F74A 3S37L 1T0PB 2WAHA 2CLZA 2Z31C 5ADOL 2ITDB 4C4KO 4HUUA 1OTUD 3SE4C 2HLFC 1ZHKA 1MOEA 3ULUF 3X11B 2ADIB 4NM8H 3CC5B 3I3EA 3DIFB 4IJ3B 4KJWC 2OZ4A 1Q1JH 3CUPA 5ESVA 1F4XL 3QHFH 4ZUSB 4O58H 4KKBD 3HE7D 3MNZB 2FH8A 2DI7A 4C57C 4R7NB 4XCEA 5IG7A 2DJUA 1TETH 1FFPB 2NNAB 2OXHA 1OGAA 3QEUA 2NR6C 4MB3A 4P5TB 4S0SD 2EIDA 3CX5J 4K07A 1RUQH 1OGAE 1U3HD 4LCWB 2ZSWA 5D1XC 2C4FU 1FFOA 3KWWA 3WFCH 2AKRB 5SWSB 3TF7C 1LNUB 1OWRM 1FVDB 1KNOB 1TVHB 4H1LB 5T1MA 4I3SH 2EKJA 3T0VA 3NIGF 1ORQA 2F53B 3QG7H 5IVZA 3L5XL 5CJ8A 4S1QH 2OQJB 4KY1H 3VRLE 3BAEL 1MFNA 3QQ3A 4J4PC 2IPTH 3BSZL 1EVTC 4M1DL 3EYQD 2B8OT 4HHAB 4ZTOL 2Y6SD 3DX9B 1MFEL 3FB6B 3MA7A 1JGLL 5CEXB 2JCCE 4QHKJ 4LLWA 5BQ7A 3QSKB 3JV6A 4OF8A 3REWB 5C0JB 4GAGH 3ULVD 1BHGA 4YZFE 4M5ZH 2O61B 3L5WA 3F58H 4JY6A 4BSWA 4G6JH 4JQVA 3RPIB 1XGQA 3N1PC 4NKIH 1JNLH 3KYMB 4HW6A 5BZWA 5IB3A 3MLPA 1YZZA 1LE9B 1FJ1B 2E7MA 2C5DC 5CKAA 2CGRL 3IAPA 3TO4C 4Y5VC 2DMBA 3WL9B 3R0NA 5T1KA 3O11A 3LRSA 2Y06L 1QFPA 1UVQA 1LEGA 3AAZA 3KPSB 5DD5L 1JYNA 2D9QB 3PDDA 3TJEL 3NAAL 2DWEB 1WWCA 2G9HA 3MRNB 4OCXL 3KPLA 1ADQA 3MRCA 3ZDXF 4PJHA 1J1XH 4PJDF 5HYJB 5IIEB 2X1QA 4PJ8A 5SX5K 4H8WC 3KR3H 4Y2DC 4U0RC 3VWJB 4R0LB 1E4XI 1K6QL 4WFHE 1ZLUK 1FV1A 4L8SC 2WIIA 4IOIB 3V0VB 4Z5RB 4U1MB 2R1WB 5FF6A 1KCRL 5MP6L 3CSYA 1A6UH 1ZANL 3EFFA 4C56A 4GW1A 1FQ9C 3DLQR 3FL7A 4YHIB 4XCCH 1S7WB 1QKZL 2K1MA 4KRPD 1EUTA 3ULSA 2BXYA 4P49A 4K23H 1UGNA 4KPHL 1F5WA 4HV8A 1G9MH 2CO6B 3H3KA 4U1IB 5FYLL 4Y5YA 4ZD3H 3U0WH 1SY6A 4RA0C 3E6FB 4OGXH 4EDXB 1K85A 2UZXB 1SM3L 4PJXF 2BHUA 3CDGA 2A9NH 1R3LB 4YGAB 3KJ6H 5GZND 1MVFA 3F6LA 4ZQKA 5LQBL 5JQ6H 3FO0H 1T03H 4G42B 4Z7OF 4K3EL 1MHCB 1ZGLM 4PV8B 1H15B 3RZCA 4KJQD 3SQOL 4M6NH 5K9JH 2HVKA 4N0UB 3LKSB 4G8IA 3UTTD 1EV2E 3UJTL 1KLGA 1AGDA 4XCYB 3RWHB 3MRRA 4HIIA 2EDDA 3JZ7A 2GJ6A 3RGVC 3D6GA 1T1XB 1NPUA 4XC3H 5FYJL 4JRWA 1KIRB 2FRGP 5DC4B 2ZNXA 3N06B 5I76A 1AP2A 1TZIA 3JVGA 4I8DA 1R5WA 1OB1B 4RZCA 4FABH 4Z0XA 1NH6A 4P46C 1VFAB 3UTQA 1NANH 1GGIH 1A1NA 1Z9LA 4HAGA 2B5IC 5IMLA 5C86A 4G7YL 3NABH 4OM1L 4TSCL 3SJVE 4LMQE 3C6SB 3KPRA 1A9EB 2WUBL 2NY3D 4UV4H 2P5EA 3PWNB 4GG6B 4OFYD 2ADJA 2X4OB 1BBDL 3TJHC 1B88A 4J8RB 1MJ7H 4YEEA 2AJZA 5GRZA 5TPWH 4Q7DA 4HUXB 4PLOB 4LLVB 3C60C 2AV7B 5ADPL 4U1NB 2OL3L 3QEQA 4OAWA 3OJDA 1X4YA 1KN2L 3UP1A 4M1GH 4KDTA 2Y07L 1BF2A 3QEQE 4O51A 4OCRH 2VUOA 2CLZB 4IIQA 3JWDH 1TMCB 2W65A 5CJ5A 2B1AH 3DRQB 1ZHKB 1N4XL 3PQYD 5DO2D 4MA1C 3SE9L 3ZT7A 1FZOA 4K7FB 1AH1A 1NGYB 4LU5H 2E27H 5C2UB 4GUPB 5ESVB 2BNUA 5BVPH 1FBIH 2D7PA 5GGUB 4G6ML 4S2SA 5D7SL 3A6CH 4XCEB 5IG7B 5HI4D 3VU2A 1GVIA 4JDVB 3HNTL 3IDXL 4FQJH 5EC1A 3WN5A 3I2CH 4OLYL 1OGAB 2VLKD 2NW2A 4NRXA 4Z78B 4IRSA 5FGCE 1FFOB 5D7JC 3GDBA 1LP9E 2FZ3A 1X44A 3L3KB 2W0PA 2DTML 3UBXG 2NY1C 4NQDA 2BJMH 4LNRA 1AHWB 5I1GH 5CBEB 1E4JA 1QZ1A 4NQDE 4WV1A 3B9VA 1YN6A 2H9GA 1X6NA 3B9EA 4TUOB 1A7PL 2JCCB 1TPXC 3OG4B 2NX5D 4K71C 4OCWH 5F7HA 4WFFE 4Q6IC 5L6YL 1DQMH 1FO0H 5CSZA 3QO1B 4RNRB 1UH3A 2DBLH 4LLWB 4TQEH 5DEFB 4TNVK 2F19H 3V52L 3OX8B 4NUGL 4PRAA 4WO4D 4Z7NF 1ZMYA 1J0YA 5T3ZH 3K2UL 3MJ8A 1I1YA 1MRCH 2CXGA 4LIQL 3WSQL 3NTCH 5BZWB 1A1MA 4HJ0D 5E2VL 4WWKA 5B3JF 5AZEH 1I1AA 3DBXA 3MCG1 2BFVH 2BVPA 3GHBH 4LSPL 4YBQD 3O3AB 1U91A 1MCOH 4LLYA 3QXAA 4IJ3C 4N90E 1D5XA 5DJAA 5T1KB 1OAKL 3I02B 3AROA 3LRSB 4P2RD 5IQ7H 2F5BH 1OSPL 5A2IH 4W6XB 4IOFC 1KIPB 2VLJE 3MRDA 4OGYH 3LS4H 4IHOA 2Q87A 5D93C 3I50L 3IRPX 5F9WB 3GKZA 4P5TC 2W0KA 3KPLB 5GQBA 4WI7A 5C71A 3QDJD 2JJWA 1G6RA 5C6PB 2HH0L 4MD4B 3LB6C 1OAYL 3S35X 1V8HA 4OTXH 3QB7C 4X4ZA 4OKVB 3KNBA 2YMXL 1FV1B 3AC0A 1QSVA 4G9DA 1ZA3B 5EUOA 1JRHL 3BN9C 4MNQA 3TGXA 5FDWA 1HINH 1G0DA 3RVWC 4QF1A 3LQAL 3IT8D 1HCFX 1MQKH 4QT5A 1K4CB 5EUOE 3ARUA 2AEPH 4GW1B 2VAJA 2IH1A 5FM5M 4M61A 3DI3B 4HIJA 4MDIA 1CLYH 3GMQA 5C0ND 3HFML 3MOAL 4JHWL 3SDDA 4GW5A 4HV8B 1XGTB 4JFHE 4RGOH 4B7LA 1AE6L 3S35L 2X6MA 1UC6A 1DBAH 5ELIA 1MLBA 1RURH 2R1XA 4F7MB 1WZMA 4LDOB 1UM6H 3ZKND 4G8GD 4QRTA 2X89A 2OCFD 5E7FA 4TUJA 3DECA 2MHAA 1ZE3C 5H37H 4M93C 5HXMA 3S4SG 4J6RH 1KIUA 4XH2B 5JO5A 4HLJA 3ARDD 2Q8BL 3RZCB 1B6DA 4P3CL 2AS5M 1JZ6A 4UOJA 3DETC 4G8IB 3VXQA 3ZKMD 1P5VA 3C2AL 1AGDB 3FKUS 1B6UA 2YBRB 3MRRB 5KVEL 1RU9L 5EIQA 1RIHH 1FC1A 3P0VL 5F93C 4Q0XH 2PXYC 1JHLL 3LEVL 2HFGH 5I76B 2R0WH 1I3GL 4GW4A 4IDJH 2P8PA 4RZCB 4UIKH 4BM7A 4DGIH 2EDEA 3UTQB 1UZ6F 4PLJD 5DJDA 3CZJA 5I66A 1A1NB 3SJVB 3I75A 2ICEA 4ZFOA 2XPGA 1YJDC 1TLKA 4PS4L 1A7BA 4XTRC 4X6CF 2VZUA 4H20L 4BFEA 1NAML 1J05B 1JI2A 2BY0A 2AP2A 3G6JF 2N7BA 2E5EA 4JFDA 4WENB 2DLEA 5B3NA 2NY7H 5E2TL 2AJZB 1MJ8H 5IBLC 2GTZA 2EE9A 3MJ9L 4UDUB 4CADB 4DZ8A 1S7SA 3QEQB 3ZHDA 1ULVA 4WI8A 1CG9B 1MHPH 1CD1A 4OAWB 5IGXL 5E6IA 1N64H 3BHBA 3NA4A 5GS0L 1PKOA 3IJSA 1VESA 1KB5H 4O4YL 4IIQB 1JNNH 4LKCA 2W65B 3TT3L 3QIBB 5J13B 5C0AE 1J11A 4HF5H 5KW9L 1DTUA 3MBEA 3C6LD 4ZOEA 4YDJA 3QPXH 4XPAL 3IDGB 3WNPA 5GHWH 3U7YH 4S2SB 5GS0D 5DK3A 5KJRH 4GAYB 2DQTH 3GMRA 3BT2L 3TBTA 2LFGA 1FN4B 2CDFB 3RUGA 5EC1B 1MIEL 5EA0L 4F9LC 2MTPA 1NBQA 2EZ0C 2MQCA 3G6DH 4HPOH 5FGCB 3RUGE 2FWOA 1LP9B 1NCCH 2O5XL 2EH8H 1M1SA 4IRSB 3OGCA 2R0KH 4UAOC 3OAYK 1ZTXH 4YDLB 4X7EC 3PDGA 3ARVA 4Y4FA 1JWUB 1OLZA 4HCRH 4OLUL 4POZC 1G7MB 4LFHD 5E8OA 4P57B 3GB7A 4KTDH 3B4NA 4WV1B 2DM2A 2VDRH 3S36H 1OAXL 2H9GB 4X0KB 5D1QA 4EN3D 3MGAA 1B2WH 1VGEH 2ZCHL 1FRGL 2VKWA 2AJYH 4XC1L 1CXKA 1HIML 5CSZB 2I9LB 3MMEB 3MSPA 4JKPH 5I0ZA 3MRQB 1CWVA 1II4E 3DYOA 5F3HB 1A6VL 4BK4A 3MJ8B 2Q76B 3EO0B 1NBVL 4OLZL 1IGML 1MAKA 3OKMA 3SDCD 1LO3H 5C2BH 2ESVA 3IDIB 3DUHA 3K7UA 4QRPD 2ARJB 5FGRA 1ETZA 2ESVE 5BCAA 1I1AB 2H2PD 5ISZD 4P23A 3DBXB 1JWSA 4QHUA 4A2MA 2BVPB 2W9DH 1U91B 2NMSA 4LLYB 3QXAB 5DJAB 2V2WA 1EJOH 3QUYD 2YUWA 2VLJB 3IETA 2EDWA 1YNLL 1VPOH 3SE3A 1OAQH 2D31B 1C08B 3ARTA 3RX5A 1RZIA 4I2XA 5C0CA 1IEBB 2P8MA 2XTJD 4KKNA 2A6KB 2DQEL 3FB7A 4C59B 5I1IH 1RJYB 4OZIF 4I2XE 3CMOH 4KK5D 5C0CE 1CGVA 4G9FA 5L88H 4TTGA 3MRPA 3OHXA 5AAMA 3KNBB 2JJSC 2RCSH 3ZE1E 4G9DB 2BSRB 3BISA 4G9FE 3OPZH 1JJUA 5EUOB 5FDWB 2P8LB 4V1DE 2NCMA 3LS5L 4Y4HB 3EZJB 4PTUA 2FO4A 3SY0A 4DK6A 4JPKL 4MJID 1CZ8L 3FT3A 4M61B 4HIJB 4MDIB 4K7PH 3SO5A 1GCFA 3SDDB 3N1GC 1OF2B 4ONFH 2GFBA 1NGXA 3UJJL 4GW5B 2Z8VC 3U4EB 2B4CH 4QXGH 1F4WH 4WI6A 1P2CB 4QRTB 3VFTB 2BDNL 4TUJB 3BH9A 2MHAB 5INCA 1AY1L 5KSAA 2VDNL 2I07A 3KLSA 2ITCA 3D69B 3MA9H 3NH7H 4EI5D 5E4EB 2H3NA 2C4XA 1FVCA 5LGHL 4L3ED 1FO0A 1WEJH 1LO5B 3O3BB 3WO4C 3MNVB 1IL1A 3IDMB 4PJEF 4XVSH 3K81A 4YLQT 5HI3C 4PJ8C 1HHKB 2D7TH 1EFXA 3LPWA 5T3ZE 2XZAL 2YA0A 2OMBA 3S7GA 2XG4A 4M9PA 4KHXH 4PJ7A 5HDLA 1SYVA 2JK5B 5D5MA 4LHUG 2P8PB 1C5BH 2BX5A 4NKOA 4PTTA 1S7XA 4YFDB 5T3XH 3LOWA 2VQTA 3GSNH 5D5ME 4O00A 1NFDF 4QYOB 4PJCF 1OARL 5F89A 4M4RA 2UZIH 4S1SH 5I1AA 3WJLA 2EYTB 4LL9A 3QDHA 4GKSA 3R0MA 5EO1A 4WHYH 4OI8A 4TUKL 2VXTL 5EOCJ 5KANI 4Y5YC 2ZG2A 5BRZD 3UBXB 4P4KA 2GTZB 4JZNB 1FFNA 1G7HA 1S7SB 4AM0B 1JN6A 4E0RB 5B39G 4ELKB 3Q5TA 4Z76A 2EYRB 2YEZB 3CZFB 2BP3A 5DTFA 4XPGH 3QDMD 4LLDA 5C0AB 5MEND 4P2OB 3M8OL 5DD3H 3STLB 2VLRD 1MF2H 4X8JB 1V3JA 3RZCC 5GZOC 1G7QA 2FX9H 5IV2A 2R2BB 4OCSH 4YDKL 2UZYB 4HWBL 4OFPA 2ZCLH 4QTIL 2WANA 1DDHB 3BIAX 1I9IL 1CU4L 2EH7L 4OQTL 1DQLH 5JOPD 1BD2B 5IESH 2BHYA 2LABA 2P7TA 1J8HD 4TNVF 3RUGB 1X4XA 2XY2A 2CIIA 5TQ0L 4HT1H 2R4RH 2IH3B 1VENA 2JJTA 1SVZA 4FOMA 1PZUB 3VD4A 2FWOB 1S9KC 5CP3H 4HWZA 1P53A 3C87A 4LLQA 3JVGC 4DKAA 4HH8A 3OGCB 4LSRL 1U8HA 3VFUB 2E7HA 4KK9D 3ALPA 1EHLH 4E41D 4CBPA 4HGWB 4F7CB 4JFZL 4Y4FB 4RDQF 3GJEB 3SDXA 1R3JA 2HLFD 1N7ML 1PZ5A 3WFDL 3FFDA 2VIRB 5J3HC 1IGJB 3FO2A 3BMVA 4G3YL 3SDXE 2BSTA 3C5ZC 3EOTL 1CFTB 5D1QB 4OJFH 2VXSL 4BSVA 1BVZA 2X4RB 2DQFA 1ONQB 1OD7A 4HKZB 4AEIL 4X80H 4JVPA 3GBML 3IFOB 5EU7E 5F6IB 1YNKH 3VFMA 3VFGH 4OLVL 4Z0BH 3DTXB 3NACL 2PKDA 3CLEL 5KSBF 4WEUD 4FQ1L 1KGCD 3ARWA 3F12A 1EEUA 4KDTC 1FVEB 2HWZH 2PO6B 2ZUQC 1CE1L 3FQNB 2ESVB 3EYVA 2UUDH 5C09D 1XF3B 3BVNB 3ULUH 1L4IA 4PJFF 1MFDL 3ARPA 4K3GA 2PYED 4NJ9H 4JEGB 2ADGB 1JWSB 4QHUB 1CTOA 1S5IH 5IB1B 4HIEA 1CGSH 3EJYC 4LSDA 4Q9QH 1OAUH 1WBZB 2Z8WC 5DVLA 3U7WL 5C6WH 3IETB 4OV5B 3IJYA 1YQVL 4JREB 4Y19A 3KJ4C 5C0DA 2CUIA 3WN5C 5DT1H 3FRUB 4I2XB 5C0CB 5DFTA 5FO9A 4Y19E 5EFIA 1BGXL 4Z7QF 1D6VH 3FB7B 3L3OA 3S3PA 1LO2H 3ZTNL 5IFAL 4F57L 4IRSC 1LEKA 1K4DB 3U7AA 3V4VH 3PNWA 3OKEA 4G9FB 3ROLA 2VLME 3UTPE 2IQ9L 4V1DB 4WCYH 3INUL 1GZPB 2GJZA 1KB5A 4PREB 5F9OL 3VXUA 5I1HL 5JW3H 4KI5E 3DVGA 3DX8B 1A3RH 1UM4H 4WV1C 3O2VL 4X4MA 4H8WL 1K3IA 3CIQA 5IMMB 3OZ9H 3T0EA 1WIUA 1QSZA 4X4ME 5FV2A 5B22A 2YA2A 2Q3ZA 4OLEA 4J1UA 3SDAA 2J6EL 1NGXB 5FDYA 5C0IB 2CDGA 3EJJX 4NN7B 5D9SB 1Y18A 3NIDE 1RVFH 3W81A 2FD6H 3CVHH 5E8NA 5K59E 3IU4L 5A40E 5CS7A 1U92A 1GGBH 1MLCB 4FXLA 3B9KA 35C8L 1P1ZB 4WWKC 4M5YL 1ZHBA 2VQ1B 3NFNA 2BK8A 4HCRA 3ZT5A 1F58L 2ZG3A 1KELL 2Y23A